1DCLA

Mcg, a lambda v type light-chain dimer (bence-jones protein), crystallized from ammonium sulfate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSNVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCG
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 42
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dclA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dclA02
1MFBL 2GFBB 1P84J 1RURL 4I13B 4PG9B 2E6PA 3B2UC 3MCKA 3Q6GL 4HF5L 4R0LB 3JWDH 3OWEA 5IVOA 2FL5B 4HT1L 5DVNA 1NFIB 3SDXB 5C08E 2YMXL 1VFOA 4KJQC 5AZEH 3ARZA 2D7TH 1KN2L 5DD1H 4P57A 4N1CA 3ZKMC 4JDZA 2NY0B 4PREA 4Y1AB 4PRPE 1YEHH 4X7EC 5JQHC 1M71A 5B3NA 3AMLA 4HUMB 4LLVB 4WUUD 1ND0B 4FFZL 4ZFGH 2PF6A 4R3SA 1UKTA 1RZ8A 1CXEA 1OARH 4BK4A 4NBXB 5C0IA 2VO5A 4XP9H 3T65A 3T4YB 1VSCA 5JW4Q 1DQQB 4Y4KB 2QSCH 1TTGA 4XTRC 1B3JA 1QUNA 3OPZH 3SDCB 4UV7L 2ZPKH 4OF7A 4WI8A 3MNVA 2X4OA 3OKNB 4HEME 4ODSH 2XZZA 4Y2DD 1ES0A 1MEXH 3TFKC 3HR5A 1ZWIB 4GRLD 4Z7OE 4TVPE 1WZ1H 4HGWB 2A83B 4N0UA 4D0BB 4R97B 4LASL 4OV5A 2YOCA 4OZIB 4N9GB 1S5IL 2EDHA 4KQ3H 5D2LE 1CZ8L 2BY2A 3VWJB 2A73B 4XBPA 3MRNA 1BBDH 2Y7QB 5F7DA 5IIEB 1UFUA 3NN8B 5GGRB 3QWRA 4KUCF 4K2UH 4TVSa 2HJLA 5JLZA 1QRND 1KCVL 2Q6WA 3E6FA 1G7LB 3KR3L 3QDHA 5BVPL 2DQEH 3BQUD 3ZDZE 2VC2L 2I07B 2BMKB 3MLVL 1VFUA 4XBGB 4KMQA 4IOFD 4Y5YB 3SKOA 4D0DA 4PJHA 5DZNA 2FR4B 4XXDB 5FEBA 1JVKA 2R0ZL 1AFVH 3BPLB 2UZXB 3HG1A 5H94B 4Y89A 3WD5L 5TGBA 5L7XL 5C08B 5F97E 1ZAGA 2QBWA 3R06B 5FUCE 2F9BT 1F6LL 4NUJA 2W9LA 3RNKB 4DFIA 2ARWA 4RZCA 2NCMA 4GRLB 1Z5LB 4JKKA 1GXEA 5EOQH 3QUYC 4FS0A 2DTMH 2PTVA 4PRPB 1LEKB 4N90E 1JPST 5FK9B 4HPOL 4NQED 3RKDC 1EFXD 4P2RA 4PGBB 1ZT7B 1HIMH 1HHGB 1A9BA 3G5VB 3B43A 3ZHDA 3CU7A 3GSOA 3VGAB 4YPGB 5C8JB 1QRNB 3TVMA 4JDVB 4WDIB 4KTDL 5IROC 4B50A 4POYA 1FG2A 2IC2A 4JFZL 5HGGS 1EHXA 3IJYB 2D31B 3N85L 3BVNB 5EU7E 2IBGA 3L3OA 2VKWA 2Q8AL 2C3XA 1H0DB 3QUZA 5AYUH 2FBJH 2X1XR 2XKSA 4LU5L 4JJ5A 5KSAA 4FQIL 3VRIA 9CGTA 2EDXA 3ARQA 1LDPH 5CD5C 1LEGB 4JO3H 2JJTC 4XGZB 2NY5C 4R4NC 4MA8L 2Y6SD 2WLZA 4XNXL 1PG7H 5D2LB 3W39B 1BFVL 3T8XA 5FCUL 4R4FL 3SKJL 4F9LC 1T1YB 1FC2D 1YC8A 3QDJD 1MLCA 2W0PA 4OZGA 1NDMB 4ELKB 1I9IH 1OAQH 5DJ2B 3ALWA 4NC1E 3VE0A 1FFOB 3QDGA 1X5ZA 4K3JL 4H0GA 4DWHA 1KBGL 1PSKL 2GTWB 4PFEA 2B1AL 1UYWH 3K4ZA 4MA7H 1P69B 2DMKA 5GPRA 2VISA 4ETQA 3BJ91 4P0DA 3RVVC 1LQSR 2QADC 3E2HB 4L8DB 5FYJE 1KIQB 5TE6L 2VDPH 1BZQK 3ARBB 3NZ8A 1OCWL 1GJIA 4OZFA 4QYOB 2Z92B 4MZ3A 5FAAA 4ZTPH 2J6EA 4OAWA 2GCYA 1SHMA 1E4JA 3FFDA 2EXWC 4HWBL 1MPAL 1KOAA 3RY4A 1G7QA 1PX3A 5T1MA 1DP0A 3OKLA 5LAXB 3JZ7A 3TNMA 2NW2A 5HYJD 1I1AB 3IDNB 4BQ8A 4YHZL 4KRLB 2R1WA 4PJFB 5JO5A 4PYGA 1W8OA 5C3LD 2IFFL 3CXDH 4CMHC 1I1YB 3CUPB 5LVEA 4LAQL 5E2JA 3INUL 3MUJA 4JO4L 1GCFA 1V7MH 3BGMB 1TZIA 5FKAB 1XH3B 3GBMH 3NCMA 3MQIA 5EPMA 3T0EE 2ZOKB 3BSZH 4O58L 4TSAH 1UWEH 5L8KB 3LN4A 4UU9A 5DD5H 1MQKL 5IM7A 1H5BB 1DVFD 3TJHD 3O3AA 5D71H 4K3GA 4QNPF 3UTOA 2WSKA 4ZUTA 5SWSD 2Y5EA 1BAFL 2BNUA 4F8TA 1FRGH 3K7UA 1QFUH 3BD4A 5GGSB 4M00A 5SWZA 2X2YA 4KPHL 4HX1A 1FDLH 3CFDA 4LSPL 1E4KC 5DUPL 3ULVL 1AO7E 2VQ1A 1TPXC 1XCQA 2NXZC 1HHKB 1NMAL 3DYPA 2ZUQB 3MYJB 3ARGD 1U2CA 3C8DA 3EYUH 3U46A 1F4HA 3VFSB 3PDDA 3MC0A 1I3GH 4EUPH 5I8OH 3K4DA 3WIFA 5I75B 3RPIB 3KYAA 4ZO8A 2EDNA 4E5XB 2Z8SA 5GISL 2Q3AA 5EU4B 4FXLA 1DN0A 4TUKL 3L3KA 2AAVA 2UWEA 4UBDD 1OP9A 3OAZK 3VD9A 3BD5A 1BEYL 5C0RL 4S0TD 5JXEA 3T77B 3GBLA 4G7VH 1FFRA 5E9DA 3RHWF 3SJVA 3ECBB 3WIIL 1JIBA 4V1DE 1EEZA 2D7MA 2X4RB 3V52H 5CJQH 2HRLA 2A2QT 4LHUB 2NXYB 4OT1H 3KJ6L 3C6LD 1FORL 5J9PA 4MNQA 1RK0B 5JORB 1QRKA 4LCYA 1DQJB 1S7UB 3QUXD 3DV6A 4PJ8D 5IQ7H 4G8GD 4F9PC 2AJZB 5FECB 2DIJA 4UQ2A 4NC2B 1JN6B 2Q76A 1KNOA 1TXKA 4NJAH 2GT9A 1FO0H 3GSNH 5JNYA 1DUYB 2IAMD 1M6OA 1A7BA 2YC1A 4M1DL 1QSZA 4Y5VC 5F1KC 4I48A 2JJWA 2QQLL 2FGZA 5D7IA 4KKBD 4FTVE 1YNLH 1CD1A 1YDPB 1H8SA 4IIQA 5CEZD 1G7MB 4JGUA 5D7JD 5HI4D 3L7FA 1JPTH 2ICWA 3VH8B 1S7SA 2OS7A 4GXUN 4EI5D 1FSKB 1JUFA 1OAXH 4I18B 3T0EB 3P40A 2Z4QB 3PIQA 2UY7A 2F19L 5HHPA 1KCRL 4LNRB 4XVUC 2ADIA 4ZDHA 4NKQB 1J86A 4AIZA 1IM9D 2DB8A 1DBBH 2GAZA 3SE9H 3T3MF 2VWEC 3QIWD 3VDAA 1UJTA 3BPCA 2ZG2A 1AO7B 4S1DD 4RFOL 5GRJL 3OF6A 4S11A 3MRPA 5E5MB 4UINL 4XP4L 2ZUXA 4KTYA 4H25B 2AXFA 1F3JB 4YGVB 4XMPH 4LIQL 3QXDA 4HFUL 4NKDB 1IEAB 4PRDA 3MRKB 1FYHB 1MF2L 2AEQL 3ABZA 3BUYB 2E7BA 3DX9A 1F97A 2FH8A 1U8MB 1CDYA 2R0WL 3MBEB 5I8KL 2EKSB 4CRPA 3MPCA 5I15H 1E6OH 3NCBB 2PO6D 4OZFG 4O4YL 4PJ9D 4WGWB 1HXMA 5IB4B 4OFPA 4LCWA 1D9KC 4ALAH 2VYRE 1E4XI 2P8LA 4X98B 3EDKA 2R56L 5MI0C 4CW1B 4KK9D 4U1HA 4DGYL 2GTZB 4YHLL 1RZFH 1H15B 1P6FA 3CK0H 2BSRB 2Y07H 3LQZA 1A02N 3O9WA 1YEJH 5DZOA 4O2FA 2E9JA 1FNGB 1CE1H 1CLYL 4FZ8L 4FQQB 2P44B 1K8IB 1LDSA 1U95A 3U48A 4HG4K 4DW2H 3FB7B 1NCCL 3OXRB 2JELH 3HB3C 2MJWA 1IM9B 4WEUD 4H8WH 3EYQC 1OGTA 1A6VH 3Q1SL 4BQCA 1LP9A 2P43B 4JPKH 1IM3B 1KENL 4L4JA 4UDTB 4FXGA 3UZEA 1N4XL 4EN3A 4F57L 5DFVC 3NPSB 3PE9A 1AD9A 3RY6A 4M48H 4WTWA 4TRPH 1A7PH 4LCUA 4P5KB 2KZ1B 2ZKHH 2DIBA 1MH5A 2EIZA 3CFBB 5EU5B 2XWJB 4IS6B 1YUHB 1OB1B 3I2CH 1G9ML 4K7FB 5E94A 1AHWA 3GI8L 5E6ID 3L3GA 4NT6B 3RUGF 3MR9A 4XAWL 4PV8B 4XNYL 1EPFA 4X7DC 4EOWL 4F7EA 5GRWA 3V0WL 1HHIA 3C8KA 3ZT5A 4YZFE 3D0LA 1D3CA 4ZS6C 3KPTA 3VG9C 5CCKL 3L3IA 1T7ZA 4YXHL 2YUZA 2W60A 5MHSE 3MLRH 5FGBA 2V5MA 1GIGH 2HWZH 4H20L 5F3HB 1KSRA 4Z7NE 4HHAA 5EFIA 3DGGA 5CJ5A 2DQDH 1Z3GH 1OM3H 1QA9A 2M2DA 4P4KB 2CUIA 5IMKB 1VDGA 1CD9B 2AK1L 1OWRM 1FFPA 4OCNC 4HZLB 4GMTH 5D6CB 5MEPB 3B5GA 2X89A 1K5NA 2AQ2A 3UZVB 3LKNA 3UYRH 1BWMA 3V6OC 4FQXB 4I3RH 3LH2H 1CXLA 1F00I 1WWBX 5J1TC 3PGDA 4ENED 1LK3L 2R29H 1G7HB 4XC3L 4RMSA 1KJ2H 3PP3H 4IDJH 3QUKB 2ENYA 3QQ4B 1C16A 2DKSA 1GHFH 2OXGA 3HMXH 4ZXBC 3ME0A 3O2WL 5CSBA 7FABL 4POUB 2XICA 4KJWC 4U1GC 3BDBA 2FATH 4LVNC 5CWSA 2VH5L 2C26A 4S2SB 3EOBB 3X3GL 3BEVA 1I9RH 3RIFK 3TYFA 3FRUB 3LRGA 4OZHF 3UTPD 1XF5B 2VIRB 4OZ4A 4HWEL 4Q9RH 4QF1A 5C6PB 4YNYB 1GH7A 4QXTB 1PX4A 2R1YA 4S0SD 4KTEL 4ZOAA 3RWFB 4JZNA 5IQ9A 1L4IA 1TDQA 3F6IA 4JB9L 3UX9B 4GAYB 1FGNL 3TV3L 1VACA 1IGCL 1MFEL 3D3VA 1CXHA 4ONGL 4YIQA 5J1SC 4HG4J 1ZHBB 5BOZG 1VKXB 2EDKA 1T0MB 2VLKE 4UQ3B 2BCKA 5T3XL 3S88H 2HN7B 5INCA 4QXGL 3GHEH 4WGVB 1OT2A 5ISZE 3JWOC 5F9OH 2AXHA 4JR9L 3SGDH 4X5WA 3KS0H 4G7YH 5HYSB 1KG0A 3FJTA 2VLJA 4PG2C 1A1OA 2JJVA 2DQGL 2XWTB 3BX7C 3IJSA 1IGIH 5EOCL 1F3RB 3P0GB 3S5LB 4RNRB 3V7MA 5JHLL 3CIQA 2BC4A 3DIFA 2GIYA 3PWLB 4IRJB 4PJCE 5E2UH 4FA8A 5DFTA 4JAMA 1R3KA 1NSNL 1SVZA 4P5TB 1N64L 4X83A 2D9QB 2DQHL 2NTFB 3VXME 4RX4A 1ZLSH 1OW0A 3GIVB 2ZJSL 5GGTL 1AGFB 4WV1B 2WINB 2F5BH 5DUBA 3ULUD 4Y2DC 4MVBD 3WUZA 1PZUB 3F7RA 5D72L 4AL8L 3GSWB 4EXKA 5C07E 3B9DA 4Z7UA 4I3SH 4P57B 1K8DA 4J7RA 3QWRD 4JDZB 4NPYA 1DLHA 1WAAA 2JLLA 4NZTH 1NCBH 2C7UA 5DJAA 5HDOA 1A5FH 4FQCL 5IGXH 1YY8A 2VOTA 3QCTL 4IBLT 3K4AA 5DSCA 2UUDK 4YK4B 2CUHA 1OTUC 4LP4A 4XZUB 5TH2B 4FFYH 1RJZB 3VFPB 3V5DB 5IEHB 5J6HA 5ITBL 3W0WB 1SY6H 1CQYA 3N9GL 3BQUC 4WY7L 1A4KA 4M3KB 4U6XA 3DRQA 4WWKA 5KZCB 1T1XA 3HG1D 2KZWA 3UMTA 4DAGL 1O7SA 4R6UA 2APXA 5I1LA 1CXFA 4IOFC 2NY2D 1ED3A 3VGEA 4M7LT 2Z31A 5CGYD 5D1QA 1CLZH 3DO3A 1MREL 2B39A 1WK0A 2XA8H 4NM4L 5TPWL 2AERT 3DSFH 1OLLA 1SVCP 1YEDA 3MFFB 4Y16A 3UYPA 4P2RD 4RWYL 3L3JB 5I6XB 4PTTA 2YBRB 2JJSA 2HFFB 4UT9H 3RJDA 4Y4HA 5ISZB 1HSBA 2APVA 1ULVA 3TVMD 4RMWA 2Q6WB 3IU4H 3ROLB 4AT6B 1AGDA 4JREB 5INDB 1FL3A 1BM3L 1Q0XH 3KYNA 2PYFB 4Y4FB 3KYOA 1JZ5A 3EJZC 5KS9F 3QUZD 2JF1A 3UEZA 3PWVB 1C7TA 3Q5OA 4PJCB 2XZQH 3BP4B 1MHHA 4F7MA 5KSAD 1OHQA 5CHNA 4LLAA 3WUWA 4OLUH 4NNYB 5F93C 3LKRB 3VXMB 4ZAKB 4K71B 4UAOC 5FYLE 5I66A 5EUKA 3S98A 3WKMH 1FO0A 3GSNA 3G6AB 3MXVL 2GSIB 1NGXB 3A6OA 3SBWC 2HKFL 3G6JE 5GGUA 3TP4A 1FGVL 5C07B 4YHYC 3DX8B 5E24E 1IEHA 2YUVA 3TO4A 3QDGD 5AYQA 1UT9A 2C4FU 3HZYB 1JK8A 1CFQB 5E0QA 3SDAB 2P49B 2ZNXA 1GL4B 4QHLA 4NO3A 3MACL 3DUUA 4ZPTA 1PG7X 1AH1A 5K9OA 2CSPA 1NFDF 1AXSA 5CAYB 4C4KT 5D8JH 3D25A 5DRNA 2VLRA 2BDNL 4PS4H 4UT6L 1ZS8B 5GZNC 2BNQA 4U05A 4X9FA 3QWOA 3RWGA 4ZFFB 2MQCA 5EN2B 4A6YH 3O2DL 1GC1C 5F7YC 4DTGL 3MA9L 4K7PX 2JCCE 1W72B 2ZUTA 3N1PC 1OPGL 1T04B 2HP4A 1QO3B 1T2JA 2I60H 3IDMA 2OQJB 3W5NA 2E7CA 2NY1D 1MCDA 2FO4A 1M7DA 3GSQA 1I3RB 4PV9A 4GXVH 1BLNB 5C0CE 4Z7VA 2B8OT 3VXUE 4FXKB 5KSVA 1G7IA 2YPVH 4JO1L 3WSQH 4KFZC 2FZ3A 1DCLA 2C4FT 2BNRE 5JR1H 2F15A 2CUMA 3N0PB 4C4KO 4ELME 3QPXL 4B53A 3SE3A 3QZWB 1GGIH 4P48A 5SWZD 2DM3A 3CFKA 3BAEH 3AXLA 3HI5L 1DVFC 3NZ8B 3R0NA 3DGCR 3EGSB 1VCAA 5IVXF 2ADJB 1EXUA 2XT1B 1IGYA 3UJTL 1YA5A 1JGEB 2JTDA 3KPOB 1RUQL 4YWGL 1MJUH 1UQSA 3BZDA 3FFDB 4KQ4L 4UOJA 2LV4A 2OYPA 1UM4L 3V4UH 4AEIL 3ESUF 2DQUH 4JQXC 2APTA 1VENA 3QHZL 1A7RL 2AJ3B 4X7SH 4TULL 3P11L 1IAKB 3IU3A 43CAA 3G6JB 2K7QA 1Z2KA 5DD6B 4M4RA 4UTAH 4LF3A 3ARGC 3IT8D 3JTSA 4FTVA 4XPAH 4QY8B 1JMXA 3MMEA 5JXED 1M7IA 1MCFA 2EDEA 5E9DD 3SJVD 5HHXH 5KVDH 4QRRA 1B4JL 3QNXA 2DYPB 2OL3L 4XI5D 5CINH 4L8SC 2QJDA 1GZPA 1GGCH 4JRXE 5ERWA 3IS1X 3CFEB 3FHAA 4WEMB 2DJSA 3MRHB 4UBDC 5TDPB 3IDXH 2QQKL 4HQQL 1P4LB 4KI5D 4CN1A 4MNQD 4UIMB 4M61A 3QRGL 3QQ3B 1KB5H 3GHBH 3WJJA 1T22B 4W4OA 2XN9A 1MHEA 1UADC 4G8FB 4MZ2A 3CMGA 4UV4H 3KWWA 3D69A 2APBA 3ESVF 2GJ6E 4Q6IB 4IRSB 1QQDA 3C6LC 1IQWH 4HBCH 4X9GA 4CVWA 3C5SA 3VFTA 1KCSH 3W11C 2HJKA 2JCCB 1BX2A 2EYTA 3QUXC 2P47B 4PJ8C 1T7VA 4FRWA 3KLAA 4GSDH 1KEGH 3R4DA 2FJGA 5SWQB 1MFBH 1RURH 3TT1L 5ICZB 2V2XB 3EFDL 2IAMC 1IRAY 4GLRH 3EYOA 4TUJA 3Q6GH 4HF5H 5JDJA 4UUJA 2OP4L 4HT1H 5C0CB 3T09A 2YKLL 3VXUB 2YMXH 2E3VA 4MXWH 4NBZB 4KKBC 1R5WA 4FQHA 4N68A 3L3KB 5IBUG 4Z18A 1S7RA 1WVZA 5I73B 4E42A 5D7JC 4F3FB 1B0RA 5HI4C 4EVNA 2BNRB 2Z91A 5DJYA 5IJKA 4ELMB 3WUWG 4JKMA 4EI5C 1VADB 4QRTB 4JFOB 3T0VA 1IGJA 1CE6A 1KXTB 3STZB 1BF2A 1AGEB 1G7PA 4FFZH 3T1FB 5E7FA 3EZ8A 3S34L 4GBXA 1KJ2A 4NRZB 1RZGB 3OF6D 3LS5L 1PG7W 5DRXA 5LBSL 3HMXA 5EZIH 1FL6B 4LDOB 4L4TA 3X3FL 3RWEA 1T0NA 3SOBL 5JNYB 3F65A 4Y5XA 5AD0B 2FIKA 3QIWC 5BZDA 4OCXL 3KDMB 3P73B 1G6RL 4S1DC 4Z0XB 2G9HB 1ACZA 3FQWB 4XCYB 5I8EB 3I75A 2YPLA 3BIAX 2EXYD 4ZYKA 4NZRL 4PJIA 1FIGL 4LCWD 4NHCL 1MCWM 4LASH 1DBJL 5AUMB 3L1OH 4Z95H 1S5IH 1ZT1B 2FB4H 1S7QB 1CZ8H 3BZFB 1MWAB 2VDQL 3J8F7 1BQUA 4QHKJ 1F58L 1R3LA 2J8OA 2AQ1A 1TVDA 5E1AB 1OP5H 1MUJA 2EDOA 2PO6C 4PJ9C 3O9WD 3LKSB 1F8TL 1KCVH 4U0RB 4PJAA 3KR3H 4KK9C 2YD8A 3O6KL 4AIZB 1TQBB 2GJ6B 5BVPH 2VC2H 1OSPL 2WIIA 2OJEA 1ZGLB 3MLVH 4W81A 1KELL 3E3QE 1EMTL 2EO9A 4NWTL 5B38B 1N5AA 4QHKI 3BP7B 5FYJU 1T1WA 3FO2A 4CJ0A 4EJ1C 5JPNB 4EN3D 1HDMA 2D7PA 5HJ3B 1CFSA 3MJ7B 2DBLL 1NCAH 4B41A 2EICA 2VXSH 1J87A 5DI8A 4CVZB 2R0ZH 4NCC2 3DRTB 3ZSTA 3MRIA 3WD5H 4NQDA 3ARXA 5F6HJ 5F8RC 5HSFA 5L7XH 4O5LH 1U8OB 3WHE0 3WLBA 5BO1H 4OSUH 3BZEB 3BKCL 2OCFD 2CDFB 1NH6A 3O2VL 1EVUA 1CIDA 3THML 1TZGL 1T1ZA 5H37G 5BS0E 3V9FA 4RDQF 2HKHL 2BSSA 4KV5F 2V7HB 1JFQL 2VQTA 3FO9A 5FV1L 1JBJA 1J8HE 4ODHL 5E6IC 1K4CA 3QEQA 4PTUB 3F7QA 1WISA 3O9WB 2CDGA 2ZSVA 1LE5B 2YS4A 2ORBL 3G5YB 4KTDH 3P0VL 5DMKA 1XGTA 4JFZH 3CZJA 1YYLH 3H9SA 3OHXB 4NKIH 3N85H 4J1UB 3VWKB 5GS2H 1B88A 5GS1A 2Q8AH 4PJXF 1ZLWK 3VXNB 1Q9KA 5JA8B 1PBYA 2X89D 1P53A 5F9WC 4HUKB 4M6NL 5F21B 4KK6D 4LU5H 3RIAK 1OTSC 1UVQA 2IMMA 4FQIH 4HBQA 3SY0A 3O3UN 1XR8A 5KOMC 4PJDF 4XHQA 4B7LA 5DQJA 4MA8H 2R2BB 2BY1A 4XNXH 3NFNA 1BFVH 1ONQA 5DJ0A 5FCUH 4R4FH 3SKJH 3FT3A 3LVEA 3OJDB 5TJWK 1Z9LA 2YA1A 1NGQL 3DV4B 3BH9A 2XKNB 3QO0A 1A6WL 4UI2A 2FJHA 4G5ZL 1D5MB 4DQOL 4ENEC 4K3JH 1PVHA 2LU7A 4F7EB 1KBGH 1PSKH 3VCLB 2B1AH 5HBBA 3V5HA 4U1SB 3D0LB 3STLA 3T4AA 4AENB 3N50A 1NJ9B 4OCYH 3B9KB 2VABA 4BH7A 1D5BB 4OTXL 3WN5C 3TN0A 4NN7C 2VDML 5HDQL 3K2MC 5LGHL 3AS0A 5BXFA 4OF5A 2H32H 3MJ6A 1NMBL 4U1JB 5E1HB 1R0AL 1BBJA 4HWBH 1MPAH 4ODTL 3TO2A 3BO8A 3D3VD 2VSDA 2YZ1A 2AVGA 4KK8D 5IWLA 1JHKL 1UEMA 1JZ8A 5JXAL 2R8SL 3SKMB 4PBXA 4JFYA 3DHJA 5HPMB 3CFJA 3KPRE 3RWHB 4YHZH 3WHXB 2IFFH 4XB8A 2X5PA 3LEYL 5EBMA 4LAQH 3RIFF 3INUH 4JO4H 5IFHL 5A43C 4QGTA 3HI1B 1U93B 3U1SL 1JWMA 3H2WA 4LBEA 4MXQD 1CICC 2VLJD 5BS0B 4K23L 1D5ZB 5AG8A 4U1NB 3QFDB 4TNVF 4O58H 5I71B 3NGBB 4L3AA 5BV7C 2VXTL 2J5LB 5DEFB 4XAKD 1MQKH 4OJFL 4XRCA 4LVHC 3TBYB 4PJ7E 2IGFL 1A3QA 4QLRA 3BWAA 3QULA 2CIIA 4D2NA 3MFGB 1BAFH 3LS4L 4P2CG 1WSST 3EYSL 4RX4D 4KPHH 3NA9L 5IR1B 5JQ6L 4LSPH 3MCLL 5D1ZA 5DUPH 1RULL 4A6YA 3ULVH 5F88A 4Z7WF 5I74C 5EUOF 3TBSB 4P2OB 2QV2A 1RMFL 4OQTA 1NMAH 3DMMA 4Z5RA 1AD0A 4CADB 4YIQB 3WNOA 3UC0L 5I17B 2IMNA 2HRPL 4YDLC 4OGZA 2R2EA 5DR5L 4X5XB 4U1LA 1DEEB 4MVBC 4NKMA 1L7IL 1Q94A 4TUKH 4LLQA 3TBVA 3GSXA 3LIZH 4JFXA 4NSKB 3I3EA 1BEYH 5C0RH 5GRVK 5DEGB 4U7KA 4RBPH 1AI1L 4P9HC 1KG0B 5EZOL 1TJHL 3NCCB 4LCCA 3K1KC 1UCBL 4WWKD 3S3PA 1KUMA 1AQDA 2P45B 3KJ6H 3HPLB 3ZL4L 1FORH 2Z93A 2BC4B 5HY9A 5DJCB 2Z31D 2CKBB 1HI6A 1YEEL 5ID0A 5D1QD 1R3KB 2D2OA 1CLOL 1PAMA 2HFEA 4L8CA 1U36A 4HKBA 1V3MA 4PJGE 5HHOA 4H88L 1BREA 1RJLB 3WIHL 2GW5A 3DJ9A 4ONOA 3TESA 3BKYH 4M1DH 1BD2E 2NY2C 1ZT4A 5DUBB 4Y16D 1NKRA 2QHRL 5CGYC 3MLSL 2QQLH 4K55A 3LKPB 1QKZH 3MUGB 1PJ9A 2ICWI 5CUSL 2GK0B 2XRAL 4Y4HD 3GSVA 3U7YL 5I18L 3DXAA 2VE6A 2V2WA 3RRQA 1CFTB 3MV01 4JPVL 4JY4A 1YPZE 5E8EA 1A1NA 2B2XL 4Z77A 1YY8B 3D39E 4AIXA 1EFQA 4M8QB 1C08B 4JZJB 5IVNA 3IXAB 4CGTA 3BW9B 4PJ7B 2F19H 5FOBA 4Z0BL 1MCNA 3PABB 3WFHA 3TVMC 4X5LA 1KCRH 1X44A 1U3HB 3E8UL 4UILL 4KKLD 1KB5A 2IANA 3GMOA 1INQB 4QXWA 4P2QE 4HMCA 4QRPE 3KPQA 1JNHA 3QUZC 1DE4B 4PR5B 4JY6B 5E5UB 5E8OB 1WCBB 4JCLA 1JPFA 5KSAC 2DBJA 2HH0L 4RFOH 5GRJH 3P4MA 4N8VB 2ITDB 3BE1L 3S8WA 2AABL 4K07A 3QXAB 4XP4H 4EDWL 3ARWA 4BFIB 3KXFE 3TO4D 4XPGL 4IMLB 2AJSL 1CQKA 5KN5A 3OJMB 3FCTB 2B0SH 4YBQD 2W65A 3DETD 4EUPB 4HFUH 2AEQH 1MF2H 2Y4SA 2A0LD 1F42A 2R0WH 5I8KH 1ZHKA 3QCVH 4O4YH 4MJ4A 3LY6A 4Y4HB 4M62H 1OAKH 2KKQA 4U2YA 2VLRD 1MY5A 3QDME 2X4UB 2BNQD 3RDTB 3ARUA 2R56H 1JNNL 3AREA 4LSVL 3CSYA 3OR6A 4DGYH 2VZ1A 1UM5L 2R2CA 4KK5D 3OBAA 4YHLH 5JOPE 5ACLA 3VXTA 4KJPD 4LDLB 3D85B 1XR9B 1CT8B 3OGCA 5EORL 1TVHB 3S3JA 5FO7B 1SMAA 3PDOB 2FX8L 5HYEA 5L2KA 1PDKA 1CLYH 4FZ8H 2ADGA 4PJGB 1RZKC 3ZZ1A 4LSSL 2O5ZL 1S7WA 1NCCH 1TIUA 2DIAA 1H3UA 1MJJB 5HGBA 3BP6B 1FQ9C 3PWJA 3V5KA 1LMKA 4R2GB 3Q1SH 1RAMA 2Y06L 4Y19A 1KENH 4DCQA 2A6DA 4TTDC 5ICYA 1N4XH 3JUYA 2OMNA 2F53E 5GGUB 4F57H 1CGWA 1OAUL 2Q1EA 5C0BB 3IDGB 1U8LB 5E4IA 2FECI 2NY1C 4YHML 1FZOA 3IJHB 3VW3L 5L8JB 3S6CA 3WEXA 2JB5L 5LQBL 1I8MB 3QNZB 1NPUA 5I1GH 2V9QA 3IDJB 3D39B 4JRXA 1G9MH 2L7JA 3DOSA 3Q6FB 3GI8H 3FFCE 2DWDA 4NO3B 2UZIL 2QR0A 3EO1A 2GITB 4RIRA 4XAWH 1BVLB 1UENA 3RZWA 4XNYH 1FZMA 4UNVA 4NRYB 4EOWH 3V0WH 3UTSA 4P2QB 3DUHA 1K85A 3QA3B 4I1NB 4QRPB 3FL7A 3WXWL 3W2DL 1U8QB 2P8PA 4YXHH 1SMOA 1J0ZA 4MX7B 1N5YL 2FH6A 4H20H 4CVXB 1RJYA 4FTVD 1ZEAL 2ZOLB 3LHPL 3NCFB 4QRQB 1IBGL 3KXFB 5TQ2H 4QRRD 4U6YB 3P9MB 2AK1H 3JXAA 1HWHB 1I4FB 3UTTE 4JRYE 5FB8B 1HQRB 43C9B 5GJTL 2YRLA 5F96H 1HXYA 5DJDA 5IBTL 5KSVB 4WU7B 1W0WB 3HE7B 5C2BL 4F2MA 4JHWL 3S96B 2VZUA 5JXEC 5DK2B 1IEBB 5KG9B 3I6KA 3IRZA 1BMGA 4KXZI 1U58A 3QDMB 4IHOB 4XI5C 4JM4L 4HIXL 2XN9D 1R3HA 1LK3H 1U0QA 1X6LA 4ORGB 3RGVB 3LEXB 3ARFA 3U4EA 2QKIA 2D9CA 4XC3H 1MJ8L 3QJFA 4MDJB 4F15C 3A67L 5DTFA 3FQRB 1SJVA 4KI5C 3HTLX 1UA6H 5FA4B 1F6AB 3I02B 5GZOD 5C0GA 4L29B 4GFTB 1PY9A 7FABH 4Q0XL 1KLGA 2OSLA 2WAHA 1IL1A 4XPBL 5ENWA 4BSVB 5M95B 1UQSB 2VH5H 3U79A 1MCKA 5C0JB 4ODBD 4IM8A 5MEOB 4L9DA 3FB5B 4D8PA 3QB7C 4LHQB 3BYYA 2IADA 4HWEH 3OG6B 2F53B 4JG0L 4KTEH 1FNSL 1I7RA 3JTSB 4IIQC 5ESQB 1A6ZB 4JB9H 5D9SA 2PXYD 1FGNH 3CH8A 3TV3H 4LLYB 1IGCH 1MFEH 1M7IB 4ONGH 4PBWD 1WCQA 2I25N 5K93A 1A14L 5CJOL 3AMKA 3QPQD 2WWKO 4J3XA 5T3XH 3FFCB 4QXGH 3SPVB 1HKFA 1FVDA 4GBXD 1HSAA 1KIPB 1VGEL 5EWIL 3H3PL 4FP8H 2VN7A 4JR9H 3K8MA 1T7WA 3OKKA 4A2LA 3JVGA 2XN9B 3LPFA 1JTTA 4TUOB 3RGHA 1IILE 1NL0L 1SYSB 4MJ5A 4L4TD 2DQGH 4F80A 4WJ5A 5EOCH 2X70A 3FZUD 1LK2B 3C5SB 3BH8B 2BOCB 5F1OB 2FIRT 4OGXL 5J6GA 5EO0B 2YPLD 4ODXB 2ZUVA 4X6FA 4ONHB 1N64H 2VDLL 1WFTA 3P4OB 4DN3L 2YD2A 2DQHH 2H32A 1KEML 4HWBA 4TUJB 2ZJSH 5GGTH 3SHSA 4JRYB 4LFHG 4M93B 5CZXD 3ZKXB 3MXWH 4XWGH 3KPLB 3VFUA 2UYLB 3HNSL 3KJ4B 2DD8H 5D72H 2D7OA 4AL8H 2EXYC 1WTGT 2CRYA 4K94L 1F13A 3L3HB 3I9GL 2PXYB 1JZ6A 4U33A 5DWUL 4C58B 3MROA 2J8UA 4FQCH 2JIXA 4XCNA 5FO9A 3QCTH 3VRJA 4PRHE 5IB1B 5DK0A 3BGAA 3BGFB 4NN5C 1AIFA 4RFNC 1TCRA 1IE5A 3U0PB 1EVTC 4I9WD 4IDLA 4G9FB 5ITBH 3OKMB 4GUPA 4ZO6A 1KLUA 4UDUB 4WFGD 3N9GH 4WY7H 1IGFL 3A6CL 5E5RB 1DLFL 2NY4B 3ZYJA 3S36L 3PHQA 3KLHD 4DAGH 4NQDD 4MCZB 1L6ZA 3S4SA 3DUSA 2DMBA 3MNWA 4EN3C 3ZE0E 1MHCA 3HFML 4MS8C 4JN2A 4AJ0A 4PJEF 5C0AE 3QT2A 4ZYKB 4AEFA 4NP4L 4JZOB 1MREH 1DBKL 1NBZA 4YHPA 3GIZL 1PKQE 5I19H 4EXPX 2ZWLT 3WDJA 5DMJB 4NM4H 5TPWH 1QVOA 1CXIA 1FZJA 4G9DB 4GQPH 1AHWC 4RWYH 4XMLL 1HOCB 3B3IA 4NUGL 3IKKA 4M7LL 4KKNA 3QEQD 5IV2A 2O5YL 1Q9WA 3KVQA 1F4AA 3BKJL 2XTJE 3RL1A 1QSEA 1XGUA 2VXQL 4YHIA 1I3VA 3RNQA 3RAJH 3DO7A 2PW1B 3H9SD 4GXUM 1BM3H 2OX5A 2P8MB 3C2SA 1RIUL 4EBQL 1WICA 3RWJB 3NFPB 5FGBC 4JGMA 4Y5YC 4X6DF 2UWEF 3IKCB 3WS6A 1CFSB 1U92B 1PW3A 5EBWB 4U0QB 1CLCA 4YDKL 5FYKE 5IW3A 1NLBL 1RHHB 4ORZC 4PGDB 1IGTA 2IPUG 1M4KA 1RU9L 4GT7A 4GAGL 3WLBB 3KPRA 4KK6C 2EIEA 4QRSA 4W70A 5CSZA 4KI5F 3JWOH 3QISA 5JIKA 2Z8RA 3M17B 4NHUA 1R24A 4MQ7B 3VXOA 3QEHB 2AI0L 1P4IL 2EDRA 3RVXD 3RIAF 2GHWB 3C60A 4FMKA 3A0OA 1IC5H 4PRHB 2DLIA 2NY3D 3UXFA 4X6BB 3MACH 3ARDB 3BHBA 1ZHLB 1I7ZA 1X9QA 1FCGA 3TN0D 3SQBA 5KVFL 3DURA 2BDNH 4KRPB 2XWBB 4UT6H 5DMKB 3S35L 1XGTB 2ILLA 3EYVB 3PP3K 4XNUL 3NIFF 3DX6B 5JHDE 3MV9E 3O2DH 2ATKB 5ESAB 1HKLL 4FNLL 1Q9KB 4DTGH 3MA9H 5MENB 1OPGH 3MRBB 4LRIA 5C1MB 1A64A 1RIVL 5C0AB 4YHKL 1FNEA 4LVOC 3O4OC 1PKQB 3ELAT 5EIQA 1REIA 4TSBL 3TWCL 4GKNB 4KK8C 1AY1L 1SM3L 5ACZA 8FABB 5J57B 3HZVB 3CDCA 2CXGA 3MRGB 5IVZA 3L5IA 5DJ0B 2D7QA 5KSBE 1VFMA 3A6BL 4Q9CA 2CLZA 4F7TA 2P7TB 4JO1H 1V3JA 2HTLC 4GQ9L 4MCYA 5F1NA 2ENSA 4AH2B 2XTJB 1EO7A 3AS1A 3QPXH 4M7ZC 5DJ6B 3LN9A 2C4XA 4NO0D 3GSRA 3HI5H 1JWSA 1BJ1H 3FQTA 5D1ZD 3RUGA 1MY7A 1NEZA 2VZTA 2SEBA 4HGMA 3TN0B 3UJTH 4ZS7L 1RUQH 5F72S 5BXFB 4YWGH 2XZCL 3DMMD 4KQ4H 12E8H 1UM4H 5I1DA 4AEIH 2VDRL 1V5JA 3PWNB 1OW0C 4YBLC 1QLEL 2EYRB 1E4WL 4P99A 2W07A 2PYEE 4I0PA 4XPFL 3QHZH 1A7RH 3F7YB 4PLKD 4TULH 1BD2A 3P11H 3CFJB 3TNNB 5FUCC 4LEOA 4QKXB 3W82A 5EBLA 4HWZB 1F2XK 1QLFA 4N8PA 4ZO7A 4ZPVB 3K2UL 4P23C 3ZTNL 2DRUA 1A0QL 3MLTB 1BQHB 1B4JH 2NZIA 2OL3H 1YPZA 3PQYE 4FQLH 2EYSB 1X5KA 4C55A 3STBA 4BZ2L 3GGWB 1IVLA 1LO2H 2QQKH 4HQQH 1HILA 4NZUL 3S4SG 1QR4A 1T83A 4H1LH 3BWAB 4CU8A 3QRGH 1JCKA 1IAOA 3R0MA 4F37F 4KVNL 1VGKB 5HHOD 5EU7C 2A38A 4WWKC 5CD3B 3F5WA 4NO0B 1Q9OA 5JTWA 4U6HA 1CXKA 3UZQA 4CU6A 4Y5VA 1Y0LA 3NCEB 1ZA3A 2Z31C 2BVUA 4I4WA 1U8NA 4XPTH 5F88B 5D1QC 4HKZA 4TSCL 2ZCHL 5J06A 1ODAA 2HLFD 3HPJB 3TT1H 4LMQE 1NUNB 4BQ6A 4OGAD 3DBXA 3DXAD 1KTLB 3EFDH 1J1PH 1UH4A 1A7OH 5IMOA 5JW5A 4Y16C 2OP4H 4W6XB 1G0DA 1KV3A 1MCJA 5KSBB 2RQ8A 1E6JL 1FNLA 1TZHA 4E0RB 3QH3B 2GI7A 1MNUH 5D96C 3VGGA 3GSXB 2JJSC 2AK4E 3MREA 4WW1B 2QHLA 3EO0A 2YN5A 3FRPA 1HNFA 4NC1C 4RAHA 5ITFA 1C8PA 5EU6E 3HCVA 3HUJA 4GJTB 5F44A 2IAND 4MYWB 1SEBA 3UJIL 4UOW1 2NYYC 3RWDA 3G04B 5CIPA 1G7JA 4NRXB 3S34H 5JOFA 3GJFH 1ERNA 2XV6B 3C87A 4TVPL 1MLBB 5I9QB 4ISVA 1KTDA 3FN3A 3LS5H 5DJXA 5LBSH 4QTHB 5TQ0H 5C0EB 1TETL 3BPOB 5F89B 2HAZA 1ZVSB 1U2HA 1CG9A 3X3FH 1F5WA 1XAUA 4PD4J 5C3TA 3SOBH 4M7JL 4NKOB 2AGJL 2PYEB 4TN9A 4GS7C 1D5XB 4OCXH 32C2A 4XH2B 4MA1C 1ZKAA 5F7HA 2IH1B 1I8LA 3R8QA 4G8EA 4N5UA 4U1IA 3GSUA 1LO3L 1FYTE 1NC4B 1CF8H 1FIGH 2G2RA 2CLVA 4NO5A 4GRMB 1FN4B 5F6IB 4WHDA 5C6TL 2H26B 4I5BB 5E8EB 3DETC 3RPKA 3PQYB 3ARED 1AXIB 2VDQH 2A0LC 4LFHD 2DM7A 1F58H 4RISL 1U8HA 3KGRA 3GM8A 2M1KA 4AZ8A 4D0CB 3RP1A 1LO0L 4KUCD 2D7NA 2E9WA 3SGDI 1F8TH 3PWUA 5L2KD 5LKNA 3PV6B 1BFSA 4LKXA 3O3BB 4Z7OF 2WM0A 4HUWB 1J05A 4KK5C 1BIIA 3O6KH 3V4VL 1OSPH 1SJHB 3VXSE 5GQBA 1KELH 1EMTH 1I7UB 4NWTH 3I85A 4Y19D 3TEUA 4QHMA 3ARSA 3HS0A 1QHPA 1NFKA 1OGAE 5B8CB 2BVPA 2D0HA 5FHBH 5CP3H 1FCCA 3QHFL 2Y25A 4W6YB 2DWEA 2M26A 3CSGA 4UT7L 4MNHA 3T2NH 2CQVA 3CAFA 3L6FA 3GUTA 4JPIA 5TDOA 3B9VA 3WFCL 5GGTA 3BKCH 4RMTA 2FSEB 4D9QE 5D1XA 4P46B 1NEZG 1J7VR 3WFEL 2AK4B 2B4CC 2VXVL 1QFPA 1BOGB 1NCUA 4NGHL 5MEQA 2RHEA 3DX7B 3O2VH 3SE3C 3VXRE 3G9VA 3MCG1 3RX8A 5DMGD 5DJZB 1TZGH 3BMWA 4JY5L 3UTSD 5IJVB 1UXWB 2HKHH 3W9EA 2BHUA 3RL2B 4F33B 4GKOA 1JFQH 1R5IA 1RUKL 1Y6MR 5FXCH 1XEDA 4ODHH 4FG6D 1FZKA 5KJRL 3MRLA 3MRMA 4HAFA 2ORBH 1F4WL 2VDOL 4Z7UF 4L1DA 3P0VH 3C5JB 2IPTL 3PL6B 4X4XA 2VN4A 2R2HB 2C1PB 2DLHA 2OTWB 3V5KB 5IMLB 5T1KA 4O2EA 1WLHA 5I76B 4NQTA 5F7KC 4M6NH 4YAQB 1P4BL 1KT2A 2LTQC 1QACA 5D5MA 1KPRA 1NBYA 4LGPB 4QHNB 1FYTB 3V6OA 1PZ5B 3U30B 5C9KA 2GJZB 4JDTL 1JGDB 1EBPA 2HMID 5DA0B 3NPZB 5GS0L 5FYJL 1S8DA 1EK3A 3MLUL 3OL2A 3ARFD 4NZJA 1NCTA 4PRBA 5T5NF 4QWWD 3G5XA 1NGQH 2JB6B 1FBIL 5LCVL 1A6WH 4ZFZA 3WJJC 4W4OC 4G5ZH 2MMXA 1DUZB 3FQXA 1BVKB 3AS3A 3ZDXE 3SO5A 2P5WA 3P3YA 4HXAL 3B2UD 3VXSB 5HGAA 1EDQA 2K1MA 5GS2D 3OZ9L 1XF2A 2IPKA 2PNDA 3FMGL 4P9MH 2VL4A 4OTXH 4KJQD 3SO3C 5LGKA 3D5OF 2VDMH 4PGZA 1OGAB 5HDQH 1XF3A 4DZ8A 1UEYA 5T1DL 5LGHH 3WNKA 2VZSA 3FRPG 2CGRL 1NMBH 3HNTL 3PDGA 4GW5B 1R0AH 4ODTH 1S7VB 1QR1A 4RCAA 4LLUB 4AQ1B 2A9NL 3FOLB 5DS8A 1JHKH 1MAML 2ITCA 2R8SH 4RAVA 5DYOB 2AJVL 1F2QA 2AEPL 4N0FB 1CWVA 3LEYH 3RWCA 4C83A 4JM2A 4PJ5E 4P59L 5IFHH 1J0KA 5IJKC 1NBQA 1S9WA 5IK3A 4L3EE 3U1SH 3B8SA 1I8IA 3SDDB 3VXQB 4JHZA 1XGRB 3QPQC 3DVGB 5LGJA 4K23H 4XTRD 3X17A 3ET9F 1YN6B 2C3HA 2VXTH 4XBEL 5L0QB 3F12B 5HVHB 4GBXC 4OJFH 3HZKB 1Q9LA 2IGFH 1MI5E 1JGVH 1Z9MA 1S7XA 1IL1B 3BPNC 1EH9A 4HLJA 4GAJL 1OT1A 4PJBA 3LS4H 4Y5XC 2H8PA 4Y7MA 4UMGA 3NA9H 2FYYA 4MNGE 5JQ6H 5DHVH 3MCLH 1RSFA 4WO4A 4JFEE 3IF1B 2X9WA 3O2DA 5IVXA 3MRFA 2B4CL 1RMFH 5F71A 5I8CB 1T7YA 1ZOXA 3ZHKA 4X9HA 3KYMB 2VB5A 2UUDH 3JTTA 3QFJA 3V0VA 3JBG7 3PJSA 4JG1L 2YD7A 2HRPH 5CZXC 3K8LA 5DR5H 5FHAL 2JIXD 3X12A 4G8IA 1A1MA 4MA3B 2OBGA 1L7IH 3RBGA 3HA0A 3B6SA 3LD8C 35C8L 1OY3B 4YC2C 2J4WL 2YXMA 2VR4A 5GIRB 1WFNA 1TMCB 5GJSL 5MERA 1A9EA 2L4OA 1AI1H 1F3DH 3IETB 5EO9B 3PP4L 5EZOH 1TJHH 4RFEA 5IHZA 1OP5K 1ACYL 1QBLL 1UCBH 2CLRA 3GMMB 5IMMB 3K46A 1ZSDB 4L8BB 3ZL4H 4KZDH 2A74B 1JRHL 3MO1A 2E7MA 5J6GB 1YEEH 1ZLVH 2GUOA 5IB2A 4HCRH 4ODUA 3ULVD 1CLOH 1UB6B 5FKPA 1FV1B 4HIIB 3CFCL 2VNCA 4H88H 3IFPB 3EZJB 3KLHC 3PNWB 4L5FL 3WIHH 1HH6B 2CIKA 3T3ME 1GAFL 1L0XA 1WT5A 3MLSH 2RAMA 1FE8L 4DEPC 2HVKA 5CUSH 2BK8A 2BRQA 4HUUA 3U7YH 5I18H 1QSED 3BOVA 1U6AL 4JPVH 1XIWA 5E2VL 3VGHA 2B2XH 1UXSA 1X7QA 1N2RB 5FO8A 1RZ7L 4Z76A 3EHBD 4Z0BH 3BP5B 3QXTA 4H1LA 3DROA 1FFNB 4NNXB 2YHGA 3E8UH 3CGTA 4UILH 3ILPA 2W92A 5EC1B 1U8JA 3HI6H 5JHDA 5GS1C 3MV9A 2DL9A 4MNGB 2V5RA 4JFEB 3M8OL 4GKZA 1JWUB 3X14B 4PGEB 4J23A 2AABH 4EDWH 1TTUA 1X5AA 3QUYB 5E4EC 5EA0L 3CVHA 3OKEB 4XPGH 2EDQA 2AJSH 4OUUA 3MLPA 1CDGA 1UZ8A 3REVA 3HRZA 3NIDF 1FZJB 3C60D 1DANU 3AGVA 1HN1A 3VFNB 2R23A 2QTEA 4PGJA 1DQDL 1EJOL 4EQ3A 2MPAL 4KDTA 2VDNL 5F1IA 4YDJB 1JNJA 3UTZA 3RVXC 1JNNH 4H0HB 3L95B 4PRIE 1KGCE 3RX5A 4B0MM 2NY3C 4PY7A 3LSOB 3DVNA 2P5EE 3CFIC 1DBAL 3F7VA 5EORH 3T08A 3VI4F 4WFEE 2FX8H 4HIHB 1EHLL 3BXNB 3GJFA 1N7ML 2YA0A 1QD0A 3OAUL 1PEZA 3EKCA 3FT2A 3V7AE 1CDCA 5BOPA 1EGJL 4ZFOB 2HVJA 4LSSH 4M5YL 5DQ9B 2O5ZH 3VMPA 3O6FC 3LV3A 4MD4A 4XP6H 3QO1B 3U4BL 1IGTB 1PLGL 1KTRL 1J1OL 2Y06H 1MOEA 4DUXA 5DURB 3OTTA 4OFVA 4QRSB 3W9DB 2P24B 1G6RA 1OAUH 4J6RL 2OI9C 5KVEL 3PWPA 1LD9A 4YHMH 1EEYA 1JNLL 5JZ7C 5CBEA 3VW3H 1DANT 2JB5H 5LQBH 3VJ6A 5E99L 4OD1L 2XPGA 3ROOA 5D7SL 4X6CE 3CDGB 4JFQB 4P3DB 2QADB 1S9VA 1A3LL 4P3WA 3LMJL 3B5HA 1K2DA 1S78D 1A4JA 5E8NB 1CCZA 2UZIH 4GG6E 5C70A 4H0IA 3F58L 4LKCB 5EZJA 3QIUC 4N0CD 3HE6C 2GEEA 1QLRB 2MSPA 5DK3A 2EZ0D 1P7QB 4I0KA 2XTLA 3RHWK 4FZEH 4WI3A 4I0PD 1NCWL 3FONB 3EO9L 5D1ZC 2WZPD 3W2DH 3WXWH 2B1HL 1Q38A 3IGAA 3ARTA 1E27B 2F54A 1JI2A 4WHTA 4HWUA 3GNMH 3WL9B 3O4LA 1SBSL 1N5YH 5HI5D 4CMHB 5TE4L 4XP1L 3DMMC 5H35A 3LHPH 4MDIB 1CVSC 5B39B 5CP3A 1IBGH 2AKRB 1V8HA 4G6FB 3GJEA 4QCIB 3GMPB 4ZUVA 4R96B 3OKYA 4L8SA 4WW2A 4FABL 1T03L 4PLKC 3CLEL 5I1AA 5HGDB 2VLLA 5T33H 1BZ7B 1F4XL 5GJTH 3OKOB 5IBTH 2ESVA 4I2XE 3TA3A 1N59B 5C2BH 4JHWH 4WU5A 2ZUSA 3SCMA 3LKQA 3V2AR 3VI3E 4JM4H 4HIXH 1DDHB 3BN9D 4LCCC 1L9MA 2B7DT 4RRPA 4PRIB 4MSWB 3NZHL 3KHQA 1MJ8H 2H45A 3A67H 4KHXL 5GRUL 2P5EB 3MRCA 2XOTA 2V2TB 5T3ZE 3RUGB 3H6JA 5F7WC 1AP2B 3EDDA 1TPXB 1NC2B 1KB9J 4APQA 1A2YA 2NXZB 3O41B 2A6JA 2A6KA 4Q0XH 4XPBH 1CFVL 4HKJA 2BSTA 4XB7A 4KRMB 1QSFE 1T5XA 4U3HA 1X5JA 1JYXA 5ETUA 2VLME 5CEXA 4JG0H 5F3BB 5FF6B 1FNSH 3VFRA 1QPXA 4BKLA 1W0VB 5CEYA 3DARA 2KH2B 2HLFC 3H9HA 1T7XA 4OGAC 4H1LG 3ZYOA 3TBTA 1ZLUH 5C0DA 4HH9A 1WV7T 5E95B 5HHMD 4ZQKA 3MV7E 1A14H 5CJOH 3GMNA 1NANI 3KPSA 5A2FA 4X6CB 2BHYA 5BZWA 5CJBA 4L4VA 4FN0A 2O61B 5KANG 4BELD 2H9GA 3FB8A 1VGEH 5EWIH 3BWUC 3H3PH 3O6LL 2IFGA 5E8PB 1RZKH 4RQQA 2DQTH 3H42H 1T4KA 1Y6KR 5JDSA 2KUTA 1KACB 1NL0H 3N1MC 2J1KA 1J18A 1Q9OB 1UJ3A 2GQHA 1FNAA 1FVEA 4Y5VB 2IG2H 2CDEB 3ZKND 1VA9A 4IOIA 4J3WA 4OGXH 3SKNA 3TLRA 4QT5B 1U8KA 2ID5A 4ZOBA 4HKZB 5IW1A 3QIBA 4OF6A 2VDLH 2BVQB 4KI1A 3VFGL 3EDEA 2YPKB 4LSUL 4DN3H 2PN5A 3DBXB 4JPWL 4GW1A 5FYKU 4OZHB 4PLJD 4DGIL 3FT4B 3HNSH 4I2XB 1TZHB 3TH3T 2CKNA 4HW6A 5C09A 2OLDA 1QPPA 1JHTA 4K94H 2F8XC 4X4MA 5T3XD 2G5BB 1PYWA 3I9GH 4PJCF 5FM5M 3IFOB 4ZUWB 5DWUH 4HIJA 3AREC 3NACL 3VXRA 4YQXH 5CZKA 2QL1A 4R4BB 5BRZE 4U3CA 4BH8A 2HJFB 3NTCL 4PRAA 1W72L 1EO8L 4WUKL 1G7JB 3GMQA 4OQTL 3VFMB 3I6LE 3NCJL 4JFFE 4ZUUB 2A6IA 3G08B 4TQEL 3EDFA 4XCEB 3HR6A 1S9XB 3BDYL 5L8LB 2EE2A 2OK0L 1IGFH 3A6CH 4H5SB 4KJYA 1DLFH 1QSFB 2MHAA 2BOBA 2AJXL 1J0JA 3S36H 5EC2A 3LKOA 3IXTA 2E6QA 32C2B 4KKCD 5KS9E 4MJIA 3ARVA 5DHVA 3HFMH 5D7LE 5D1XD 1CN4A 4GRWE 1S5HA 2ARJB 1WIPA 4NP4H 3WE6A 1F02I 4R7NA 4ESKA 1D9KB 4ZSOA 1DBKH 5K9KA 4HFWA 3SGKA 3MV7B 4IOSD 5MI0B 3GMRA 4X6EB 1AGBA 2GSGA 3O3DA 4O2CB 4XMLH 5DD0L 4NUGH 4M7LH 4X0KA 2NMSA 2O5YH 1G84A 1U8PB 1ZLWH 5IB3A 1ZA6B 4MMZC 4B7IA 5DMGC 1CR9L 3ZE2E 4WFHD 2O5XL 4PIRF 5FYLL 4LSTH 5BJTB 3H7BB 3CMOL 1HCFX 1CDUA 1RIUH 4EBQH 5SX4H 5T1KD 1YMMA 1NFDE 2NNAB 4E41E 1NQBA 2ZCKL 2MOVA 5I16A 4XMKL 3VMNA 1R3JA 4ZUSB 4YDKH 2YSSA 5GXBB 4U6TA 3ZT7A 1FG9C 5EO1B 1UWXH 1NLBH 4RRPG 1J12A 1UACL 1RHFA 1RU9H 3EFFB 4Z8FL 2JK5B 4JO2L 5H2BA 5DMIL 3WIHA 4M43L 4MJ6B 3E6HA 5FIEA 1T21A 1U8IA 2PCPA 1UKQA 2XNAA 3WS3A 2HMIC 3FTGB 2AI0H 2JE8A 3OXSB 3UBXA 4ZO9A 4Q97A 4WUUE 4XP5L 1P4IH 3WMSA 3ARFC 2P5WD 1F11B 3S37L 1KN4L 4HUVB 4QWWC 3VG9B 1T0PB 4QRUA 1LO5A 1ETZB 1KPVA 3WN5A 1MI5A 3G6JF 4JGJA 4HV8A 3VFWA 5CFHA 3S35H 3WDHA 3BZ4A 1G0YR 3HC4L 4XNUH 2BVOB 3U36B 1BOYA 4HUXA 4BSWA 4XVSL 3BT2L 4G42B 1I1FA 3MJ9L 1HHJA 1GZQB 1HKLH 4O2EB 5KS9B 4FNLH 3KPMA 3DI3B 3V79C 1N3NA 2H6PA 1RZJL 2NW3B 5D7LB 2EH7L 1RIVH 4YHKH 4GRWB 1DJSA 4JM2D 4YHNA 4CDGC 2HG5B 5EULV 4DGVL 4TSBH 3TWCH 2FEDD 2DJUA 1AY1H 1SM3H 3MGAA 5J13C 1CICA 1BGXH 2ICEB 5TFSL 4M1GL 2CO7B 3UROR 3C08L 4MQSB 4X80L 4TYUA 1GGBL 1Q8MA 3OG4B 1XZ0A 4HJ0D 3A6BH 2AV1B 2I26N 4LP5A 5ESVA 3AY4C 3C9NB 4ZXBB 3UPCA 4GQ9H 4U1MB 1QRNE 3SQOL 3JVGC 1HH9B 4KMLB 3VD7A 4U1GB 4LVNB 2Y5TB 3HZMB 4HKXB 1IKNC 4CU7A 5JUEL 2P5WB 4PGCB 1CBVL 1YMHA 1WBYB 5J56B 5HGAB 5IEKB 4EI6B 1NFDB 4WO4D 1ORSA 4E41B 2Q3ZA 4ZTOL 5ECJE 1BZ9A 4OV6F 4OLXL 4Y88A 2HA1A 2XZCH 4NQCA 4Q9BA 3VFVA 4NIKB 4ELMF 2VDRH 3QFJD 1EAPA 1QLEH 1YEGL 1E4WH 4DVBB 3P4NA 4XPFH 1T20B 4N0YL 1JZ7A 3HC0B 2YUWA 2IH3B 3EOAB 4JFPA 4P5MB 4CNIA 5EIIA 2HT3C 3H0TA 1OTUD 3K2UH 2Y1VA 3MRQA 5B4MD 3ZTNH 1A0QH 1A6AA 5C0FA 2OTUB 4NQEE 4WUUB 3O8XA 1J1XL 4BZ2H 1BP3B 1I8KA 3NGBC 4G43A 1B0GA 3F8UB 1MCEA 3NBNA 4NZUH 5TDNB 5E00B 2V5TA 4IMKA 5I0ZA 2DOCA 4G80A 5HHQA 4KDVA 4KVNH 5HYQB 1UZ6E 3MX0A 3ULSA 3KPPA 4PY8J 2H8PB 2WLYA 3JWDL 4WHCA 3ZMRA 4GH7B 4OUOA 4PJFE 1K3IA 4KHTL 4HJGB 4RGMC 5LWYL 3WNLA 4Y2DB 5IVXB 2R15A 4TSCH 3M1BA 3ULVC 2ZCHH 1FLTX 4F7PA 1TQCB 1NGYA 2K7PA 3RWIB 1FL5B 1EEUA 1IAMA 2CRIA 4KXZH 2PTTA 3PGCB 3FB6A 1B4RA 3VFOB 1XIWD 3MRRA 4NQXB 3Q0HA 1E6JH 2QSVA 4X8JA 4PY8I 3QDJE 3EJZD 5T1LA 4DZBA 3P9LB 2WQRA 2X4NA 4XNQA 2YZ8A 5ADOL 3L3DA 5HTSA 3K3QA 3P4LA 3MV8D 4RFEB 3U9UA 2HLAA 3BQUB 2ZPKL 4NZDA 5JHDD 3BEWB 5BQ7A 3MV9D 1QEWB 1T5WB 3EHBC 2NX5A 2V7NB 4ODSL 5IKCA 4TVPH 3WS6C 3MO1B 1FAKT 5J1AA 4OCMC 3KNBA 1ORQA 1P7KA 2MFNA 1LWRA 1TETH 2RR3A 3O11A 3I6GA 5FKPB 3VA2C 3ZE1F 5JPMB 3TZVA 3UBXG 1J0HA 5BVJA 5B22A 2I9TB 5HYJE 5D2NA 4KQ3L 4D9LH 4J2XA 2AGJH 1A6TB 2APWA 1OSZA 5I30L 1X4YA 1FJ1B 2X9YA 5DT1L 3O0RL 1BBDL 2YEZA 1ZHNA 3B5TA 3OKDA 3B83A 1LO3H 2C1OA 4HUUB 3D9AH 4L3CA 5K9JL 2V9RA 5EOCJ 5C6TH 5GZND 4NQEB 4NWUH 1D6EA 4JKPL 3C60C 1EFXB 1KULA 3X11A 2OL3B 1N0XL 4NC0B 4JZJC 4RISH 4C56A 5CMAA 1LO0H 4GG6A 1VHPA 4FQPA 5HHNA 1KPUA 5SWSE 4H1LB 3UPRB 1WIOA 3MV8B 3KYKL 4YR6B 5A2LH 1KIRB 4CN4A 4KV5E 1TNNA 2RFXA 3QCUH 4X8XA 4UAOB 3V4VH 3QI9A 3WV0A 1CDBA 5LXGL 5L2JB 4LRIC 2X7LB 1DR9A 3LZFL 4OFIA 2N7BA 4KMTL 1HHHB 3L9RA 4YHYB 1YEFL 5IFJB 3QHFH 4YO0A 3PWPD 4UT7H 1GOFA 1BHGA 3SDYL 3I3BA 4OUUB 2R0KL 3VMOA 5CBAA 4QGYA 4MQTB 3HRZB 4CMMB 3WFCH 1WBXA 3Q48A 5FA3A 2GK2A 1YECL 3ZTJH 5AWNL 1OLZA 3QDJB 3C5ZA 4PJEA 3WFEH 5DRZA 4JFDA 2VXVH 3GMLB 1C12B 1NGPL 4NGHH 4PJDE 3C6SA 2AV7B 4FOMA 2FLBT 3QNYB 3O3EB 2W0FB 3U0TA 4JY5H 4XT1C 5ANME 1NDGA 3RTQA 1CFBA 4MD5A 1RUKH 1S78C 1BWWA 5ILTL 5AYUL 4QOKA 5KJRH 1PQZB 3H3KA 1CFNB 1XF4A 2F54D 1AE6L 1WBZB 5CLWA 1XCTB 4HDIA 1L0YA 3O4LD 2VDOH 4N0CC 3NFSL 1JP5A 3L5JA 2OR8A 3TC9A 2WBJA 3L5WA 1LVEA 3T3PE 4RAUB 2EZ0C 1K3ZA 4PRNB 4NJ9L 5DHXB 4LPVA 5IB5B 2J8UF 4I0PC 5HYJB 5EU3A 3RBSA 4WENB 2PW2B 1KCUL 4R7DB 3MRJB 4KAQL 4X6DA 2ESVD 1YNTB 5HI5C 1P4BH 2FWOB 3TA3D 5KSUB 2ZUUA 2DICA 1JE6A 2FJFB 3D0VA 3GBNL 5CEZE 1I9IL 4LLWA 2IQAB 1EEQA 3SCMD 4JDTH 2XQYG 4H26A 3CC5A 1LEIB 4XNMB 1I7TB 5GRXG 4K7PL 1YN7A 1UH2A 4GAFB 3IAQA 4MA7L 1AQKL 3DTXB 3CH1A 1DVFB 1G9MC 1T83C 2NY6D 1OL0A 2CKBL 1K2DB 3IDIA 2X4SA 4UOW0 1N8ZA 3CPLB 3W11D 4PYHA 1FBIH 5LCVH 2NLJB 4HK0A 4APQD 1HQ4A 3FO1A 4ZNEA 3ULVF 3BN9C 2IALB 5SWSB 4W4NA 5HD8D 3TIEA 4F7CB 4HWNA 1S9YB 5GS3A 2R4SL 3L7EA 3MJGX 4HPYH 4HK3N 1NGZB 3TPUA 2FHBA 4OF0A 3HHRB 5AZ2L 1JYWA 2Q86A 1Y18A 3O4LB 3V6FB 3CXDL 3MTRA 2Q7YA 5E03A 5HGHA 1JF1B 1NGWA 3ARGB 2AXGA 3HAEB 4WI6A 4MAYA 3VXPB 2CGRH 3HNTH 5DLMH 3BIKB 4JQIL 1LE9B 2A9NH 3PHOA 1R5VA 4LPWA 3T1WA 1HEZA 3TBWA 3Q3GB 1ZV5A 1MAMH 4PJXB 4XNZC 4NYLB 2R1XA 2AJVH 2AW2A 2VAAB 3KPSD 5J11C 4AM0A 4Z7WE 1T3FA 2ESVB 4L4VD 1JV5A 1KCLA 5EUOE 4BYHA 4CUCA 5D71L 3WBDA 3ES6A 3G5ZA 3CD4A 4P59H 4YUEL 1VFBB 4PJDB 4HMDA 3MZGB 2ZSWB 4WNQA 4CDHA 2LVCA 3D18B 4HS6A 4NQVB 5DHYA 4J8RB 5ANMB 2H2SD 1U91A 4XBEH 3C6LB 4NDMA 1J9CT 1WF5A 2VL5A 3P77B 4U1KB 1TLKA 3QUXB 4PJ8B 4YDVA 4LLDA 4G8GB 1MVUA 3V6ZA 4JFFA 3QIBD 2VXUL 4CL7A 2GFBA 4GAJH 4PG9A 1DQLL 4EDXA 4UB0L 2IAMB 4OD3L 3TCLB 3GJFK 1RFDL 4R0LA 2FL5A 3FQUB 3ZKNC 1NFIA 3SDXA 1I1RA 1EUTA 4X9BA 4K9EC 1I8LC 1MIML 4P4RB 3EYFB 2B4CH 1FIEA 5K9QG 5C09D 3DECA 5D7JB 5F9JB 4Y1AA 1NAKL 3JV4B 4PP2B 5ICXB 1JHLL 4EI5B 2XFXB 4PLJC 3FAWA 4ZQKB 1DQML 1BJ1J 5I2IB 4LLVA 1WC7B 2KDGA 1ND0A 1VEPA 3V52L 3KPSB 1XGQB 4OFKA 3LN5A 5IBLD 4XVTL 35C8H 3QG7L 1IMHC 2VQUA 2CO6B 3T4YA 5GJSH 4D94A 3EAKA 5H37H 1KTKE 3U83A 1DQQA 3PP4H 4Y4KA 2ZP0T 4DK6A 5C9JB 1ACYH 5FDWB 1QBLH 4MHHI 3SDCA 1ZGLP 3CCHB 1WZMA 1TTFA 5IOPB 3QIWB 1KIUA 3OGOE 4MJID 1AGCB 3AU1B 1FVCA 3OKNA 1JRHH 1VFAB 2DDQH 1ZWIA 1NAMB 1ZANL 1UB5B 4HGWA 2A83A 4D0BA 4WFFD 1UWGH 3CFCH 1QYGL 4OZIA 4N9GA 4RGND 1DBML 4KKCC 5IHBA 4L5FH 2AQ3A 3U2SB 1GAFH 3AAZA 3HLAB 3VWJA 1EAJA 4Z7WB 2A73A 5DVOA 5D1XC 5EUOB 1JMZA 2Y7QA 5IIEA 2PO6B 4PJ9B 5BCAA 3NN8A 1U42A 5GGRA 1KJMA 4LNVA 3MRDB 5J12C 3O81A 1U6AH 1G7LA 5E2VH 4BH8B 4PRAB 2I07A 1J8KA 1RI8A 2BMKA 3IFLL 1SQ2N 1RZ7H 1YMMD 4JVWA 4WTZA 4XBGA 3GMQB 2I9LB 4Y5YA 5ID1B 1OTSD 2GJJA 2FR4A 3MNZB 5J0BA 1T2QL 4XXDA 3H9YA 4KWUA 4XXCA 1K4DB 4Q9QL 2Y72A 3IDYC 3JV6B 4KVCL 3RVWC 3RVTD 5KANI 3ALPA 1YPZF 5H94A 3UTPE 1RZIB 5C08A 4AYFA 3M8OH 3R06A 1BFOB 4NM8L 4XX1G 3RNKA 5A16B 2ATPB 2W0LA 3QJHB 1BECA 1Z5LA 4NOBA 4S1QL 3GB7B 5EA0H 4PRPA 1ZTXL 1LEKA 5FK9A 5IG7B 2MNUA 4PGBA 1AGBB 1RZFL 1HHGA 3N1QC 3G5VA 5E6IB 1DQDH 1UKSA 3QUMB 2MPAH 2COQA 4XWOC 1M05B 1MI5D 2VDNH 5L9DH 5C8JA 4JDVA 4WDIA 3CXHK 1P1ZB 3W0WE 3IJYA 3MLYL 2Y36L 2D31A 3BVNA 4HIEA 5JW3H 1J5OL 3UTQB 2QQQA 4YXLL 5A2IH 4K9EL 3LDBC 3P30L 1H0DA 1PKOA 4HMEA 1NMCC 1DBAH 1ZVHA 4TNVK 5F9WB 2K3TA 1QOKA 1EHLH 2VAJA 1N7MH 2XY1A 1MSPA 5E08L 1A7PL 1S3KL 1B90A 1LEGA 4EEEA 1EGJH 2X4QB 4M5YH 4XGZA 3HUJF 1CK0H 3BI9X 5MP6L 1CICD 5D2LA 3W39A 3U4BH 1PLGH 5IW6B 3ULUE 5GGQL 3CZFB 5H2BB 1SJEA 1T1YA 2AEWA 3E6HB 3RJQB 4ELKA 1NDMA 4J6RH 2EECA 3MGTB 4JM2C 5EOTB 4Z78B 5KVEH 1RV6X 3L5XL 5DJ2A 1FFOA 1RUAL 2FEDC 2G75B 1JNLH 3MGOB 2GTWA 2KBGA 5E99H 1T80A 2ED7A 4OD1H 2BRRL 5D7SH 5IF0B 1CI5A 4HJ0C 4OLWL 4L8DA 1KIQA 1A3LH 3ARBA 3LMJH 4JFHD 4Q74A 4NBYB 4QRUB 4AG4H 1R3IH 2R4RH 1OP3H 4QYOA 3WN5B 4MLSA 4NN7B 3U6RB 2Z92A 1UM6L 3F58H 2IBBA 4PJHE 2FEEL 2X09A 1CYGA 3J7HA 4NQCD 2FLRT 2YWYA 3DVIA 4HS8L 4PB0L 3MCKB 5LAXA 3HG1E 1I1AA 3IDNA 3SKUD 1QBML 2IJ0C 3EO9H 4WO4C 2B1HH 1B2WL 1SBSH 2DLTA 2QQNH 4BUGA 1I1YA 5TE4H 4P23A 4PREB 3UYRL 1FP5A 2L0DA 3NA4A 3BGMA 1XFPA 4OLEA 1QFWL 5C0ND 1M71B 3RY5A 5FKAA 1XH3A 4FABH 1BJ8A 3O8XD 3CLEH 2X44D 5A2KH 4P2RE 2ZOKA 3V8CA 4R3SB 2L7UA 3N1FC 5BV7B 1RZ8B 3G9AB 5C0IB 3ZDYE 1MIEL 3LPGA 4LVHB 4XHJD 2XY2A 5B4MC 3ILQD 3T65B 1CDJA 4TNWF 1YYML 5GGSA 3NZHH 4J3SA 1K9TA 4KHXH 5T5FL 1Z0MA 1INEH 3MNVB 3OB0K 2X4OB 4MXVE 1ES0B 5I74B 3HR5B 1HHKA 3H9ZA 3MYJA 2V6HA 4N0UB 1CFVH 4OV5B 3BISA 3VFSA 2E9BA 3CXHJ 5L88H 1NCNA 1XT5A 4KZEL 3RPIA 4YDLB 3P4NB 4E5XA 2XG5A 1ZLVK 1MCRA 1JZ3A 1WT5C 4N8CL 4XBPB 3MRNB 5FDYA 5F7DB 4OZGE 4WTZG 5T1LD 1WWCA 3ZYZA 4YDIH 3MJ8A 3T77A 2HJLB 5JLZB 3S9DB 2P42B 3QDGE 5DJ8A 3OMZA 4G7YL 3ECBA 1XIWC 5KVMC 2CJUL 3E6FB 2Q20A 2X4RA 4LHUA 4RMQA 1UH3A 3RQ3A 1KLFA 3DPBA 2H2PD 2NX5D 1RK0A 5JORA 3O6LH 1DQJA 3SKOB 5D5MF 4D0DB 4PJHB 2ERJC 1I9JL 2AJZA 5FECA 3GZKA 1JN6A 3F6LA 2W91A 1DUYA 1SYVA 3HG1B 2BFVL 3ZKSD 2HT2D 5TGBB 3BUTA 2F5BL 3BYTA 4JE4B 5I1HL 1GVIA 1CVRA 2NY2B 4MAUL 4WRLA 4NUJB 4RZCB 3KAAA 4NN6C 5EZLA 1G7MA 3VFGH 4WCYL 3ALXA 4FFWD 5HHVH 4LSUH 4OB5L 4NOFA 4JPWH 3VH8A 5E7BA 1KJVA 4I18A 4DGIH 4P2RB 3T0EA 5F1SA 1O5DT 3QQ9D 1A9BB 4NCDA 2Z4QA 5TE7H 1SJXA 4C56D 5EDXA 4KDTC 3GSOB 3KG5A 3TVMB 2IEPA 4LNRA 1FG2B 1H8OA 3NACH 5SWZE 4NO2A 3L3OB 1W72H 2VRAA 3QI9D 3QUZB 3SN6N 4WUKH 1IKFH 4OQTH 1AO7A 2Q7NA 4TTDD 4JJ5B 5KSAB 3NCJH 2J7LA 3VRIB 4ZODA 3MOBL 4JM2F 5E5MA 1IAIL 4TQEH 3LQAL 2OXHA 2OK0H 4H25A 3C09C 5KOVC 1Q1JL 1F3JA 4YGVA 2AJXH 4MB4A 3T8XB 1QSVA 4N0RA 4NKDA 1IEAA 3MRKA 4K8RL 3BUYA 1U8MA 2UWEE 3MBEA 2EKSA 1MLCB 3C5ZD 4GMSL 2FNBA 4OZGB 4XCCL 3PXJA 4JFDD 3VE0B 5IB4A 3SJVE 3NCYS 3QDGB 1RUPL 4X98A 4V1DA 2P48B 4PJBF 3RFZC 4CW1A 2VISB 4ETQB 4KGJA 2H3NA 2GTZA 1P9MA 3RTQD 1H15A 2BSRA 4QHUA 2OZ4L 2YA2A 4CKVX 5DD0H 3CDYA 4KI5E 2MQ0A 4QOKD 1AKJA 4MNQE 1PEWA 2BY0A 4OZFB 1ADQL 2XA3A 3ZE0F 4LLMA 1FNGA 1C7SA 3DNKA 4OAWB 2GCYB 5FYKL 2WBJD 4FQQA 1K8IA 1G7QB 4OLUL 5T1MB 2O5XH 3FB7A 3OKLB 5JIHA 3QR2A 3OXRA 4DUWA 1WEJL 3TNMB 2NW2B 3CMOH 4TPRH 2APFA 1F6FB 2XQYK 3WKML 1NUFA 1YJDL 1IM3A 2R1WB 4UDTA 5JO5B 4JANA 5D7IE 4PP1D 3ZTJG 1WWAX 4XMKH 4QXUL 4P5KA 2LQRA 2NY1B 4DKFL 3CFBA 5EU5A 1TZIB 1EIBA 4WW2C 2XWJA 5EPMB 1UACH 1YUHA 4IS6A 3MBXL 1OB1A 3BN3B 2VUYA 2NY7L 4K7FA 3LN4B 5T5NG 4JO2H 4UU9B 3TA3C 5DMIH 1WZLA 2NPLX 4M43H 5IM7B 4ZNCD 5DC4B 3CVIL 1IJ9A 3O3AB 3EUUA 4NFCA 4ZUTB 3UBXI 3SCMC 1P84K 4PV8A 2BNUB 2FCBA 1PY4A 4JQVC 4XP5H 5SWZB 4XC1L 4G3YL 1F4YL 3S37H 1KN4H 4HX1B 2NY6C 3CFDB 2MTPA 3DWTA 2MCPL 2VQ1B 4APQC 1XCQB 4LRNL 2I60L 3CVHL 5HD8C 4HULB 3SGEI 4MAYD 3U46B 1G9NC 3PL6C 3HC4H 4P4KA 4EIGB 5IMKA 3WIFB 3CDFA 4XVSH 3BT2H 3MJ9H 4HZLA 5H8DA 5MEPA 2X9XA 4LHUG 4PLOB 2N4IA 4LQFL 2EDDA 1DN0B 4KROD 2UWEB 1RZJH 1KN2H 2EH7H 3D0VB 4LCWE 5CZVL 1AJ7L 4FQXA 5E9DB 3SJVB 5JR1L 4DGVH 1EEZB 4L9LC 2IBZY 1IZKA 5TFSH 4M1GH 2WP3O 1J0IA 3C08H 1G7HA 4X80H 1NLDL 1H3VA 4F15B 2J3SA 3QUKA 4U2ZA 5J9PB 1N8ZB 3QQ4A 4MNQB 4D9RD 1ZLUK 4LCYB 2FHFA 3DV6B 2UVFA 3SQOH 4GO6B 4JFFD 4UQ2B 4S2SA 3EOBA 2Q76B 3V4UL 1KNOB 2Z9TA 2GT9B 2H2SC 3VH8G 5JUEH 4XPHL 4UV7H 1UJ3C 1M6OB 3OX8A 3TJEL 3L7EB 2YC1B 1XGPA 3KLDA 1LP9E 5C7XL 1IGML 1XF5A 2EE9A 2VIRA 4RMVA 3I84A 4I48B 4Z6AT 5KSBF 4ZTOH 5D7IB 4YNYA 2Q86B 4QXTA 3RWFA 3VD4A 3QIBC 1CD1B 4OLXH 2AXGB 4IIQB 3CNKA 5M94B 4GAYA 3L7FB 4Y1AD 2NY0D 2ICWB 5D7KD 5KVDL 3GFUA 1FC1A 1V7NL 1S7SB 1YEGH 5A2JH 1ZHBA 1EGJA 1JUFB 1VKXA 1T0MA 3QG6A 1E0OB 3PF2A 2HN7A 3PIQB 4XVJL 5HHPB 4ONFL 3GHBL 2LFGA 4I8DA 5HYSA 2ADIB 2F8OA 4ZDHB 3RU8L 3KPNA 1T6WA 4Y4KD 1J1XH 2FX7L 2XWTA 4LARL 5FGCB 3TYGL 5IBLC 4FMFA 3SDCD 2AJYL 4YFDB 2GAZB 3S5LA 4HXBL 3BPCB 3DHMA 4YX2L 4RNRA 2ZG3A 3PWLA 4IRJA 2Z8WC 4MS8D 3MRPB 1MCPL 2YXFA 4P5TA 2DQJL 5BMFL 1IC7L 2X6MA 4OBRA 1OD9A 3N1GC 2NTFA 3K81A 4EDXB 2AXFB 1X6NA 2PUQT 3GIVA 2WANA 1AGFA 3QXDB 4WV1A 2WINA 4PRDB 1CL7L 1M1SA 3DX9B 2XXCB 5FV2A 4KHTH 4MXWL 4YXKL 5LWYH 3VWJD 3GSWA 1UCTA 2BSED 1HXMB 1EV2E 4LCWB 4OIBA 3FKUS 2Q8BL 3M45A 3SGKC 4RGNC 2P8LB 4I77L 3LAFA 1EX0A 4HPOH 4U1HB 3UDWA 3LN5B 4YJZL 2EDFA 2YR3A 3LQZB 4NN5B 3JSSA 4RFNB 4O2FB 4XZUA 5TH2A 5ADOH 1G9NL 1RJZA 3VFPA 1FAIL 2PR4L 5EZIL 3V5DA 5IEHA 1U95B 2HTKD 3W0WA 1JPSL 4WW2F 1YNKL 1TCMA 5IP4A 1OGTB 1LP9B 4C59B 4FXGB 5C08D 1FVCB 4EN3B 1YC7A 1AD9B 4LCUB 3NH7L 1T89A 4W6WB 4JVPA 3D3VE 1MH5B 2EIZB 3L1OL 3RVTC 3AUVA 4PRPD 4Z95L 2FB4L 4V2CB 1I85A 1OQOA 1YQVL 5K59E 1NANH 2VLKA 5I30H 3QAZC 3GM0A 3MFFA 4YH6A 5E94B 5DT1H 3AAZB 1AHWB 1B6DA 1EA9C 3L3JA 1LHZA 5E2TL 3O0RH 3L3GB 3MR9B 3ZKQD 2YBRA 2HFFA 1UWXK 5ISZA 1KJMB 5K9JH 4HH8A 2DKMA 3GI9L 4ZD3L 2VLJE 3ROLA 4AT6A 1HHIB 3C8KB 5INDA 1GGTA 5CP7A 4JKPH 3PV7A 2YD9A 5K9QI 2PYFA 4Y4FA 1VERA 1N0XH 2D4DA 5TE6H 2E9IA 4XAKE 3L3IB 3TCXA 3LB6D 1OCWH 2W60B 3PWVA 4PJCA 3BP4A 5GGRY 1OAYL 6FABL 4HHAB 5EFIB 3DGGB 1EZVY 4TVPD 1NCAL 1QA9B 2VXSL 4NNYA 4GW4A 3KYKH 3LKRA 3VXMA 1FFPB 3O6FA 4ZAKA 8CGTA 5HDBF 1K5NB 3G6AA 5LXGH 4O5LL 4N1HB 5BO1L 2YRZA 4OSUL 2GSIA 1NGXA 3LZFH 2F58L 4KMTH 4Z7UE 5C07A 1YEFH 3DX8A 3LKNB 2HTLD 1WAAE 4HLZH 5I1EL 3PGDB 2BXYA 4G6AD 3SDYH 3HZYA 2R0KH 1G0XA 4DN4L 1YECH 1CFQA 3SDAA 5AWNH 3ARBD 1C16B 2E8YA 1NGPH 1A7QL 2UZYB 5CWSB 3QIUA 3HE6A 1ZS8A 4CBPA 3BEVB 3TYFB 1YYLL 4NKIL 4HIEB 3EJYD 4DKDC 1MFCL 3VGDA 4ZFFA 5EN2A 3CSBA 1I1AD 3OJ2C 2Z35A 5ILTH 2NTSP 5GRYA 4OZ4B 1W72A 2EDYA 1FH5L 1CGTA 4QF1B 1AE6H 1T04A 2R1YB 4XCFL 1QO3A 1JYNA 4JZNB 5IQ9B 3NFSH 1JTPA 1EO5A 2OQJA 1VACB 4P23D 1OAZL 3D3VB 3UO1L 4CAGA 3IVKA 4LVOB 3O4OB 4NJ9H 5HYSG 1TJIL 3Q5YA 5I1KL 4N90D 4R8WL 4F37K 4JHAL 1I3RA 2BCKB 1H3WM 1QBBA 5GISH 1BLNA 2A1WL 1KCUH 1YZZA 4FXKA 5F7UA 3S5LG 4KAQH 5INCB 2WIMA 1SJEB 4PUBL 1W8NA 4GOSA 3TGXA 5DO2D 3GBNH 4X5WB 2RIKA 5C0NC 5DEZA 3WIIH 4LPYA 1ZGLM 3O8XC 4OM1L 2VLJB 4M4PA 1A1OB 4K7PH 3FN0L 4M7ZB 3QZWA 1WFOA 1YY9D 3IJSB 1AQKH 1PFCA 4R9HA 1MCOL 4XHJC 2ICWJ 4OI7A 2CKBH 4OCYL 3EGSA 3ILQC 4N5ED 2FX9L 3DIFB 4IMKC 2ADJA 5FUZL 4JVUA 1JGEA 4JAMB 5B3JF 3KPOA 5E70A 3ZSSA 5AEAA 5J4MA 2EC8A 4IJ3C 4YBLB 2N1KA 2R4SH 3ARRA 5SX4I 2AJ3A 3Q5TA 2N56A 1IAKA 2FBOJ 1MCBA 5AZ2H 4X99A 3G6JA 5C0BE 5DD6A 4Z7UB 3WFBL 1K8DB 3QHTC 5FGSA 4QY8A 4LOUD 4RA3A 4P23B 4NPYB 1DLHB 4JQIH 1RIHL 2C7UB 5DJAB 2DYPA 5GSRA 3ZDXF 5I1CL 5ALCL 1RK1A 1KFAL 3D1MC 4LEXL 4HC1L 4J4PA 3CFEA 4LHUD 2NXYD 1JZ2A 2NYYD 3MRHA 5TDPA 5GS0D 5FYJD 2X41A 4MMXC 5DSCB 1P4LA 4YUEH 4UIMA 2VLRE 3QQ3A 4J12A 2EE6A 1T22A 2BNQE 5J6HB 1HYSD 4G8FA 1HK6A 2PKDA 4U6VL 5CS7A 1A4KB 4WWKB 4U6XB 3DRQB 1T1XB 4Q6IA 4IRSA 2H2PC 5I1LB 3WFDL 1PGRB 3QBTB 2JCCA 2ADFL 2IF7A 1ED3B 4OFYA 1KC5L 1JYVA 4A2MA 2Z31B 3AFLA 5D1QB 2AJUL 2EH8L 4UINH 2M8XA 1RD6A 2VXUH 5SWQA 3TZVC 5ICZA 2V2XA 1DQLH 5D93C 5IESL 4RMRA 4UB0H 5GGSY 1OF2A 5D2NC 4OD3H 2HT2C 1RFDH 5IHUL 4LIQH 5KVGL 2EE3A 1IC1A 4Y8AA 1YEDB 4Z7VE 4Y16B 5C0CA 3T0ED 2MKWA 3VXUA 3MJ9A 1MIMH 5D96B 3LIZL 4DKEL 4PTTB 4F3FA 1HSBB 4FFWC 4PB9L 3MJ8B 2BNRA 1NAKH 4ELMA 5DJ8B 1JHLH 1VADA 4QRTA 4JFOA 1AGDB 1DQMH 1FL3B 3STZA 3WO4C 4M1CD 1VB9A 2E7HA 3KYNB 2NZ9D 3QQ9C 1AGEA 3KYOB 4Z7QE 3T1FA 4XVTH 1CU4L 5IBUB 3QG7H 5C2UB 2VTFA 4NRZA 3FN9A 3E0GA 1AO7D 4J3OC 4F7MB 1MHHB 3MUZ1 2VZ3A 5CHNB 4ZFOL 1RZGA 5CKAA 1OTTD 3WUWB 5ABDE 2NY5L 5ALBL 1FL6A 4CVUA 2FDBP 1SYVB 3QI9C 5I66B 5EUKB 1H3XA 5AD0A 1H9VA 1FO0B 3GSNB 3BKYL 4GS7B 1AXTL 3CX2A 3KDMA 3P73A 3U9PL 4Z0XA 4MA1B 2G9HA 3FQWA 4XCYA 5I8EA 3EW3B 3MBED 1QKZL 2CRZA 1ZANH 2AP2A 5EZLB 3TO4B 4QRRE 5AUMA 1JGUL 1QYGH 1KJVB 1ZT1A 1DBMH 2BZDA 4V1DD 3RZCC 1S7QA 3BZFA 4OM0L 1JK8B 1MWAA 2WUCL 3C5ZC 5E1AA 4QHLB 4ZPTB 3DUUB 5K9OB 1AXSB 3VDCA 1AKJD 3D25B 5DRNB 4K94C 3LKSA 2VLRB 5C6WH 4YEEA 2XN9E 2BNQB 4FQ1L 5CGTA 3MODL 3QWOB 3RWGB 3DI2B 5F7EL 3NIDE 5HYIA 3RTQC 4NO2B 2GJ6A 5CCKH 1ZGLA 3IFLH 5GGVL 1MQ8A 5B38A 2FD6L 2D03L 1BJMA 3BP7A 4LHJB 5JPNA 5HJ3A 2WBJC 3IDMB 4FFVD 3MJ7A 1T2QH 3ZT6A 4Q9QH 2P46B 3QQNA 4CVZA 3RA7L 4KVCH 2FO4B 5GHWL 5F7MC 2B0SL 1M7DB 3DRTA 3GSQB 3QZWG 4PV9B 4Z7VB 1U8OA 1G7IB 4PP1C 3VI4E 3BZEA 4NM8H 1QG3A 3AB0C 4LPTA 1C1EL 3QCVL 4FQJL 2B5IC 2CDFA 4U4BA 2O93L 2FZ3B 4K3HA 5TF1L 1MRDL 3PGFL 4M62L 1OAKL 4S1QH 1RJCA 2R9HD