1DCPA

Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcpA00
2EBBA 3JSTA 1USMA 2V6SA 1F93A 1DCOA 4WILA 2V6TA 3HXAA 1RU0A 4LOWA 4C45A 1USOA 1DCHA 1DCPA 2V6UA
chains in the Genus database with same CATH superfamily
4LK0A 4P9SA 3Q3QA 5IP7C 4AYBL 3FOEA 4Q5SA 4MEYA 2CFAA 5IYCK 5L46A 4A3CK 2XCQA 3HOYK 2R93A 5IP7K 4XCHA 1XZPA 3HOVC 2JA8C 3GTQA 3LAPA 2E2JK 1O29A 3GTKC 3HOVK 1R9TA 2YU9A 3GTKK 1WOPA 5M3MK 1K83C 1SFOK 4QJVB 1C0AA 1O24A 3GTJA 2O5JA 1HI9A 3S17C 1I50C 4G0VA 3G4CA 1ZYRA 4ZH4A 4BKWA 1I50K 2JA5A 3GTPA 3HOWC 3BUEA 2B63C 1DD5A 4OIOA 5IYBC 5HL8A 3HOWK 4A3FK 2R92A 4A3MK 4GTBA 1XZQA 3A8KA 4BY7K 5IYBK 2V6TA 1YCLA 4G0WA 4KMDA 2JA6K 3S1NK 3T00A 3GIRA 3GTOC 1WOOA 2E2IA 1TWHA 1EH1A 1I3QC 2D6FC 1G51A 4KASA 2A69A 3CAGA 5C3EK 5IOQA 1TWCC 2JA7K 5IP9K 3S16K 1TWGC 1IL2A 1PJ7A 4A93C 3H0GA 1BGWA 3HOUC 1TWCK 5C4JC 2E2HA 1TWGK 5CJ9A 1F93A 4A93K 3HOUK 1X31C 4GTAA 5C4JK 3BP8C 3IPJA 3FHZA 4KN7A 4C2MC 2NVXA 1IW7A 3FKIC 3DXJA 1Y1WA 1EI6A 1ZBSA 1F7UA 3FKIK 3AQPA 3GTLK 5TJ3A 1BJTA 3MMLB 3TTGA 3QX3A 3M4OC 3S2HC 4A3KC 3S0XA 3A8IA 4KATA 3HOXK 3M4OK 3S2HK 4A3KK 1IBAA 4Q4ZA 4KB2A 3V4GA 4P5BA 4C3HK 5FLMC 3CQZC 4AYBD 2VUMA 1IE0A 1AB4A 2O5IA 1TWAA 3AQOA 3GEEA 2XCRB 5IYDC 1J6VA 4KN4A 2R93C 5M5XK 3S2DC 1WQFA 3T02A 2XCOA 3AH5A 4KMAA 5IYDK 3GTQC 3PO2C 2V6UA 4BBRK 2R93K 1BDFA 3S2DK 3AD7C 1R9TC 3GTQK 3TFHA 2KWAA 4RMFA 4A3CC 1PJ5A 3HOYC 1KQ4A 1J6WA 1O27A 2PA8L 1XZQB 1R9TK 2YU9K 1B4AA 4OIPA 2A6EA 2NVYA 4OIRA 2E2JC 4MQ9A 4A3IC 3GTJC 1DCHA 4A3JK 4XSZA 2NVQC 1O26A 1XPPA 4A3IK 3GTJK 1YNNA 2JA5C 3GTPC 4FZBA 4A3DC 2NVQK 2ZUFA 1SFOC 2JA5K 3GTPK 4A3DK 1DCPA 2R92C 2Y0SL 4BBSK 3OEPA 1YX2A 1EK8A 1EFWA 2R92K 2ZFZA 4G7ZA 4OIQA 1RU0A 4A3LC 2A68A 3H3VL 3A8JA 1VLOA 2E2IC 4A3FC 2JH3A 1TWHC 3GTGA 4A3MC 4A3LK 1YNJA 4BY7C 5C44K 4FM9A 4Y7NC 1O2AA 2E2IK 1TWHK 2R7ZA 4G7OA 2JA6C 3S1NC 4GZYA 4Y7NK 2E2HC 1WOSA 2EBBA 4BLAA 3H0GK 4QIWL 3HXAA 2E2HK 1O2BA 5C3EC 3RZOC 2JA7C 5IP9C 2NVXC 5M5WK 3S16C 4BXXK 3PO3K 1HQMA 3RZOK 2NVXK 5C4XC 4BY1C 2GAHC 1Y1WK 1K83A 4KC6A 4GFQA 3N0CA 5C4XK 3GEIA 5FJ8K 4WJ4A 4BY1K 4GTDA 4MEXA 3HKZL 3S1QC 4ILDA 4M1XA 1ZXOA 3RZDC 5IOTA 1WSVA 3S1QK 4LQYA 2B63A 1B4BA 4KMHA 1O25A 3GTLC 3RZDK 1ZQ1C 4XLNA 1INNA 1IQ0A 3SZYA 4YFKA 3AD8C 2CFAB 5JFEA 4GTFA 2VUMC 1TWAC 2GSNA 4QJVA 4XLPA 1XZPB 2VUMK 2RH6A 4C3IC 4KB4A 1TWAK 3TFJA 3HOXC 3I4NC 3OREA 1VH2A 3GTOA 3HOZC 1UV7A 4C3HC 4C3IK 1WORA 1I3QA 4OINA 4A3BK 3I4NK 3HOZK 3JSTA 2PA8D 5EGHA 4WILA 1WCMA 1GE9A 3BP3A 2NVYC 4BBRC 1J6XA 2NVYK 3K7AC 4X6AK 1WSRA 2FQOA 2NVTK 3S1RC 2YU9C 3K7AK 2W7VA 4G7HA 3S1RK 1TWFA 2PHCB 1Y1VA 2Y0SD 4A3JC 3G4AA 3S15C 1F9NA 4KAWX 3N3YA 3S15K 4WJ3M 3H3VD 3I4MK 5CHPA 2ZUEA 4BBSC 1JQWA 3CQZA 4Y52K 1XXBA 3LAJA 3GTGK 4LK1A 1J98A 2R7ZC 4DDQA 2WAQL 1PJ6A 1VJEA 2P8TA 5IOSA 4QIWD 2R7ZK 2FQTA 3GTMA 1BS2A 4GT9A 1XXAA 4A3GC 3L4JA 4BLBA 5C44C 2A6HA 2JA8K 4A3GK 4GTLA 1F7VA 4XSXA 3SZZA 1USOA 1L0WA 2WB1L 4PAAA 2PMZL 3GEHA 1O2FB 1ZVUA 3H0GC 2BE5A 1JOEA 5EGEA 4LLGA 3HKZD 3GDZA 1K83K 2CW0A 1EQRA 4BXXC 3PO3C 1WIHA 4O2DA 1JVIA 3S17K 3GTKA 2Y3PA 3OPFA 1Y1WC 2P5MA 3TFIA 2V6SA 1SFOA 3N0BA 2B63K 4YG2A 1DCOA 4GTEA 4NOIA 4YFNA 1VRQC 1I50A 4A3EC 5JVOA 1XXCA 5TMFA 3EQLA 4A3EK 5M5YK 3NUHA 3GTOK 1O28A 4KDDA 3WODA 1I6HC 1I3QK 2JA6A 4KM9A 3S14C 1WCMC 4LJZA 3S1MC 1WQGA 1I6HK 3S14K 1VGXA 1WCMK 4C3JC 4LOWA 3S1MK 4A3BC 4KARA 2JA7A 4C3JK 4JK1A 1WQHA 2GSOA 4C2MK 5E68A 1TWCA 1TWGA 4P5AA 4AH6A 3ERED 5IORA 1TWFC 1Y1VC 4GTCA 4X6AC 1TWFK 3M3YC 2NVTC 1Y1VK 4YFXA 4PABA 4LR2A 3M3YK 5D4DA 5M3FK 3FKIA 3GTLA 4KMUA 5TMCA 2GSUA 3LPXA 3GSIA 3VA7A 2WAQD 1V5VA 3T01A 2GAGC 4C45A 5FLMK 3CQZK 3L4KA 3AD9C 1USMA 1IS1A 3GTMC 3I4MC 2RGRA 2PPBA 4J3NA 1ISEA 4KM8A 3ADAC 3FOFA 4G0UA 3GTMK 4Y52C 1I6VA 3GTGC 3PO2K 5IYCC 2WB1D 1SMYA 2PMZD
chains in the Genus database with same CATH topology
2EBBA 3JSTA 1USMA 2V6SA 1F93A 1DCOA 4WILA 2V6TA 3HXAA 1RU0A 4LOWA 4C45A 1USOA 1DCHA 1DCPA 2V6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBB A;  3JST A;  1USM A;  2V6S A;  1F93 A;  1DCO A;  4WIL A;  2V6T A;  3HXA A;  1RU0 A;  4LOW A;  4C45 A;  1USO A;  1DCH A;  1DCP A;  2V6U A; 
#chains in the Genus database with same CATH topology
 4LK0 A;  4P9S A;  3Q3Q A;  5IP7 C;  4AYB L;  3FOE A;  4Q5S A;  4MEY A;  2CFA A;  5IYC K;  5L46 A;  4A3C K;  2XCQ A;  3HOY K;  2R93 A;  5IP7 K;  4XCH A;  1XZP A;  3HOV C;  2JA8 C;  3GTQ A;  3LAP A;  2E2J K;  1O29 A;  3GTK C;  3HOV K;  1R9T A;  2YU9 A;  3GTK K;  1WOP A;  5M3M K;  1K83 C;  1SFO K;  4QJV B;  1C0A A;  1O24 A;  3GTJ A;  2O5J A;  1HI9 A;  3S17 C;  1I50 C;  4G0V A;  3G4C A;  1ZYR A;  4ZH4 A;  4BKW A;  1I50 K;  2JA5 A;  3GTP A;  3HOW C;  3BUE A;  2B63 C;  1DD5 A;  4OIO A;  5IYB C;  5HL8 A;  3HOW K;  4A3F K;  2R92 A;  4A3M K;  4GTB A;  1XZQ A;  3A8K A;  4BY7 K;  5IYB K;  2V6T A;  1YCL A;  4G0W A;  4KMD A;  2JA6 K;  3S1N K;  3T00 A;  3GIR A;  3GTO C;  1WOO A;  2E2I A;  1TWH A;  1EH1 A;  1I3Q C;  2D6F C;  1G51 A;  4KAS A;  2A69 A;  3CAG A;  5C3E K;  5IOQ A;  1TWC C;  2JA7 K;  5IP9 K;  3S16 K;  1TWG C;  1IL2 A;  1PJ7 A;  4A93 C;  3H0G A;  1BGW A;  3HOU C;  1TWC K;  5C4J C;  2E2H A;  1TWG K;  5CJ9 A;  1F93 A;  4A93 K;  3HOU K;  1X31 C;  4GTA A;  5C4J K;  3BP8 C;  3IPJ A;  3FHZ A;  4KN7 A;  4C2M C;  2NVX A;  1IW7 A;  3FKI C;  3DXJ A;  1Y1W A;  1EI6 A;  1ZBS A;  1F7U A;  3FKI K;  3AQP A;  3GTL K;  5TJ3 A;  1BJT A;  3MML B;  3TTG A;  3QX3 A;  3M4O C;  3S2H C;  4A3K C;  3S0X A;  3A8I A;  4KAT A;  3HOX K;  3M4O K;  3S2H K;  4A3K K;  1IBA A;  4Q4Z A;  4KB2 A;  3V4G A;  4P5B A;  4C3H K;  5FLM C;  3CQZ C;  4AYB D;  2VUM A;  1IE0 A;  1AB4 A;  2O5I A;  1TWA A;  3AQO A;  3GEE A;  2XCR B;  5IYD C;  1J6V A;  4KN4 A;  2R93 C;  5M5X K;  3S2D C;  1WQF A;  3T02 A;  2XCO A;  3AH5 A;  4KMA A;  5IYD K;  3GTQ C;  3PO2 C;  2V6U A;  4BBR K;  2R93 K;  1BDF A;  3S2D K;  3AD7 C;  1R9T C;  3GTQ K;  3TFH A;  2KWA A;  4RMF A;  4A3C C;  1PJ5 A;  3HOY C;  1KQ4 A;  1J6W A;  1O27 A;  2PA8 L;  1XZQ B;  1R9T K;  2YU9 K;  1B4A A;  4OIP A;  2A6E A;  2NVY A;  4OIR A;  2E2J C;  4MQ9 A;  4A3I C;  3GTJ C;  1DCH A;  4A3J K;  4XSZ A;  2NVQ C;  1O26 A;  1XPP A;  4A3I K;  3GTJ K;  1YNN A;  2JA5 C;  3GTP C;  4FZB A;  4A3D C;  2NVQ K;  2ZUF A;  1SFO C;  2JA5 K;  3GTP K;  4A3D K;  1DCP A;  2R92 C;  2Y0S L;  4BBS K;  3OEP A;  1YX2 A;  1EK8 A;  1EFW A;  2R92 K;  2ZFZ A;  4G7Z A;  4OIQ A;  1RU0 A;  4A3L C;  2A68 A;  3H3V L;  3A8J A;  1VLO A;  2E2I C;  4A3F C;  2JH3 A;  1TWH C;  3GTG A;  4A3M C;  4A3L K;  1YNJ A;  4BY7 C;  5C44 K;  4FM9 A;  4Y7N C;  1O2A A;  2E2I K;  1TWH K;  2R7Z A;  4G7O A;  2JA6 C;  3S1N C;  4GZY A;  4Y7N K;  2E2H C;  1WOS A;  2EBB A;  4BLA A;  3H0G K;  4QIW L;  3HXA A;  2E2H K;  1O2B A;  5C3E C;  3RZO C;  2JA7 C;  5IP9 C;  2NVX C;  5M5W K;  3S16 C;  4BXX K;  3PO3 K;  1HQM A;  3RZO K;  2NVX K;  5C4X C;  4BY1 C;  2GAH C;  1Y1W K;  1K83 A;  4KC6 A;  4GFQ A;  3N0C A;  5C4X K;  3GEI A;  5FJ8 K;  4WJ4 A;  4BY1 K;  4GTD A;  4MEX A;  3HKZ L;  3S1Q C;  4ILD A;  4M1X A;  1ZXO A;  3RZD C;  5IOT A;  1WSV A;  3S1Q K;  4LQY A;  2B63 A;  1B4B A;  4KMH A;  1O25 A;  3GTL C;  3RZD K;  1ZQ1 C;  4XLN A;  1INN A;  1IQ0 A;  3SZY A;  4YFK A;  3AD8 C;  2CFA B;  5JFE A;  4GTF A;  2VUM C;  1TWA C;  2GSN A;  4QJV A;  4XLP A;  1XZP B;  2VUM K;  2RH6 A;  4C3I C;  4KB4 A;  1TWA K;  3TFJ A;  3HOX C;  3I4N C;  3ORE A;  1VH2 A;  3GTO A;  3HOZ C;  1UV7 A;  4C3H C;  4C3I K;  1WOR A;  1I3Q A;  4OIN A;  4A3B K;  3I4N K;  3HOZ K;  3JST A;  2PA8 D;  5EGH A;  4WIL A;  1WCM A;  1GE9 A;  3BP3 A;  2NVY C;  4BBR C;  1J6X A;  2NVY K;  3K7A C;  4X6A K;  1WSR A;  2FQO A;  2NVT K;  3S1R C;  2YU9 C;  3K7A K;  2W7V A;  4G7H A;  3S1R K;  1TWF A;  2PHC B;  1Y1V A;  2Y0S D;  4A3J C;  3G4A A;  3S15 C;  1F9N A;  4KAW X;  3N3Y A;  3S15 K;  4WJ3 M;  3H3V D;  3I4M K;  5CHP A;  2ZUE A;  4BBS C;  1JQW A;  3CQZ A;  4Y52 K;  1XXB A;  3LAJ A;  3GTG K;  4LK1 A;  1J98 A;  2R7Z C;  4DDQ A;  2WAQ L;  1PJ6 A;  1VJE A;  2P8T A;  5IOS A;  4QIW D;  2R7Z K;  2FQT A;  3GTM A;  1BS2 A;  4GT9 A;  1XXA A;  4A3G C;  3L4J A;  4BLB A;  5C44 C;  2A6H A;  2JA8 K;  4A3G K;  4GTL A;  1F7V A;  4XSX A;  3SZZ A;  1USO A;  1L0W A;  2WB1 L;  4PAA A;  2PMZ L;  3GEH A;  1O2F B;  1ZVU A;  3H0G C;  2BE5 A;  1JOE A;  5EGE A;  4LLG A;  3HKZ D;  3GDZ A;  1K83 K;  2CW0 A;  1EQR A;  4BXX C;  3PO3 C;  1WIH A;  4O2D A;  1JVI A;  3S17 K;  3GTK A;  2Y3P A;  3OPF A;  1Y1W C;  2P5M A;  3TFI A;  2V6S A;  1SFO A;  3N0B A;  2B63 K;  4YG2 A;  1DCO A;  4GTE A;  4NOI A;  4YFN A;  1VRQ C;  1I50 A;  4A3E C;  5JVO A;  1XXC A;  5TMF A;  3EQL A;  4A3E K;  5M5Y K;  3NUH A;  3GTO K;  1O28 A;  4KDD A;  3WOD A;  1I6H C;  1I3Q K;  2JA6 A;  4KM9 A;  3S14 C;  1WCM C;  4LJZ A;  3S1M C;  1WQG A;  1I6H K;  3S14 K;  1VGX A;  1WCM K;  4C3J C;  4LOW A;  3S1M K;  4A3B C;  4KAR A;  2JA7 A;  4C3J K;  4JK1 A;  1WQH A;  2GSO A;  4C2M K;  5E68 A;  1TWC A;  1TWG A;  4P5A A;  4AH6 A;  3ERE D;  5IOR A;  1TWF C;  1Y1V C;  4GTC A;  4X6A C;  1TWF K;  3M3Y C;  2NVT C;  1Y1V K;  4YFX A;  4PAB A;  4LR2 A;  3M3Y K;  5D4D A;  5M3F K;  3FKI A;  3GTL A;  4KMU A;  5TMC A;  2GSU A;  3LPX A;  3GSI A;  3VA7 A;  2WAQ D;  1V5V A;  3T01 A;  2GAG C;  4C45 A;  5FLM K;  3CQZ K;  3L4K A;  3AD9 C;  1USM A;  1IS1 A;  3GTM C;  3I4M C;  2RGR A;  2PPB A;  4J3N A;  1ISE A;  4KM8 A;  3ADA C;  3FOF A;  4G0U A;  3GTM K;  4Y52 C;  1I6V A;  3GTG C;  3PO2 K;  5IYC C;  2WB1 D;  1SMY A;  2PMZ D; 
#chains in the Genus database with same CATH homology
 2EBB A;  3JST A;  1USM A;  2V6S A;  1F93 A;  1DCO A;  4WIL A;  2V6T A;  3HXA A;  1RU0 A;  4LOW A;  4C45 A;  1USO A;  1DCH A;  1DCP A;  2V6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...