1DCQA

Crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
276
structure length
276
Chain Sequence
LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ARF-GAP domain and ankyrin repeats of PYK2-associated protein beta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords PYK2-ASSOCIATED PROTEIN BETA
total genus 93
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1dcqA02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 1dcqA01
3JXIA 3DEPA 4BETA 3TWRA 2JABA 2FO1E 2DWZA 1DC2A 3C5RA 2V4HC 5ENPD 2CRRA 3HRAA 3T9KA 2ETCA 4OAVB 3KEAA 3UTMA 5ENQD 4K5BA 4LSZE 2KXPC 2XENA 3AAAC 3V2XA 1TR4A 5EN5D 3W9GA 1N0QA 3EHQA 5AN8A 4DRXE 4UUCA 1K3ZD 4J8YA 4NIKA 3HG0D 4DX5D 2AJAA 3LJUX 4HBDA 5CBOA 1BLXB 4CZ2D 4Z68A 5CERB 3SUBA 3NBNB 1IHBA 5AQBA 1BU9A 1S70B 5D66A 3TWSA 4BEPA 3FM8C 4G8KA 5BXUA 4HB5A 5FINA 3O47A 3TWVA 2Y1LE 2QC9A 3V79K 1WDYA 3NOCD 4J7WA 4YDYA 1OY3D 2B0OE 5EIDA 2A5EA 2XZDG 4HQDA 2Y0BG 1YYHA 4GPMA 1BI8B 2VGEA 2XZTG 4HLLA 4CYMD 5ENRD 5CEAA 2RFAA 4HRNA 3UI2A 1D9SA 3MDBC 3V31A 4U8YD 1MYOA 4QFVA 1BD8A 4ATZD 3EU9A 2F37A 2KBXA 4HRLA 2P57A 3LVRE 1G3NB 4LG6A 1MX2A 1MX4A 2HE0A 3Q9UC 4HNAD 5HS0A 3ZU7B 4C48B 5ITZF 2J8SD 1N11A 5KWDA 4GMRA 3B95A 3ZNGA 5CECB 3ZKJA 3FEHA 4B93B 1IXVA 5KBAA 4O1PA 3D9HA 4DX7D 2L6BA 5ENOD 5KNGA 1WG0A 4O1OA 2BKGA 3T8KA 4DX6D 4K5AB 3Q9NC 1YCSB 2NYJA 3F6QA 2ETBA 3J5PA 5ENSD 5AQAA 3TWTA 4DX1A 2CRWA 1YMPA 3V2OA 5BXOA 4DX2A 4O60A 3LVQE 5HRYA 1SVXA 4DUIA 1A5EA 5AQ9A 3EHRA 4K5CA 4BSZB 4JB8P 5CEDB 3TWWA 5KNHD 3ZUVB 4OAUC 3NOGD 3JUEA 5HKPA 1MX6A 2MYOA 3UXGA 3SO8A 2IQJA 2V5QC 4YDWA 4QQIA 2OWAA 5FIOA 3J5QB 3AJIA 1K1BA 4TUMA 1AP7A 1OT8A 1DCQA 1K1AA 5AARA 3V30A 4ZFHA 1IKND 5AAOA 2QYJA 5EYPF 5EYLA 3TWXA 4A63B 2F8YA 1MJ0A 1UOHA 2DZOA 4N5QA 1N0RA 5JMND 3W9FA 3B7BA 5EILA 3LJNA 2RFMA 2BKKB 4HI8A 4U8VD 5CBNA 1SW6A 4HI9A 3IXEA 3TWUA 1AWCB 2P2CP 4F6RD 2DZNA 4U95D 2PNNA 3DEOA 4G8LA 1NFIE 3DWDA 3TWQA 4BERA 4LNUD 2DVWA 4RLYA 4U96D 5AQ7A 4HRMB 2ZGDA 4F1PA 4ZHBA 2XEHA 2ZGGA 5ENTD 4BESA 2XEEA 1BI7B 5EIBE 5JA4D 2F8XK 1QYMA 2ETAA 3JXJA
chains in the Genus database with same CATH superfamily
3G2SA 4GB0A 4ACLA 3MV2B 3PUKA 2ETCA 3DBSA 3IHPA 2XENA 1E8YA 4I43A 3HTKC 5B75A 4NIKA 4EZKA 3JCKC 2AJAA 3ZGQA 1H19A 3M63A 1E7UA 5DKAA 4G8KA 2LAIA 3TWVA 3V79K 1HXIA 2B0OE 5LFAA 4AYCB 3HXFA 1BI8B 4UI9C 1E7VA 4CYMD 4EQFA 3ISMC 4RG9A 4FJZA 1TN7A 3FJUB 3D3MA 2YINA 4I6JA 4B93B 1IXVA 1N4RA 3VTYA 3PEUB 5ENOD 3Q73A 2LAHA 2NYJA 5H1TA 2ZU6B 3VLEA 3LKUA 3ZPJA 3ZUVB 5CRUA 2LGLA 4I17A 2LSVA 2WXGA 4DI3A 2KCLA 2YQMA 3MCXA 4I9CA 1N4QA 3ZXPA 3I5PA 2XOZA 4U0ZA 1ELKA 1N0RA 1TNYA 2IDAA 4I6EA 3SOXA 4BX9A 4BHWA 3CVLA 3MV3B 5CHEE 2KKXA 3Q15A 2J08A 2DVWA 2GGFA 4I2WA 3LDYA 4XEIG 3QAQA 1MM2A 2F8XK 3VK6A 3SGHA 4AP4A 1FBVA 3IKOB 4BX8A 4M3OA 4W9RA 4I7BA 3O36A 2OXQC 2V4HC 5CCMA 4F3VA 2I2OA 3LDZA 4I1OB 3C3RA 4F53A 4TXPA 5ANRA 2WMOA 2M63A 4WNGA 3B7SA 3FFLA 2M6MA 2OEWA 2IF4A 2MA6A 2XPYA 2IQCA 4S3OC 3KV6A 3FUKA 5CCLA 3GL6A 1OCZE 5G05J 3EB6A 4E6HA 3NQPA 3RO3A 3MDBC 3UIOC 2ILRA 2F37A 3FUNA 3APDA 1XNFA 2DCPA 5TDWA 4AVXA 4U0SA 5FQ7A 1OCRE 5KNGA 4O1OA 4WUYA 3RRUA 3LQHA 3T8KA 5B79A 2WXPA 5AQAA 1SZ9A 2LQ6A 2VSXE 2PM7A 3LVQE 4YBSA 3LY9A 3Q79A 2EINE 4I1MA 4OAUC 2IU1A 3UUXA 1ZB1A 5J08A 2V4LA 2VSYA 3V30A 4ZFHA 2X6HA 3QKYA 2MT5A 1JPLA 4Z0RA 5D0OD 1KZOA 1HG5A 4AXHA 1AWCB 2ZETC 3T6RA 2KWOA 3FH7A 4LNUD 2ZGGA 2EGPA 5KH9A 1Z2QA 4GNGA 2P9KG 2KU3A 3SZ7A 3UQ3A 5AIUA 1JCSA 3DEPA 3CHMA 3PEVB 1TN6A 3E4BA 3OTNA 3KEAA 4LSZE 3C5KA 2KXPC 5TDRA 3O33A 5AN8A 5J90A 4J8YA 2JMDA 1H2TC 2GRNB 3GV4A 3BG1B 5FINA 5BV0A 3APFA 1UN9A 3CSFA 3O70A 2YYRA 2PNXA 4IULA 1D8DA 4HRNA 1OCCE 3PLWA 2UY1B 1V87A 4U8YD 2PUYA 1MYOA 1BD8A 1TJFA 1Z5SC 3RO2A 2D8UA 4JHJA 2HE0A 3LY7A 3ZKJA 3FEHA 2FI7A 5A23A 2L6BA 5LCWJ 4B86C 3CVWA 1W3BA 4XI9A 5LKTA 2B6CA 1SVXA 5AYWD 3EHRA 4WWOA 1UJKA 4JB8P 3ZYMA 2R05A 3TWWA 3O7AA 3UXGA 3ASDA 1AP7A 1OT8A 1DCQA 3NF1A 3RK6A 3CQCB 2P9UG 2QYJA 3DSSA 5EYLA 3LJ3A 5BV1A 4MS6A 4A1GA 3CHSA 4K03A 3DRAA 3CVNA 4FLHA 4JEHA 3N71A 5J3XA 3KSQA 4HOSA 4Q94A 1EYHA 2NSZA 4LERA 3L17A 3GW4A 5T8IA 4S3OB 3QOUA 4N39A 3O48A 3JXIA 1TN8A 4UQYA 1NL4A 2XEVA 4DJAA 2EILE 1IQRA 4QF3A 4YATA 2HR2A 2M1RA 3OXLA 4C9ZA 5EN5D 1IHGA 2RI7A 2KZTA 2DBAA 1KT0A 4J8EA 4A4CA 2WB2A 2F6JA 2JEKA 1HE8A 4JVSA 4N3BA 4YDOA 3RU0A 2YQLA 1L5JA 4GTVA 5FZQA 3C3QA 4V3IA 2FUUA 2AW6A 3MJWA 1H6OA 5ENRD 1XGWA 4FO9A 3AG4E 2UZGA 2A5UA 1QQEA 4QFVA 3Q75A 2QIZA 2YHEA 2FBNA 2HO1A 3N9MA 3AG1E 4F7AA 2L43A 4YAXA 3NG2A 2P9LG 2V5FA 2CSZA 5G55A 3LY8A 4DX7D 3ZYLA 2JUNA 2GROB 4UWGA 1Z3YA 4U8HA 3N9QA 4QF2A 2MOWA 5FERA 4YVOA 2XEUA 3ZYKA 1JM7B 5D1KB 2XS1A 3JUEA 2L7PA 2HDPA 2CG2A 3B7TA 2VJEB 2XGMA 2LXPC 5AAOA 4R7EA 4A63B 4R7LA 4TUUA 3SBTB 4IC2A 2L75A 4HI8A 5CBNA 1KPSB 3FDHA 4JA7A 2KE1A 3LCAA 4P29A 4EBAA 4YC9A 2RD0A 1VFYA 2WXJA 2WXFA 3M99A 3ESKA 1JM7A 4RLYA 2XHEA 3BU8A 3AS4A 1LD7A 4C0MA 5B76A 4EBAG 3CR3A 4JHRA 1KZPA 1RW2A 4ATGA 2XOYA 2CHZA 2LXMA 2XQ0A 3HYMB 2WXQA 2WXNA 2YURA 3DWLG 2GRPB 2YNQA 4NURA 3AAAC 2VSNA 2WXMA 2GRLA 3EHQA 1X4UA 1TNBA 3JYSA 3PH0C 3ZNIA 3S7FA 2HM8A 5AJLA 4GA2A 3G2WA 3EHMA 5G04B 3SUBA 4UWLA 5D66A 2VTBA 4U63A 3RPGC 4KXKB 3ZTGA 4J7WA 4WZ3B 3ZVYA 4HQDA 2X6IA 4GPMA 2Y69E 3QARA 3DXKG 3L6AA 4AP2A 5ARFA 5EYAF 2P57A 4W4UA 5EX3A 2JMJA 4HNAD 4LKAA 2EGMA 4U0UA 5CECB 4ANWA 3TXMA 4L9PA 4GTQA 4L58A 3MHHA 1X4IA 2MNYA 3WXXA 4HVBA 2CRWA 3B7RL 2ECIA 3QB2A 3ULEG 3PZ1A 1TYQG 4GPKA 5CEDB 3U64A 4FA6A 4YBTA 3SY2A 1N4PA 3LEWA 2WXRA 4GTTA 3GZ1A 5M72A 2J09A 2VJ8A 3Q49B 1JUQA 5ENNA 4URKA 1BORA 3M62A 4BT8A 5EILA 2BKKB 1N9AA 5EKQD 1FVHA 4BFRA 3S7BA 2CSYA 2UY1A 2EODA 3JUIA 3PVLA 3PREA 2MNZA 2ZGDA 4ZHBA 3MGBA 2VTBB 1N54A 3QWVA 3PE4A 2OV8A 2I50A 2L0IA 2XGSA 1S0PA 3HXDA 2ECNA 4TRQA 2JABA 3APCA 2FO1E 2Y1MA 5JHAA 2EXUA 4CDRA 1K2FA 4FLBA 3FTXA 4OAVB 4GAAA 4N4FA 1IYGA 1WFKA 1N0QA 4I7CA 3ASFA 2F0YA 1U3DA 3KEZA 1A17A 3C3OA 3HG0D 3SHFA 1IHBA 3TWSA 3LQJA 2K4DA 2QC9A 4BBQA 1E8ZA 1GW6A 3ZHEB 1JWGA 5TBNA 1D8EA 2MKEA 2RFAA 3BQOA 4YVQC 1ELRA 1HF8A 4LRZA 2XB1A 5C13A 2UWJG 3O4ZA 4ATZD 4LG6A 3SOWA 1FP0A 5JJ6A 3UT8A 4LADB 2I1JA 4JD2G 1FCHA 3MA5A 2LXLA 5B1BE 4B8AA 3UPVA 3S7JA 5BXOA 4G11A 2ZISA 2LNIA 2PZIA 1ZU2A 5DBKA 4JA9A 4DLQA 2EIME 3ZPV1 1XWHA 1NP7A 3CVQA 3RAUA 3T5VA 5AARA 3EB5A 3CVYA 3S2AA 4GU5A 1SQMA 3KDEC 5FJYA 4CRWA 2KCVA 3MKRA 3SFZA 2YQ8A 3FTVA 2WPVA 2XEHA 1BI7B 2KCKA 3EIJA 1V55E 3HIZA 4APOA 1DC2A 5E76A 3GZSA 4B7YC 4K5BA 5B8DA 4IC3A 2P9NG 1ZBDB 4GZCA 3PZ2A 4G2VA 2J49A 4GZ3A 1EDUA 5CERB 2GW1A 2K1JA 2PQNA 2QFCA 1JCQA 4XI0A 1MQSA 3CV0A 4J6IA 1TEZA 3HXBA 4N2QA 1WEOA 2M3HA 4JPSA 4HLLA 4Q96A 4BWRA 3LPZA 3MEKA 2KFTA 2K17A 3V31A 2XCBA 2HYZA 2BF0X 4JC8A 3PUQA 3D9PA 3HVEA 5KJLA 4H7XA 4EZJA 2QICA 4AY5A 2E61A 1WEVA 2YSMA 1WIMA 4GB9A 4YBMA 5ENSD 3FU6A 3KD7A 3IBEA 4DX2A 2K16A 3CVPA 3D9OA 1JOCA 4XKBA 4FHKA 3C6WA 3E37A 5JJTA 1ZBPA 2BAYA 1WE9A 1HO8A 4XKCA 1K1BA 1VD4A 4XE0A 3CVUA 1WESA 2WXOA 2LN0A 5BNWA 1QNFA 1X4JA 1OWPA 3K9IA 1SW6A 4P5OB 1OWOA 3QC1A 2KZTB 4AEZC 4O6FA 2LAUA 4D10C 3QZVA 4TKPB 3N9PA 4HRMB 2VPBA 2L0BA 3QDNA 2FFWA 5JA4D 4LNGA 1TJCA 4ANXA 3SFXA 2GRRB 2QY7A 2E6SA 1LD8A 3O34A 2Y1NA 4DI4A 3C5RA 3JQ1A 5D1LB 3GYZA 2KWJA 3HXEA 4MBGA 2J4DA 4FJYA 4GYYA 2EIKE 1MM3A 3Q5MA 2KREA 4DRXE 3E34A 3FUIA 3FUHA 4Z0OA 5CBOA 3BG0B 3Q7AA 5BW8C 4CDNA 1BU9A 3AS8A 4C0EA 3ZYQA 4HB5A 5I3LA 2VPGA 4KMOA 4MSXA 2XCCA 5JJ7A 4JHKA 1EF1C 3N9OA 2FO7A 5CEAA 3TGOA 1PAQA 3UI2A 3U5NA 3ZW3A 4KVOA 3PZDA 2LGGA 3FTZA 3SQVA 3ZU7B 4WZ0A 4FADA 2J8SD 4L7XA 3PNTB 4O1PA 3ZVZB 2VPDA 3U5OA 1X81A 4G23A 5BT1A 4F52B 1INZA 2QJ0A 3DPDA 2ETBA 4DX1A 3ULYA 3AG3E 4BT9A 5ARGA 2IFUA 3E30A 4ZDTA 3FUEA 1H2UA 3C98A 4TXQA 1WM5A 3CVXA 1E96B 3ML8A 3ZIMA 3TG4A 4A3TA 3ZPVE 3QWPA 4K0RA 3FP3A 1N4SA 5ANLA 4PS7A 4GTOA 3CGHA 1UW4B 4PH4B 1S64A 4PS8A 4WNDA 2JM3A 4YABA 5KH7A 2VJFB 2IOSA 3IHVA 1U3CA 2P2CP 3NZSA 3DSWA 1HU3A 4KT6B 4L2YA 4F1PA 5FT9A 3TL5A 4NRHB 5ENTD 4BESA 1HYJA 2CFUA 1QYMA 4I9EA 3M7KA 3MKQA 3UINC 2R2LA 2PQRA 4ME2A 5FQ8A 5HQ8A 1WEUA 4APFA 4DLOA 4B8CB 3FUJA 4FP7A 2LGVA 3PRZA 2VJFA 4J8DA 5EDSA 3UMVA 4UUCA 3UKRG 4HOTA 4UP0A 2WMNA 4ILHB 4BY6A 1OWNA 1TNUA 5EX0A 2AXUA 4KYOB 1CHCA 2Y0BG 3FUFA 2XZTG 3UT7A 3PE3A 4UI9J 3OAWA 4JEUA 2EIJE 1V54E 3EDTB 1MX4A 2EQXA 5G2NA 3TXNA 4LLBA 2I1KA 3UM2A 3D9IA 1UG3A 3T7LA 5LCWC 1E90A 3V2OA 3I3NA 1HS6A 2GRMA 5D1MB 5A7DB 3D9NA 4CGWA 1A5EA 5SVIB 1WILA 3LXUX 2R02A 3TG5A 3OXFA 3FU0A 4G24A 5HKPA 3FEYA 1H2VC 4AIFA 4EECA 2ZXWE 2MA5A 4HOQA 4WWPA 5EYPF 1HG2A 1MJ0A 2DZOA 2XOCA 2FF4A 4G25A 4JL0A 4U8VD 2RFMA 2VGXB 1OUVA 3FH8A 3G2VA 4I1AA 2AXZA 4OYSA 3L13A 3TWQA 2GRQB 2MIQA 4UWKA 5B78A 4E85A 2Q7FA 2VP7A 4GTSA 4RQIA 2YREA 3B13A 2ECJA 1NA3A 2DJAA 2V8SE 4B89A 3O35A 1HX8A 1N94A 4V3LC 2YW8A 2X3MA 3AU4A 5ENPD 5LOZA 5AITA 4RSYA 2VGXA 4CEMA 2Y4UA 3ML9A 4HOUA 1WGMA 3ZRHA 3ABLE 2DYSE 1SA4A 1K3ZD 5G0FA 4NQ0A 3T5XA 4HBDA 3G2UA 3ZVVA 1JWFA 1U2VG 2XRYA 3KAEA 3URZA 3FUMA 2LDRA 4MVTA 1S70B 3FM8C 4GNFA 3EUVA 2IEJA 2Y1LE 5BUZA 3L11A 5KH3A 1WENA 3PZ3A 4EPZA 1Q2ZA 2Y4TA 3FWVA 2CHWA 2P9SG 4FIPA 4OGEA 2P9PG 4B0ZA 1FPPA 1MX2A 5HS0A 3RRMB 4GMRA 3B95A 3CQGB 2XGOA 4KVMA 3DQVR 1WG0A 1E8XA 2XPIA 3MZLB 3PZ4A 2D8SA 5FEYA 2RSDA 4K5CA 4HFGA 5FB1A 3HDXA 2CHXA 4LUNU 1N52A 4TUMA 3KNVA 4ACKA 2YUCA 1ELWA 4EZLA 5FZSA 4WAFA 4Q6FA 3X2QE 2MD7B 4F6RD 3FULA 4L23A 3L22A 3DWDA 1O1TA 2WM9A 3U5PA 3SF4A 2OEVA 3FU3A 2JMIA 5JHBA 1OWMA 4N2SA 2E2EA 1FT1A 2J9QA 2IONA 3L1XA 2KWNA 2X6FA 3C72A 5CMWA 3E33A 3CIAA 1NI1A 2OOEA 3ZFWA 2XRZA 1B89A 3DPLR 2IJGX 4N5CA 3CSTA 2H6IA 3SOUA 3LJUX 2R03A 2WQHA 3NBNB 1Z60A 5BXUA 1WDYA 1UN8A 3IV0A 4U07A 5H9MA 1OY3D 4BTAA 5JG6A 4PPEA 1YYHA 1DCEA 2YSJA 5D2MC 2C0LA 1G25A 3DSXA 1D9SA 1MHQA 3ABME 3ONKA 3LVRE 2J4BA 2WXIA 4C48B 1DVPA 3ZNGA 3ENEA 4BSXA 2FULA 2QZAA 2WXLA 2FSAA 2P9IG 4ZUXU 2MHKA 4GCNA 2BEDA 4RVBA 4U04A 4JXTA 1BPOA 3VLDA 2DSMA 1MX6A 2MYOA 2IQJA 2H0DA 5FIOA 4CDMA 2KM4A 3CK9A 4XI1A 2KR4A 4UI9K 5CMYA 3RPGB 1E8WA 2H6GA 3LRQA 3ZXSA 2DYRE 3PDNA 3I2DA 4ABNA 5SVYA 1X5BA 4J8FA 2OCCE 2LGKA 2YHNA 3UM3A 4PDXA 4GA0A 4A1SA 1IKND 3FAOA 2V0PA 3PUJA 1F62A 1NZNA 4GZ6A 2R17C 4FHJA 1Y8MA 1QBQA 1Z6TA 4J8SA 3T9KA 3FY4A 3UTMA 3DSTA 3N9LA 4G1TA 4DPRA 5H1UA 4RG6A 3FHEA 4WWNA 2E0IA 1H6PA 1YA0A 1TNZA 4GTRA 3CVVA 5G05B 4CZ2D 2G45A 4PTBA 4BTBA 4FULA 2R59A 4ANUA 3Q1DA 1U6GB 3AU5A 5AENA 5G04C 4NACA 1HZ4A 2XZDG 1K8KG 3BUAA 3Q47B 3FU5A 4UWFA 4WNFA 3KQIA 2RG8A 3FUDA 3HCUA 4GNDA 4R2YA 4LK9A 4CA1A 3CHRA 2F42A 1DNPA 1TNOA 5ITZF 3FANA 1LF8A 3D9HA 5DINA 3SHBA 3SI5A 4K5AB 1YCSB 4B94A 2MD8C 2YHCA 3J5PA 4OVVA 4O60A 5LP0A 4C9BB 4AJWA 2X6JA 3RJVA 2IO3C 4A49A 3CKBA 4GA1A 3I4GA 4G26A 4ILGA 4O62A 3D9LA 3IHYA 3QK0A 2JRJA 4AY6A 3LQIA 2VGYA 4JZYA 3ABKE 2KIZA 2F8YA 1N95A 4N5QA 2A4ZA 4CCGX 3IEGA 5JMND 3W9FA 2LV9A 2OVBA 3L54A 3E32A 3Q78A 3UX4A 3ESLA 5KCMA 2LXHC 2DIWA 4IN3B 5EIBE 1MZCA 3NAWA 3H7HA 5D0QD 4NN2A 2ETAA 5FZRA 4BETA 5K3QA 2DWZA 2IO2C 3B7UX 3HRAA 2G43A 4LNBA 4IRUA 3D9JA 3MHSA 2WXKA 4LJNA 2WQ7A 2AWIA 3FTYA 3V2XA 1TR4A 1RZ4A 1PY1A 2J07A 2G6QA 3LS8A 3D9MA 2H6HA 3L08A 1O5MA 4ANVA 5H7PA 4GTMA 4WNEA 2E6RA 3O47A 5KJMA 3EU5A 3NOCD 2M85A 4O64A 1KLXA 2YT5A 5G05C 3OXGA 1FT2A 2WXHA 3R9AB 4N3WA 3SFYA 3KV5A 2RR4A 3PS6A 1FVFA 2CT2A 3EU9A 3T8MA 1VDYA 4MKTA 4FC8A 3KS2A 5KWDA 2KWKA 4CGVA 4Q69A 2H6FA 3HCTA 3F6QA 3TWTA 2YHOA 4TV3A 1YMPA 3MX3A 2KYUA 2EA6A 2IY0C 5AQ9A 3RRNB 3U66A 1WEEA 4J0UA 2IOLA 5KNHD 3KSLA 5SVXA 3SO8A 3AS5A 2XPZA 4YDWA 4QQIA 3J5QB 5TRBA 3Q4AB 1PC2A 1UJJA 4XIFA 1HFAA 4KZCA 4AV7A 3ASOE 2MRIA 2WQ6A 2WVIA 1IQUA 2M13A 4OVUA 3I4RB 3LJNA 2HYED 4HI9A 4L2LA 2CFZA 1Z6UA 3R9MA 3RKVA 5AQ7A 2NAAA 3P2BA 3HVEB 1LDKC 4HORA 1LDJB 3JXJA 3FTWA 4HS2A 4CT0A 2NXPA 1E4UA 4YNDA 3FH5A 4AYCA 3DXMG 2CRRA 2FUIA 1WY6A 5ENQD 4GTPA 4UQZA 3DSUA 3UM0A 2L5UA 1T1HA 4AUQB 1H0AA 3CHOA 3E2DA 3LYAA 2JLBA 3UKUG 2H0DB 3NZUA 5HI7A 4ILIA 3FTSA 4DX5D 4GMJA 3GZ2A 4H7YA 1HYIA 4GCOA 4Y6CA 3S7DA 2AVPA 4UWHA 4BEPA 3RIBA 5EIDA 3L1ZB 4AM9A 1WEPA 3HXCA 2YVRA 4MLPA 4N3AA 3RTRB 2KBXA 2F6NA 2MUMA 3Q9UC 1N11A 3HHMA 5FQ6A 2KKYA 3CEQA 3Q9NC 2P58C 3QJZA 5T3RA 2FEZA 1OXJA 2X38A 4DUIA 4CT4A 4AOFA 3NB2A 5FB0A 4WZ2A 2OWAA 2I6HA 2DX8A 5B3SE 3V43A 1IYMA 2CG3A 1QZ2A 1O1RA 3SBSA 4KZ0A 3FL2A 1LTXA 3EHNA 3ZEFA 4GMLA 4GZDA 4X8QA 3TWUA 1P5QA 1WEQA 5AJDA 3DEOA 2ZIRA 4G8LA 1OWLA 4XZ4A 1WEWA 3P1UA 4BERA 3CHQA 3U9WA 1Z3XA 3ONLA 2FD4A 5A6CA 4V3KC 4HLEA 2C2VS 3TWRA 1VYXA 1JCRA 2ECWA 2L80A 5LCWB 2C0MA 3EJNA 3O37A 5SVIA 4YADA 4QQ4A 2AXVA 2PL2A 5H1VA 5LX8A 3D9KA 5E75A 2R5SA 4PS3A 5B1AE 1RMDA 5C11A 2LSUA 4EHMA 4Z68A 1EPUA 3ASHA 5AQBA 4YDEA 4L1BA 4F1SA 4WA6A 5KJNA 3UIPC 3EIQC 3N9NA 3UT4A 3R7QA 3WG7E 4IYPA 2A5EA 1WEMA 1H6KA 3L82A 2CSVA 3VTXA 2VGEA 1WAO1 1Y6IA 3SNXA 4I7DA 3ULQA 4DK5A 5LKUA 3U5MA 1HH8A 1NA0A 4HRLA 3U3WA 5BPPA 2L9BA 2VNFA 3PHDA 5KBAA 5FQ4A 3L16A 3ASGA 3MKQB 3L9TA 2ECGA 2VPEA 5DIZA 3ASLA 5HRYA 2CKLA 2VYIA 4HXIA 3FTUA 2KC7A 2VJEA 4LEUA 3AJIA 4KBQA 4UQXA 2L0TB 5C2YA 3SD5A 2QYUA 2XP0A 3QNKA 1KT1A 4UI9B 3ZHEA 3DPYA 4N3CA 4GZ5A 3QWWA 2DZNA 2BTDA 3ZN3A 4A4BA 4U95D 4ZQLA 2CKLB 1NFIE 1OCOE 4U96D 4FU3A 4Y6WA 2L6JA 4I6GA 2NC9A 3PNLB 4A3VA 4FK5A 2ECVA 5G04J 5TABA 2PM6A 5CRVA 2Y3AA 4X3GA 3MYVA 3Q7FA 4A0CD 4PUCA 1SA5A 4JW1A 3W9GA 5FTPA 4L7TA 3TJPA 4M7CA 3TAXA 3DDTA 3CK8A 4GYWA 2LUHA 2C2LA 3FEXA 4GYOA 4MRUA 4I2ZA 1BLXB 4H9DA 4GNEA 4FJCA 3R7RA 3CHPA 4YDYA 5C1DA 4XX5A 2OVFA 4U7EB 5KJKA 3UM1A 3JQ0A 2ONDA 2LRIC 5T4YA 1G3NB 4TXRA 5AIJA 2ECTA 5LKXA 3ASNE 3BEEA 3AG2E 2BKGA 4DX6D 2I9CA 2KGGA 3VLFA 2XS8A 4OGCA 2VSOE 3CK7A 5FWQA 2AN6A 2X6KA 1SZAA 2YU4A 4BSZB 1S63A 2RKKA 1O1SA 3DSVA 3NOGD 2V5QC 2BUGA 3PURA 1K1AA 2KGIA 3RSEG 2VQ2A 3TWXA 1UOHA 4UP5A 3B7BA 3HCSA 4LCTA 2KATA 3IXEA 2PNNA 3CLJA 2CONA 1N87A 2Y43A 5B77A 5IY5E 4R8PK 5LKZA 4A55A 3U4TA 2LO6A 3CKCA 2XEEA 4CCAA 3G2TA 1MBMA
chains in the Genus database with same CATH topology
3JXIA 2DJAA 3DEPA 4BETA 3TWRA 2XOYA 2JABA 2FO1E 2DWZA 5K3QA 1DC2A 3C5RA 2EXUA 2V4HC 5ENPD 2CRRA 3HRAA 3T9KA 2ETCA 4OAVB 3KEAA 3UTMA 5ENQD 4K5BA 4LSZE 5SVIA 2KXPC 2XENA 3AAAC 3V2XA 1TR4A 5EN5D 3W9GA 1N0QA 4QQ4A 3E2DA 3EHQA 5AN8A 4DRXE 3DDTA 4UUCA 1K3ZD 4J8YA 4Z0OA 4NIKA 3HG0D 4DX5D 2AJAA 3LJUX 4HBDA 5CBOA 1BLXB 4CZ2D 4Z68A 5CERB 4H9DA 3NBNB 3SUBA 1IHBA 5AQBA 1BU9A 1S70B 5D66A 3TWSA 4BEPA 3FM8C 4G8KA 5BXUA 4HB5A 5FINA 3O47A 3Q1DA 3TWVA 2Y1LE 2QC9A 3V79K 1WDYA 3NOCD 4J7WA 4YDYA 1OY3D 2B0OE 5EIDA 2A5EA 2XZDG 4HQDA 2Y0BG 2CSVA 1YYHA 4GPMA 1BI8B 2VGEA 2XZTG 4HLLA 4CYMD 5ENRD 5CEAA 2MKEA 2RFAA 4HRNA 3PLWA 3UI2A 1D9SA 2YVRA 3MDBC 3V31A 4U8YD 3FJUB 1MYOA 4QFVA 2RR4A 1BD8A 4ATZD 2D8UA 3EU9A 2F37A 2KBXA 4OGEA 4HRLA 2P57A 3LVRE 1G3NB 4LG6A 1MX2A 1MX4A 2HE0A 3Q9UC 4HNAD 5HS0A 3ZU7B 4C48B 5ITZF 2J8SD 1N11A 5KWDA 2EGMA 4GMRA 3B95A 3ZNGA 5CECB 3ZKJA 3FEHA 4B93B 1IXVA 5KBAA 4O1PA 3D9HA 4DX7D 2E61A 2L6BA 5ENOD 5KNGA 1WG0A 4O1OA 2JUNA 2BKGA 3T8KA 4DX6D 4K5AB 3Q9NC 1YCSB 2KKYA 2NYJA 3F6QA 2ETBA 3J5PA 5ENSD 5AQAA 3TWTA 4DX1A 4OGCA 2CRWA 1YMPA 3V2OA 5BXOA 4DX2A 4O60A 3LVQE 5HRYA 1SVXA 4DUIA 1A5EA 5AQ9A 3EHRA 4K5CA 4BSZB 4JB8P 5SVIB 5CEDB 3TWWA 5KNHD 3ZUVB 4OAUC 3NOGD 3JUEA 5HKPA 1MX6A 2MYOA 3UXGA 3SO8A 2IQJA 2L7PA 2V5QC 4YDWA 4QQIA 2OWAA 5FIOA 4O62A 3J5QB 3AJIA 1K1BA 4TUMA 1AP7A 1OT8A 1DCQA 1K1AA 5AARA 3V30A 4ZFHA 1IKND 5AAOA 5SVXA 2QYJA 5EYPF 5EYLA 3TWXA 4A63B 2XOZA 2F8YA 1MJ0A 1UOHA 4Z0RA 2DZOA 4N5QA 2JM3A 2XOCA 1N0RA 2M13A 2XP0A 5JMND 3W9FA 3B7BA 5EILA 3LJNA 2RFMA 2BKKB 4HI8A 4U8VD 5CBNA 3KDEC 1SW6A 4HI9A 5SVYA 3IXEA 3TWUA 1AWCB 2P2CP 4F6RD 2DZNA 2KKXA 4U95D 2PNNA 3DEOA 2LAUA 4G8LA 2CONA 1NFIE 3DWDA 3TWQA 4BERA 4LNUD 2DVWA 4RLYA 4U96D 5AQ7A 4HRMB 3LDYA 2ZGDA 4F1PA 4ZHBA 2XEHA 2ZGGA 5ENTD 2FFWA 4BESA 2XEEA 1BI7B 5EIBE 5JA4D 2F8XK 2FD4A 1QYMA 3H7HA 3M7KA 2ETAA 3JXJA 2YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  3DEP A;  4BET A;  3TWR A;  2JAB A;  2FO1 E;  2DWZ A;  1DC2 A;  3C5R A;  2V4H C;  5ENP D;  2CRR A;  3HRA A;  3T9K A;  2ETC A;  4OAV B;  3KEA A;  3UTM A;  5ENQ D;  4K5B A;  4LSZ E;  2KXP C;  2XEN A;  3AAA C;  3V2X A;  1TR4 A;  5EN5 D;  3W9G A;  1N0Q A;  3EHQ A;  5AN8 A;  4DRX E;  4UUC A;  1K3Z D;  4J8Y A;  4NIK A;  3HG0 D;  4DX5 D;  2AJA A;  3LJU X;  4HBD A;  5CBO A;  1BLX B;  4CZ2 D;  4Z68 A;  5CER B;  3SUB A;  3NBN B;  1IHB A;  5AQB A;  1BU9 A;  1S70 B;  5D66 A;  3TWS A;  4BEP A;  3FM8 C;  4G8K A;  5BXU A;  4HB5 A;  5FIN A;  3O47 A;  3TWV A;  2Y1L E;  2QC9 A;  3V79 K;  1WDY A;  3NOC D;  4J7W A;  4YDY A;  1OY3 D;  2B0O E;  5EID A;  2A5E A;  2XZD G;  4HQD A;  2Y0B G;  1YYH A;  4GPM A;  1BI8 B;  2VGE A;  2XZT G;  4HLL A;  4CYM D;  5ENR D;  5CEA A;  2RFA A;  4HRN A;  3UI2 A;  1D9S A;  3MDB C;  3V31 A;  4U8Y D;  1MYO A;  4QFV A;  1BD8 A;  4ATZ D;  3EU9 A;  2F37 A;  2KBX A;  4HRL A;  2P57 A;  3LVR E;  1G3N B;  4LG6 A;  1MX2 A;  1MX4 A;  2HE0 A;  3Q9U C;  4HNA D;  5HS0 A;  3ZU7 B;  4C48 B;  5ITZ F;  2J8S D;  1N11 A;  5KWD A;  4GMR A;  3B95 A;  3ZNG A;  5CEC B;  3ZKJ A;  3FEH A;  4B93 B;  1IXV A;  5KBA A;  4O1P A;  3D9H A;  4DX7 D;  2L6B A;  5ENO D;  5KNG A;  1WG0 A;  4O1O A;  2BKG A;  3T8K A;  4DX6 D;  4K5A B;  3Q9N C;  1YCS B;  2NYJ A;  3F6Q A;  2ETB A;  3J5P A;  5ENS D;  5AQA A;  3TWT A;  4DX1 A;  2CRW A;  1YMP A;  3V2O A;  5BXO A;  4DX2 A;  4O60 A;  3LVQ E;  5HRY A;  1SVX A;  4DUI A;  1A5E A;  5AQ9 A;  3EHR A;  4K5C A;  4BSZ B;  4JB8 P;  5CED B;  3TWW A;  5KNH D;  3ZUV B;  4OAU C;  3NOG D;  3JUE A;  5HKP A;  1MX6 A;  2MYO A;  3UXG A;  3SO8 A;  2IQJ A;  2V5Q C;  4YDW A;  4QQI A;  2OWA A;  5FIO A;  3J5Q B;  3AJI A;  1K1B A;  4TUM A;  1AP7 A;  1OT8 A;  1DCQ A;  1K1A A;  5AAR A;  3V30 A;  4ZFH A;  1IKN D;  5AAO A;  2QYJ A;  5EYP F;  5EYL A;  3TWX A;  4A63 B;  2F8Y A;  1MJ0 A;  1UOH A;  2DZO A;  4N5Q A;  1N0R A;  5JMN D;  3W9F A;  3B7B A;  5EIL A;  3LJN A;  2RFM A;  2BKK B;  4HI8 A;  4U8V D;  5CBN A;  1SW6 A;  4HI9 A;  3IXE A;  3TWU A;  1AWC B;  2P2C P;  4F6R D;  2DZN A;  4U95 D;  2PNN A;  3DEO A;  4G8L A;  1NFI E;  3DWD A;  3TWQ A;  4BER A;  4LNU D;  2DVW A;  4RLY A;  4U96 D;  5AQ7 A;  4HRM B;  2ZGD A;  4F1P A;  4ZHB A;  2XEH A;  2ZGG A;  5ENT D;  4BES A;  2XEE A;  1BI7 B;  5EIB E;  5JA4 D;  2F8X K;  1QYM A;  2ETA A;  3JXJ A; 
#chains in the Genus database with same CATH topology
 3G2S A;  4GB0 A;  4ACL A;  3MV2 B;  3PUK A;  2ETC A;  3DBS A;  3IHP A;  2XEN A;  1E8Y A;  4I43 A;  3HTK C;  5B75 A;  4NIK A;  4EZK A;  3JCK C;  2AJA A;  3ZGQ A;  1H19 A;  3M63 A;  1E7U A;  5DKA A;  4G8K A;  2LAI A;  3TWV A;  3V79 K;  1HXI A;  2B0O E;  5LFA A;  4AYC B;  3HXF A;  1BI8 B;  4UI9 C;  1E7V A;  4CYM D;  4EQF A;  3ISM C;  4RG9 A;  4FJZ A;  1TN7 A;  3FJU B;  3D3M A;  2YIN A;  4I6J A;  4B93 B;  1IXV A;  1N4R A;  3VTY A;  3PEU B;  5ENO D;  3Q73 A;  2LAH A;  2NYJ A;  5H1T A;  2ZU6 B;  3VLE A;  3LKU A;  3ZPJ A;  3ZUV B;  5CRU A;  2LGL A;  4I17 A;  2LSV A;  2WXG A;  4DI3 A;  2KCL A;  2YQM A;  3MCX A;  4I9C A;  1N4Q A;  3ZXP A;  3I5P A;  2XOZ A;  4U0Z A;  1ELK A;  1N0R A;  1TNY A;  2IDA A;  4I6E A;  3SOX A;  4BX9 A;  4BHW A;  3CVL A;  3MV3 B;  5CHE E;  2KKX A;  3Q15 A;  2J08 A;  2DVW A;  2GGF A;  4I2W A;  3LDY A;  4XEI G;  3QAQ A;  1MM2 A;  2F8X K;  3VK6 A;  3SGH A;  4AP4 A;  1FBV A;  3IKO B;  4BX8 A;  4M3O A;  4W9R A;  4I7B A;  3O36 A;  2OXQ C;  2V4H C;  5CCM A;  4F3V A;  2I2O A;  3LDZ A;  4I1O B;  3C3R A;  4F53 A;  4TXP A;  5ANR A;  2WMO A;  2M63 A;  4WNG A;  3B7S A;  3FFL A;  2M6M A;  2OEW A;  2IF4 A;  2MA6 A;  2XPY A;  2IQC A;  4S3O C;  3KV6 A;  3FUK A;  5CCL A;  3GL6 A;  1OCZ E;  5G05 J;  3EB6 A;  4E6H A;  3NQP A;  3RO3 A;  3MDB C;  3UIO C;  2ILR A;  2F37 A;  3FUN A;  3APD A;  1XNF A;  2DCP A;  5TDW A;  4AVX A;  4U0S A;  5FQ7 A;  1OCR E;  5KNG A;  4O1O A;  4WUY A;  3RRU A;  3LQH A;  3T8K A;  5B79 A;  2WXP A;  5AQA A;  1SZ9 A;  2LQ6 A;  2VSX E;  2PM7 A;  3LVQ E;  4YBS A;  3LY9 A;  3Q79 A;  2EIN E;  4I1M A;  4OAU C;  2IU1 A;  3UUX A;  1ZB1 A;  5J08 A;  2V4L A;  2VSY A;  3V30 A;  4ZFH A;  2X6H A;  3QKY A;  2MT5 A;  1JPL A;  4Z0R A;  5D0O D;  1KZO A;  1HG5 A;  4AXH A;  1AWC B;  2ZET C;  3T6R A;  2KWO A;  3FH7 A;  4LNU D;  2ZGG A;  2EGP A;  5KH9 A;  1Z2Q A;  4GNG A;  2P9K G;  2KU3 A;  3SZ7 A;  3UQ3 A;  5AIU A;  1JCS A;  3DEP A;  3CHM A;  3PEV B;  1TN6 A;  3E4B A;  3OTN A;  3KEA A;  4LSZ E;  3C5K A;  2KXP C;  5TDR A;  3O33 A;  5AN8 A;  5J90 A;  4J8Y A;  2JMD A;  1H2T C;  2GRN B;  3GV4 A;  3BG1 B;  5FIN A;  5BV0 A;  3APF A;  1UN9 A;  3CSF A;  3O70 A;  2YYR A;  2PNX A;  4IUL A;  1D8D A;  4HRN A;  1OCC E;  3PLW A;  2UY1 B;  1V87 A;  4U8Y D;  2PUY A;  1MYO A;  1BD8 A;  1TJF A;  1Z5S C;  3RO2 A;  2D8U A;  4JHJ A;  2HE0 A;  3LY7 A;  3ZKJ A;  3FEH A;  2FI7 A;  5A23 A;  2L6B A;  5LCW J;  4B86 C;  3CVW A;  1W3B A;  4XI9 A;  5LKT A;  2B6C A;  1SVX A;  5AYW D;  3EHR A;  4WWO A;  1UJK A;  4JB8 P;  3ZYM A;  2R05 A;  3TWW A;  3O7A A;  3UXG A;  3ASD A;  1AP7 A;  1OT8 A;  1DCQ A;  3NF1 A;  3RK6 A;  3CQC B;  2P9U G;  2QYJ A;  3DSS A;  5EYL A;  3LJ3 A;  5BV1 A;  4MS6 A;  4A1G A;  3CHS A;  4K03 A;  3DRA A;  3CVN A;  4FLH A;  4JEH A;  3N71 A;  5J3X A;  3KSQ A;  4HOS A;  4Q94 A;  1EYH A;  2NSZ A;  4LER A;  3L17 A;  3GW4 A;  5T8I A;  4S3O B;  3QOU A;  4N39 A;  3O48 A;  3JXI A;  1TN8 A;  4UQY A;  1NL4 A;  2XEV A;  4DJA A;  2EIL E;  1IQR A;  4QF3 A;  4YAT A;  2HR2 A;  2M1R A;  3OXL A;  4C9Z A;  5EN5 D;  1IHG A;  2RI7 A;  2KZT A;  2DBA A;  1KT0 A;  4J8E A;  4A4C A;  2WB2 A;  2F6J A;  2JEK A;  1HE8 A;  4JVS A;  4N3B A;  4YDO A;  3RU0 A;  2YQL A;  1L5J A;  4GTV A;  5FZQ A;  3C3Q A;  4V3I A;  2FUU A;  2AW6 A;  3MJW A;  1H6O A;  5ENR D;  1XGW A;  4FO9 A;  3AG4 E;  2UZG A;  2A5U A;  1QQE A;  4QFV A;  3Q75 A;  2QIZ A;  2YHE A;  2FBN A;  2HO1 A;  3N9M A;  3AG1 E;  4F7A A;  2L43 A;  4YAX A;  3NG2 A;  2P9L G;  2V5F A;  2CSZ A;  5G55 A;  3LY8 A;  4DX7 D;  3ZYL A;  2JUN A;  2GRO B;  4UWG A;  1Z3Y A;  4U8H A;  3N9Q A;  4QF2 A;  2MOW A;  5FER A;  4YVO A;  2XEU A;  3ZYK A;  1JM7 B;  5D1K B;  2XS1 A;  3JUE A;  2L7P A;  2HDP A;  2CG2 A;  3B7T A;  2VJE B;  2XGM A;  2LXP C;  5AAO A;  4R7E A;  4A63 B;  4R7L A;  4TUU A;  3SBT B;  4IC2 A;  2L75 A;  4HI8 A;  5CBN A;  1KPS B;  3FDH A;  4JA7 A;  2KE1 A;  3LCA A;  4P29 A;  4EBA A;  4YC9 A;  2RD0 A;  1VFY A;  2WXJ A;  2WXF A;  3M99 A;  3ESK A;  1JM7 A;  4RLY A;  2XHE A;  3BU8 A;  3AS4 A;  1LD7 A;  4C0M A;  5B76 A;  4EBA G;  3CR3 A;  4JHR A;  1KZP A;  1RW2 A;  4ATG A;  2XOY A;  2CHZ A;  2LXM A;  2XQ0 A;  3HYM B;  2WXQ A;  2WXN A;  2YUR A;  3DWL G;  2GRP B;  2YNQ A;  4NUR A;  3AAA C;  2VSN A;  2WXM A;  2GRL A;  3EHQ A;  1X4U A;  1TNB A;  3JYS A;  3PH0 C;  3ZNI A;  3S7F A;  2HM8 A;  5AJL A;  4GA2 A;  3G2W A;  3EHM A;  5G04 B;  3SUB A;  4UWL A;  5D66 A;  2VTB A;  4U63 A;  3RPG C;  4KXK B;  3ZTG A;  4J7W A;  4WZ3 B;  3ZVY A;  4HQD A;  2X6I A;  4GPM A;  2Y69 E;  3QAR A;  3DXK G;  3L6A A;  4AP2 A;  5ARF A;  5EYA F;  2P57 A;  4W4U A;  5EX3 A;  2JMJ A;  4HNA D;  4LKA A;  2EGM A;  4U0U A;  5CEC B;  4ANW A;  3TXM A;  4L9P A;  4GTQ A;  4L58 A;  3MHH A;  1X4I A;  2MNY A;  3WXX A;  4HVB A;  2CRW A;  3B7R L;  2ECI A;  3QB2 A;  3ULE G;  3PZ1 A;  1TYQ G;  4GPK A;  5CED B;  3U64 A;  4FA6 A;  4YBT A;  3SY2 A;  1N4P A;  3LEW A;  2WXR A;  4GTT A;  3GZ1 A;  5M72 A;  2J09 A;  2VJ8 A;  3Q49 B;  1JUQ A;  5ENN A;  4URK A;  1BOR A;  3M62 A;  4BT8 A;  5EIL A;  2BKK B;  1N9A A;  5EKQ D;  1FVH A;  4BFR A;  3S7B A;  2CSY A;  2UY1 A;  2EOD A;  3JUI A;  3PVL A;  3PRE A;  2MNZ A;  2ZGD A;  4ZHB A;  3MGB A;  2VTB B;  1N54 A;  3QWV A;  3PE4 A;  2OV8 A;  2I50 A;  2L0I A;  2XGS A;  1S0P A;  3HXD A;  2ECN A;  4TRQ A;  2JAB A;  3APC A;  2FO1 E;  2Y1M A;  5JHA A;  2EXU A;  4CDR A;  1K2F A;  4FLB A;  3FTX A;  4OAV B;  4GAA A;  4N4F A;  1IYG A;  1WFK A;  1N0Q A;  4I7C A;  3ASF A;  2F0Y A;  1U3D A;  3KEZ A;  1A17 A;  3C3O A;  3HG0 D;  3SHF A;  1IHB A;  3TWS A;  3LQJ A;  2K4D A;  2QC9 A;  4BBQ A;  1E8Z A;  1GW6 A;  3ZHE B;  1JWG A;  5TBN A;  1D8E A;  2MKE A;  2RFA A;  3BQO A;  4YVQ C;  1ELR A;  1HF8 A;  4LRZ A;  2XB1 A;  5C13 A;  2UWJ G;  3O4Z A;  4ATZ D;  4LG6 A;  3SOW A;  1FP0 A;  5JJ6 A;  3UT8 A;  4LAD B;  2I1J A;  4JD2 G;  1FCH A;  3MA5 A;  2LXL A;  5B1B E;  4B8A A;  3UPV A;  3S7J A;  5BXO A;  4G11 A;  2ZIS A;  2LNI A;  2PZI A;  1ZU2 A;  5DBK A;  4JA9 A;  4DLQ A;  2EIM E;  3ZPV 1;  1XWH A;  1NP7 A;  3CVQ A;  3RAU A;  3T5V A;  5AAR A;  3EB5 A;  3CVY A;  3S2A A;  4GU5 A;  1SQM A;  3KDE C;  5FJY A;  4CRW A;  2KCV A;  3MKR A;  3SFZ A;  2YQ8 A;  3FTV A;  2WPV A;  2XEH A;  1BI7 B;  2KCK A;  3EIJ A;  1V55 E;  3HIZ A;  4APO A;  1DC2 A;  5E76 A;  3GZS A;  4B7Y C;  4K5B A;  5B8D A;  4IC3 A;  2P9N G;  1ZBD B;  4GZC A;  3PZ2 A;  4G2V A;  2J49 A;  4GZ3 A;  1EDU A;  5CER B;  2GW1 A;  2K1J A;  2PQN A;  2QFC A;  1JCQ A;  4XI0 A;  1MQS A;  3CV0 A;  4J6I A;  1TEZ A;  3HXB A;  4N2Q A;  1WEO A;  2M3H A;  4JPS A;  4HLL A;  4Q96 A;  4BWR A;  3LPZ A;  3MEK A;  2KFT A;  2K17 A;  3V31 A;  2XCB A;  2HYZ A;  2BF0 X;  4JC8 A;  3PUQ A;  3D9P A;  3HVE A;  5KJL A;  4H7X A;  4EZJ A;  2QIC A;  4AY5 A;  2E61 A;  1WEV A;  2YSM A;  1WIM A;  4GB9 A;  4YBM A;  5ENS D;  3FU6 A;  3KD7 A;  3IBE A;  4DX2 A;  2K16 A;  3CVP A;  3D9O A;  1JOC A;  4XKB A;  4FHK A;  3C6W A;  3E37 A;  5JJT A;  1ZBP A;  2BAY A;  1WE9 A;  1HO8 A;  4XKC A;  1K1B A;  1VD4 A;  4XE0 A;  3CVU A;  1WES A;  2WXO A;  2LN0 A;  5BNW A;  1QNF A;  1X4J A;  1OWP A;  3K9I A;  1SW6 A;  4P5O B;  1OWO A;  3QC1 A;  2KZT B;  4AEZ C;  4O6F A;  2LAU A;  4D10 C;  3QZV A;  4TKP B;  3N9P A;  4HRM B;  2VPB A;  2L0B A;  3QDN A;  2FFW A;  5JA4 D;  4LNG A;  1TJC A;  4ANX A;  3SFX A;  2GRR B;  2QY7 A;  2E6S A;  1LD8 A;  3O34 A;  2Y1N A;  4DI4 A;  3C5R A;  3JQ1 A;  5D1L B;  3GYZ A;  2KWJ A;  3HXE A;  4MBG A;  2J4D A;  4FJY A;  4GYY A;  2EIK E;  1MM3 A;  3Q5M A;  2KRE A;  4DRX E;  3E34 A;  3FUI A;  3FUH A;  4Z0O A;  5CBO A;  3BG0 B;  3Q7A A;  5BW8 C;  4CDN A;  1BU9 A;  3AS8 A;  4C0E A;  3ZYQ A;  4HB5 A;  5I3L A;  2VPG A;  4KMO A;  4MSX A;  2XCC A;  5JJ7 A;  4JHK A;  1EF1 C;  3N9O A;  2FO7 A;  5CEA A;  3TGO A;  1PAQ A;  3UI2 A;  3U5N A;  3ZW3 A;  4KVO A;  3PZD A;  2LGG A;  3FTZ A;  3SQV A;  3ZU7 B;  4WZ0 A;  4FAD A;  2J8S D;  4L7X A;  3PNT B;  4O1P A;  3ZVZ B;  2VPD A;  3U5O A;  1X81 A;  4G23 A;  5BT1 A;  4F52 B;  1INZ A;  2QJ0 A;  3DPD A;  2ETB A;  4DX1 A;  3ULY A;  3AG3 E;  4BT9 A;  5ARG A;  2IFU A;  3E30 A;  4ZDT A;  3FUE A;  1H2U A;  3C98 A;  4TXQ A;  1WM5 A;  3CVX A;  1E96 B;  3ML8 A;  3ZIM A;  3TG4 A;  4A3T A;  3ZPV E;  3QWP A;  4K0R A;  3FP3 A;  1N4S A;  5ANL A;  4PS7 A;  4GTO A;  3CGH A;  1UW4 B;  4PH4 B;  1S64 A;  4PS8 A;  4WND A;  2JM3 A;  4YAB A;  5KH7 A;  2VJF B;  2IOS A;  3IHV A;  1U3C A;  2P2C P;  3NZS A;  3DSW A;  1HU3 A;  4KT6 B;  4L2Y A;  4F1P A;  5FT9 A;  3TL5 A;  4NRH B;  5ENT D;  4BES A;  1HYJ A;  2CFU A;  1QYM A;  4I9E A;  3M7K A;  3MKQ A;  3UIN C;  2R2L A;  2PQR A;  4ME2 A;  5FQ8 A;  5HQ8 A;  1WEU A;  4APF A;  4DLO A;  4B8C B;  3FUJ A;  4FP7 A;  2LGV A;  3PRZ A;  2VJF A;  4J8D A;  5EDS A;  3UMV A;  4UUC A;  3UKR G;  4HOT A;  4UP0 A;  2WMN A;  4ILH B;  4BY6 A;  1OWN A;  1TNU A;  5EX0 A;  2AXU A;  4KYO B;  1CHC A;  2Y0B G;  3FUF A;  2XZT G;  3UT7 A;  3PE3 A;  4UI9 J;  3OAW A;  4JEU A;  2EIJ E;  1V54 E;  3EDT B;  1MX4 A;  2EQX A;  5G2N A;  3TXN A;  4LLB A;  2I1K A;  3UM2 A;  3D9I A;  1UG3 A;  3T7L A;  5LCW C;  1E90 A;  3V2O A;  3I3N A;  1HS6 A;  2GRM A;  5D1M B;  5A7D B;  3D9N A;  4CGW A;  1A5E A;  5SVI B;  1WIL A;  3LXU X;  2R02 A;  3TG5 A;  3OXF A;  3FU0 A;  4G24 A;  5HKP A;  3FEY A;  1H2V C;  4AIF A;  4EEC A;  2ZXW E;  2MA5 A;  4HOQ A;  4WWP A;  5EYP F;  1HG2 A;  1MJ0 A;  2DZO A;  2XOC A;  2FF4 A;  4G25 A;  4JL0 A;  4U8V D;  2RFM A;  2VGX B;  1OUV A;  3FH8 A;  3G2V A;  4I1A A;  2AXZ A;  4OYS A;  3L13 A;  3TWQ A;  2GRQ B;  2MIQ A;  4UWK A;  5B78 A;  4E85 A;  2Q7F A;  2VP7 A;  4GTS A;  4RQI A;  2YRE A;  3B13 A;  2ECJ A;  1NA3 A;  2DJA A;  2V8S E;  4B89 A;  3O35 A;  1HX8 A;  1N94 A;  4V3L C;  2YW8 A;  2X3M A;  3AU4 A;  5ENP D;  5LOZ A;  5AIT A;  4RSY A;  2VGX A;  4CEM A;  2Y4U A;  3ML9 A;  4HOU A;  1WGM A;  3ZRH A;  3ABL E;  2DYS E;  1SA4 A;  1K3Z D;  5G0F A;  4NQ0 A;  3T5X A;  4HBD A;  3G2U A;  3ZVV A;  1JWF A;  1U2V G;  2XRY A;  3KAE A;  3URZ A;  3FUM A;  2LDR A;  4MVT A;  1S70 B;  3FM8 C;  4GNF A;  3EUV A;  2IEJ A;  2Y1L E;  5BUZ A;  3L11 A;  5KH3 A;  1WEN A;  3PZ3 A;  4EPZ A;  1Q2Z A;  2Y4T A;  3FWV A;  2CHW A;  2P9S G;  4FIP A;  4OGE A;  2P9P G;  4B0Z A;  1FPP A;  1MX2 A;  5HS0 A;  3RRM B;  4GMR A;  3B95 A;  3CQG B;  2XGO A;  4KVM A;  3DQV R;  1WG0 A;  1E8X A;  2XPI A;  3MZL B;  3PZ4 A;  2D8S A;  5FEY A;  2RSD A;  4K5C A;  4HFG A;  5FB1 A;  3HDX A;  2CHX A;  4LUN U;  1N52 A;  4TUM A;  3KNV A;  4ACK A;  2YUC A;  1ELW A;  4EZL A;  5FZS A;  4WAF A;  4Q6F A;  3X2Q E;  2MD7 B;  4F6R D;  3FUL A;  4L23 A;  3L22 A;  3DWD A;  1O1T A;  2WM9 A;  3U5P A;  3SF4 A;  2OEV A;  3FU3 A;  2JMI A;  5JHB A;  1OWM A;  4N2S A;  2E2E A;  1FT1 A;  2J9Q A;  2ION A;  3L1X A;  2KWN A;  2X6F A;  3C72 A;  5CMW A;  3E33 A;  3CIA A;  1NI1 A;  2OOE A;  3ZFW A;  2XRZ A;  1B89 A;  3DPL R;  2IJG X;  4N5C A;  3CST A;  2H6I A;  3SOU A;  3LJU X;  2R03 A;  2WQH A;  3NBN B;  1Z60 A;  5BXU A;  1WDY A;  1UN8 A;  3IV0 A;  4U07 A;  5H9M A;  1OY3 D;  4BTA A;  5JG6 A;  4PPE A;  1YYH A;  1DCE A;  2YSJ A;  5D2M C;  2C0L A;  1G25 A;  3DSX A;  1D9S A;  1MHQ A;  3ABM E;  3ONK A;  3LVR E;  2J4B A;  2WXI A;  4C48 B;  1DVP A;  3ZNG A;  3ENE A;  4BSX A;  2FUL A;  2QZA A;  2WXL A;  2FSA A;  2P9I G;  4ZUX U;  2MHK A;  4GCN A;  2BED A;  4RVB A;  4U04 A;  4JXT A;  1BPO A;  3VLD A;  2DSM A;  1MX6 A;  2MYO A;  2IQJ A;  2H0D A;  5FIO A;  4CDM A;  2KM4 A;  3CK9 A;  4XI1 A;  2KR4 A;  4UI9 K;  5CMY A;  3RPG B;  1E8W A;  2H6G A;  3LRQ A;  3ZXS A;  2DYR E;  3PDN A;  3I2D A;  4ABN A;  5SVY A;  1X5B A;  4J8F A;  2OCC E;  2LGK A;  2YHN A;  3UM3 A;  4PDX A;  4GA0 A;  4A1S A;  1IKN D;  3FAO A;  2V0P A;  3PUJ A;  1F62 A;  1NZN A;  4GZ6 A;  2R17 C;  4FHJ A;  1Y8M A;  1QBQ A;  1Z6T A;  4J8S A;  3T9K A;  3FY4 A;  3UTM A;  3DST A;  3N9L A;  4G1T A;  4DPR A;  5H1U A;  4RG6 A;  3FHE A;  4WWN A;  2E0I A;  1H6P A;  1YA0 A;  1TNZ A;  4GTR A;  3CVV A;  5G05 B;  4CZ2 D;  2G45 A;  4PTB A;  4BTB A;  4FUL A;  2R59 A;  4ANU A;  3Q1D A;  1U6G B;  3AU5 A;  5AEN A;  5G04 C;  4NAC A;  1HZ4 A;  2XZD G;  1K8K G;  3BUA A;  3Q47 B;  3FU5 A;  4UWF A;  4WNF A;  3KQI A;  2RG8 A;  3FUD A;  3HCU A;  4GND A;  4R2Y A;  4LK9 A;  4CA1 A;  3CHR A;  2F42 A;  1DNP A;  1TNO A;  5ITZ F;  3FAN A;  1LF8 A;  3D9H A;  5DIN A;  3SHB A;  3SI5 A;  4K5A B;  1YCS B;  4B94 A;  2MD8 C;  2YHC A;  3J5P A;  4OVV A;  4O60 A;  5LP0 A;  4C9B B;  4AJW A;  2X6J A;  3RJV A;  2IO3 C;  4A49 A;  3CKB A;  4GA1 A;  3I4G A;  4G26 A;  4ILG A;  4O62 A;  3D9L A;  3IHY A;  3QK0 A;  2JRJ A;  4AY6 A;  3LQI A;  2VGY A;  4JZY A;  3ABK E;  2KIZ A;  2F8Y A;  1N95 A;  4N5Q A;  2A4Z A;  4CCG X;  3IEG A;  5JMN D;  3W9F A;  2LV9 A;  2OVB A;  3L54 A;  3E32 A;  3Q78 A;  3UX4 A;  3ESL A;  5KCM A;  2LXH C;  2DIW A;  4IN3 B;  5EIB E;  1MZC A;  3NAW A;  3H7H A;  5D0Q D;  4NN2 A;  2ETA A;  5FZR A;  4BET A;  5K3Q A;  2DWZ A;  2IO2 C;  3B7U X;  3HRA A;  2G43 A;  4LNB A;  4IRU A;  3D9J A;  3MHS A;  2WXK A;  4LJN A;  2WQ7 A;  2AWI A;  3FTY A;  3V2X A;  1TR4 A;  1RZ4 A;  1PY1 A;  2J07 A;  2G6Q A;  3LS8 A;  3D9M A;  2H6H A;  3L08 A;  1O5M A;  4ANV A;  5H7P A;  4GTM A;  4WNE A;  2E6R A;  3O47 A;  5KJM A;  3EU5 A;  3NOC D;  2M85 A;  4O64 A;  1KLX A;  2YT5 A;  5G05 C;  3OXG A;  1FT2 A;  2WXH A;  3R9A B;  4N3W A;  3SFY A;  3KV5 A;  2RR4 A;  3PS6 A;  1FVF A;  2CT2 A;  3EU9 A;  3T8M A;  1VDY A;  4MKT A;  4FC8 A;  3KS2 A;  5KWD A;  2KWK A;  4CGV A;  4Q69 A;  2H6F A;  3HCT A;  3F6Q A;  3TWT A;  2YHO A;  4TV3 A;  1YMP A;  3MX3 A;  2KYU A;  2EA6 A;  2IY0 C;  5AQ9 A;  3RRN B;  3U66 A;  1WEE A;  4J0U A;  2IOL A;  5KNH D;  3KSL A;  5SVX A;  3SO8 A;  3AS5 A;  2XPZ A;  4YDW A;  4QQI A;  3J5Q B;  5TRB A;  3Q4A B;  1PC2 A;  1UJJ A;  4XIF A;  1HFA A;  4KZC A;  4AV7 A;  3ASO E;  2MRI A;  2WQ6 A;  2WVI A;  1IQU A;  2M13 A;  4OVU A;  3I4R B;  3LJN A;  2HYE D;  4HI9 A;  4L2L A;  2CFZ A;  1Z6U A;  3R9M A;  3RKV A;  5AQ7 A;  2NAA A;  3P2B A;  3HVE B;  1LDK C;  4HOR A;  1LDJ B;  3JXJ A;  3FTW A;  4HS2 A;  4CT0 A;  2NXP A;  1E4U A;  4YND A;  3FH5 A;  4AYC A;  3DXM G;  2CRR A;  2FUI A;  1WY6 A;  5ENQ D;  4GTP A;  4UQZ A;  3DSU A;  3UM0 A;  2L5U A;  1T1H A;  4AUQ B;  1H0A A;  3CHO A;  3E2D A;  3LYA A;  2JLB A;  3UKU G;  2H0D B;  3NZU A;  5HI7 A;  4ILI A;  3FTS A;  4DX5 D;  4GMJ A;  3GZ2 A;  4H7Y A;  1HYI A;  4GCO A;  4Y6C A;  3S7D A;  2AVP A;  4UWH A;  4BEP A;  3RIB A;  5EID A;  3L1Z B;  4AM9 A;  1WEP A;  3HXC A;  2YVR A;  4MLP A;  4N3A A;  3RTR B;  2KBX A;  2F6N A;  2MUM A;  3Q9U C;  1N11 A;  3HHM A;  5FQ6 A;  2KKY A;  3CEQ A;  3Q9N C;  2P58 C;  3QJZ A;  5T3R A;  2FEZ A;  1OXJ A;  2X38 A;  4DUI A;  4CT4 A;  4AOF A;  3NB2 A;  5FB0 A;  4WZ2 A;  2OWA A;  2I6H A;  2DX8 A;  5B3S E;  3V43 A;  1IYM A;  2CG3 A;  1QZ2 A;  1O1R A;  3SBS A;  4KZ0 A;  3FL2 A;  1LTX A;  3EHN A;  3ZEF A;  4GML A;  4GZD A;  4X8Q A;  3TWU A;  1P5Q A;  1WEQ A;  5AJD A;  3DEO A;  2ZIR A;  4G8L A;  1OWL A;  4XZ4 A;  1WEW A;  3P1U A;  4BER A;  3CHQ A;  3U9W A;  1Z3X A;  3ONL A;  2FD4 A;  5A6C A;  4V3K C;  4HLE A;  2C2V S;  3TWR A;  1VYX A;  1JCR A;  2ECW A;  2L80 A;  5LCW B;  2C0M A;  3EJN A;  3O37 A;  5SVI A;  4YAD A;  4QQ4 A;  2AXV A;  2PL2 A;  5H1V A;  5LX8 A;  3D9K A;  5E75 A;  2R5S A;  4PS3 A;  5B1A E;  1RMD A;  5C11 A;  2LSU A;  4EHM A;  4Z68 A;  1EPU A;  3ASH A;  5AQB A;  4YDE A;  4L1B A;  4F1S A;  4WA6 A;  5KJN A;  3UIP C;  3EIQ C;  3N9N A;  3UT4 A;  3R7Q A;  3WG7 E;  4IYP A;  2A5E A;  1WEM A;  1H6K A;  3L82 A;  2CSV A;  3VTX A;  2VGE A;  1WAO 1;  1Y6I A;  3SNX A;  4I7D A;  3ULQ A;  4DK5 A;  5LKU A;  3U5M A;  1HH8 A;  1NA0 A;  4HRL A;  3U3W A;  5BPP A;  2L9B A;  2VNF A;  3PHD A;  5KBA A;  5FQ4 A;  3L16 A;  3ASG A;  3MKQ B;  3L9T A;  2ECG A;  2VPE A;  5DIZ A;  3ASL A;  5HRY A;  2CKL A;  2VYI A;  4HXI A;  3FTU A;  2KC7 A;  2VJE A;  4LEU A;  3AJI A;  4KBQ A;  4UQX A;  2L0T B;  5C2Y A;  3SD5 A;  2QYU A;  2XP0 A;  3QNK A;  1KT1 A;  4UI9 B;  3ZHE A;  3DPY A;  4N3C A;  4GZ5 A;  3QWW A;  2DZN A;  2BTD A;  3ZN3 A;  4A4B A;  4U95 D;  4ZQL A;  2CKL B;  1NFI E;  1OCO E;  4U96 D;  4FU3 A;  4Y6W A;  2L6J A;  4I6G A;  2NC9 A;  3PNL B;  4A3V A;  4FK5 A;  2ECV A;  5G04 J;  5TAB A;  2PM6 A;  5CRV A;  2Y3A A;  4X3G A;  3MYV A;  3Q7F A;  4A0C D;  4PUC A;  1SA5 A;  4JW1 A;  3W9G A;  5FTP A;  4L7T A;  3TJP A;  4M7C A;  3TAX A;  3DDT A;  3CK8 A;  4GYW A;  2LUH A;  2C2L A;  3FEX A;  4GYO A;  4MRU A;  4I2Z A;  1BLX B;  4H9D A;  4GNE A;  4FJC A;  3R7R A;  3CHP A;  4YDY A;  5C1D A;  4XX5 A;  2OVF A;  4U7E B;  5KJK A;  3UM1 A;  3JQ0 A;  2OND A;  2LRI C;  5T4Y A;  1G3N B;  4TXR A;  5AIJ A;  2ECT A;  5LKX A;  3ASN E;  3BEE A;  3AG2 E;  2BKG A;  4DX6 D;  2I9C A;  2KGG A;  3VLF A;  2XS8 A;  4OGC A;  2VSO E;  3CK7 A;  5FWQ A;  2AN6 A;  2X6K A;  1SZA A;  2YU4 A;  4BSZ B;  1S63 A;  2RKK A;  1O1S A;  3DSV A;  3NOG D;  2V5Q C;  2BUG A;  3PUR A;  1K1A A;  2KGI A;  3RSE G;  2VQ2 A;  3TWX A;  1UOH A;  4UP5 A;  3B7B A;  3HCS A;  4LCT A;  2KAT A;  3IXE A;  2PNN A;  3CLJ A;  2CON A;  1N87 A;  2Y43 A;  5B77 A;  5IY5 E;  4R8P K;  5LKZ A;  4A55 A;  3U4T A;  2LO6 A;  3CKC A;  2XEE A;  4CCA A;  3G2T A;  1MBM A; 
#chains in the Genus database with same CATH homology
 3JXI A;  2DJA A;  3DEP A;  4BET A;  3TWR A;  2XOY A;  2JAB A;  2FO1 E;  2DWZ A;  5K3Q A;  1DC2 A;  3C5R A;  2EXU A;  2V4H C;  5ENP D;  2CRR A;  3HRA A;  3T9K A;  2ETC A;  4OAV B;  3KEA A;  3UTM A;  5ENQ D;  4K5B A;  4LSZ E;  5SVI A;  2KXP C;  2XEN A;  3AAA C;  3V2X A;  1TR4 A;  5EN5 D;  3W9G A;  1N0Q A;  4QQ4 A;  3E2D A;  3EHQ A;  5AN8 A;  4DRX E;  3DDT A;  4UUC A;  1K3Z D;  4J8Y A;  4Z0O A;  4NIK A;  3HG0 D;  4DX5 D;  2AJA A;  3LJU X;  4HBD A;  5CBO A;  1BLX B;  4CZ2 D;  4Z68 A;  5CER B;  4H9D A;  3NBN B;  3SUB A;  1IHB A;  5AQB A;  1BU9 A;  1S70 B;  5D66 A;  3TWS A;  4BEP A;  3FM8 C;  4G8K A;  5BXU A;  4HB5 A;  5FIN A;  3O47 A;  3Q1D A;  3TWV A;  2Y1L E;  2QC9 A;  3V79 K;  1WDY A;  3NOC D;  4J7W A;  4YDY A;  1OY3 D;  2B0O E;  5EID A;  2A5E A;  2XZD G;  4HQD A;  2Y0B G;  2CSV A;  1YYH A;  4GPM A;  1BI8 B;  2VGE A;  2XZT G;  4HLL A;  4CYM D;  5ENR D;  5CEA A;  2MKE A;  2RFA A;  4HRN A;  3PLW A;  3UI2 A;  1D9S A;  2YVR A;  3MDB C;  3V31 A;  4U8Y D;  3FJU B;  1MYO A;  4QFV A;  2RR4 A;  1BD8 A;  4ATZ D;  2D8U A;  3EU9 A;  2F37 A;  2KBX A;  4OGE A;  4HRL A;  2P57 A;  3LVR E;  1G3N B;  4LG6 A;  1MX2 A;  1MX4 A;  2HE0 A;  3Q9U C;  4HNA D;  5HS0 A;  3ZU7 B;  4C48 B;  5ITZ F;  2J8S D;  1N11 A;  5KWD A;  2EGM A;  4GMR A;  3B95 A;  3ZNG A;  5CEC B;  3ZKJ A;  3FEH A;  4B93 B;  1IXV A;  5KBA A;  4O1P A;  3D9H A;  4DX7 D;  2E61 A;  2L6B A;  5ENO D;  5KNG A;  1WG0 A;  4O1O A;  2JUN A;  2BKG A;  3T8K A;  4DX6 D;  4K5A B;  3Q9N C;  1YCS B;  2KKY A;  2NYJ A;  3F6Q A;  2ETB A;  3J5P A;  5ENS D;  5AQA A;  3TWT A;  4DX1 A;  4OGC A;  2CRW A;  1YMP A;  3V2O A;  5BXO A;  4DX2 A;  4O60 A;  3LVQ E;  5HRY A;  1SVX A;  4DUI A;  1A5E A;  5AQ9 A;  3EHR A;  4K5C A;  4BSZ B;  4JB8 P;  5SVI B;  5CED B;  3TWW A;  5KNH D;  3ZUV B;  4OAU C;  3NOG D;  3JUE A;  5HKP A;  1MX6 A;  2MYO A;  3UXG A;  3SO8 A;  2IQJ A;  2L7P A;  2V5Q C;  4YDW A;  4QQI A;  2OWA A;  5FIO A;  4O62 A;  3J5Q B;  3AJI A;  1K1B A;  4TUM A;  1AP7 A;  1OT8 A;  1DCQ A;  1K1A A;  5AAR A;  3V30 A;  4ZFH A;  1IKN D;  5AAO A;  5SVX A;  2QYJ A;  5EYP F;  5EYL A;  3TWX A;  4A63 B;  2XOZ A;  2F8Y A;  1MJ0 A;  1UOH A;  4Z0R A;  2DZO A;  4N5Q A;  2JM3 A;  2XOC A;  1N0R A;  2M13 A;  2XP0 A;  5JMN D;  3W9F A;  3B7B A;  5EIL A;  3LJN A;  2RFM A;  2BKK B;  4HI8 A;  4U8V D;  5CBN A;  3KDE C;  1SW6 A;  4HI9 A;  5SVY A;  3IXE A;  3TWU A;  1AWC B;  2P2C P;  4F6R D;  2DZN A;  2KKX A;  4U95 D;  2PNN A;  3DEO A;  2LAU A;  4G8L A;  2CON A;  1NFI E;  3DWD A;  3TWQ A;  4BER A;  4LNU D;  2DVW A;  4RLY A;  4U96 D;  5AQ7 A;  4HRM B;  3LDY A;  2ZGD A;  4F1P A;  4ZHB A;  2XEH A;  2ZGG A;  5ENT D;  2FFW A;  4BES A;  2XEE A;  1BI7 B;  5EIB E;  5JA4 D;  2F8X K;  2FD4 A;  1QYM A;  3H7H A;  3M7K A;  2ETA A;  3JXJ A;  2YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...