1DCLA

Mcg, a lambda v type light-chain dimer (bence-jones protein), crystallized from ammonium sulfate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSNVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords MCG
total genus 42
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dclA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dclA02
5ICZA 2EH8H 1E0OB 1Q9KB 3PWJA 5H94B 1IT9L 4IRSD 1JJUA 5T1KB 4ORZC 3GSNL 2DM7A 2J8HA 2Q3ZA 3NN8B 3MA9H 2Z8VC 1PFCA 4TVSa 3IRZA 3KR3H 3MRJB 1CIUA 4G5ZL 2JIXD 4H1LA 5FV2A 4F57L 1OSZA 3QIUD 2E6JA 2Y6SD 4RBPH 2AJSL 2IQAB 3JWDH 1JF1B 4Z7QF 3PL6B 5EB9A 2C5DC 4HS8L 4M7LH 4J1UB 1A1NA 2YSSA 5FF6B 4ZUWB 5DJ2A 1OOAA 1QVOA 5B38B 2BVQB 1EJOH 3BZFA 3V5KB 1DQTA 3FQWA 3CFDB 2E7HA 4ZQKB 1T04A 4AM0A 4I3RH 4U2YA 5HGDA 1AC0A 2M8XA 5D70H 2BOBB 4KK9D 3D0VA 1WZ1H 1UKTA 1P1ZA 1YDPB 3SEPA 4J12A 1XIWA 5GJSL 1MFDL 1GIGL 5ISZD 4K9EL 4J3WA 5DS8A 3QUZD 4NN6C 3T8XA 1GYAA 6CGTA 2HRPL 3QUKA 1N6VA 5AYUH 4XNZC 1K6QH 1G0XA 1I85A 1IC4L 1KENL 3VFUB 5T3ZD 1IGCH 1FL3B 4XBPB 1IQWH 1U6AL 4NO0B 2DI8A 4FQ2H 2MNUA 4BQBA 4GW1B 5I8OH 3TBTA 5KSAB 2ZSWA 3O3AA 1BPVA 2EYRA 1KB5L 4LFHD 5I1DB 1AR2A 1T21A 5EPMA 1W2KT 3WJJC 1CE1H 1V7NL 3BEVA 3NFPB 4NC2B 4EIZC 1FGVH 3ZE2E 2X89D 5B8CB 3QNZB 4FFWC 4HWZA 2W9EL 4NKOA 4RA3A 5DD3H 2VABA 3QB7C 5HI3D 4QTHA 5JHDE 5L0QC 4PBXA 5A2IH 2VUYA 4Y2DB 4ODTL 4I3SH 4QXTB 4M6ML 5EOCJ 1NCTA 4O2EB 3UBXB 3MLTB 1C12B 1U58A 4G6JL 1T03H 2GT9A 5LCVH 2DQUL 2DLEA 4Y8AA 5C8JA 3EYSH 4AEIH 2ESVE 3VMNA 3ARVA 1RUQL 2VH5L 4PJEB 2HWZL 4JO1L 5CEXB 1RZKL 3O8XA 4QRRA 3CSGA 5GGQH 3U83A 4ZS7H 25C8H 3SDDC 1EJ6A 1RUAH 4NJ9H 4WTXA 2W0LA 4P59H 1BQHB 4LVHB 3OB8A 2R4SL 4M8QA 4YZFF 4ZFOB 3AREB 3LEXA 5I8KL 5GRXG 2JCCB 1J7VR 1CE6B 4H5SB 2XQYK 3O6FD 5JUEH 1A14L 1KPVA 5BRZE 1LEGB 2FECL 3JV6A 4WW1A 4YDIH 4KAQL 1NJ9B 4LLWA 3DURA 3VI4E 4FQLL 4PY7A 4U6VL 4NBXB 1JHLL 1A6VH 2H26B 3O4LB 1EEZB 3DI2B 3EHBD 4OT1H 2WZPD 1KTLB 4YC2B 4XNQB 2OTUA 3MZGB 5MI0B 3ZTNL 1RHHB 2BY1A 3P4MB 4U1GB 1C08A 3RVUC 2AQ1A 1BD2D 4D0BB 3U7AA 1AD0A 5GGTA 1NAKL 3GSWB 3ZHDA 5D1QA 2DBJA 1JBJA 4HBQA 3VH8B 1CF8L 3WUWA 1JN6B 4DFHA 4K07A 1SEBB 4MAYC 3TN0C 2CLZA 4N0RA 1QHPA 1CGSH 4M5ZL 3L3KA 4LAQH 3TPUA 2EE3A 4WEBL 1NC2A 4LARL 5F7HA 4NCC2 5CBEA 5ICYA 2OCFD 1KN2H 1TXKA 4P2OC 4PJXA 2YRLA 1B0WA 3B9KA 4X4YA 1X5XA 4XVSH 2VISA 4KDTC 1OF2A 4FQIL 1JZ6A 4DW2H 3EOAB 3B6SA 2BHZA 4HC1L 1R3IH 1RURL 3PWPD 2YMXL 3QR2A 3PDDA 3U46A 3S88H 4XGZA 4L4VE 5IP4A 2IFGA 2UUDH 2XA8L 2APTA 3LKOB 3MOAL 1CGWA 1UB5A 3RQ3A 3U4BH 4X8XA 2Z35A 3CX5K 3ARSA 2YPLD 1G1CA 3O45B 4H26B 4PD4J 3WNOA 2CKBH 4NQSB 4QHKJ 2VLMD 2B1AL 3B3IB 1D5ZB 3MJ7B 3BKJH 4UV4H 2X7LA 4X6DE 1Z5LB 2W9DH 1I8LC 3TYFA 2GTZA 1BGXL 4LSRH 5IFAH 5C09A 1CXEA 3MUGB 4Y7MA 5IWLC 5DO2D 1CU4H 2CDFB 2V5RA 5B22A 1MWAL 1SJVA 4MAYA 5T5NG 5MEQB 1KTRL 4R0LC 5DJ8B 3FQUA 2XTJB 4P2RA 2E8YA 1F3DJ 1X4ZA 5FYJD 3NCJH 4POZD 1OT2A 3L5WA 5KANG 2VMFA 5TDNA 3MV11 4XPAL 1JWMA 4CGTA 4BFEA 4MJ4A 2ADFL 1CDIA 1A4KB 2WWKO 4GMSH 3OG6B 1ORQB 4I13B 4LSPH 1OCWL 4AYFA 4L1HA 4GAJL 5DRNB 5C0RL 3MROA 1CFSB 3QG6B 2A9NH 3QQ3B 1A7RH 5IUSA 4BK4A 1A6ZB 4JFED 2B20A 3O2DH 3QDMA 1MJ7H 3SDCC 1MLCB 3DUSA 1KGCE 5FUZH 2WMPA 4X7SH 1WITA 2V5SA 4NRXA 2XT1B 4WWKC 1ZEAL 5AWNL 4Q6IA 1B0RA 3EYOA 4UT9H 4I0PD 3LN9A 3QIBD 3JV5A 2R1YA 1U3HC 3SQOL 5BV7L 4HS6B 1T2QL 1D6EA 1AE6L 3P9LB 4X6DA 5HHVH 1CVRA 5DEGB 4X6CA 5SWZE 4HIEA 4LCCB 2CDEB 5I6XB 5MENE 1OQOA 3HE7A 3UBXI 2C7UB 3TPKA 2VLKD 3CVIL 3QJHB 4NRZA 4P5KA 3GEWB 4IRSA 3G04A 2X6MA 5C71A 1ORSB 3FT3A 1GOFA 1JP5A 1GPOH 3V5DB 1MCSA 2C4FU 4E41E 1OARH 1BOGB 2J1KA 3HMWL 5DQ9A 1L7IH 5D2NB 5E94A 3RGVC 4C83A 4NCC1 4YO0B 1UVQB 2N7BA 5DZNA 4LCWE 4N68A 4Q74A 5MEOB 3L5XL 3L3HB 5IQ9B 5C0BA 1LNUA 1KCUL 1KPVB 3MLRL 5GS1B 4NQTA 2VLJB 2O5ZL 5BVPH 1BWWA 2FD6L 3PG2A 3MMEA 3WE6B 5I1JH 4TOYH 4RGND 2HT2D 3QNYA 2ZOLB 5FIEA 1JNHA 1WT5A 4F7EB 4HWBL 1PG7L 3LKNB 1MIMH 4FQJL 4Z5RB 1H15B 3AREA 4Z18A 2AJZB 2WWKT 4OZFH 2PXYA 3DBXB 4M7LT 1RZFH 2JJVA 4L3EA 5CGYD 1RZ8A 4HUUB 1AQKL 1UM5H 2VLKE 4CRPA 3MCKA 2YK1L 4RMRA 5C6PB 1NBYA 7CGTA 4CDHA 4K8RH 5J13B 1M6OA 1MHEA 1AIFB 3CFCH 2X41A 4XBGA 3RDTC 2NY4B 2IC2A 5HSFA 1FNSH 5JOPD 3K74B 3RWEB 4JQVA 4PB0H 3CAFA 1GC1L 4JZJA 1QKZH 1YYMH 4NNPH 1H8SA 1KIQB 4KTYA 1HKLL 4OZGE 5DJCA 5T1LA 3BH9B 1YY8A 4R7NA 3U82B 5C0BE 4ZO9A 5DJ6B 4K2UH 3WFCL 5DHVH 3BHBA 1XF2B 4GXVH 1X4YA 2DM3A 5FUOH 2VC2H 4HZAA 5HYJE 4JN1L 5F9WC 4H26A 3X3FH 1XH3B 3RRQA 3LHPL 3OAYH 5EOQL 1HN1A 3MSPA 3GUTA 3D69B 2QLVB 4KQ3L 3DX8A 4V1DA 4HBCH 4Y88A 2V9TA 3S96A 2IMMA 4MD0B 3D0VB 4IM8A 3NAAL 4L4VA 4TSCH 4K8RD 4GRLC 4Z6AT 4MXWL 4LGSB 4LSQL 1MCWW 1RPQA 2O5YH 4HW6A 3B9DA 1I4FA 1ZA6B 4WV1C 1RMFH 5ACLA 2Q76A 2WLZA 3GHEL 1ZHKB 3MYJA 4NGHL 1F4HA 4EI5D 1C5BH 4BFGA 4DAGH 5F88A 4LLUB 3FHAA 4XP4L 5C7XH 4Q9CA 3QUYA 1CL7H 2A6DA 4A2LA 2ITDB 4YWGL 1ZA3A 5SX5H 3DRTA 1DSFH 4EI5A 4PJ8D 3RZCD 4IOFC 2ZSVA 2J4WL 4YR6B 3SGEH 3IXTB 4I0PA 4HIHA 2XQBH 1BJ1J 2EIZA 2GFBB 3ILQD 2EKJA 3C6SA 4I9WE 4KKNA 4OZIF 3M1BA 1INEL 3LN5A 2FGWL 3QDMD 4NQCE 5J6HB 3FFCA 2BNRE 3T77B 4Z95L 3OKEA 1WCBA 1U8KA 2FO4A 2VDKL 5A40E 1E4XI 5KS9E 3IDGA 3HG1D 5DJDB 4K94C 3K46A 1RK0A 4P3DB 1NGYA 3KPOB 3MJ8B 4X5XA 3HNSL 4M62L 2WM0A 2GUOB 4F80A 2F9BT 3INUL 1QBAA 2HJFA 5J0BA 3VXRB 1VKXB 2P24A 4ZPTB 2VLJD 1AGCA 5T1LD 3AXLB 4W4OA 1JNLH 3LB6C 2DQHH 2NW2B 4RBPK 3BSZH 2ILLA 5DR5H 4WO4D 3C5JB 3N85H 4OF0A 5CZXC 3ZKNC 3MRNB 5FUCE 3W9DB 1P9MC 2APFA 2E9JA 3MODL 4PREB 5CZVL 1NEZB 3WFEL 3O9WC 4YHKL 1YEJH 3M8OH 2J8UE 1MEXH 3IXAA 4TUKH 1ZLUH 3AROA 4O4YL 5CGTA 3CU1A 4I48A 8FABB 4YO0A 3JXAA 1QBMH 3QUYD 1DL7H 4GW5B 4JY4B 5T1DL 2YPLA 3U9UA 1FGNL 1S9VA 1W8NA 1R0AH 4G6MH 5INDA 3F12B 1T66D 4OM1H 3RL2A 4AENB 3QT2A 5KOMC 1H3PL 4Z7VB 1CFNA 3EYFB 3FFCE 2BNRA 5TH2B 4E41A 2VZVA 5KS9A 1W72H 4NT6A 2CUHA 1RIVL 3T0BA 3IAGC 3RU8L 3T04D 4NBYB 4WUKL 2QV2A 3GMRB 5DVOA 4IIQC 1J0YA 1XF3B 2H8PA 1UJ3A 5DI8B 2CJUL 2VZTA 4R8WL 2DWEB 1CT8B 4KKCC 5F1NB 5MEOA 1Q72L 2E7LC 3W0WE 3DYMA 3OTTA 2ZUUA 5GS0L 2V2XB 4DWHA 4X6CB 4O9HH 1JI2A 2D2OA 5DD5H 1NMBH 1X7QA 2HKFH 1ONQA 2H2PD 5KVGL 4TN9A 5B3NA 5KW9L 1P1ZB 3RPIB 5DT1L 4PTTA 4PYHA 2COQA 2OP4H 4JPIA 5GHWL 5F3BA 5KSVB 1KEGH 3UAJD 3DWTA 5C0CB 1TJGH 2P8MA 5CD5C 1QA9A 3CVHB 1YEEL 4PFEA 3DIFB 3PJSB 4KK5D 1J5OL 3OGOE 1OSPL 4J1UA 3BT2H 2VNCA 1AD9A 1RZ8B 2VDNL 5DFWH 3OKDB 1IMHC 1J1OL 1U3JA 4X6FB 1JZ5A 2F8XC 5D2LB 4WWKA 3KYNB 4ZTPL 5IVOA 2NX5E 3S36X 1W0WA 2YN5A 4GKSB 3P11H 4TULL 4FFZH 2ZZUT 4P4KA 4CDGC 3K8LA 3TYGH 3RNQA 2RCSL 2VDRL 4QNPF 3GRWA 1OM3H 3ME0A 3ZKXC 1I1YA 2J5LB 4OIIL 5DJZA 1AGDA 5D72H 2CXGA 3JZ7A 1D6VH 1U8MA 1NBQA 4N5EC 4M03A 3E3QE 3O9WA 3V6OA 3ZL4H 1I3RB 2YBRB 1IFHL 4GW1A 4J3XA 5E2TH 1HE7A 4OGAC 1XFPA 4MVBC 1VPOL 4UUJA 1FV1B 3QG6A 3QQ3A 4FQQA 3RIAK 2VB5A 3J8F7 4FFYH 5IG7B 1QA9B 4AG4L 1B0GA 1HZHL 1SY6H 1YNKL 3KPSE 4WTWA 5ESQA 1JFQL 5JOEA 2NY2B 1EFQA 3KWWB 3KLSA 4N0FA 5JPNA 3C2AH 1K5NA 2ICEB 2EYTB 1DE4B 4U6TA 1X7QB 3TO2B 2MCPL 3E6HB 4G8FA 6FABL 1JZ4A 3JV4A 3FZUD 1FNHA 1JGLL 4L8BA 4KHXL 3QCUL 4M4PA 3O6ML 1FJ1B 5LGJB 4KMTL 5DUMH 5LBSL 4ONGL 4KJPC 3BZ4B 5AZEH 2IFFH 2FLRT 1Q9WB 4JPKH 4I2XE 1J05B 5BW7A 4O5LL 2XN9A 1DQLH 2IH1B 4QXUH 3QUYB 3H0TB 4P4RA 4CBPA 3IETA 2IGFH 2XV6B 3MCLH 1G6RA 1MHHA 4Z76A 3UZEA 1BZ7B 5IMOB 5CCKL 3ARFD 1G9NC 4NKQB 4R4ND 3UPCA 4PUBH 1HCFX 3DYOA 1DBML 3MFFA 4ZS6C 1HH6B 1IKFH 4GW4A 4JRYA 5JQ6H 4NQDA 1FCCA 1Z0MA 1ACYH 4OB5H 3TN0A 5C0IA 4P2QE 1J1PL 4UTAH 1RVFH 1TPXC 1FVEA 1LDPH 4NWUL 4RISL 1NAML 4MHHI 1DLHA 3D39B 2EIEA 4OLWH 3DV4A 1MRDH 1MQKH 2RB8A 5D1QD 2XG5A 3IFOA 3NTCL 5E8EA 2XG4A 1T83A 3QRGL 1E6OH 2J6EL 4IHOA 2VL5B 3FOMA 5ALCH 2FYYB 2DM2A 4Y4FD 3BP4B 1CG9A 1HI6A 3V7AG 1JE6A 5IHZB 5T3ZE 2KH2B 4OD3L 3EAKA 3N9GH 2V2TA 1EMTL 3SJVD 3IXAB 3WS6A 2E5EA 4K71C 1UM4L 3HUJE 2XKUA 2NXYD 5LAXB 1Q38A 4NQCD 3MRKB 2NTFA 5KG9B 5CLTA 1FVDB 1XMWA 5C07B 3I6KA 2VAAA 1PDKA 4H25B 4WDIA 4EKXA 4PV9B 4CMHB 5BJTB 4Q6IC 5F9JB 3SY0A 4UB0H 3EUUA 4LSDA 3WHXB 5I1CH 3HI1B 1AGFB 3E8UH 3IFLH 3QNZA 3P73A 4Y5YB 5ADOL 3HC4L 4HQQH 1NH6A 2DQJL 4HZLA 3QAZB 4RIRA 1D5MA 5ICXA 1D5ZA 1FNFA 3VD3A 1IBGL 4OCXL 3K4ZA 1T20A 4EOWL 1S7VA 2G5RA 4OKDA 3TA3C 1A3RL 1H3XA 5FYKL 2HN7B 2EYRB 1NUNB 1C12A 4R2GD 3U9PH 4BKLA 3G9AB 1GOHA 1UKQA 3MLVH 5CZKA 3T4YB 3HE6A 4CN4A 1A64A 2BVPA 4C55A 3KDMA 4N8VG 3W81A 5TE6H 1CICC 2BJMH 3LVEA 5ESAB 4LRNH 3UTPE 3V5HB 4S1SH 5GXBB 4PJDB 1RZIB 4HWZB 1XR8A 5L8JB 5DJ2B 5L88L 4JHZA 5I66B 3G6JB 2C4FT 2BDNH 2YUWA 4NO3B 1CGXA 2VDOH 3BJ91 5IM7B 2MMXA 1JPTH 4JZOA 3KS0H 4X6DB 3C60A 2GYSA 3B9EA 1OTSC 1UQSB 2YC1B 4JM2A 4U6YA 5TH2A 1HSAB 2D31A 5FGCB 4ELMB 1T0MA 1PYWB 4ZFZB 3MV9A 4CVXA 4Y1AD 2JJSA 3U6RB 4HK0A 5AAMA 1M7IB 4L4VB 3NMEA 4WI2A 5EBWA 4UMGA 3T4YA 1G7JB 5ECJE 2X42A 1IZJA 4IRSC 1I1AA 5IB4A 3V6FB 2APVA 2XFXB 4KY1H 3ARFB 1S7XA 4D3CL 4GG6A 5EBLB 1NC4A 3DO7B 1CFVH 3QP3A 1IL1B 3RKDD 3MBEA 2R9HC 4NUGH 4P2OA 5TPWH 1A7NH 4YUEL 3UYOD 1I75A 1HYRC 4NN5B 2CRIA 4FTVB 4TNVK 3NACL 3SDAD 2BSSB 5D96C 4QXTA 5C08D 4QRPB 3UJJH 3OHXB 2OXHA 1AGCB 5IQ7L 4HKZB 1I1YB 4PJIA 4WY7L 4X6BA 3U7YL 1DDHA 3MACL 1DEEB 5DD0L 1RULL 2D03H 3B6SB 4LSSH 2ZOLA 3AS1A 2WQ8A 4J2XA 4LLAA 3DXAB 3GIZH 3QUML 4YBQD 5E95B 2JJSC 1JPGB 5IESL 3V2AR 3VXNA 1YEIL 3IDNA 1FV1A 4FQQB 5K9OA 2XFXA 3IDXH 3QEQA 4F9PA 1QFWI 5IIEB 3C5ZC 1BECA 3MV9E 3VWKC 1GAFL 1MCIA 3QDGE 2ZUYA 1MSPA 2JCCE 2FZ3A 2QQNH 4UAOB 2Q86B 3SE4C 1OAQL 3BQUB 2IPTL 2LFGA 4EDXB 1XIWD 2P1YA 2YXFA 3H9ZA 1CXFA 2YPVH 1Z6JT 5B39A 1UXSB 4M61B 3BVNA 4UIMB 1U8OB 3Q1SH 3BKMH 4JFYB 3IDUA 4U0QB 4HKXB 5CINL 2BC4A 3BEWB 1WWBX 2K3TA 4KUZH 4L3CB 3QXVA 2NZIA 3AS3A 3DARA 1MJUL 4RFEB 4HC1A 3I02B 1X4XA 4G3YL 4JM2F 4LP4A 1P4IL 3CMOL 1CD8A 2FHFA 3ARDD 1A7QL 5CEZE 4JAMB 1P7HL 2DYPD 1U91A 5KVDL 2FZ3B 3QFJE 4BFIA 3KHOA 4LASL 1R5WA 5F8QC 3VFSB 4OI8A 5EUKA 5TQ2L 4BA8A 4NKMA 2IAMB 1XGTB 1QVOB 3EFDL 2WK2A 4WI4A 1PQZB 1B2WL 4J3OC 1IGTA 1KC5L 1U58B 3WHXA 3OZ9H 3HA0A 5H8DA 1AJ7L 2WWMC 2X2YA 1YEKH 3KLAB 2MHAB 4KQ4H 3UC0H 4XPGH 4OCLC 1CLYL 2I5YH 5E2WL 5H35A 2PNDA 1MFAH 4XMPH 1N6UA 1KCSL 2VXVH 1ZLSL 2DLFH 5D6CB 5F3HB 3ALXA 4QCIA 4PJIF 5DC0A 1PGRB 4MYWB 2E7LA 3TN0D 4TSBL 3GDBA 4JGJA 4OZ4B 1FFQA 1RZJL 1B6DA 3E3QC 5GS2D 3QCTH 3LKPA 1NFDA 4K55A 5LAXA 2CR3A 1HH9A 1ZS8B 3ARBD 2B8OT 3VXME 2F5AL 3NGBB 2C3VA 3T3ME 4MNHB 2KBGA 3UJIL 4L9LC 2XWTB 3UTTE 4D9RD 2HTKD 1S7QA 2VSCA 3VWJB 4TNVF 4CMMB 3GSUB 4OCWH 5KSBF 3SDYH 3IF1A 3VXQB 5CS7A 3AS2A 3UEZA 1TVBB 4G9FB 4OM0L 2NY3D 5IMKB 3K4DA 4HWEH 3QYCA 1EFXD 1S7UB 3RGHA 4I4WB 3O3DA 1VCAA 4M1GH 3BGMA 4MJ6B 1FDLL 2IAMA 3RTQA 3PABB 3QQ9C 2ITCA 2EDFA 1Q1JL 1MREL 1EO8H 5DO2C 4L8DB 4KJQC 3S37H 1WT5C 3X3GH 3MO1B 2V9QA 4K23L 5FV1L 1ZVSA 3RWGB 3K1KC 5FHBH 2NY6B 4MZ3A 1JN6A 1I1RA 1SEQH 3BO8B 4OGZA 1RIUH 2QSCH 3NFNA 5ENWA 3DTXA 2DL2A 4PLNC 3V0WL 4HSQA 3VU2A 1IGML 4G8GD 2DWDA 1KN4H 2VR5A 2EICA 5ALBH 4P3WA 3DHMA 1MHCB 1Z2KA 4NQUA 3VA2C 3UTTA 4NFCA 5AEAA 4V2BA 2FATH 1YZZA 3F7YA 1IM9B 4N8CH 4WU7A 1KLGA 4BSVA 4LIQE 1ADQH 1NCBH 1ZANL 2R2CA 3CFJB 4YDKL 4NP4L 3W2DH 2VLRE 4IOSD 3FONA 4LEOB 5I1IH 3GK8L 2KQNA 5TF1H 3O6KH 5CFHA 3HI5L 1T83C 2ADIA 3HAEB 2AK1H 1MWAB 5FB8A 2DLTA 4XVUC 3RL2B 1HHGB 1A1OA 4P9HC 3MX0A 4BUHA 2BVEA 4WWKD 4MXQD 1F4XL 1AY1H 4GBXA 4X98B 3SOBL 3T1WA 1U8PB 3NOIA 2CKBB 4AIZA 3BDXA 4Y4HD 4GFTB 2Q86A 2QQKL 2JK5B 2VZ3A 2OSLB 3JTTB 1J18A 4IMLB 3RKPA 2GJ6A 4H1LH 2EZ0C 4M7KL 4PLOB 3PIQB 5L7XH 2W07A 1FHGA 2UYLA 4BQCA 1HDMA 4LLQB 4JQIL 4P2RB 1XGUB 3BAEL 5I18L 5A16A 4X6FA 1D5XA 3TFKC 1GSMA 2FIKB 5D7KD 1F4YH 3FTGA 2VABB 2B5IC 3PWNA 4XCEA 4DZ8B 1L6XA 5E2UH 1WWCA 2GTZB 3F6LA 5E56A 5JZ7D 2ESVA 5DD6A 3IKCB 4PP1C 4APQA 3SKNA 4XNXL 3T2NH 1T80A 3UDWA 4KZEH 1FN4B 1HEZB 1SM3H 4AL8H 5I1AA 2AERT 3KPLB 3NCCB 2K7QA 2R29L 2QKIA 3T0ED 3V0AC 3R0MA 4IBLT 3SGKC 4NZRH 4D0BA 3QDJB 2HLFC 3QFJA 3HNTL 1TNNA 5IOPA 3VFWB 2VUOA 4W6XB 4LDLB 1NBVH 4KTDL 4PGZA 3AAZB 1DQQA 4WI8A 1WFOA 4NRZB 4C4KO 3OB0H 5GQBA 2VKXA 1I3VA 4YE4L 2HT4D 4PJ8A 3RZCA 2Z4QA 1YEGH 4FXKA 1NGQL 3VD5A 3SY0B 1HXMB 2BVPB 4N0YL 2AXFB 2F8VA 4LPWA 4Y4KC 3FT2B 1N6QH 4Q7DA 4OFPA 3RDTD 4HS3B 1RZIA 1C5CH 2P48B 1FL6B 3WDHA 5LXGH 5HGDB 1SMAA 1T1WB 4KTEL 5EZOH 4NO0D 3K8MA 4Z7UB 3WFHA 4ODUB 4NNXB 4PREA 5JR1H 5ERWA 3MNZB 5F9OL 4PJ7B 4WW2B 4OZHB 4ZOCA 3SKNB 4N0UB 3QG7H 3WNLA 2AJYH 5DMJB 4X7FC 5FYKE 5B39G 2XZZA 4UDTB 2NR6D 2NXZB 3BW9B 3QNXB 3MLUL 4LCYB 4HV8B 5CEZD 1NDGA 3ARWA 4N8VA 4PJBB 2CDFA 5CKGA 2MPAH 2APBA 3MLYH 3ABZA 4PRIA 4HKZA 4PJIB 4X6BB 2EYSA 5TE4L 4WFFD 3P77A 4OCRL 2OX5A 5I8EB 1IC5L 5HHPA 1S7XB 2C3GA 4PRHD 3B2UD 4LOUD 4RWHA 4ETQA 4TUOB 3OPZL 3F6IA 3ZDYF 3LRGA 4EI5C 3PGDA 2E9IA 2UZIH 3G08A 4JFFE 1I9RH 4NOBA 4PJXF 4YHMH 2PCPA 2JJTC 4PB9H 1H3TA 1B4RA 5IVXE 4ZTOL 4JANA 4WU7B 4X8JB 4EIGB 1CICA 3ARED 5IB2B 4HXBL 3O6FB 3MOBH 3QXDA 3I6LD 1YPZB 1FYTB 1MUJB 3E6FA 3L7FB 4P46D 1NL0L 3BZFB 3V5KA 5JW4Q 4E5XA 5KSAA 3X14B 1W8OA 1FYTE 1XCQB 5HYJD 3DMMA 4IOIB 4QHNB 3VE0B 4OZFA 4ISVA 5D7LB 3QDME 4ZUSA 5J1SC 1PSKL 4OUUA 3HZMB 1EBAA 1PAMA 4PJGE 3D69A 4M7ZB 3LQMA 2CK0H 3D85A 3Q6GL 3DTXB 4MGXA 2H1PH 3LB6D 5HXMA 3T0EB 4X6CE 1AXSA 1XZ0B 1CIDA 1MCJA 4HUNB 3EOAA 4YHZH 2P7TA 1NCAH 1AO7B 3KNBB 3L7EA 2CDEA 1KJ3L 1EDQA 4UNTA 2JLLA 2CMRL 3NIGF 3BQUA 5DUBA 1LVEA 3TT3L 1G7IB 2X1PA 1CD9B 3I2CH 4H5SA 3V0VA 2GCYA 5J1TC 3V4VL 5JA8B 4R6UA 4XTRD 4OZFG 5B4MC 1YMME 5BVJB 3RI5F 1PG7X 3IDJB 1UACL 2GY5A 1ZSDB 3DVGA 3OMZA 5JHLH 3MJ8A 4BH8B 1ZTXH 3A6CL 4YXKH 3RVWD 1INDH 2FX9L 5DYOA 5F7WC 3S4SB 2VRAA 4NM4L 2EH7L 3SGDH 2XWBA 3SGKA 1JUFB 1S9YB 3QEGL 3QDGA 1G9NH 4KI1A 3MGOB 2VQUA 3RJDA 2OL3L 3SDAA 4U1JB 2I26N 4OGYL 1E4JA 1DFBH 2OK0L 5HHQB 5SWSD 15C8H 3VGGA 5C0GA 3SDXB 2IANB 2QSTA 4LIQH 1NC4D 2XY2A 2Z91B 3B9KB 1OGAE 4NO5B 4YAQA 3VFMA 3S34H 4PRHB 3DVNB 3ZTJG 2ZCHH 5C92A 4ERSL 5C0FA 4LLYA 1PX4A 1REIA 5FA4A 1KPRA 4ELKA 4NNXA 1EPFA 1KJVA 4JZJC 4Z9KB 2FGZA 2DKUA 1OPGL 4A6YB 1U3HA 4P9MH 3K2UL 4OJFH 3FO1B 1S8DB 4ODHH 1JRHL 4RRPA 5MERB 1YMMA 2F53E 4JFPB 3U79A 5BO1H 2CLVA 5D7JB 4Z0BH 2YD3A 4X4YB 1F3JA 2J8UB 4PRAA 3G5VB 4PG2A 3TBSA 1FYTD 1ZT7A 2GI7A 1RJLA 2VQTA 1FE8L 4MSWB 1Z3GL 2ITCB 5EUOA 2MQ3A 2VXSH 2Z4QB 3MRQA 3PWPA 4N5ED 2X4NA 3SDXA 5C0GB 1M71B 2BC4B 1HIMH 4OGAD 3WLBB 4PJAB 5DJAB 4DCQA 2IALB 4JZNA 4GBXC 4F7TB 3KYOB 3LS5L 4UZGA 4ONHA 2LU7A 4G9FA 3QO1A 4OQTL 5JHDB 4G8EA 4LGPB 4QHUB 4F7MB 5C9JB 4LLYB 2HAZA 1MCOH 1OP5H 4TTDC 2MQCA 2VAAB 4ZSOE 2HN7A 5I1EH 4PRIE 1EBPA 1OTUC 1N0LA 4HIIA 4R0LA 2AEIT 1I9IH 3FZUC 3K2MC 5SWZA 1CLOH 4X6EB 2OTPA 3TM6A 2GSGA 4NQCB 3IU3A 2F19L 1I3UA 4EUPG 1TENA 1SYVB 4X4ZA 3CGTA 3OKMA 3NABL 4BYHA 4YQXH 4OBSA 5GGSY 3MXWL 4RMTA 5I0DA 2B2XH 1KPUA 3H42H 5BZWA 1E4XH 4JDZB 2LTQC 3KWWA 5DK3A 4OD2A 2FIKA 3SO5A 5ITFA 2NY1B 3GJEA 3DMMC 3PWPE 3OKKB 1JWSB 3PGDB 4Y4FB 2FO4B 3R06A 4Q6YA 4PGDA 1CYGA 4WHTB 4X6EA 3U0TA 4P2YA 2OM5A 2GUOA 1GGCH 1R5IB 5GISH 3BZDA 3ESUF 5GZND 2A73A 1KCRH 1QLRA 2B0SL 4FZ8L 3PWVB 4C56E 2A6JB 1H5BC 2UUDK 1BQUA 4GT7A 3TVMD 3MBEC 3VFTB 5I1HH 1X44A 4IOIA 5DDHA 1Y6MR 1HHKA 2PYEA 3QPXL 4R4FL 5FGBC 5SWSB 2E8ZA 5E00A 3VGAC 3QRFM 2YPLE 4QKXB 2R8SH 4XP6H 3QEUB 2Y25A 1EUUA 4OZGB 3PP3H 2IF7A 2QADB 1ZT4B 4OLYH 4KVCL 1QFPA 3LDBB 2VDLH 3C08H 4L4VD 3VGFA 2GHWB 2Y5EA 2EYTA 2LU3A 2P5WB 4QRRE 2BSED 3MYJB 3DSFL 4PGCB 4TQEL 2IG2H 1R5IA 4MWFB 4RFOH 5C3TA 5I73B 5FM4A 4PLJC 4ZDHB 3QUZA 4E9LA 1MCKA 3T4AA 5D7JD 1LQSR 2VZOA 4M1DL 1C5DA 3VFTA 1RU9H 1N7ML 1CFSA 2PF6A 5BXFB 2BOCA 1G0DA 2Y36L 1NFDF 1PKQB 3EKCA 2HLAA 5HYJA 5TE7L 3PGFH 4LNRA 4JGUA 1RUMH 3AGVA 5KVMC 2Z93B 3O3BB 3F7RA 3UJTH 5H2BA 3DROB 2CLRB 4MQXC 3TZVA 1OAXH 1X3DA 4RGOH 1RK0B 2YKLL 5F7FA 5GRJH 1X5IA 4YPGA 5FO8B 5BS0D 1QUNA 5IROA 3T0XA 3SQBA 4MJ5B 3U0PA 4FTVA 1WICA 4ZPTA 2ZUQC 3GJFH 3GI9L 4G8IA 3U36B 1QFUL 1MRCL 1NUDA 2P8MB 2R0LH 4HJ0C 5IT2H 1MCPL 2XRAH 2DD8H 5KTEL 1N0XH 2XPGB 1EHAA 3NA9L 3VXRD 4OAWB 32C2A 3ARGA 4RMVA 4HV8A 2F54A 2I60H 1I8KB 1C16A 2EKSA 1ND0B 4G7VL 4FXLA 3VW3L 3UTZA 1KB5A 3VGEA 4DCQB 2B1HH 2F53A 4I18A 1KJ2L 3QCVH 2OJEA 3KXFA 5TDOA 4LCUA 1AC6A 4YPJA 3OKOA 4APQC 3CX5J 1FCGA 2QR0A 4RAHA 3RBGA 4UU9A 1A0QH 2VZ1A 1LGVA 2DQDL 2OJZH 5T5FH 4H20L 5E8NB 1F8TH 4PRAB 3Q2CA 3TJHC 5ICYB 1MY5A 3EZ8A 2XZAH 3N0PB 5E6ZA 1LNUB 2UVFA 5C09E 4HCRL 3TCLB 4L8SC 3SKUD 3EYUH 2HFEB 3UTQA 3O6LH 3FO1A 1Y6KR 4LEXH 4G9FE 4XP1H 5I17B 4LVHC 5GGVH 2YD1A 3MV9B 4NC0B 4JO4L 4YHOH 3WCYA 2MKWA 1A6WL 5E94B 4K3JH 4LLVA 1ZK9A 2IAMD 4UI2A 4Q0XL 3FQRB 2DWEA 4Z76B 4OSUH 3BN9D 3CDGA 5CUSH 4S1DC 5D71L 3VFGL 3ETBF 4MAUH 5J12B 4YBQC 1OSZB 5IOPB 4OZFB 1W0VB 1V3KA 4XCYB 4LU5L 3ROOA 3H7BB 2F54E 3LCYA 1S7UA 1I1AC 4L5FL 3S7GA 3WXVH 3C5ZD 1TQCB 3PWJB 1NCUA 4QY8B 5DK0B 1MLBA 4TVPL 5DMIL 3VWKD 5ESAA 8CGTA 4JDTL 1MHPH 2A0LC 2WUBL 3T0EE 1P7KB 4NJAL 4I1NB 3F58H 1FIGH 4JRXB 1NLBL 2IMNA 3DX9A 3VFRB 2JJUA 2AKRB 5IB1B 3OAYK 3F5WB 1NSNH 4RQQA 1UYWL 4HT1L 3SE9L 5I15H 4ISVB 3DXAA 1FNLA 5CWSA 4KVNH 3DVGB 1IC7L 5D7SL 1A9BA 4XHJD 4H88L 1KJ2A 3EJZD 4ZXBD 4TVPD 4YGAB 5AAWA 4FQXB 5CEZL 2FX7H 1BAFH 4F58H 1QFWL 5E9DE 2HH0H 1HILA 4OTXL 1FRGH 5D1XB 3D39A 3WIHH 3GMOB 4JHWH 4FNLL 4M7JH 3NVQA 4U6XB 3OWEA 4WFEE 4RAUB 5ABDE 3V7MA 3GFUA 5A2LH 3HUJB 4XI5D 1U36A 2V5TA 1F6FB 5JIKA 1N5YL 3MRHA 2ZPKH 3IKKA 1E4WH 4HDIA 5F21B 3MNZA 4AZ8A 4MDIA 3KYAA 3T4AB 2H6PA 1PEWA 4FFVC 4PRPA 4MNGE 2PR4H 4BH7B 1GHFH 4AMKL 4GH7B 2R56L 1N8ZB 3FCTA 1KTDB 4MD0A 4R90L 2DJSA 1A8JH 5FDWA 3BKYH 3NH7H 1KUMA 2HLAB 2A74B 3QIUB 1HK6A 2L4OA 3MJ9A 5K9JH 1JHTB 1BBDL 2Y5TA 4S1RL 4YXLL 5FYJH 3P9LA 2ZCLH 4OF6A 3O2VL 1G7LA 2A6IA 3P73B 4Y5YA 4DQOL 1IM9D 5DHXB 3QI9D 3S3PA 5HHXL 2CLZB 3PXHA 2C7UA 1QFWM 3WO4C 2YZ1A 3BGFB 4JFOA 3V9FA 3LQAC 1HHHB 3X17A 1IEBA 4IJ3C 2RQ8A 5K93A 4P23C 5CJQH 4Y4HB 3VXOB 5H94A 3S37X 3MV9D 3ARTA 3C60C 2AV1B 3REVA 4ONFH 4TYUA 1FZMA 1CDUA 1BMGA 3NPZB 3O4LA 2EO1A 1VACB 2PN5A 4P5TC 4BQ9A 1QTYT 4XXDB 1WWWX 1KBGL 1BM3H 3UBXG 1KIRB 4JFZH 1NLDL 4X6CF 1D9KC 3BYYA 3KR3L 1I7UA 4GXUN 5FYLH 1TLKA 1KNOA 1TCMA 3MBXH 3JVGA 3LSOA 3WIHA 4AEFA 4OKVB 1BEYH 4WO4B 4ZOBA 2CLRA 2Z31A 2E27L 1K5NB 3ZSTA 3EBAA 3OSKA 5K9KB 3QDJE 1LEKB 1MHEB 2D9QB 2FEEL 2R1WB 3R1GL 1TETL 3KYMA 4S11A 3W11D 2OSLA 2Y06H 3JTTA 4YFLF 1P2CB 5BW7C 4MA8L 4JRXD 1NGXB 2HJLB 2ICWJ 4RNRB 1BLNB 1UB5B 2YPKA 2BERA 4MD5B 3FL7A 5T5NF 5GJSH 1JWSA 2K1MA 4PG2C 3CH1B 4O2CB 3MNWA 1JPGA 5GS1C 1T1WA 4OCSH 3BPNB 4U4BA 1K6QL 2V9RA 3KPMA 3MJ9L 3MOQA 4JFHE 5E1HB 1OLZA 3SE4A 4WGVB 3V4PL 2G2RB 1N59A 3NFPA 4FQXD 3LKOA 1KB5H 2B39A 3RHWF 1DJSA 1KCKA 3QH3B 1EHNA 3QXTA 1OTTD 1FLTX 3QUXC 4MXQC 1JF6A 5F1SA 2VJXA 5F96L 3FO0L 5EO1B 4YHNB 4NQCA 4LLVB 3AAZA 1JIBA 3QIWA 4ODXB 4GG8A 5LGKA 4JM4H 2VDML 5C0IB 5AG9A 4O51A 3CC5B 2IADB 5J13C 3ZSSA 3TO4B 4ORGA 3CVHL 3GI8H 4PIRF 1I8IB 5A3IC 1GGIL 3QDJA 2EDQA 3SGEI 4G6JH 1LO2L 2AEPH 2KKQA 4HUWA 2DQUH 3HC3L 3LEYL 3EYSL 4OD1H 1QR1B 4JO2H 4G42B 3IB4A 3OR7B 1KJVB 1VGKB 5HHMB 1BVZA 5C6TH 1T22B 3ARBA 4JO1H 2X4SB 1CBVL 4HH9A 4IDJH 4UBDD 2VXQL 4P5MB 4QHMB 3WDIA 3U7WH 2IQ9H 4P2QD 5F1IB 3PWUB 2ARJA 5DEGA 1J8HB 4HH8A 5IMMA 3QA3B 4PP1D 3QIWB 1G7PB 4QRRB 4Y1AB 1OGTA 4P2RE 1T89A 3JWOH 1LK2A 1I9EA 2KUTA 2NY0C 2VXTL 2XQYG 5CJOL 2EIDA 5EU6D 5EUOF 2H6PB 1OAUL 3D39E 3ZTNH 4ALAH 1RD6A 5E2VH 3R8QA 3T0DA 3L3GB 3QDGD 3ISWA 5CP3H 5IGXL 4X0KA 4LPXA 1I7RB 2AJVL 1IGIH 2ZKHH 2BZDA 3MLZL 3GGWA 4IIQA 3SO3B 4DZBA 1P69B 4UUJB 5DRZB 4JR9L 3GSVA 2MJWA 4FTVD 1BHGA 1P4BH 4EUPH 4TPRH 3ARDA 4M5ZH 4U1KB 2HA1A 1WBXB 3RJQB 4LARH 4NPYB 4UV7H 4K9EC 4MAYD 3RUGF 2ZCKL 5EZJB 2F54B 5C09D 3SKJL 4HPYL 5I75B 4Q9QL 1KPUB 3HPLB 4M6AA 4Q2ZA 3LH2L 3A67H 1AGEA 3X12A 3Q5YA 1NMCC 3UO1L 1T7XA 2C3XA 3A6BL 3WFDL 5F7EL 5C2BL 4Y19E 3BISA 1M7IA 2H32A 2XOTA 1AI1L 4XAWL 4GLRH 4D8PA 1DVFB 4NHCL 4UV4L 3QQNA 5DFVD 5JIHA 1JNNL 3F12A 3IAPA 3CXHK 2DI7A 3GMLB 5ID0A 4PJ9B 1XIWB 3CXDL 4FQCL 1H3WM 5DSCA 1LO5B 4AK1A 3DRTB 5IWLA 4TRPL 4PJHF 3KLHC 3WS6C 3PWVA 1MELA 1QSED 3WL9B 5GZOD 4NQDB 3NCJL 1KCVH 1LO4L 2D7TL 3U0WH 4P23A 3R0NA 3CIQA 4QOKD 4WFED 5JDSB 4XHQA 1A7PL 1U8OA 2ARJQ 1FH5L 1JHTA 2Y5TB 3EOBA 5D5MB 4YBLC 3QFJB 1A1MA 1JUFA 1S9YA 1J9CT 1IGFH 1JVKA 1QLRB 5EC2B 5DUPH 4KK6D 2YZ8A 5IR1A 1G6RH 1E27B 3VXNB 2G75B 3HE7C 5CSBA 1QYGH 3A0OA 3BDBA 4L3EE 4F2MA 1DN2A 2M1KA 5IHZA 1F45A 1ZEAH 5AWNH 3W0WD 5IIEA 3RWJA 2I9TB 1DUYA 2HJLA 4UT9L 3N1PC 3CMGA 2Z31D 1S5IL 3MRBA 5HI4D 4E42B 1J8HD 3VFMB 1EEYA 2W38A 3G5ZA 4YK4B 3TP4A 4XC3H 4H1LB 5E6YA 1G0YR 5HYQB 5FFLA 3H9SB 1T6VN 3QDHA 3VDAA 4CAGA 1ZE3C 4QRRD 5F1OB 3N06B 4KV5F 4HLJA 5ESQB 4WCYL 4D0DA 3BWAA 4KKLD 4DOHE 5HYSA 5M94B 2P5EE 3I75A 1MRFL 4RQQB 1NCWL 1RFDH 1SBBA 1DLFL 5C70A 4DK6A 1U8KB 2W0PA 4WW2A 1G7MA 1GPOL 3CDYA 5CJ5A 4KXZI 1GXEA 4PRDB 4HGWA 5DRWA 1T22A 3ARBB 3H7LA 2IBBA 4MX7B 4WFGE 3TEUA 1HWGB 3MRLA 3U30C 4KUCF 2OR9L 2B4CL 2VLLB 3QUKB 3OKNA 5HVWA 2NY4D 5CSZB 4M5YH 4MDJA 2YC1A 1YNLL 4D9QD 2EEBA 3DPBA 3L5XH 4IRJC 3VDBA 3QA3A 3V5DA 1WWAX 4G9FD 1INQB 3ESVF 4LKXB 2D7QA 2O5ZH 2AQ3A 1K4CB 5F6HI 1GGBL 4ODXA 4NO3A 2M26A 5GGUB 1IGTB 1RJYB 3LQAH 5CMAB 5HBBA 1AHWB 4F9PC 1ETZB 4JE4B 5LGJA 4DKEL 2X4RA 3FKUS 2DQTL 3RWIB 1Z0NA 3ARRA 2ZJSL 4WFFE 3DV6B 4JAMA 5T3XD 1J87A 2FDBP 3RFZC 4G43B 4JRYD 3WLWC 2DQIH 5FCUH 1RZFL 1AQKH 1UM5L 1TVDA 4FMKA 2VLLA 2P5EA 2YK1H 4MMXC 4FXKB 3T0EA 1EZVX 1I9JH 4GG8B 4X7EC 3ZDXF 5I17A 3I84A 3RA7L 1WLHA 3CSBA 3CFCL 4OV5A 4DN3L 2ZNWA 3WSQL 3BH9A 4I5BA 2H3NB 2OQJA 5FK9B 4PB0L 4F33B 4MA1B 3VDCA 5E08L 1YYML 4NNPL 1JGEA 1TJIL 4LVOC 4IMKA 3S4SG 5C1MB 3OKNB 3EYFA 2VZSA 3WEXB 2FBJL 3GMMA 5E9DA 3DXAD 1X5KA 4LVNB 2EO9A 3QDMB 4K3DH 5FO7B 5I1GL 5CP3A 4OUOA 4BUGA 1KIPA 5JDJA 3QWOA 4K3EH 2FJHB 4YIQA 1ZHLA 4JY4A 2VL5A 3FOMB 5IFJB 1F58H 4DGVH 1DEDA 2A9ML 3IU4H 1Q9OB 3VD7A 2XWTA 5F9AC 1IZKA 3P4OB 3KPQA 5EORL 5EZIL 5F3BB 4ZD3H 1X6NA 2APWA 3WD5L 4MXWH 3NZ8B 2UWEE 3MRPA 4RDQG 2IJ0C 4TUOA 1XF4B 3MRFB 1TPXB 5I9QB 2Z31B 4ZUUB 1RMFL 1X5AA 4PRPE 5I1KL 1AKJB 1DBKL 2XZCL 1C5BL 5IB3B 1KOAA 4FABH 1O5DT 1ZWIB 3P0YL 4PBWD 4JFDB 4KZDL 4POUB 3RIAF 3KYMB 4NQVB 3KPSB 4U1SB 2KDGA 3DETC 5IHUL 4AY0A 3P40A 1FG9C 3LD8B 5J56B 1OY3B 1IM3B 4F9LC 3VFSA 5TQ0L 3PHSA 3HI6L 1A5FL 1WFUA 2X09A 4IOFD 3MQIA 4JDVA 1VFAB 4Z7NE 1U8NB 3ILPA 5ITBH 4XRCA 4ETYA 5HDOA 2R0WL 4OFKA 4PJBE 3DUUB 2GTWA 4JFDE 2DYPB 2EXWC 3VRIB 4EZMA 3FN0H 4L4JA 3WEXA 3GSWA 1CDJA 1HSAA 4M62H 5E00B 1CXIA 4D94A 1DQQB 4QOKE 3WL9A 3EDEA 1BBJB 5F44A 2DF3A 5LGHH 5DHVA 4UOW0 1M7DB 2ADGA 1AO7E 3GMLA 2BSTB 5CKAA 1G7LB 2QADD 3BP7A 4A6YA 2NX5A 4KU1A 4TSAL 3CLEH 4CW1B 5A16B 3WYRA 2ATPB 1GC1C 2FJFA 1FNEA 3BDYH 1BZ7A 1E6JH 5GZNC 1DZBA 3NN8A 3IETB 3RVXD 4XBGB 2VYRE 5CSZA 5JMRA 1N4XH 2BNQA 4I3RL 1CFBA 1R0AL 3P4NB 5AD0A 5ITFB 1E4KA 1EERB 1WZ1L 1I7RA 1NFDB 4PJBA 2VN4A 5EBMA 2W65B 5DTFA 5HYQA 2VDQH 5JMOC 1RIVH 2PTTA 3IDNB 5AYUL 3OKMB 2FJGB 4X99B 4YPGB 1IC4H 5I8EA 1IGCL 3EO0B 2BMKA 3GSUA 4FQ2L 3F7PC 1ES0B 4O00A 4K94H 3H7BA 1YECL 5E0QA 3MRRB 2XNAA 5J89A 4XCCL 3PWLA 4QTIL 1BVKA 5EZLA 3CFBB 3IFNH 1YA5A 3KYKL 4O9HL 2W9EH 3DX9B 3TBTB 3VFRA 4XXDA 3MLTA 2JJWA 4PTUB 1U42A 2XN9E 4Z7UA 3WFHB 5DT1H 2BNRD 4XGZB 2NY6D 1S7WA 5EU6A 2A6KA 4OBRA 2NY7L 1UVQA 4GRWF 2J8OA 1GZQB 1S7SA 2VDPH 1JPSL 3STLA 3ARGC 1FAKT 3B8SA 3HNVL 1T03L 2OMBA 2ZSVB 4IRZL 2Y07L 1FNEB 1RUQH 1MNUH 4UINL 1J1OH 1S7RA 4QXWA 5LJYH 1S9WA 1OGAA 4HIXH 4CNIB 4YDLC 3O4OB 4PJ7A 1UT9A 2BRRL 2WUCL 3IDYC 4JFPA 4JCLA 4A6YH 5BQ7A 1I4FB 1ZA6A 4GS7C 1UCBH 3W39A 1BIHA 2R69H 2PW2A 1OGAD 4KDVA 3WN5A 4MCYA 4NSKA 1RQ5A 4XAKD 5JUEL 3TBSB 3SDCB 1P7QB 2JB5L 4NZUH 5IBLD 4FQLH 1YY9D 1F6LL 4U6VH 2AP2A 5E24E 1DQDL 1OVZA 1I8IA 5L9DL 1A7OL 4LSTH 1U3HB 1VPOH 3V5HA 5FHAH 1S3KL 2E7CA 1XGQA 5I6XC 3QEUA 3GB7B 4LLWB 1AO7D 1UH2A 1X5FA 3DUHA 4U1SA 1I8MB 1MCCA 1FYTA 1MVUA 5EU6E 3EIFA 1VB9A 3HUJA 3H3PH 3LKRA 4DUXA 4NN7C 1OB1A 5C0DA 3PIQA 4OCMC 1FLRH 4L4TA 4DVRH 4WEBH 1UCTA 32C2B 5DUML 5LBSH 3KVQA 4I8DA 1PZUB 2J6EA 1AGFA 2A77H 3V6BR 1KN2L 3ARUA 3BPLB 3KPLA 5SX4H 1LE5B 4O5LH 2NW2A 1LD9B 4PJ7E 4CJ1A 1DQLL 2BSSA 1MIEH 1RAMA 4J6RH 1R3IL 1RURH 2IAMC 4HDIB 2HFGH 4OZIA 3OAUH 3MCLL 2IGFL 3L3HA 2PXYB 1QG3A 5GGRA 3C09B 1F6AA 4JG0H 4P2OD 3SCMB 1FORH 3GMMB 4BQ6A 1XGRA 3BFOA 3N50A 3B3IA 4OF5A 3U1SL 3DO7A 4QHLB 1NCDL 3ARZA 4EI6A 3MRGA 2WIMA 2W60B 4JVWA 1GGTA 3AB0C 5CIPB 1G7PA 3ZLQC 3QNYB 3OX8A 1I1AD 1YC8A 1V7MH 2VLRA 5C0DB 5DWUL 3THML 1VENA 3T0WA 4RGNE 5F88B 4PV8A 3BP7B 3DV4B 1QHOA 5C2UB 2ED9A 4QOKA 1U8QB 1LO0H 1NANH 2N7AA 3H9HB 5JXED 1YMMD 2Q8BL 3CK0H 1JTTA 4JFQA 1IILE 2E6PA 2WV3A 4BQ8A 5F6IC 4OLWL 1BQLH 4UT6L 4FN0A 3GMRA 4MNQB 4MA7H 1MVUB 1T3FA 3T65B 4QWWD 5I1DA 5ALCL 1AFVL 2FSEB 2ARWA 2CLVB 3RDTB 2NZ9D 1YJDH 4G6AC 1ROWA 3HPJB 4C54A 5GS2H 1JZ2A 4GAJH 4ZAKB 4LP5A 1OP3K 1FBIL 3EYQC 4LDEB 2A9NL 5JLZA 2C9AA 4KRNA 4YHPA 3TNMB 1WV7T 3FB7B 3RIFK 4HLZH 3QI9A 4DKFH 1WFNA 2PYEE 5DJ6A 5K9QI 1JNJA 1LK3H 1OWWA 4GG6E 1WBYB 1GVIA 5K9OB 3AM8A 1FC1A 1HOCB 1MFBL 4RFNC 2WAHA 2NXYC 3VXUB 4UB0L 2NXZD 3UYPA 5IHBA 1YMHB 5I74C 1DDHB 1DQJA 4GMTL 4JHAL 3HC4H 2GIYA 3TZVC 3FRPG 4Y1AE 3PGCB 5BJTA 1KPRB 4GRLB 3CFEB 3PUCA 4PJAE 1ZKAA 3CVIH 4RSVA 1KGCD 5J3HD 3I50H 2BCKB 1XCTB 1NEZG 4WV1B 5TDPA 4PRNB 5J7CC 4YAQB 3LN4B 1PZ5B 5ADPL 1RZKC 3IVKB 4O2CA 3UPRA 1E27A 4G80B 2R0KL 2HJKA 2IPKA 3C8KB 3IT8D 4R2GC 2VE6A 4JLRB 1EIBA 1L7IL 3PP4L 5FM8A 2BMKB 3KLAA 1M05B 1EVTC 1CICD 3GJEB 2VDOL 3RY6C 4FHBD 4NZTL 2RAMA 1DQJB 4QXGH 1QR4A 5JW5B 4Z7WE 3CSYA 3MUGA 3UYRL 4ZSOA 1QD0A 5BVPL 5CWSB 3UPAA 1AP2A 1R24B 2FD6H 4YHIB 1KB9K 2OQJB 4U7MA 3HZYB 4H8WH 2M2DA 2IWGA 3FQNB 3SKMA 4P5TD 3T3PE 3LKSA 3TWCL 3GMNA 4LCIH 1MIML 4KY1L 3SCMD 3C6SB 3A6OA 4GO6B 1MI5B 1MCWM 1FVCB 1MFEH 5D6CA 3MC0A 2V7NB 1IJ9A 1LP9E 3LQZA 4WTZA 1DANT 1G6RB 1EO7A 35C8H 3SDDA 2EDJA 2EDRA 3SKOA 1WC7A 4K7FB 3HC0B 4MHHG 4X83A 3WO3B 3SJVE 5BOZG 2PETA 4K7PL 1KJMB 5HY9B 1N5AA 3CDCA 1V3MA 2NYYC 4ZUTB 2HT3D 3FQRA 4NHUA 2AI0L 4RX4A 1CTNA 2Y7QA 1C1EL 1JZ3A 5DD0H 2D03L 1FPTL 3C9NB 1IAMA 2DOCA 5I71C 2GITB 4MNQD 4TVPE 4PD4K 3Q48A 4LHUA 1MFCH 2NPLX 3IF1B 4F3FA 2Y23A 3QWQB 1IAIL 4Z7WA 3G5YA 3V4UH 2ERJB 2QHRL 4KRPB 5DK2B 3G6DL 3IDXL 3ZYJA 5IVXA 4XPBL 5CILH 4KJWC 3MRGB 3GNML 1JGVH 1CTOA 3WJJA 4XNQA 4YC2C 4WUUA 4D8PB 4N1HB 4NSKB 2BXYA 4S1QL 4ZODA 3IDJA 4PGDB 5HYEA 1NFDE 4XNYL 5FCSH 2YD6A 1HSBA 4TSCL 1S9XA 4XPHH 2CDGA 3IRPX 3MLWH 5SWQA 4HZLB 2W65A 4HKJB 5DTFB 4Y4KB 4M3JA 4DZ8A 3L3IA 4X7TA 5GJTL 3EOTL 5K9KA 2FWOA 3BPCB 5IVNA 3GBNL 5EWIL 1F3RB 4LCYA 4XP4H 4WI5A 2IAND 2BOCB 1B0GB 3B9KD 1X5HA 4NYLB 2GAZB 3NPSC 5GGTH 5IB1A 3QO0A 3DGCR 1UWGL 3CMOH 3W9EB 4HULB 4LCWB 2DQEL 2D7MA 3LOWA 3TH3T 4F7PA 4ODSL 4U6XA 5D7IF 2BFVH 1D5BA 1X6LA 2QJDA 1H5BA 4M1CD 3NZHH 4RWYL 3ET9F 5TQ2H 5JXAH 3MXVH 3ARDC 1NFIA 4M43L 3EFDH 1C7SA 1PKQA 3OR6A 4X98A 1CQYA 2C1PA 2WBJB 2ZUVA 4MJID 5C0EB 5E6IB 1B3JA 5KVFL 5JHDA 4MNGB 4E42A 1QSFE 3VRJB 5L6YH 2XN9B 2J5LC 1BIIA 2ORBH 1EFXB 3AU1A 3B5TA 1PX3A 4CVXB 5I1LB 4JFFB 1UWEL 3HR5A 2NY5L 4WEMB 4PJFA 1QSEE 1XR8B 3O4LD 4QRQB 4OI7A 4FTVE 5BV7B 3ZYZA 4RZCB 4R0LB 4HKBB 1JF1A 3WNKA 4PJXB 1MAMH 5F1IA 5DHYA 1U93A 3HTLX 3HPJA 4KHTH 1BD2B 1AO7A 3MODH 5CZVH 5DGRA 4Z7OE 5I16A 5EU3A 2NY2C 3D3VA 3HZMA 5MP6H 4G8EB 1Q9KA 5DRXA 3ZDZE 2AEQL 2ESVD 5I1AB 2Z8WC 3DOSA 4Q9BA 3LS4H 2J88H 4OIBA 1MFNA 3FAXA 3GO1L 1UM6L 5EULV 3S9DB 1UEYA 1Q0XL 5HTSA 4O02L 3ECBB 1BIIB 4OM1L 3GSXA 3QPQC 2IADA 5EA0H 3DNKA 2GEEA 2DBLL 4PV9A 4KMQA 2R0ZH 2HTKC 1CFTB 2YA1A 3GBMH 2XKNB 1TCRA 3QQ4A 4WUKH 5HDQH 1QSFA 3ULUH 2EE2A 3P9MB 3JV4B 4YHYB 5HGBB 3FRUB 1I1FA 1OL0A 2C1PB 2WBJA 4R8WH 3RWCA 4QRTB 1FO0L 1Z9MA 1MVFA 2W1NA 5K9QG 5TFSH 3G9VA 1LD9A 5GGSA 3QQ9D 2DQFB 5E8NA 4Y2DA 1WSST 2DL9A 3TYFB 2AJSH 3JWDL 3KLHD 4F15C 4S2SA 4J23A 3HG1A 5GZOC 4RDQF 1P6FA 1BLNA 4BZ2H 3V0WH 4F37F 3IS1X 2FCBA 4NQEE 2AJXL 4QY8A 5DK0A 3HZVA 1J5OH 1OSPH 4NQXA 2PW1A 4YDKH 1MQ8A 3MLSH 5HPOA 3PNWA 4PJ5B 2NW3B 1L0XA 4N90E 4ODVL 4TULH 2ZUSA 5CEYA 4N90D 5HD8D 1QNZL 2XI9A 3RUGA 4D0CA 2GT9B 4CKVX 1U6AH 4QO1A 2RCSH 4GJTB 3T77A 3QWOB 4G43A 4ZUVA 5I8OL 4GQ9L 3FT4B 1TNMA 2NNAB 1NGWB 4XVUD 3C9NA 2ADIB 3J7HA 4KROC 3MUY1 1M71A 1VEPA 3HMXA 4I0PB 2DQGH 3QDJD 3FO2B 3RTQD 4HJJH 3T3PF 3D18B 4M6OL 1SY6L 4JREC 3EFFA 2P45B 5L7XL 4HIEB 2AABH 2XN9D 5DQDL 4G9DB 3BMWA 3E6HA 3ZYOA 3HG1E 4RIRB 5AYQA 3I9GH 1PEZA 2H26A 5IV2B 3TPUB 2X4SA 7FABL 4HUVA 1F4YL 1FNGA 4MVBD 5C0JB 3FFDB 5JW3H 2MKLC 1JGLH 1DBBL 5DGQA 5E2UL 5L2JA 1C7TA 4KHXH 1K4DB 2H2SD 3QCUH 3W9EA 3S35H 4MDIB 1U9KA 2ICWI 2V17L 5AZEL 4UT7H 4K7PX 2IFFL 5F89A 4KMLB 4NJ9L 1S7QB 1P84J 1ZHNB 1J0KA 1M6OB 5IKCA 3BWAB 4EEEA 4ENEC 4J4PD 2VN7A 2WNGA 1EHLH 2R29H 1A14H 4X9GA 1NEZA 2FEDD 5C0ND 3T1FA 4CVZA 5KSBE 4JPVL 4KJPD 4YDIL 1YQ2A 3Q5TA 4HUUA 2ATKB 4JFFA 1SBSH 1A6VL 1L9NA 5ELIA 5CCKH 5KJRH 3OKKA 1EEYB 3G5ZB 4OT1L 4EN3B 4RGNB 5KS9F 5C3LD 4Z7UF 4H0GA 3CPLA 5JQ6L 4JG1L 3SPVB 3VWJA 2OZ4H 4MDJB 4KTDH 5I2IB 4L4TB 1BZ9A 5DQJB 4U0RB 3MNWB 3JBG7 2ITDA 4GG6B 5ANMA 4JB9H 3LMJL 2CH8A 3GRWL 3NFSL 4WHCA 1L7TH 2ED7A 3C6LB 4NWUH 4RISH 4XZUB 4LMQE 3CDGB 1ONQB 1N6QL 3VXPB 2GCYB 4LAQL 2IPKB 1G9EA 1I1CA 4CADB 4GSDL 2RGSA 1P2CA 3UTSD 1DCLA 5EIIA 5I19L 1I3GL 2OTWA 3OF6D 4KI5E 5D96B 1SY6A 4GAGH 4X80H 3ZE1E 3KHQA 4RGMC 2ZUTA 1T5XA 4MQ7B 4RX4D 5DC4B 4FQIH 1LP9B 3S97C 4JFHD 1NCCL 5DD1L 4BSVB 5D8JL 1SJXA 2LTQB 1RJLB 1BOYA 4L9LA 4JFDD 5D1QC 3TV3H 1ITBB 3KPSD 3OGCA 2NY1C 1N3NB 2HTLD 3RI5K 3I6GB 2XA8H 3B9VA 5I8CB 4Y4FC 3EJYC 3U4BL 2PTUA 4XMLH 4NQED 1DP0A 3C5ZB 5C6WH 4CN6A 3AUVA 5FKAB 4Y19A 3BD4A 3S35X 2A6DB 4WEUD 4EDWL 2W9DL 5I1CL 4JGMA 3D85D 3D25A 1LO3L 3E8UL 1Y0LA 4JKMA 3LEVH 3DVNA 1FNAA 3RZWA 1A2YA 1MWAH 2DQJH 2CUIA 4M6NH 3KPMB 3B83A 1D5IL 1AP2B 3QXAB 3UX9B 4RZCA 4ZAKA 4PJAA 5DJAA 1HH9B 4AEEA 5CD3B 1AD0B 4PS4H 2YPKB 5CHNA 2ADFH 4Z7OF 3O8XC 4OZGF 1CLZL 4GMSL 1MPAH 2Q8AL 1N3NA 4WWID 3TCXA 3L1OL 2PTVA 4ZNEE 2PO6A 2J3SA 4LRNL 1CWVA 2N4IA 3VXQA 2OI9B 2NW3A 1EEZA 1QSFD 3IJSA 3TA3D 2BDNL 4OLZH 4AH2B 1A6UL 4G6KH 5IVZB 1HILB 3O2DL 3LRHA 2O5XH 5EU6B 1MJ7L 4EBQL 2EXWD 5FUZL 1EEUA 4X7SL 1XGUA 1F13A 4MD5A 4BSJA 1KT2B 43C9A 2P8LB 1ED3B 1QQDB 1IVLA 3CFEA 1IAOA 4YH6A 5BV7H 4FA8A 5SWZD 3RUGE 4NKOB 4HPOH 2OL3A 2X9WA 2PYFB 5DK2A 3KPRB 1U8IB 3D25B 1CFQB 5C9JA 5FO7A 1NCAL 1MJJA 4WFHD 1YYLH 3U46B 1HYSD 1QLEH 2CMRH 5BQ7B 3RVXC 1KLGB 1JGUH 3N1QC 5HDLA 4ZFGH 4CVWA 1P6AB 2AV1A 1J8HA 4QF1A 3CSPA 2APXA 5DMGC 3HFML 3SDXE 3O45A 3DXAE 3V52H 4XNMB 1SQ2N 4PJCE 3F7QA 1PG7W 4GRWB 1RI8A 1A47A 3IDIB 3TJEL 4R3SB 4DGIH 4I0KA 5I30H 3LIZH 2EDWA 3O3UN 2BOBA 3SDAC 5D6DC 1CI5A 4OGXH 2CIIA 4AQ1B 4UOJA 3B2VL 2EDNA 4FRWA 4J3TA 3ZT5A 4KI5C 5JHLL 3MJ6A 2HMIC 4XTRC 3RPKA 3DX8B 4YEFA 1HXYB 5D1ZC 4B50A 3QHFL 2QSVA 5J8OA 3TT1H 3SDCA 3FT3B 1R24A 2NQCA 3RVWC 4NQDD 4M93B 3D87B 1U8HB 4Q2ZB 2IANA 1RZGA 2F15A 4Q9RL 4AEHH 1F90H 1ZLUK 3O2WH 4WFHE 2Q20A 4PRBB 4QOKB 1FFPA 1H0DB 1RUPL 2FB4L 1DN0A 2XZQH 4WJ5A 4M4RA 1QRND 2R2BB 3RAJH 3SCMA 2X4OA 3JSSA 1FSKC 3VFPB 2YWYA 4MNGA 2NY6C 1Q0YL 1WEJH 1QRNE 4CADA 3STZB 3VXRE 5HGGS 1EHXA 3ARGD 1BFVH 4WDIB 2FX8H 4ODWB 5DA0B 1B0RB 1J8HE 1MH5A 2XPGA 4HKBA 5DEFA 2EC9U 1VGEL 3FMGH 4YX2L 3P0VL 1WCBB 4ODHL 4ZPVA 2F5BL 1I3RA 4LLDA 5IW6A 4U1HA 4OLUH 3MRHB 3W82A 3KYNA 4GAYB 1H15A 2VC2L 2HVJA 2BSRB 2A1WH 1QBLL 1QSFB 4U1NB 1B2WH 3LHPH 5IBLC 2P24B 1F02I 1KLUB 4KQ3H 2VOTA 1G7HB 3L5HA 3BRGC 5CIPH 4QLRA 3D1MC 3LRSA 3MMEB 3WE6A 3NAAH 4F9LA 4PJFE 3LS5H 2R4RL 2I5YL 4JVPA 4EQ2A 4OQTH 5EO0B 4ODWA 4DEPC 1KULA 3QHZH 1ZHLB 2O5YL 4DVBB 1KCSH 3MV7D 5B8CC 4WU5B 4MJ5A 4XMKL 5AG8A 2DLGA 4GBXD 4DAGL 1DR9A 5T3XH 1RIHL 3ES6A 4ZAKD 3DROA 1PLGL 2G60L 1AXTL 2NNAA 4U6YB 5EC2A 3L3IB 4X7TB 3EOYG 1YEFH 3KJ6H 5C07E 1K3IA 3LPFA 3MRMA 4BJLA 2EEDA 4Z7NF 4EXKA 2F19H 4PJ5E 1IKNC 3PL6D 1NAMA 4HK3J 4XNUH 2CSPA 5C86A 2X1WL 2NTSP 4GUPB 4K71B 4XPFH 3KG5A 1QSVA 3NABH 1NGPL 1UZ8A 2DLHA 4U1MB 3OKOB 1F4WH 1YN6B 5CD3A 2B2XL 3H42L 1OAYL 3VFUA 1FZMB 3V7AE 2A6KB 1DBJH 2N56A 2BVUA 1GOGA 1RK1A 5J4MA 5GRZA 2EE9A 5F9JA 5F7DB 1JV5A 4I3GA 2P5WD 1C16B 2EKSB 4I77H 2R1YB 1MHHB 3HCVB 4IS6B 3AMKA 1B4JL 1UB6B 1X9QA 1P5VA 4Y5YC 2LAAA 4HMDA 3WXWH 3QIUC 3MLXH 4XBEL 3QAZC 5HHOB 3DMMD 2DQHL 5SV3A 1GGCL 2NY3C 3EYVB 3W39B 1D9KA 1WQVT 3HS0B 5KSAD 1R3JB 1WTGT 1CG9B 2P8LA 5BZDA 4DVBA 3MA9L 1MCLA 4G7YH 2CGRL 4P3CH 3IFPA 3RP1A 1ACZA 1MEXL 1OAZH 5DZLA 1RIUL 1ND0A 3WO4B 1CICB 4MAYB 4Y5XB 5D6DA 1VADB 1WJ3A 3G6JF 1KN4L 1B88A 1EJOL 3S4SA 2W60A 3PHOB 4G6AD 1R3KA 2F74A 4M8VA 1JWMB 1K8DB 1PZ5A 4P3DA 1BJ1H 1F5WA 1MJJB 1JPST 1MFDH 4P9HL 5D70L 3DSNA 2AKRA 1CK0H 5FA3B 4X4XB 4ELMF 1HCVA 3T1FB 4LSUH 1IAKB 3M1BB 3MNVB 4K9EH 3DSFH 1AGDB 4YDJA 1BFTA 3FOLB 4BFBD 1R5WB 5D2NE 3TIDB 4U33A 1AY1L 5L2KD 2P8PB 2NXZC 1IQWL 1ZAGA 2XKNA 5T1KD 5F89B 4FFWD 3QUZC 5ACMA 4PJ9D 1Q72H 1V7NH 3OJDA 3I02A 4YBHA 3T08A 2EDOA 4PLJD 1R3LA 2GY7B 3GHBH 3P9MA 4XX1G 5D7LA 3UTSE 4JZNB 5E1AA 2GFBA 1QSEB 2BVQA 1FGVL 5ERWB 5ID1A 3VJ6A 4FXGB 5KVGH 3JWNC 4NRYB 5DD3L 3BE1H 1FFRA 2XTJC 3WNPA 5I18H 2EE6A 5EBGA 5IM7A 5GRJL 4M6MH 2PUQT 2YD7A 5HYFA 2FSEA 3QFJD 3BGAA 4ORGB 4OUUB 5HI3C 4HD9A 1ULVA 1FL3A 2HWZH 5LCVL 2LQRA 1WAAE 4F7TA 2R2BA 3LY6A 3O6FC 1FFNB 25C8L 2VH5H 4HUWB 4N0UE 5E4IA 3BHBB 3T2NL 2C3HA 4B7LA 5KTEH 3VG9B 1XF2A 1RZKH 3IJYB 4J8RB 2R4SH 3JTSB 2YUZA 1A3LL 1VEMA 4FQHB 4NQVA 1E4KC 3BJLA 4L8BB 4P59L 1H8NA 1HOCA 3I75B 5JIPA 1TTGA 5E6IA 5DD6B 5HVGB 3DLQR 2O26U 4KAQH 3H2WA 1J05A 1XF4A 3I3DA 3MRFA 3TO4C 2QEJA 2OS7A 4MQ7A 3SE8L 3RX7A 1IFHH 4X9HA 2X70B 5E2TL 1ADQA 3MREA 4J3VA 1JHLH 4JFDA 3G5XB 4LQ1A 5DMYA 4JM2C 3QJFB 4WVRA 2FL5B 5EBMB 1NAKH 4APQD 1AGBA 2XZAL 2AJZA 1X5GA 5EN2B 3O6LL 3PHQB 4UTBL 5IEKA 2P42B 2VWEE 4UU9B 1LEKA 1CF8H 1UADC 4HGWB 4PTTB 4KMTH 3TBVB 1ES0A 1C5CL 1U8PA 2A83B 4JPKL 4ZXBB 5FO9A 3UBXA 3SE3A 4KTEH 3PGCA 1YJDC 3LN5B 4XAKE 2WBJD 4MJIB 5ACZB 4Z7VE 5F9DC 1I7UB 4N0UA 2NY0B 1QPPA 1HHIA 4Y4KD 1GH7A 4QRSA 1AD9B 3Q0HA 1FVDA 5C07A 1MJ8L 5CIPA 3VXUE 3JUYA 4MB5A 4O58H 1NDGB 4DW2L 1TVHA 2X4NB 4HC1H 4OZIE 3QG7L 1F2QA 3ALWA 4KJWD 2HG5A 2R2EB 3RY5A 1YEDA 1FAIH 2EDTA 5DMIH 2VXUH 5EOCH 3MCG1 5E8DL 4OZIB 1V3LA 2OYPA 4L8CB 3VCLB 2MPAL 5IMLB 3MOAH 4YGVA 3RVTD 3C8HA 4R4BB 4OCRH 2V5MA 4B41A 2CKBL 4LSRL 2B1AH 5L2KB 4C58B 3HUJF 4POZC 3MREB 3BKJL 5I15L 4JPWH 3S36H 1CU4L 4UTAL 1RVFL 3QIBB 4BKLB 5HPMA 2I24N 2XICA 5KAQF 4D9LH 2HKHL 1KSRA 4XCFL 2Y1VA 4YHML 3O4LE 3PQYA 3NGBC 1OAKL 1QFWH 1G9MC 5DZOA 4LHUG 2CR6A 4NCDA 3QI9B 4XCEB 2CO7B 1OCWH 4P46A 3OKYA 3X14A 1A22B 3MRQB 3PWPB 4JHWL 1MI5A 1KB9J 4Z7VA 2F58H 3D9AH 1TVBA 1EMTH 2IQAA 3EO9H 4PTUA 3NCYP 2ZOKB 3HE6D 2Z8RA 3O81A 3Q3GA 1JMZA 5T1MB 2ZPKL 3SDDB 1N26A 4CU8A 1P7QA 1BVKB 4XC1H 1A6TA 2JB6A 3DYPA 4ZQKA 1S78D 3Q6FA 2PR4L 2FEEI 1GHFL 4AMKH 2X4UB 5IFJA 1T1YA 1AE6H 4UIKH 3QO0B 2DQCH 4I18B 5KSUA 4FFVD 1S9WB 4QHKI 2SEBB 1TZHB 4NO2B 4I48B 8FABA 5MI0C 1T2QH 5HGBA 2IBGA 5DFTA 4LLDB 4ZUUA 4Z7QE 4PYGA 1NMAH 3MV01 3STBA 2P8PA 3W5NA 2PW1B 4U2ZA 3IJSB 4DZBB 5D5ME 5EO9B 3RGVD 1AIFA 4FZEL 1CZ8H 3BIKB 1OB1B 4R9HA 1MH5B 3HHRB 3WFBL 3WKMH 1WBXA 9CGTA 3HMWH 4S1SL 3ROLB 2AXHA 5E4EC 4Y4FA 2JTDA 1OARL 4JFEB 4NO0A 1XGYL 2ZG2A 4P2OB 1T1XB 1MWAA 5IJVB 5IKCB 2EYSB 2OMNA 1AR1C 2X4QB 1OLLA 4YK4C 4JQVC 4ONFL 5GRUH 2HT2C 4NBZB 4FQPA 2VR9A 4P23D 4HF5L 5GS0D 4L4TE 4XCYA 3WHE0 1KBGH 3UTTB 2AXFA 4ZOEA 1DBAL 4X7CC 5D7IA 1ZT4A 3VXMB 1GZPA 2E3VA 4NM4H 5IBUG 2E27H 1IAIM 3IAQA 5GGUA 1P53A 4N8PA 3LZFH 5BMFH 1CFVL 1WISA 3QFDA 4FQJH 2IANE 3NCMA 1HINL 4OGYH 5GSRB 1LO5A 1BJ8A 3N1FC 5TPWL 1BQSA 5DJ0A 15C8L 3X12B 1ZVYA 2A73B 1OT1A 1JV5B 4LIQL 3W11C 4KDTA 1T0NB 4DKDC 3E0GA 1EV2E 3BO8A 1KTLA 1UWXH 2V5YA 4LPUA 3AM8C 4OCSL 1Q9WA 5IQ7H 5CJ8A 4G8GB 3WJLC 1UQSA 5HHQA 1MCRA 5EC1B 1K9TA 5J57B 1GZPB 3V4PH 1JYWA 3WV0A 5EZLB 1QFOA 3QUMH 4NO5A 2DIJA 5C9KA 1ZMYA 2YD2A 4QF1B 5IESH 4EN3D 3M07A 1GC1H 3TO2A 3WFCH 1KCLA 5I66A 2FNBA 4GXVL 3R8BB 1SVZA 5FUOL 3LPWA 1RUKL 4K3HA 3KXFB 1IGJB 1J1XL 4JN1H 1S7WB 3X3FL 4LQFH 3H6JA 5EOQH 2CD0A 1XAUA 4WUUE 5T3ZH 4LPYA 2QQNL 3AXLA 1QEWB 2MTPA 3MGTA 4JLRA 3UP1A 3HS0A 5HYSG 2WLYA 3CFBA 3ULSB 4QHLA 4HBCL 1LO2H 4KUCD 1IKNA 2YPVL 2R2EA 3GBLA 3LEYH 3VG0H 1Q9OA 3BKML 2P5ED 4M48L 1XCTA 4WV1A 5CINH 5TDPB 3WJLA 5L8LB 1KIUA 4HS3A 1UZ6F 2LV4A 4LVOB 4PLKD 5AZ2H 5IEHA 5A2JH 4IDJL 4K8RC 3ILQC 1DSFL 2VXQH 4ONHB 5E99H 1MJUH 4U1HB 3FQTA 1T0MB 4Y1AA 1CR9H 4G3YH 1J0IA 3TIEB 2XQBL 5J6GB 4X4MA 4PJGB 5D2NC 3EJJX 3RGVB 4JVUA 4UILL 1OGAB 1UXWB 1INEH 5F7LB 4NNYA 4HIIB 2RBLA 3L3JB 2DKMA 3VXOA 1HWHB 1XT5A 4CN1A 5F7UA 1FZJB 3V6ZA 4EDXA 2X10A 3O11A 1P9MA 3IGAB 4HUKB 1FL5B 5EU4A 1T7WA 3HNSH 1DVFD 1AJ7H 3INUH 1IGJA 1QP1A 4HMEA 4XPGL 2FHCA 2B4CC 1CD1A 4NHUB 2OR8A 3FJTA 1QSEA 4JR9H 4B0MM 2ED8A 3L3DB 4EI5B 4F33A 4TPRL 1T20B 3O41B 5KN5A 2GITA 1BBJA 2MCG1 1IT9H 1FIEA 3GSNH 4TSBH 2R23B 1YEJL 5MERA 4G5ZH 5D1XA 2DTSA 3D3VE 4L8SB 3ZDZF 1DQMH 2D0HA 1T66C 3CFKB 2AXJA 3M8OL 4TUKL 4YDVB 2F5AH 4NPYA 3ZKND 3CZJA 5CZXD 3MO1A 4HUXA 3D3VB 5FEBA 4H25A 2C1OA 1SJHB 2VLRD 4P4KC 5T1DH 4R7DB 2I9LA 1S7VB 4KFZC 4OCWL 2V7NA 1H3PH 4YHIA 1VERA 4KVCH 3HMXH 3P77B 3TVMC 4Z77A 4OM0H 3C08L 3SJVA 3QUYC 2YD5A 4XAWH 1ETZA 5D5MF 3K3QA 4XVTH 4JKKA 2YXMA 3RU8H 4AIZB 4IRJA 3EJYD 4M7ZC 1I7TA 1UZ6E 4KKCD 3JV6B 4XZUA 4XWOD 5JPMA 4M1GL 1WTLA 1BFOA 1KG0B 4QCIB 2JIXA 1XF5A 4LSVL 5JORA 5DFVC 1KJ2B 2A83A 4ZXBA 3QULA 2R2HB 4G6FB 2Q7YA 1G84A 1EO8L 4N0CD 4YHLL 3L6FB 3GKWL 4GKZA 2X4UA 4HLZG 3BZEA 1VADA 5F7MC 1QO3B 1LO4H 1RU9L 2D7TH 1CE1L 5D7IE 5FHBL 5JNYB 5GS0H 1UENA 4H0HB 4NO2A 1NBYB 2HKFL 4OLXL 5SV4A 4I5BB 1M4KA 2QSCL 2W9LA 4YIQB 4ETQB 3G6JA 1HXYA 1K85A 1NMBL 2DMKA 3S6CA 1KEGL 1VFBA 4NM8H 2JF1A 1WGOA 3GJFB 3WUWG 4RMSA 5J11B 1IEHA 4Y19D 2V7HA 4RAVB 2P5EB 3B5HA 4UQ3B 4LGRB 3ARFA 4E0RA 2H2PC 4KJYB 1CN4A 1QFHA 1YEEH 3KPRD 4WGWB 2A6IB 3GK8H 5TF1L 1KJMA 5HY9A 2R0LL 5IT2L 5DHVB 5LQBH 5CGMA 4FFZL 1HQRB 4DN4H 1S5IH 4PJEE 5CD5D 5EPMB 1FC2D 3QIUA 3TYGL 1N64L 1TZGL 3NCBB 3IDMA 1A6PA 1OM3L 3FO2A 1CD0A 3EW3B 3BD3A 4MJ2A 3ZE1F 4R26L 5CP7A 4LCUB 2YUVA 5HI4C 5I8KH 1D6VL 2DI9A 4Y5VA 3ZTJH 1TZIA 4JKWA 4PRPB 3PXJA 5E5MB 4FP8H 1HEZA 3VXTB 2OBGA 3ARGB 3SDXF 3ZMRA 4FFYL 1G7QB 4AG4H 4OFYA 1U3ZA 4KKLC 5B3JE 1JFQH 3X11A 4JQIH 2Z91A 3KPNA 1H3VA 3P9WB 1YN7A 3C2AL 1U92B 4I0CC 2HFTA 3CSYB 3VFNA 3IDYB 1UA6H 3FQTB 6FABH 4YXHL 1VFAA 2QHLA 4IHOB 2X1QA 5KVEL 4YZFE 3CLFL 5JQHC 1CDBA 4K3JL 4C56B 1CGSL 3TJHD 1NGZA 5FDWB 4ONOA 3VFGH 3RL1B 2CPCA 4OCYH 4OQ1A 1BP3B 4QXUL 5D93C 4MQTB 3BMVA 1AXIB 4XVSL 2MSPA 4R4NC 43CAA 4X4ME 2VLRB 4XWGL 2D7NA 3ZZ1A 1F00I 2G5BA 2YMXH 3MV7B 4JRXA 4P5TB 5KSBA 3AY4A 5F72S 5D1ZD 3DECA 2LU4A 2HJFB 3HZYA 1A1OB 1YN7B 2JELH 3ZDXE 4BSWA 4DK3A 4BH8A 1DBMH 1HHJA 4NJAH 5EN2A 1F6AB 3TF7C 4NN7B 5DVNA 3ZO0A 5C07D 1FZKA 3ZE0E 1AKJD 4DGYH 5IFHH 4OB5L 2AK4E 2P49B 2AEWA 2ATPA 4JKPH 3ARFC 3RWHB 5HGHB 2GJJA 4U49A 3BPLC 2PTTB 4HXAH 5E7FA 5KAQG 5MHSD 2N1KA 5IFAL 1LDPL 4L8SA 2EIZB 5T33L 5D7SH 4ZS6D 5J06A 2WINA 4X9FA 2RFXB 4ZUWA 1MRDL 4JN2A 4LKCA 3M17B 5EUKB 3BH8A 2EEAA 3PQYE 4DUVA 3PHQA 3FB6B 1MQKL 3G5VA 4XPAH 5EZOL 2LABA 1EGJA 3MTRA 3IDGB 3F8UB 3L3KB 3QUXA 4LSPL 2FJFB 1OQXA 1MI5E 2D0FA 5HJ3A 3TO4A 4M7JL 4LHUB 3ZT6A 4E41D 5E9DD 5C0RH 1F58L 4DGVL 4Y19B 3UROR 2Q3AA 4KPHH 1A7RL 2DMBA 3O3DB 4MJ6A 3RTQB 4UDUA 5EOTA 1LEIB 1P5UA 1CGTA 1S9VB 4M9OA 3V6ZB 1UJ3B 5DI8A 2BNQE 2YA0A 1I8LA 1S7RB 1EX0A 1Q9LA 5TE4H 1PD6A 3OJDB 4RAUA 3ULVL 3PV6A 4XI5C 4ZFFA 3P0YH 1IM3A 3TNNA 4PJHE 2Q87A 1A1NB 1F11B 3SQOH 3H3KA 1VSCA 5DLMH 2KPNA 1R3HA 4PRPD 4BH7A 1KG0A 4NFBA 5FYKH 2GTWB 1IEAA 3RNKA 5J9PB 2WBKA 3VA6A 4ZTOH 3BXNB 1JF5A 1XH3A 3PJSA 5TE6L 1JMXA 4Z7VF 2BJML 2P46B 2LVCA 2PO6C 1N2RA 4N9GA 1A9EA 1A4JA 4JQXC 4KK8D 4YDJB 1QLFA 2AJUH 3M17A 4PRNA 3NA4A 4N1CA 5L88H 5EUOE 2NXYB 1YUHB 1RZ7L 2BVYA 1OTSD 1TDQA 5LKNA 4P57A 4J7RA 3LKRB 4QRPD 1U2CA 4O2FA 3S5LG 1PSKH 3MUHL 3D6GA 5LGHL 4DTGL 3W5MA 2IEPA 1ZT1A 2OL3B 4L4TD 2QQLH 1EGJL 4NN6B 3NBNA 2W0FB 3E1F1 3F7YB 1J11A 3CZFB 4PJEA 3FOLA 3ULSA 2XY1A 3C6LD 2R9HD 5BVJA 5KSAC 2ZSWB 1J12A 4HWBH 5IHLB 3E2HC 1FQ9C 4HFUH 3DIFA 4JY6A 1ERNA 5JLZB 5L2JB 1A7NL 4YUEH 3VH8A 3EDJA 2E9WA 1FL5A 1SMOA 4X7DC 3FONB 4LEOA 3KPPB 4V1DD 3HCVA 1KEMH 4J3SA 2GSIA 1T3FB 3T65A 3RX5A 5BXFA 4Y2DC 1NAMB 4IEFB 1OW0C 3KLDA 4XVJL 1UXWA 4DFIA 2DN7A 5ANME 2P44B 2D31B 1KELH 1YN6A 1KTDA 4YHPB 3DI3B 3C5JA 4K94L 1U41A 1UACH 5BS0E 4LSSL 5FKPB 1YEIH 1ZT7B 1HKLH 4UQ2A 3BESR 4PJEF 5CJXC 1INDL 2FX9H 5C0FB 4R3SA 5D7KE 3C87A 3SBWC 4L8CA 2EH7H 1T2XA 4XP5H 4APQB 4QRPE 1GZQA 1S7SB 2IH3A 4NFDA 1Z9LA 4NNYB 1L9MA 1TJHH 4F8QA 4JFXA 3MRRA 3GI8L 1YEHH 2DTMH 4MX7A 2IPTH 4GQPH 3DVIA 2UZXB 2OK0H 5CSGA 2AEPL 3MRNA 3OHXA 3HC3H 2Q6WA 1R5VB 4NYLA 2G9HA 3Q1SL 3BD5A 4Y8DC 5HI5C 1OP9A 5JW4R 5C08B 3B9AA 4XP9H 4ZSOB 1CBVH 3GHEH 4NGHH 5FYLE 3VWKA 2Z93A 3VXRA 1SVCP 4G80A 4KC3B 1D5BB 5IW1B 1CL7L 5IBTH 1OPGH 2XYCA 3TN0B 3WN5C 1P4IH 4P9ML 1YQVH 5BZDB 4LFHG 2XWBB 5F93C 2PXYD 1CXHA 4Z0BL 3U2SA 1A7QH 1TQCC 1OW0A 5SWZB 4BZ1L 3UPRB 3VGBA 1KYOK 1OAUH 3MJ7A 2EDEA 1XGPA 4LPTA 1Z3GH 3ZYIA 1S3KH 3PHOA 1ZVHA 4HUVB 3L9RA 2VDKH 4KKAD 2R2HA 3BP4A 4WHYH 3RIFF 4ZNCD 1YEKL 1KC5H 3GMQB 4BELD 4GRLA 3BI9X 3NIFF 2BSRA 3VRLE 1HHHA 1PBYA 1K4DA 2NCMA 3WS3A 1KTKE 1V5JA 1BFSA 1CL7I 4LLUA 5EIQA 5DJYB 1MFAL 3OKDA 4OZHA 4XMPL 2DMCA 3QUMA 4KQ4L 3UC0L 2KZWA 3FB8A 4FXGA 1FLRL 5BRZD