1DCPA

Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
molecule keywords DCOH
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcpA00
1DCPA 2V6SA 4WILA 2EBBA 1F93A 2V6UA 1DCHA 4LOWA 3JSTA 4C45A 3HXAA 1USMA 1DCOA 2V6TA 1RU0A 1USOA
chains in the Genus database with same CATH superfamily
1IW7A 3S2DK 2EBBA 1YX2A 2GSNA 2B63K 3T00A 3TFHA 2B63A 5C3EK 1IE0A 1TWAK 1ISEA 1V5VA 4GTLA 1SMYA 2FQOA 4BY7K 2E2JC 4OIPA 3H3VL 4G7HA 2PHCB 4A3KC 3GTGC 4G0WA 1HI9A 3WODA 3S15C 1RU0A 3GEEA 3HOZC 5JVOA 3TFIA 3GTKC 3I4MK 3S1NC 1F93A 2GAGC 3JSTA 1HQMA 4C2MK 2XCRB 1O26A 3LPXA 3GTLK 3S1MC 3HXAA 2RH6A 2JA7C 1R9TK 3L4JA 3HOUK 4RMFA 2D6FC 3HOUC 3AQPA 3FKIK 2Y0SD 3A8IA 5IYBK 4KMUA 4KC6A 1XXBA 3VA7A 5M5YK 2NVTK 4WILA 4YFNA 2JA8K 4C3JC 2R92K 1SFOA 5IYDK 4LR2A 3V4GA 4AYBD 4XLPA 1I6VA 3S1RK 1BS2A 4A3MC 4KMAA 4GTAA 1I6HK 2PMZD 4KB2A 1TWGK 2E2HK 1Y1VC 1ZXOA 1R9TA 4A3DK 5C44K 2P5MA 3CAGA 3LAPA 4GTDA 4XCHA 5M5XK 4C3IC 1TWHC 3OPFA 2VUMA 4BKWA 4BY1C 3S2DC 5FJ8K 2VUMC 2JA6C 1VLOA 4YFKA 2R93K 4KASA 3A8JA 1VRQC 4Y52K 4QJVA 4KMHA 1GE9A 1WCMC 3GTOK 4A3CC 4G0VA 4A3JC 3S16K 4A3CK 1XZQB 3GTKK 4A3JK 3S16C 1PJ7A 4C3HC 5IYCK 1VJEA 2R7ZC 3GTPK 5CJ9A 2JA7A 2A6EA 5IOQA 1X31C 3PO2K 5TMFA 1XZQA 1USMA 3L4KA 2KWAA 2YU9C 1F7VA 4BXXC 2YU9K 4BLBA 4GTCA 1EFWA 1TWAC 5L46A 2Y0SL 1K83A 4G7ZA 2NVYC 2V6UA 5M3MK 4P5AA 4G0UA 1ZVUA 3HOWK 3I4NC 3OREA 5HL8A 2R92A 3M3YC 2JA8C 3H0GK 5D4DA 2R92C 5IORA 4LK1A 3S1QK 3S14K 4GTBA 1VGXA 4BLAA 4Y7NC 2GSUA 1TWHK 2JH3A 3MMLB 3G4AA 4KATA 5IYBC 4ILDA 2JA6A 1INNA 3HKZD 1KQ4A 2R93C 3S0XA 1BGWA 1TWCK 3FOFA 3N3YA 3T01A 1IQ0A 4A3MK 4LQYA 1WCMA 3GTMK 2E2IK 4XSXA 2GAHC 1WSVA 2PA8L 2V6SA 4OINA 4KN7A 3RZOC 1EI6A 4KAWX 1Y1VK 4A3DC 3GTOC 4NOIA 2WB1L 4BBSK 2WAQD 4GFQA 4QIWD 4BBRC 1Y1WK 2CFAA 4ZH4A 4OIRA 3HKZL 2E2JK 2VUMK 2NVYK 3AQOA 3ERED 1UV7A 4XLNA 3H0GC 2NVXK 1JQWA 1O2BA 2NVXA 2V6TA 2O5JA 3S15K 2ZUEA 3T02A 3GTLC 3EQLA 1WOSA 3S1QC 3S1MK 1Y1VA 3GSIA 5IYCC 2R7ZK 5C4XK 4GT9A 5C4XC 5JFEA 1WQHA 4A3IC 2B63C 1USOA 1DCPA 3AH5A 3AD7C 3FKIA 1XXCA 3FKIC 1J6WA 3CQZA 3GTJK 3GTJA 3GTJC 3GEHA 3M3YK 1DCOA 4A3FK 3RZDK 4C3JK 5IYDC 4KB4A 3GIRA 3GTMC 3S17K 2E2IA 5IOTA 4QJVB 3GTOA 2R7ZA 4XSZA 1TWGC 3ADAC 4Q4ZA 1Y1WA 1XZPB 4C3IK 4Y7NK 4GZYA 5FLMK 1B4BA 3GTQC 2ZUFA 4A3GC 3GTQA 1XZPA 4GTEA 3GTQK 1O27A 4G7OA 4DDQA 3M4OK 4KDDA 4Y52C 1AB4A 3PO3C 3S1NK 3PO3K 3BP8C 1XPPA 1VH2A 3GTLA 3HOXC 3HOVC 3GTPA 4A3LC 4BBSC 2CFAB 3GTPC 3S2HC 2Y3PA 3BP3A 4J3NA 4C3HK 1TWFK 1IL2A 4BXXK 4YG2A 2NVQC 2A68A 3N0CA 2JA5K 3FHZA 3CQZC 3IPJA 4MEXA 1EK8A 5EGHA 2PA8D 4A3EK 5EGEA 4A3KK 1F9NA 3I4NK 1WQFA 3I4MC 4PAAA 3SZYA 4A3BK 3S17C 5E68A 4C2MC 1YNJA 4O2DA 3S14C 4M1XA 1O28A 4A93K 1DD5A 2E2HA 1EH1A 1ZYRA 4GTFA 2E2HC 1I50K 1BDFA 2A6HA 2PMZL 3BUEA 1K83C 4PABA 4A3GK 3NUHA 4P9SA 4KM8A 3GDZA 1YCLA 3TFJA 2NVTC 1B4AA 4FM9A 4QIWL 4A3FC 4FZBA 1TWCC 1IS1A 1F7UA 4X6AC 4LK0A 4YFXA 4P5BA 3GTKA 1J6XA 3RZOK 1I3QK 3Q3QA 3S2HK 5C4JK 1O24A 4WJ4A 1TWFA 1TWFC 5C44C 1I50A 1WOOA 5FLMC 3GEIA 5M3FK 3TTGA 1PJ6A 2YU9A 3SZZA 3N0BA 2JA5C 4BY1K 3CQZK 1WOPA 4Q5SA 2R93A 2A69A 3GTGK 3K7AK 2NVYA 2JA6K 1SFOK 1SFOC 3HOWC 1WCMK 3LAJA 2E2IC 3HOYK 3HOZK 3A8KA 1J6VA 1BJTA 2RGRA 4OIQA 4A3BC 4A3LK 3HOYC 1IBAA 2O5IA 3DXJA 4BBRK 1R9TC 3PO2C 2W7VA 2WAQL 5C3EC 1J98A 3AD8C 2NVQK 5CHPA 1EQRA 3FOEA 1TWHA 4A3IK 5IP9C 1K83K 4KMDA 4LLGA 3H3VD 4BY7C 4MQ9A 5IP9K 4LJZA 4A3EC 3AD9C 3GTGA 3RZDC 4AH6A 1TWCA 1YNNA 1JVIA 3H0GA 3S1RC 2NVXC 2BE5A 4JK1A 4X6AK 4A93C 1WIHA 2WB1D 1G51A 1O29A 2XCOA 2JA7K 5IOSA 1I3QA 5C4JC 1I3QC 1I50C 1O2FB 1JOEA 1XXAA 2XCQA 2PPBA 1L0WA 1O25A 2FQTA 2JA5A 1ZBSA 2ZFZA 2P8TA 4KM9A 1TWAA 1O2AA 1C0AA 3M4OC 5TMCA 1PJ5A 4WJ3M 5IP7K 3G4CA 3OEPA 5IP7C 5M5WK 4LOWA 3K7AC 3GTMA 4OIOA 1WQGA 1WORA 2GSOA 1I6HC 1DCHA 3HOXK 3HOVK 4C45A 1ZQ1C 3QX3A 5TJ3A 1TWGA 4AYBL 1WSRA 1Y1WC 4MEYA 2CW0A 4KARA 4KN4A
chains in the Genus database with same CATH topology
1DCPA 2V6SA 4WILA 2EBBA 1F93A 2V6UA 1DCHA 4LOWA 3JSTA 4C45A 3HXAA 1USMA 1DCOA 2V6TA 1RU0A 1USOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  2V6S A;  4WIL A;  2EBB A;  1F93 A;  2V6U A;  1DCH A;  4LOW A;  3JST A;  4C45 A;  3HXA A;  1USM A;  1DCO A;  2V6T A;  1RU0 A;  1USO A; 
#chains in the Genus database with same CATH topology
 1IW7 A;  3S2D K;  2EBB A;  1YX2 A;  2GSN A;  2B63 K;  3T00 A;  3TFH A;  2B63 A;  5C3E K;  1IE0 A;  1TWA K;  1ISE A;  1V5V A;  4GTL A;  1SMY A;  2FQO A;  4BY7 K;  2E2J C;  4OIP A;  3H3V L;  4G7H A;  2PHC B;  4A3K C;  3GTG C;  4G0W A;  1HI9 A;  3WOD A;  3S15 C;  1RU0 A;  3GEE A;  3HOZ C;  5JVO A;  3TFI A;  3GTK C;  3I4M K;  3S1N C;  1F93 A;  2GAG C;  3JST A;  1HQM A;  4C2M K;  2XCR B;  1O26 A;  3LPX A;  3GTL K;  3S1M C;  3HXA A;  2RH6 A;  2JA7 C;  1R9T K;  3L4J A;  3HOU K;  4RMF A;  2D6F C;  3HOU C;  3AQP A;  3FKI K;  2Y0S D;  3A8I A;  5IYB K;  4KMU A;  4KC6 A;  1XXB A;  3VA7 A;  5M5Y K;  2NVT K;  4WIL A;  4YFN A;  2JA8 K;  4C3J C;  2R92 K;  1SFO A;  5IYD K;  4LR2 A;  3V4G A;  4AYB D;  4XLP A;  1I6V A;  3S1R K;  1BS2 A;  4A3M C;  4KMA A;  4GTA A;  1I6H K;  2PMZ D;  4KB2 A;  1TWG K;  2E2H K;  1Y1V C;  1ZXO A;  1R9T A;  4A3D K;  5C44 K;  2P5M A;  3CAG A;  3LAP A;  4GTD A;  4XCH A;  5M5X K;  4C3I C;  1TWH C;  3OPF A;  2VUM A;  4BKW A;  4BY1 C;  3S2D C;  5FJ8 K;  2VUM C;  2JA6 C;  1VLO A;  4YFK A;  2R93 K;  4KAS A;  3A8J A;  1VRQ C;  4Y52 K;  4QJV A;  4KMH A;  1GE9 A;  1WCM C;  3GTO K;  4A3C C;  4G0V A;  4A3J C;  3S16 K;  4A3C K;  1XZQ B;  3GTK K;  4A3J K;  3S16 C;  1PJ7 A;  4C3H C;  5IYC K;  1VJE A;  2R7Z C;  3GTP K;  5CJ9 A;  2JA7 A;  2A6E A;  5IOQ A;  1X31 C;  3PO2 K;  5TMF A;  1XZQ A;  1USM A;  3L4K A;  2KWA A;  2YU9 C;  1F7V A;  4BXX C;  2YU9 K;  4BLB A;  4GTC A;  1EFW A;  1TWA C;  5L46 A;  2Y0S L;  1K83 A;  4G7Z A;  2NVY C;  2V6U A;  5M3M K;  4P5A A;  4G0U A;  1ZVU A;  3HOW K;  3I4N C;  3ORE A;  5HL8 A;  2R92 A;  3M3Y C;  2JA8 C;  3H0G K;  5D4D A;  2R92 C;  5IOR A;  4LK1 A;  3S1Q K;  3S14 K;  4GTB A;  1VGX A;  4BLA A;  4Y7N C;  2GSU A;  1TWH K;  2JH3 A;  3MML B;  3G4A A;  4KAT A;  5IYB C;  4ILD A;  2JA6 A;  1INN A;  3HKZ D;  1KQ4 A;  2R93 C;  3S0X A;  1BGW A;  1TWC K;  3FOF A;  3N3Y A;  3T01 A;  1IQ0 A;  4A3M K;  4LQY A;  1WCM A;  3GTM K;  2E2I K;  4XSX A;  2GAH C;  1WSV A;  2PA8 L;  2V6S A;  4OIN A;  4KN7 A;  3RZO C;  1EI6 A;  4KAW X;  1Y1V K;  4A3D C;  3GTO C;  4NOI A;  2WB1 L;  4BBS K;  2WAQ D;  4GFQ A;  4QIW D;  4BBR C;  1Y1W K;  2CFA A;  4ZH4 A;  4OIR A;  3HKZ L;  2E2J K;  2VUM K;  2NVY K;  3AQO A;  3ERE D;  1UV7 A;  4XLN A;  3H0G C;  2NVX K;  1JQW A;  1O2B A;  2NVX A;  2V6T A;  2O5J A;  3S15 K;  2ZUE A;  3T02 A;  3GTL C;  3EQL A;  1WOS A;  3S1Q C;  3S1M K;  1Y1V A;  3GSI A;  5IYC C;  2R7Z K;  5C4X K;  4GT9 A;  5C4X C;  5JFE A;  1WQH A;  4A3I C;  2B63 C;  1USO A;  1DCP A;  3AH5 A;  3AD7 C;  3FKI A;  1XXC A;  3FKI C;  1J6W A;  3CQZ A;  3GTJ K;  3GTJ A;  3GTJ C;  3GEH A;  3M3Y K;  1DCO A;  4A3F K;  3RZD K;  4C3J K;  5IYD C;  4KB4 A;  3GIR A;  3GTM C;  3S17 K;  2E2I A;  5IOT A;  4QJV B;  3GTO A;  2R7Z A;  4XSZ A;  1TWG C;  3ADA C;  4Q4Z A;  1Y1W A;  1XZP B;  4C3I K;  4Y7N K;  4GZY A;  5FLM K;  1B4B A;  3GTQ C;  2ZUF A;  4A3G C;  3GTQ A;  1XZP A;  4GTE A;  3GTQ K;  1O27 A;  4G7O A;  4DDQ A;  3M4O K;  4KDD A;  4Y52 C;  1AB4 A;  3PO3 C;  3S1N K;  3PO3 K;  3BP8 C;  1XPP A;  1VH2 A;  3GTL A;  3HOX C;  3HOV C;  3GTP A;  4A3L C;  4BBS C;  2CFA B;  3GTP C;  3S2H C;  2Y3P A;  3BP3 A;  4J3N A;  4C3H K;  1TWF K;  1IL2 A;  4BXX K;  4YG2 A;  2NVQ C;  2A68 A;  3N0C A;  2JA5 K;  3FHZ A;  3CQZ C;  3IPJ A;  4MEX A;  1EK8 A;  5EGH A;  2PA8 D;  4A3E K;  5EGE A;  4A3K K;  1F9N A;  3I4N K;  1WQF A;  3I4M C;  4PAA A;  3SZY A;  4A3B K;  3S17 C;  5E68 A;  4C2M C;  1YNJ A;  4O2D A;  3S14 C;  4M1X A;  1O28 A;  4A93 K;  1DD5 A;  2E2H A;  1EH1 A;  1ZYR A;  4GTF A;  2E2H C;  1I50 K;  1BDF A;  2A6H A;  2PMZ L;  3BUE A;  1K83 C;  4PAB A;  4A3G K;  3NUH A;  4P9S A;  4KM8 A;  3GDZ A;  1YCL A;  3TFJ A;  2NVT C;  1B4A A;  4FM9 A;  4QIW L;  4A3F C;  4FZB A;  1TWC C;  1IS1 A;  1F7U A;  4X6A C;  4LK0 A;  4YFX A;  4P5B A;  3GTK A;  1J6X A;  3RZO K;  1I3Q K;  3Q3Q A;  3S2H K;  5C4J K;  1O24 A;  4WJ4 A;  1TWF A;  1TWF C;  5C44 C;  1I50 A;  1WOO A;  5FLM C;  3GEI A;  5M3F K;  3TTG A;  1PJ6 A;  2YU9 A;  3SZZ A;  3N0B A;  2JA5 C;  4BY1 K;  3CQZ K;  1WOP A;  4Q5S A;  2R93 A;  2A69 A;  3GTG K;  3K7A K;  2NVY A;  2JA6 K;  1SFO K;  1SFO C;  3HOW C;  1WCM K;  3LAJ A;  2E2I C;  3HOY K;  3HOZ K;  3A8K A;  1J6V A;  1BJT A;  2RGR A;  4OIQ A;  4A3B C;  4A3L K;  3HOY C;  1IBA A;  2O5I A;  3DXJ A;  4BBR K;  1R9T C;  3PO2 C;  2W7V A;  2WAQ L;  5C3E C;  1J98 A;  3AD8 C;  2NVQ K;  5CHP A;  1EQR A;  3FOE A;  1TWH A;  4A3I K;  5IP9 C;  1K83 K;  4KMD A;  4LLG A;  3H3V D;  4BY7 C;  4MQ9 A;  5IP9 K;  4LJZ A;  4A3E C;  3AD9 C;  3GTG A;  3RZD C;  4AH6 A;  1TWC A;  1YNN A;  1JVI A;  3H0G A;  3S1R C;  2NVX C;  2BE5 A;  4JK1 A;  4X6A K;  4A93 C;  1WIH A;  2WB1 D;  1G51 A;  1O29 A;  2XCO A;  2JA7 K;  5IOS A;  1I3Q A;  5C4J C;  1I3Q C;  1I50 C;  1O2F B;  1JOE A;  1XXA A;  2XCQ A;  2PPB A;  1L0W A;  1O25 A;  2FQT A;  2JA5 A;  1ZBS A;  2ZFZ A;  2P8T A;  4KM9 A;  1TWA A;  1O2A A;  1C0A A;  3M4O C;  5TMC A;  1PJ5 A;  4WJ3 M;  5IP7 K;  3G4C A;  3OEP A;  5IP7 C;  5M5W K;  4LOW A;  3K7A C;  3GTM A;  4OIO A;  1WQG A;  1WOR A;  2GSO A;  1I6H C;  1DCH A;  3HOX K;  3HOV K;  4C45 A;  1ZQ1 C;  3QX3 A;  5TJ3 A;  1TWG A;  4AYB L;  1WSR A;  1Y1W C;  4MEY A;  2CW0 A;  4KAR A;  4KN4 A; 
#chains in the Genus database with same CATH homology
 1DCP A;  2V6S A;  4WIL A;  2EBB A;  1F93 A;  2V6U A;  1DCH A;  4LOW A;  3JST A;  4C45 A;  3HXA A;  1USM A;  1DCO A;  2V6T A;  1RU0 A;  1USO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...