1DCPA

Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
molecule keywords DCOH
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcpA00
1RU0A 1USMA 2EBBA 4LOWA 2V6SA 1DCPA 2V6TA 1DCOA 4WILA 1F93A 1USOA 2V6UA 3JSTA 3HXAA 1DCHA 4C45A
chains in the Genus database with same CATH superfamily
1VGXA 4LR2A 1O26A 4KB2A 2E2HK 2VUMK 2R92C 1O2FB 5EGEA 2R7ZA 4A3FK 3H3VL 1WCMA 3M3YK 4YFKA 1XZQA 4PAAA 3HOZK 4A3GC 1YNJA 4LK1A 4RMFA 4Q5SA 4XCHA 1C0AA 4GT9A 2ZUFA 3A8IA 3S2HC 5EGHA 4BBSC 5IYDK 4G7HA 2JA6K 1EFWA 3L4JA 4OIQA 5IYBK 5TMFA 4A93K 3GTMK 5M3MK 1TWCC 5CHPA 2YU9K 2JA8C 1IQ0A 3I4NC 1Y1WA 1X31C 4Q4ZA 2XCOA 3GTLK 3S1MC 2PPBA 3HOWC 4BY7K 2PA8D 3DXJA 4XSXA 4XSZA 3HOUK 4Y52C 2NVTC 3A8KA 1TWFK 1SFOC 1DCOA 1GE9A 3S16K 3SZZA 1RU0A 3RZOC 4OIRA 2JA5C 2R7ZK 1DCPA 2FQOA 2Y0SL 1UV7A 2JA6A 2XCQA 4KAWX 2FQTA 1WSVA 3EQLA 2D6FC 1ZQ1C 3CAGA 1J6VA 3NUHA 3ADAC 3S2DC 1F93A 1I50C 3GDZA 1R9TC 3M4OK 3PO3C 5FJ8K 4G7OA 4FM9A 1L0WA 4KATA 4BY1C 3PO2K 1B4AA 2RH6A 1ZVUA 2PA8L 3GTQK 4A3LK 4GTCA 3JSTA 5IYDC 3TTGA 4BBSK 4ILDA 4KMAA 1TWCA 5IP9K 1V5VA 4LJZA 2CFAB 2E2IA 4P9SA 1VRQC 1IL2A 4A3DC 1WOSA 4MEXA 1TWCK 2YU9C 1O28A 5D4DA 4KN7A 2JA8K 5M5WK 1XZPA 3CQZA 4PABA 5FLMK 3L4KA 2GSOA 4A3EK 1ZXOA 3S17K 4KMHA 4X6AK 1XPPA 4LLGA 3AQPA 1WORA 3N0CA 1O2AA 4KARA 3GTJC 4G0WA 1PJ7A 5M3FK 4A3KC 4QJVA 4FZBA 2W7VA 2NVYC 4KASA 4KMDA 1ZBSA 3FOEA 4BBRK 3BP8C 3M3YC 1IS1A 2Y3PA 5C44K 3GEHA 4OIPA 4P5AA 3GTQC 4KMUA 1TWAA 2GSNA 3LAPA 1DCHA 1EI6A 4O2DA 4C3HC 2PMZL 3I4MK 1JOEA 3T02A 2CW0A 4A3FC 2YU9A 3T01A 1EQRA 4A3BC 4WILA 3SZYA 4BY1K 3PO2C 5HL8A 1YNNA 2ZFZA 4XLPA 1I3QA 3I4NK 3S14C 4DDQA 1B4BA 4QIWD 1TWFC 4A3LC 3HOYC 2WAQL 2WB1D 1BJTA 2VUMC 3G4CA 3HOVC 3K7AK 4YFNA 3CQZC 5IP7C 3H0GK 3TFJA 3S2DK 3OPFA 4WJ4A 2EBBA 2NVXC 1SFOA 3FOFA 2WB1L 4G0VA 2R7ZC 2NVYK 3A8JA 3TFIA 4KM9A 1WCMC 1TWAC 4LK0A 3S1MK 5M5YK 4ZH4A 5L46A 2BE5A 4G0UA 5IYCK 3GEIA 1XXAA 3S1QC 2NVTK 2NVQK 1DD5A 2R93K 3HKZL 2GAGC 2NVYA 3RZOK 3IPJA 3S1NK 4GTLA 1F7UA 1IBAA 5M5XK 1SMYA 2R93A 3GTLC 3AD9C 1K83A 1BS2A 5IP9C 4JK1A 3S14K 4OIOA 1HQMA 4KC6A 4GTEA 4A3DK 1HI9A 1IE0A 1I50A 1R9TA 2JA5K 4QJVB 4G7ZA 4A3CK 1ISEA 1J6XA 2GSUA 3GTJK 3GTPC 1J6WA 4BBRC 5FLMC 3HOXK 5IP7K 3Q3QA 4KB4A 2B63K 1TWGC 1TWFA 2E2JK 4BLAA 1WOOA 3HOYK 4KDDA 3AD8C 4GZYA 4C2MK 1F9NA 4X6AC 4C3JK 3GTKK 2NVXA 1JVIA 4J3NA 1JQWA 4A3KK 1G51A 4GTFA 1WQGA 2R93C 5C44C 4GTBA 3S1RC 1XZPB 4BXXC 1J98A 3RZDC 1TWAK 3S17C 4C3HK 3AD7C 4LOWA 3N0BA 3HKZD 2A6HA 1O2BA 1VH2A 2E2IK 3CQZK 4C3IK 4A3JK 2XCRB 4AYBD 5JFEA 2GAHC 3GTJA 4KN4A 1TWHK 3H0GC 2O5JA 2JH3A 1VLOA 1BDFA 5IORA 5C3EK 3ERED 3HOVK 2P5MA 3V4GA 2Y0SD 2B63A 2WAQD 5CJ9A 3I4MC 5IYCC 3S1QK 1I3QK 1Y1WC 4C2MC 1F7VA 3K7AC 2JA6C 5TJ3A 2JA7A 1INNA 2P8TA 3LPXA 4YFXA 1I6HK 3BP3A 4LQYA 5C4XC 3AQOA 4P5BA 1ZYRA 4A3MC 1BGWA 1WQHA 4BLBA 2PMZD 1XZQB 3WODA 1KQ4A 3GTQA 1Y1VK 4GTAA 3N3YA 4NOIA 3HOWK 5IOTA 4BY7C 1O24A 3HOUC 4A3BK 2V6UA 3FKIC 2RGRA 2JA7K 1PJ6A 5JVOA 4C3IC 1SFOK 1TWGA 4A3IK 4A3GK 3LAJA 2E2HC 4WJ3M 1WCMK 4BXXK 4AH6A 1TWHC 1WQFA 3TFHA 1EH1A 1USOA 2A68A 2ZUEA 2KWAA 4M1XA 2B63C 2V6TA 1XXBA 3GTKC 3H3VD 3GTPK 5C4JK 3S15C 2V6SA 2NVXK 3H0GA 3HOZC 1IW7A 3M4OC 4A3CC 5IYBC 3AH5A 1TWGK 3QX3A 4A93C 2R92A 3S2HK 3T00A 3GTOC 3GIRA 2NVQC 1YX2A 4Y52K 4C3JC 1I6HC 1K83C 3GTLA 3RZDK 2E2IC 2E2HA 3S1NC 1VJEA 1I50K 1R9TK 3S16C 2JA5A 2R92K 4OINA 4Y7NC 1Y1VA 3GTGC 3GTMC 1XXCA 3GTOA 1O29A 3G4AA 3MMLB 2O5IA 4MQ9A 1O27A 1YCLA 3GSIA 1AB4A 3S0XA 4GTDA 4GFQA 1WOPA 3GTGA 2PHCB 3HOXC 3FHZA 3GEEA 5TMCA 3FKIK 3HXAA 1TWHA 3PO3K 1USMA 3S1RK 1I3QC 1O25A 1Y1WK 3GTPA 2CFAA 4MEYA 4XLNA 2E2JC 5C3EC 4YG2A 1I6VA 4QIWL 4AYBL 4A3MK 1EK8A 4C45A 1WIHA 3GTOK 3FKIA 5IOSA 1WSRA 3BUEA 1PJ5A 4A3JC 2A6EA 5C4JC 3S15K 3GTMA 5E68A 1Y1VC 4A3IC 3OREA 3OEPA 2A69A 5C4XK 4Y7NK 3VA7A 4A3EC 2JA7C 3GTGK 3GTKA 5IOQA 2VUMA 4KM8A 1K83K 4BKWA
chains in the Genus database with same CATH topology
1RU0A 1USMA 2EBBA 4LOWA 2V6SA 1DCPA 2V6TA 1DCOA 4WILA 1F93A 1USOA 2V6UA 3JSTA 3HXAA 1DCHA 4C45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU0 A;  1USM A;  2EBB A;  4LOW A;  2V6S A;  1DCP A;  2V6T A;  1DCO A;  4WIL A;  1F93 A;  1USO A;  2V6U A;  3JST A;  3HXA A;  1DCH A;  4C45 A; 
#chains in the Genus database with same CATH topology
 1VGX A;  4LR2 A;  1O26 A;  4KB2 A;  2E2H K;  2VUM K;  2R92 C;  1O2F B;  5EGE A;  2R7Z A;  4A3F K;  3H3V L;  1WCM A;  3M3Y K;  4YFK A;  1XZQ A;  4PAA A;  3HOZ K;  4A3G C;  1YNJ A;  4LK1 A;  4RMF A;  4Q5S A;  4XCH A;  1C0A A;  4GT9 A;  2ZUF A;  3A8I A;  3S2H C;  5EGH A;  4BBS C;  5IYD K;  4G7H A;  2JA6 K;  1EFW A;  3L4J A;  4OIQ A;  5IYB K;  5TMF A;  4A93 K;  3GTM K;  5M3M K;  1TWC C;  5CHP A;  2YU9 K;  2JA8 C;  1IQ0 A;  3I4N C;  1Y1W A;  1X31 C;  4Q4Z A;  2XCO A;  3GTL K;  3S1M C;  2PPB A;  3HOW C;  4BY7 K;  2PA8 D;  3DXJ A;  4XSX A;  4XSZ A;  3HOU K;  4Y52 C;  2NVT C;  3A8K A;  1TWF K;  1SFO C;  1DCO A;  1GE9 A;  3S16 K;  3SZZ A;  1RU0 A;  3RZO C;  4OIR A;  2JA5 C;  2R7Z K;  1DCP A;  2FQO A;  2Y0S L;  1UV7 A;  2JA6 A;  2XCQ A;  4KAW X;  2FQT A;  1WSV A;  3EQL A;  2D6F C;  1ZQ1 C;  3CAG A;  1J6V A;  3NUH A;  3ADA C;  3S2D C;  1F93 A;  1I50 C;  3GDZ A;  1R9T C;  3M4O K;  3PO3 C;  5FJ8 K;  4G7O A;  4FM9 A;  1L0W A;  4KAT A;  4BY1 C;  3PO2 K;  1B4A A;  2RH6 A;  1ZVU A;  2PA8 L;  3GTQ K;  4A3L K;  4GTC A;  3JST A;  5IYD C;  3TTG A;  4BBS K;  4ILD A;  4KMA A;  1TWC A;  5IP9 K;  1V5V A;  4LJZ A;  2CFA B;  2E2I A;  4P9S A;  1VRQ C;  1IL2 A;  4A3D C;  1WOS A;  4MEX A;  1TWC K;  2YU9 C;  1O28 A;  5D4D A;  4KN7 A;  2JA8 K;  5M5W K;  1XZP A;  3CQZ A;  4PAB A;  5FLM K;  3L4K A;  2GSO A;  4A3E K;  1ZXO A;  3S17 K;  4KMH A;  4X6A K;  1XPP A;  4LLG A;  3AQP A;  1WOR A;  3N0C A;  1O2A A;  4KAR A;  3GTJ C;  4G0W A;  1PJ7 A;  5M3F K;  4A3K C;  4QJV A;  4FZB A;  2W7V A;  2NVY C;  4KAS A;  4KMD A;  1ZBS A;  3FOE A;  4BBR K;  3BP8 C;  3M3Y C;  1IS1 A;  2Y3P A;  5C44 K;  3GEH A;  4OIP A;  4P5A A;  3GTQ C;  4KMU A;  1TWA A;  2GSN A;  3LAP A;  1DCH A;  1EI6 A;  4O2D A;  4C3H C;  2PMZ L;  3I4M K;  1JOE A;  3T02 A;  2CW0 A;  4A3F C;  2YU9 A;  3T01 A;  1EQR A;  4A3B C;  4WIL A;  3SZY A;  4BY1 K;  3PO2 C;  5HL8 A;  1YNN A;  2ZFZ A;  4XLP A;  1I3Q A;  3I4N K;  3S14 C;  4DDQ A;  1B4B A;  4QIW D;  1TWF C;  4A3L C;  3HOY C;  2WAQ L;  2WB1 D;  1BJT A;  2VUM C;  3G4C A;  3HOV C;  3K7A K;  4YFN A;  3CQZ C;  5IP7 C;  3H0G K;  3TFJ A;  3S2D K;  3OPF A;  4WJ4 A;  2EBB A;  2NVX C;  1SFO A;  3FOF A;  2WB1 L;  4G0V A;  2R7Z C;  2NVY K;  3A8J A;  3TFI A;  4KM9 A;  1WCM C;  1TWA C;  4LK0 A;  3S1M K;  5M5Y K;  4ZH4 A;  5L46 A;  2BE5 A;  4G0U A;  5IYC K;  3GEI A;  1XXA A;  3S1Q C;  2NVT K;  2NVQ K;  1DD5 A;  2R93 K;  3HKZ L;  2GAG C;  2NVY A;  3RZO K;  3IPJ A;  3S1N K;  4GTL A;  1F7U A;  1IBA A;  5M5X K;  1SMY A;  2R93 A;  3GTL C;  3AD9 C;  1K83 A;  1BS2 A;  5IP9 C;  4JK1 A;  3S14 K;  4OIO A;  1HQM A;  4KC6 A;  4GTE A;  4A3D K;  1HI9 A;  1IE0 A;  1I50 A;  1R9T A;  2JA5 K;  4QJV B;  4G7Z A;  4A3C K;  1ISE A;  1J6X A;  2GSU A;  3GTJ K;  3GTP C;  1J6W A;  4BBR C;  5FLM C;  3HOX K;  5IP7 K;  3Q3Q A;  4KB4 A;  2B63 K;  1TWG C;  1TWF A;  2E2J K;  4BLA A;  1WOO A;  3HOY K;  4KDD A;  3AD8 C;  4GZY A;  4C2M K;  1F9N A;  4X6A C;  4C3J K;  3GTK K;  2NVX A;  1JVI A;  4J3N A;  1JQW A;  4A3K K;  1G51 A;  4GTF A;  1WQG A;  2R93 C;  5C44 C;  4GTB A;  3S1R C;  1XZP B;  4BXX C;  1J98 A;  3RZD C;  1TWA K;  3S17 C;  4C3H K;  3AD7 C;  4LOW A;  3N0B A;  3HKZ D;  2A6H A;  1O2B A;  1VH2 A;  2E2I K;  3CQZ K;  4C3I K;  4A3J K;  2XCR B;  4AYB D;  5JFE A;  2GAH C;  3GTJ A;  4KN4 A;  1TWH K;  3H0G C;  2O5J A;  2JH3 A;  1VLO A;  1BDF A;  5IOR A;  5C3E K;  3ERE D;  3HOV K;  2P5M A;  3V4G A;  2Y0S D;  2B63 A;  2WAQ D;  5CJ9 A;  3I4M C;  5IYC C;  3S1Q K;  1I3Q K;  1Y1W C;  4C2M C;  1F7V A;  3K7A C;  2JA6 C;  5TJ3 A;  2JA7 A;  1INN A;  2P8T A;  3LPX A;  4YFX A;  1I6H K;  3BP3 A;  4LQY A;  5C4X C;  3AQO A;  4P5B A;  1ZYR A;  4A3M C;  1BGW A;  1WQH A;  4BLB A;  2PMZ D;  1XZQ B;  3WOD A;  1KQ4 A;  3GTQ A;  1Y1V K;  4GTA A;  3N3Y A;  4NOI A;  3HOW K;  5IOT A;  4BY7 C;  1O24 A;  3HOU C;  4A3B K;  2V6U A;  3FKI C;  2RGR A;  2JA7 K;  1PJ6 A;  5JVO A;  4C3I C;  1SFO K;  1TWG A;  4A3I K;  4A3G K;  3LAJ A;  2E2H C;  4WJ3 M;  1WCM K;  4BXX K;  4AH6 A;  1TWH C;  1WQF A;  3TFH A;  1EH1 A;  1USO A;  2A68 A;  2ZUE A;  2KWA A;  4M1X A;  2B63 C;  2V6T A;  1XXB A;  3GTK C;  3H3V D;  3GTP K;  5C4J K;  3S15 C;  2V6S A;  2NVX K;  3H0G A;  3HOZ C;  1IW7 A;  3M4O C;  4A3C C;  5IYB C;  3AH5 A;  1TWG K;  3QX3 A;  4A93 C;  2R92 A;  3S2H K;  3T00 A;  3GTO C;  3GIR A;  2NVQ C;  1YX2 A;  4Y52 K;  4C3J C;  1I6H C;  1K83 C;  3GTL A;  3RZD K;  2E2I C;  2E2H A;  3S1N C;  1VJE A;  1I50 K;  1R9T K;  3S16 C;  2JA5 A;  2R92 K;  4OIN A;  4Y7N C;  1Y1V A;  3GTG C;  3GTM C;  1XXC A;  3GTO A;  1O29 A;  3G4A A;  3MML B;  2O5I A;  4MQ9 A;  1O27 A;  1YCL A;  3GSI A;  1AB4 A;  3S0X A;  4GTD A;  4GFQ A;  1WOP A;  3GTG A;  2PHC B;  3HOX C;  3FHZ A;  3GEE A;  5TMC A;  3FKI K;  3HXA A;  1TWH A;  3PO3 K;  1USM A;  3S1R K;  1I3Q C;  1O25 A;  1Y1W K;  3GTP A;  2CFA A;  4MEY A;  4XLN A;  2E2J C;  5C3E C;  4YG2 A;  1I6V A;  4QIW L;  4AYB L;  4A3M K;  1EK8 A;  4C45 A;  1WIH A;  3GTO K;  3FKI A;  5IOS A;  1WSR A;  3BUE A;  1PJ5 A;  4A3J C;  2A6E A;  5C4J C;  3S15 K;  3GTM A;  5E68 A;  1Y1V C;  4A3I C;  3ORE A;  3OEP A;  2A69 A;  5C4X K;  4Y7N K;  3VA7 A;  4A3E C;  2JA7 C;  3GTG K;  3GTK A;  5IOQ A;  2VUM A;  4KM8 A;  1K83 K;  4BKW A; 
#chains in the Genus database with same CATH homology
 1RU0 A;  1USM A;  2EBB A;  4LOW A;  2V6S A;  1DCP A;  2V6T A;  1DCO A;  4WIL A;  1F93 A;  1USO A;  2V6U A;  3JST A;  3HXA A;  1DCH A;  4C45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...