1DCPA

Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcpA00
4WILA 1F93A 3JSTA 2EBBA 2V6UA 4C45A 1DCHA 2V6TA 2V6SA 1RU0A 1USOA 3HXAA 1USMA 1DCOA 1DCPA 4LOWA
chains in the Genus database with same CATH superfamily
2R7ZK 2PA8L 3GTPK 2EBBA 1I50A 3SZYA 3CAGA 4AYBD 3EQLA 4BBRC 4KAWX 4G0VA 1I3QK 3IPJA 4KN7A 2R93K 1WCMA 5C44C 3PO3K 1R9TC 1O29A 3TFJA 3N3YA 4KMUA 1K83C 3GTQA 1YNNA 3V4GA 1O2FB 2CFAA 4C3JK 1Y1WA 3N0CA 2NVXK 4A3LC 1ZXOA 4FM9A 3S15K 4KB2A 1PJ6A 4A3EK 1EFWA 3LAJA 1F7UA 2YU9C 4OIRA 4OIOA 1EQRA 4NOIA 3L4JA 3M3YK 4KMDA 1Y1VK 4M1XA 4X6AK 1JQWA 4QJVB 1WSVA 4Q5SA 2NVYA 3VA7A 1I6HK 3GTKA 2PHCB 5D4DA 5M5XK 2GSOA 2PA8D 4G7ZA 4A3KC 3RZOC 1IE0A 4AH6A 5C4XC 1F9NA 1O26A 4OIQA 4BLBA 3GTJK 3GTPA 2JA7C 3S16K 1YNJA 4A3FK 5M5WK 2B63K 5IYDC 3PO2K 4Y52K 3ADAC 3HOVC 3H0GC 1TWAC 4GTEA 1KQ4A 2R93A 4RMFA 3AQOA 4KASA 4A3CC 4A93K 2NVQC 3HOYK 4YG2A 4KDDA 2NVXA 1TWFC 3HOZC 2VUMK 2W7VA 5L46A 3I4MK 3SZZA 4GTAA 1VLOA 4Y7NC 4BLAA 1VJEA 5C3EC 2R92A 3S17K 3WODA 4A3DC 4KARA 2RGRA 3S1MK 4KMHA 1Y1VA 3S2DC 3S1NK 4XSXA 4C2MC 1O24A 3GTOC 1O27A 3S1RC 1Y1WK 5IYBC 3LAPA 1SFOA 4G7OA 3FKIC 2A69A 2O5JA 4P9SA 3GTGA 4BBRK 1VGXA 3M4OK 1TWHC 1YCLA 3FOFA 1R9TK 1UV7A 2A6HA 1TWCC 1K83K 3NUHA 1WQHA 3BUEA 1ISEA 2ZUEA 2NVYK 1BGWA 3HOUC 2V6UA 2VUMA 3GTKK 1WOPA 1XXCA 2O5IA 4PAAA 4GTDA 2GSUA 1XZPA 4GTBA 2E2JC 3CQZC 2XCOA 1G51A 1XZQB 5IP7C 5IP9C 4A3MK 5CJ9A 1HI9A 3S14C 1B4BA 3BP3A 1DD5A 4LJZA 1I50C 3GTMK 3A8JA 5IOTA 4Q4ZA 3TFIA 2NVTK 4GTLA 2Y0SL 3GTLK 2JA6K 5E68A 3Q3QA 1O25A 3OEPA 2JA7K 3QX3A 2XCQA 4A3JK 1J6VA 4P5AA 4C3IK 4KB4A 5IYCC 1R9TA 1WOOA 5EGHA 4KN4A 2R92K 2JA5C 1K83A 4A3CK 4MQ9A 5M3FK 3JSTA 2RH6A 3S0XA 2E2IC 1DCOA 3HOXC 4GTFA 4Y7NK 3S2HK 4LLGA 3RZDC 1TWGK 1WSRA 1ZBSA 4BXXC 2WAQL 1SFOK 5FLMK 2JA8K 4QIWL 3GTGK 4BBSC 3G4AA 3K7AC 4FZBA 1IBAA 3AD7C 1DCHA 2CFAB 2Y0SD 2R7ZC 1BS2A 1J6XA 3GTMA 3MMLB 1I3QC 2GSNA 3GTLA 2R93C 3PO3C 2JA6A 1EI6A 3G4CA 4OIPA 4A3GC 3ERED 4XSZA 1DCPA 2JA7A 4C3JC 2PMZL 1WIHA 5JFEA 3HOWK 4YFXA 3AH5A 3S15C 4LK0A 5JVOA 1VRQC 2XCRB 3I4NK 4C3HK 4A3IK 4GT9A 1BDFA 4A3BK 1EH1A 1TWFA 5C4JK 1RU0A 3M3YC 5FJ8K 1Y1VC 2WAQD 2E2HK 4X6AC 1TWGA 4QIWD 5IOQA 1USOA 1IQ0A 3OREA 4XLPA 1B4AA 3FOEA 5IP7K 4YFKA 4YFNA 1ZVUA 1EK8A 5C44K 3GTJC 2CW0A 1JOEA 3S16C 2BE5A 3LPXA 4A3FC 4MEYA 2B63C 4Y52C 3OPFA 4A3LK 2PMZD 3AQPA 1BJTA 3GIRA 4GTCA 2FQTA 4A93C 1TWHA 3HOYC 2YU9K 1WQFA 2VUMC 2ZFZA 2JA5K 3I4MC 1IS1A 4BY7C 2A6EA 3L4KA 2E2IK 5M5YK 1O28A 3S1QC 4GZYA 3S17C 3S1MC 5HL8A 5TJ3A 1X31C 2E2HA 4A3KK 3RZOK 5C4XK 2ZUFA 3S1NC 4KC6A 1WCMC 2WB1L 3K7AK 4LR2A 4XCHA 3GTQC 4QJVA 3GEEA 5IYDK 4MEXA 1Y1WC 3HOVK 3H0GK 1TWAK 3AD8C 4OINA 1L0WA 4BKWA 4BY1C 3M4OC 5TMCA 1AB4A 4LK1A 2NVQK 4A3GK 1C0AA 1XZPB 4XLNA 1TWFK 3HOZK 3T02A 1INNA 1J98A 2PPBA 4P5BA 2YU9A 2NVYC 3DXJA 1V5VA 4G7HA 5C3EK 3GTKC 3GDZA 2JA5A 4LQYA 4A3DK 1O2BA 1HQMA 2KWAA 2E2IA 3GEHA 3S2DK 1IW7A 1F7VA 4C2MK 2WB1D 3GTPC 1YX2A 4A3MC 3GTOK 3S1RK 2GAHC 5M3MK 3GSIA 5IYBK 3GTMC 3FKIK 1WQGA 2NVTC 1J6WA 3GTLC 1TWHK 2JA6C 1ZQ1C 4G0WA 3T00A 2R7ZA 3H0GA 3A8KA 1TWAA 2NVXC 5CHPA 1TWCK 4J3NA 4A3JC 4A3EC 4C3IC 1I3QA 5TMFA 4ILDA 3HKZL 3HOUK 5EGEA 2R92C 1PJ7A 1SMYA 3HXAA 4WILA 3N0BA 3BP8C 4JK1A 2P5MA 2E2JK 3S2HC 1I6HC 3CQZK 4DDQA 4KATA 4BY7K 1TWGC 3TFHA 5IP9K 1XXBA 2V6SA 1WORA 3S14K 3S1QK 1JVIA 3T01A 3FHZA 4KM8A 5FLMC 1SFOC 2JA8C 1I50K 1USMA 3GTGC 1I6VA 4KMAA 3AD9C 4ZH4A 1GE9A 1WOSA 3H3VL 1WCMK 3GTOA 1IL2A 3PO2C 1XZQA 4AYBL 3FKIA 3GTQK 1VH2A 1XXAA 2GAGC 1O2AA 1F93A 5IYCK 3GTJA 2V6TA 1ZYRA 1XPPA 4BY1K 3HKZD 1TWCA 2B63A 2A68A 3HOWC 4PABA 2P8TA 2D6FC 1PJ5A 2Y3PA 3I4NC 3TTGA 3HOXK 4C3HC 4A3IC 3RZDK 4C45A 4WJ3M 4O2DA 4A3BC 2FQOA 4LOWA 4G0UA 5IOSA 3GEIA 2JH3A 5C4JC 4BXXK 3CQZA 2E2HC 4GFQA 4BBSK 4WJ4A 5IORA 3A8IA 4KM9A 3H3VD
chains in the Genus database with same CATH topology
4WILA 1F93A 3JSTA 2EBBA 2V6UA 4C45A 1DCHA 2V6TA 2V6SA 1RU0A 1USOA 3HXAA 1USMA 1DCOA 1DCPA 4LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIL A;  1F93 A;  3JST A;  2EBB A;  2V6U A;  4C45 A;  1DCH A;  2V6T A;  2V6S A;  1RU0 A;  1USO A;  3HXA A;  1USM A;  1DCO A;  1DCP A;  4LOW A; 
#chains in the Genus database with same CATH topology
 2R7Z K;  2PA8 L;  3GTP K;  2EBB A;  1I50 A;  3SZY A;  3CAG A;  4AYB D;  3EQL A;  4BBR C;  4KAW X;  4G0V A;  1I3Q K;  3IPJ A;  4KN7 A;  2R93 K;  1WCM A;  5C44 C;  3PO3 K;  1R9T C;  1O29 A;  3TFJ A;  3N3Y A;  4KMU A;  1K83 C;  3GTQ A;  1YNN A;  3V4G A;  1O2F B;  2CFA A;  4C3J K;  1Y1W A;  3N0C A;  2NVX K;  4A3L C;  1ZXO A;  4FM9 A;  3S15 K;  4KB2 A;  1PJ6 A;  4A3E K;  1EFW A;  3LAJ A;  1F7U A;  2YU9 C;  4OIR A;  4OIO A;  1EQR A;  4NOI A;  3L4J A;  3M3Y K;  4KMD A;  1Y1V K;  4M1X A;  4X6A K;  1JQW A;  4QJV B;  1WSV A;  4Q5S A;  2NVY A;  3VA7 A;  1I6H K;  3GTK A;  2PHC B;  5D4D A;  5M5X K;  2GSO A;  2PA8 D;  4G7Z A;  4A3K C;  3RZO C;  1IE0 A;  4AH6 A;  5C4X C;  1F9N A;  1O26 A;  4OIQ A;  4BLB A;  3GTJ K;  3GTP A;  2JA7 C;  3S16 K;  1YNJ A;  4A3F K;  5M5W K;  2B63 K;  5IYD C;  3PO2 K;  4Y52 K;  3ADA C;  3HOV C;  3H0G C;  1TWA C;  4GTE A;  1KQ4 A;  2R93 A;  4RMF A;  3AQO A;  4KAS A;  4A3C C;  4A93 K;  2NVQ C;  3HOY K;  4YG2 A;  4KDD A;  2NVX A;  1TWF C;  3HOZ C;  2VUM K;  2W7V A;  5L46 A;  3I4M K;  3SZZ A;  4GTA A;  1VLO A;  4Y7N C;  4BLA A;  1VJE A;  5C3E C;  2R92 A;  3S17 K;  3WOD A;  4A3D C;  4KAR A;  2RGR A;  3S1M K;  4KMH A;  1Y1V A;  3S2D C;  3S1N K;  4XSX A;  4C2M C;  1O24 A;  3GTO C;  1O27 A;  3S1R C;  1Y1W K;  5IYB C;  3LAP A;  1SFO A;  4G7O A;  3FKI C;  2A69 A;  2O5J A;  4P9S A;  3GTG A;  4BBR K;  1VGX A;  3M4O K;  1TWH C;  1YCL A;  3FOF A;  1R9T K;  1UV7 A;  2A6H A;  1TWC C;  1K83 K;  3NUH A;  1WQH A;  3BUE A;  1ISE A;  2ZUE A;  2NVY K;  1BGW A;  3HOU C;  2V6U A;  2VUM A;  3GTK K;  1WOP A;  1XXC A;  2O5I A;  4PAA A;  4GTD A;  2GSU A;  1XZP A;  4GTB A;  2E2J C;  3CQZ C;  2XCO A;  1G51 A;  1XZQ B;  5IP7 C;  5IP9 C;  4A3M K;  5CJ9 A;  1HI9 A;  3S14 C;  1B4B A;  3BP3 A;  1DD5 A;  4LJZ A;  1I50 C;  3GTM K;  3A8J A;  5IOT A;  4Q4Z A;  3TFI A;  2NVT K;  4GTL A;  2Y0S L;  3GTL K;  2JA6 K;  5E68 A;  3Q3Q A;  1O25 A;  3OEP A;  2JA7 K;  3QX3 A;  2XCQ A;  4A3J K;  1J6V A;  4P5A A;  4C3I K;  4KB4 A;  5IYC C;  1R9T A;  1WOO A;  5EGH A;  4KN4 A;  2R92 K;  2JA5 C;  1K83 A;  4A3C K;  4MQ9 A;  5M3F K;  3JST A;  2RH6 A;  3S0X A;  2E2I C;  1DCO A;  3HOX C;  4GTF A;  4Y7N K;  3S2H K;  4LLG A;  3RZD C;  1TWG K;  1WSR A;  1ZBS A;  4BXX C;  2WAQ L;  1SFO K;  5FLM K;  2JA8 K;  4QIW L;  3GTG K;  4BBS C;  3G4A A;  3K7A C;  4FZB A;  1IBA A;  3AD7 C;  1DCH A;  2CFA B;  2Y0S D;  2R7Z C;  1BS2 A;  1J6X A;  3GTM A;  3MML B;  1I3Q C;  2GSN A;  3GTL A;  2R93 C;  3PO3 C;  2JA6 A;  1EI6 A;  3G4C A;  4OIP A;  4A3G C;  3ERE D;  4XSZ A;  1DCP A;  2JA7 A;  4C3J C;  2PMZ L;  1WIH A;  5JFE A;  3HOW K;  4YFX A;  3AH5 A;  3S15 C;  4LK0 A;  5JVO A;  1VRQ C;  2XCR B;  3I4N K;  4C3H K;  4A3I K;  4GT9 A;  1BDF A;  4A3B K;  1EH1 A;  1TWF A;  5C4J K;  1RU0 A;  3M3Y C;  5FJ8 K;  1Y1V C;  2WAQ D;  2E2H K;  4X6A C;  1TWG A;  4QIW D;  5IOQ A;  1USO A;  1IQ0 A;  3ORE A;  4XLP A;  1B4A A;  3FOE A;  5IP7 K;  4YFK A;  4YFN A;  1ZVU A;  1EK8 A;  5C44 K;  3GTJ C;  2CW0 A;  1JOE A;  3S16 C;  2BE5 A;  3LPX A;  4A3F C;  4MEY A;  2B63 C;  4Y52 C;  3OPF A;  4A3L K;  2PMZ D;  3AQP A;  1BJT A;  3GIR A;  4GTC A;  2FQT A;  4A93 C;  1TWH A;  3HOY C;  2YU9 K;  1WQF A;  2VUM C;  2ZFZ A;  2JA5 K;  3I4M C;  1IS1 A;  4BY7 C;  2A6E A;  3L4K A;  2E2I K;  5M5Y K;  1O28 A;  3S1Q C;  4GZY A;  3S17 C;  3S1M C;  5HL8 A;  5TJ3 A;  1X31 C;  2E2H A;  4A3K K;  3RZO K;  5C4X K;  2ZUF A;  3S1N C;  4KC6 A;  1WCM C;  2WB1 L;  3K7A K;  4LR2 A;  4XCH A;  3GTQ C;  4QJV A;  3GEE A;  5IYD K;  4MEX A;  1Y1W C;  3HOV K;  3H0G K;  1TWA K;  3AD8 C;  4OIN A;  1L0W A;  4BKW A;  4BY1 C;  3M4O C;  5TMC A;  1AB4 A;  4LK1 A;  2NVQ K;  4A3G K;  1C0A A;  1XZP B;  4XLN A;  1TWF K;  3HOZ K;  3T02 A;  1INN A;  1J98 A;  2PPB A;  4P5B A;  2YU9 A;  2NVY C;  3DXJ A;  1V5V A;  4G7H A;  5C3E K;  3GTK C;  3GDZ A;  2JA5 A;  4LQY A;  4A3D K;  1O2B A;  1HQM A;  2KWA A;  2E2I A;  3GEH A;  3S2D K;  1IW7 A;  1F7V A;  4C2M K;  2WB1 D;  3GTP C;  1YX2 A;  4A3M C;  3GTO K;  3S1R K;  2GAH C;  5M3M K;  3GSI A;  5IYB K;  3GTM C;  3FKI K;  1WQG A;  2NVT C;  1J6W A;  3GTL C;  1TWH K;  2JA6 C;  1ZQ1 C;  4G0W A;  3T00 A;  2R7Z A;  3H0G A;  3A8K A;  1TWA A;  2NVX C;  5CHP A;  1TWC K;  4J3N A;  4A3J C;  4A3E C;  4C3I C;  1I3Q A;  5TMF A;  4ILD A;  3HKZ L;  3HOU K;  5EGE A;  2R92 C;  1PJ7 A;  1SMY A;  3HXA A;  4WIL A;  3N0B A;  3BP8 C;  4JK1 A;  2P5M A;  2E2J K;  3S2H C;  1I6H C;  3CQZ K;  4DDQ A;  4KAT A;  4BY7 K;  1TWG C;  3TFH A;  5IP9 K;  1XXB A;  2V6S A;  1WOR A;  3S14 K;  3S1Q K;  1JVI A;  3T01 A;  3FHZ A;  4KM8 A;  5FLM C;  1SFO C;  2JA8 C;  1I50 K;  1USM A;  3GTG C;  1I6V A;  4KMA A;  3AD9 C;  4ZH4 A;  1GE9 A;  1WOS A;  3H3V L;  1WCM K;  3GTO A;  1IL2 A;  3PO2 C;  1XZQ A;  4AYB L;  3FKI A;  3GTQ K;  1VH2 A;  1XXA A;  2GAG C;  1O2A A;  1F93 A;  5IYC K;  3GTJ A;  2V6T A;  1ZYR A;  1XPP A;  4BY1 K;  3HKZ D;  1TWC A;  2B63 A;  2A68 A;  3HOW C;  4PAB A;  2P8T A;  2D6F C;  1PJ5 A;  2Y3P A;  3I4N C;  3TTG A;  3HOX K;  4C3H C;  4A3I C;  3RZD K;  4C45 A;  4WJ3 M;  4O2D A;  4A3B C;  2FQO A;  4LOW A;  4G0U A;  5IOS A;  3GEI A;  2JH3 A;  5C4J C;  4BXX K;  3CQZ A;  2E2H C;  4GFQ A;  4BBS K;  4WJ4 A;  5IOR A;  3A8I A;  4KM9 A;  3H3V D; 
#chains in the Genus database with same CATH homology
 4WIL A;  1F93 A;  3JST A;  2EBB A;  2V6U A;  4C45 A;  1DCH A;  2V6T A;  2V6S A;  1RU0 A;  1USO A;  3HXA A;  1USM A;  1DCO A;  1DCP A;  4LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...