1DCQA

Crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
276
structure length
276
Chain Sequence
LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYK2-ASSOCIATED PROTEIN BETA
publication title Crystal structure of the ARF-GAP domain and ankyrin repeats of PYK2-associated protein beta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 93
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1dcqA02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 1dcqA01
4DX6D 4BERA 1WG0A 1MX4A 2ZGGA 3LVQE 5ITZF 3SO8A 2L6BA 3NOCD 2XEHA 2MYOA 3FM8C 2DZOA 1DC2A 3HRAA 5KNHD 4U96D 4OAVB 4F6RD 5EYPF 3TWSA 1S70B 1MX2A 2P2CP 4HRLA 2RFAA 4HLLA 5JMND 2Y1LE 3SUBA 2XEEA 1OT8A 4HBDA 3Q9NC 5EIDA 1IHBA 1K3ZD 1OY3D 3C5RA 5EN5D 5KNGA 5AN8A 4U8YD 4DUIA 2ZGDA 4BEPA 5HRYA 3LJUX 4DX7D 1D9SA 2CRRA 2ETCA 1QYMA 2XZDG 1MX6A 5AARA 3JXJA 5EILA 1SVXA 5ENPD 1K1AA 3V2OA 4DX1A 4Z68A 1SW6A 2DZNA 2V5QC 4HRMB 3ZKJA 1N0RA 2HE0A 2F37A 3V2XA 2BKKB 1BI7B 4ZFHA 1AP7A 2BKGA 5ENRD 2NYJA 4BESA 5AQ7A 3V30A 1N0QA 3MDBC 4LNUD 4YDYA 1BI8B 4HB5A 3TWTA 5CERB 2JABA 3TWQA 4C48B 3KEAA 4BSZB 5EYLA 4CZ2D 2F8YA 3AAAC 4GPMA 5KWDA 2XZTG 4UUCA 4JB8P 5KBAA 4A63B 5D66A 5AQ9A 5AQBA 5CBNA 2DWZA 2RFMA 5ENOD 2IQJA 1A5EA 2QYJA 4K5BA 3V79K 4F1PA 4G8LA 1BLXB 3TWXA 4HQDA 2QC9A 3FEHA 1WDYA 3LVRE 3UXGA 4B93B 1YYHA 2B0OE 3AJIA 1NFIE 3TWUA 3DEPA 3DEOA 4U8VD 1N11A 4J7WA 4RLYA 5ENQD 5EIBE 2OWAA 2FO1E 5BXOA 2DVWA 2F8XK 2ETAA 5FIOA 2KBXA 2XENA 5FINA 3UTMA 5CEDB 2VGEA 3V31A 4DRXE 3EU9A 5HKPA 1IXVA 3J5PA 4QQIA 5BXUA 3TWVA 3UI2A 1MJ0A 1YMPA 3TWWA 3ZU7B 5AAOA 2P57A 5ENSD 4G8KA 2Y0BG 3F6QA 4BETA 1UOHA 3LJNA 4HI9A 5CECB 4LG6A 3DWDA 1BD8A 4GMRA 1K1BA 3EHRA 4LSZE 3B95A 4DX2A 3Q9UC 2PNNA 2CRWA 4TUMA 4YDWA 4CYMD 1MYOA 1DCQA 3W9FA 1IKND 3EHQA 5CBOA 3NOGD 3D9HA 3NBNB 2ETBA 3TWRA 4O60A 5CEAA 2AJAA 4O1OA 4O1PA 1YCSB 5ENTD 1TR4A 1BU9A 3T8KA 4DX5D 4OAUC 3ZNGA 3B7BA 3IXEA 3J5QB 4J8YA 1G3NB 4HI8A 3ZUVB 2A5EA 3HG0D 5HS0A 4ZHBA 4QFVA 4N5QA 1AWCB 3JXIA 2V4HC 3JUEA 5AQAA 4K5CA 4U95D 3T9KA 4NIKA 4ATZD 4HNAD 4HRNA 2J8SD 5JA4D 3O47A 2KXPC 4K5AB 3W9GA
chains in the Genus database with same CATH superfamily
3O33A 4NACA 2AVPA 3ZHEB 3ONKA 3FHEA 3I3NA 4WWNA 3ONLA 2H6IA 3O37A 2KZTB 3D9MA 2EIJE 2KGIA 1KPSB 5D0QD 4GB0A 3Q79A 3O70A 5FQ6A 2JEKA 5DBKA 5EILA 2R03A 3ESLA 2LXPC 1WFKA 2F37A 5J08A 5D2MC 4HFGA 2IOLA 1OWMA 3OTNA 4C9BB 4WWOA 3APFA 2YURA 4AYCA 4MVTA 3ENEA 4C48B 3R7QA 3VK6A 2P9SG 4GPMA 4UP0A 2OEWA 4QF3A 3AU5A 4APFA 3L13A 4EZLA 2KWKA 1WM5A 2GROB 1OWOA 4GYWA 2IQCA 1NP7A 2YQMA 3TWUA 3N9LA 4V3KC 3FTWA 3CSFA 3AS4A 2R17C 3RRNB 2KCVA 4F3VA 5FIOA 3ZIMA 3PH0C 5TRBA 1MZCA 2KATA 3QARA 4HI9A 3W9FA 3NOGD 5G05B 4U0SA 2ETBA 3TWRA 4UI9B 2EGPA 4KBQA 4AJWA 3BG1B 5CRVA 2AXUA 3Q73A 1WEOA 3ZNGA 3GZ2A 4RVBA 4S3OB 4L58A 2J49A 3I5PA 5SVIA 2V4HC 3NAWA 2RD0A 3CK8A 4YBTA 2JRJA 4G24A 1Z60A 3ZYKA 1XNFA 4FC8A 2WQ7A 4OAVB 4F6RD 3LYAA 2PM6A 1MX2A 4JVSA 5JMND 3BQOA 3O34A 5KNGA 3PE3A 2WXMA 1EF1C 3FH8A 4DUIA 2ZIRA 2VPEA 3WXXA 5FZRA 1D9SA 2XOZA 3L6AA 2FUIA 1QYMA 2CSVA 2YNQA 2C2VS 3I2DA 1KZOA 1O5MA 4GZ5A 2DX8A 5ENRD 5A6CA 4B86C 3CVPA 2I50A 3IHPA 1SA4A 2VJEA 3SF4A 1P5QA 1PAQA 1JM7A 2C2LA 4EBAG 2MOWA 3MV2B 4F1PA 1INZA 4JXTA 1KLXA 2ECNA 3AJIA 1NFIE 5E75A 2KWOA 2VYIA 3HIZA 4GTTA 3C98A 4MS6A 3VTXA 2GRNB 4NQ0A 2XQ0A 1OCOE 2R5SA 2EIKE 1N87A 3L17A 4U8HA 2KU3A 1MJ0A 1IQUA 4WA6A 2LSVA 3G2VA 4GA2A 3PZ4A 3ASOE 3Q9UC 3EHQA 3ABKE 2F0YA 3FUIA 4E85A 3UKRG 4L23A 1TR4A 2FBNA 2E0IA 3VTYA 4A1GA 5G55A 4BFRA 2G43A 3L1XA 2KC7A 4NN2A 1ELWA 1IHGA 2KIZA 4A0CD 4JHKA 3AG3E 2IO2C 3O35A 3PZDA 4ATZD 3QKYA 5CRUA 3UM1A 1Z6TA 4LNBA 4Q96A 2AXZA 3KSQA 5T8IA 2CFUA 3NZSA 4I2ZA 2LGLA 2WXKA 3PVLA 5D1KB 4HBDA 5LX8A 3LJ3A 4AP2A 4WNDA 2FO7A 1TJCA 1ZB1A 2FD4A 1HXIA 5KH9A 3FL2A 3FTVA 3ML8A 2MHKA 3ZNIA 2KM4A 4URKA 3DXMG 5B75A 2EGMA 4Z68A 1SVXA 1VYXA 2DZNA 4A49A 3TXNA 4FLHA 2M85A 3FU5A 3TAXA 3X2QE 3FAOA 4LNGA 2C0LA 4IRUA 1WIMA 4BSZB 4JB8P 3G2UA 3MKQA 4JZYA 3HXDA 5CBNA 1TNOA 2DWZA 4G11A 4K5BA 4YDEA 4MRUA 4I2WA 2B0OE 2WM9A 2XGOA 3DEOA 5DINA 4RLYA 4GAAA 4KVMA 1LDJB 3SBTB 2QYUA 4WNEA 2LXHC 4ZUXU 4F7AA 3I4GA 1QZ2A 2Y4UA 2P57A 1YMPA 4UWHA 2CONA 4GYOA 4V3IA 1IQRA 3D9PA 3KDEC 4IULA 3U5NA 4YBMA 4BX9A 2Y1MA 4OGEA 5JG6A 2J4BA 1XGWA 3TXMA 3EU5A 2LGKA 3D9IA 3J5QB 4I1AA 2C0MA 1S63A 3U66A 1OWLA 3TGOA 3LQIA 4K5CA 3EJNA 4U95D 4TUUA 4HRNA 3O47A 3LPZA 3W9GA 3UUXA 2CHXA 3D9JA 5H1TA 1DC2A 3LKUA 4A3VA 3NF1A 2XEEA 4HVBA 1U2VG 1JWFA 5HRYA 1JUQA 3T6RA 3KEZA 2PUYA 4LEUA 3LY7A 3IBEA 4YC9A 4WUYA 3ZKJA 4HRMB 3R9MA 3ISMC 3URZA 3MDBC 4Q69A 4FHKA 5DKAA 1MQSA 4M7CA 3AU4A 5FERA 2NAAA 3JYSA 3CKCA 1HZ4A 4H7YA 4ZQLA 2XCBA 4HQDA 4JL0A 2JM3A 1QBQA 3CHRA 4GTQA 5EX0A 3QC1A 3B7UX 3PNLB 4N5CA 2WXQA 4FLBA 2XENA 3UTMA 4IC3A 5CEDB 2JMIA 2AXVA 4EECA 5FTPA 4DRXE 2VPBA 5HKPA 3S2AA 3JQ0A 3U5OA 1DVPA 4BHWA 4UQXA 4LG6A 3ZW3A 1WESA 2D8UA 4I6JA 2PZIA 5G05J 2LV9A 2XS8A 5BUZA 2XPZA 4UI9J 1X4IA 5ENTD 2XRYA 2X38A 3FUFA 3ASHA 4EQFA 3D3MA 2MT5A 4XX5A 4FIPA 2J07A 3QOUA 3FM8C 4AYCB 3DXKG 2XS1A 3OAWA 3ZYQA 2Y1LE 5FT9A 4YAXA 5AN8A 4ABNA 3LJUX 2YHEA 4HOTA 2CT2A 1ZU2A 3BG0B 2WXFA 5CERB 4W9RA 4ZHBA 2X6JA 3SZ7A 1SW6A 1SZAA 4A3TA 3FUEA 2NYJA 3B7SA 4GNFA 2DCPA 4G2VA 2OEVA 1DNPA 2KGGA 2GGFA 3S7FA 2CHZA 2LRIC 4GMLA 4YDOA 3QWPA 2X6KA 2YHOA 5KWDA 3EHMA 2CG3A 3O7AA 2ECIA 2ZETC 4UQZA 5AQ9A 2IOSA 2RFMA 2Q7FA 4G8LA 5LCWB 3V43A 3TWXA 2ECVA 1WDYA 3LVRE 1NL4A 1JPLA 5C11A 2DSMA 3LS8A 5SVIB 4J7WA 1UG3A 1UW4B 3L22A 3SFYA 3KQIA 1PC2A 3KV6A 4KZCA 4DK5A 2UZGA 4EZJA 3N9PA 2EINE 2VGEA 1HYIA 3V31A 1XWHA 5LFAA 2YHNA 1WEQA 2Y0BG 1UOHA 4HOUA 5CECB 3C6WA 4YBSA 1WEEA 4CYMD 2R05A 5FEYA 5AYWD 3RO3A 2EIME 1H6OA 3LQHA 3IXEA 2BAYA 4ACKA 3L11A 4N5QA 3VLDA 1E8ZA 4CGWA 3CEQA 2UY1A 2CSZA 3Q1DA 4XI1A 4K5AB 4GTMA 2LAIA 4DX6D 4J8EA 4AOFA 2LQ6A 3QK0A 1SA5A 3ZVVA 3SFXA 5KNHD 1JM7B 4HOSA 5ANRA 2QIZA 1K8KG 1UN8A 3ML9A 4B0ZA 2LAUA 4KZ0A 4U8YD 1Z6UA 5C2YA 4BEPA 2QICA 2G6QA 1E4UA 3G2TA 5AARA 4BBQA 5T3RA 3FTXA 5A23A 4PDXA 1FVHA 1MHQA 3EUVA 3KAEA 3U64A 5EYLA 3Q78A 2VSOE 3ZRHA 5D66A 2NSZA 4MLPA 5SVXA 3PZ2A 1H2VC 1DCEA 5BPPA 3TG5A 3B13A 5KJKA 2IFUA 4A4BA 3FDHA 4B93B 2CHWA 4WZ2A 3PE4A 4BT9A 2H6HA 3JQ1A 5KH3A 3GZSA 1WEVA 2DVWA 2F8XK 2MA6A 2ETAA 3UT7A 2E61A 2DYSE 2MA5A 2P58C 1E7UA 4H7XA 2WMOA 4I7BA 2ILRA 5B1BE 4LUNU 4A4CA 2DIWA 2FSAA 3TWVA 3LY9A 3QB2A 4C9ZA 1UJJA 3ZN3A 2D8SA 4R8PK 1MYOA 1IKND 4GTVA 3L16A 1E8WA 4JHRA 4GTOA 3DSXA 1FT1A 1KT0A 1HG5A 5ARFA 1RMDA 3FUDA 4U04A 4N3AA 2K1JA 5ENQD 1Z5SC 3FTZA 1MX4A 2XP0A 4YADA 3ASLA 4N3WA 4JPSA 2MYOA 3DRAA 1H6PA 4CDNA 2WXJA 3L1ZB 4K03A 3MKQB 4O64A 1IHBA 4XKBA 5G04C 2MUMA 1FT2A 2LN0A 2L0TB 1E8YA 4FU3A 1SQMA 4AY6A 3SQVA 2CRRA 2XZDG 3MGBA 4N2SA 1N0RA 3OXLA 2ONDA 1BI7B 3CSTA 2L0IA 1N0QA 4LNUD 5B8DA 4FK5A 4BY6A 2P9LG 4BTBA 3HDXA 2IONA 5IY5E 3ASGA 1TEZA 2YT5A 2XEUA 2WXHA 4NURA 2IQJA 1G25A 3ESKA 3Q47B 4P5OB 4GPKA 5I3LA 4DPRA 2WB2A 1OXJA 1A17A 2VP7A 5ENNA 4JEUA 4CCGX 1K2FA 3CR3A 2QFCA 4I43A 3RU0A 4R2YA 4G23A 3ZVYA 5TBNA 1W3BA 4QQIA 5AIUA 3DBSA 4I7DA 4Y6WA 3ZPV1 4FP7A 4YDWA 3E32A 2IEJA 5JHAA 4EZKA 2XPYA 4I7CA 4L2YA 3Q15A 4EHMA 5JJTA 5G04B 3MHHA 4I1MA 2X6FA 2Y1NA 5AJDA 3DWLG 5AQAA 3SHFA 4AEZC 3PREA 3KSLA 3FY4A 2MD8C 2ZGGA 3LVQE 2MIQA 3UM2A 2WQ6A 3T7LA 3PEVB 3HRAA 4UWLA 1X4JA 1S70B 1TN7A 1MBMA 1N9AA 2CFZA 3CQCB 2RSDA 1UN9A 3Q9NC 2ZXWE 4G26A 3T5VA 4O62A 3NZUA 3VLEA 4U63A 1D8EA 3FWVA 4LRZA 5FJYA 2E2EA 1WE9A 2KKXA 5JHBA 4U7EB 2V5QC 2GRLA 3UIOC 1HX8A 4YVQC 3EHNA 2IDAA 3MA5A 1AP7A 1MM2A 3BUAA 5AQ7A 2EODA 3HTKC 4YDYA 3BU8A 4HB5A 3CVVA 3TWQA 5H1VA 3FULA 3KEAA 2VSXE 2XZTG 4FULA 2YU4A 1S64A 3QWWA 4CT4A 2XGMA 3FU3A 1N4RA 5LCWJ 3G2WA 3GW4A 3HVEA 2VGXA 4BSXA 5H9MA 4N2QA 4MKTA 2KFTA 4D10C 3FJUB 2E6RA 1V55E 3FP3A 4C0MA 2FO1E 2LNIA 3E34A 3MEKA 2VSYA 2KWNA 5LKUA 5M72A 2KBXA 4B94A 3ZYLA 1NA0A 3E4BA 3D9NA 4A55A 1JCRA 2VSNA 5BT1A 2ZU6B 3LJNA 5FB1A 3RRMB 4J8FA 3DWDA 5KJMA 1BD8A 2PNNA 4TUMA 2YVRA 4I1OB 5CHEE 3SGHA 4O1OA 1VDYA 1YCSB 1BU9A 3ULEG 5EX3A 5HS0A 5FB0A 3GZ1A 4GMJA 2CKLA 1N95A 5BW8C 4U0ZA 4BERA 1E7VA 2OVFA 5H7PA 1ELKA 5ITZF 3C3QA 3M7KA 2OV8A 1WENA 5G0FA 3ZPVE 2MNYA 3FU0A 3HCUA 1HS6A 1WGMA 2H6GA 2VTBA 4HLEA 2ECGA 2QZAA 1QNFA 4J0UA 3RPGC 2WXNA 3PEUB 1TNBA 3AS8A 5T4YA 2LUHA 4I9EA 4JA7A 4GYYA 2H0DB 2HE0A 2Y69E 3NB2A 4AP4A 3KNVA 4CEMA 2ECTA 4AUQB 4GZCA 2OOEA 1O1SA 4F53A 4C0EA 4JHJA 5C1DA 2F8YA 2CG2A 4UWGA 4UUCA 2EXUA 4MSXA 3L9TA 3VLFA 4ME2A 2GRRB 2KCKA 1HYJA 3T5XA 4Q94A 3RO2A 3H7HA 4U8VD 4FADA 4IN3B 2VQ2A 4IC2A 3CVQA 2GW1A 3SBSA 1IXVA 5BXUA 3TWWA 4WAFA 5D1LB 2Y43A 4UI9K 1VD4A 2I9CA 3B95A 4DX2A 5CBOA 1LTXA 4OVVA 2DYRE 4TV3A 5FZSA 4I9CA 2VJ8A 1H2TC 4O6FA 2J9QA 1HG2A 3PHDA 4AY5A 3ABLE 3Q4AB 3CHSA 3O4ZA 3QZVA 1OCCE 2RKKA 3JUEA 3RK6A 3Q5MA 2I2OA 4GZ3A 3U5MA 3B7TA 2L6BA 2I6HA 4OVUA 3HXCA 4GZDA 1FPPA 3DSWA 3TWSA 3UIPC 3LXUX 2NC9A 2YREA 4ANXA 3FEYA 4BX8A 2BEDA 4ILIA 4FO9A 1Y6IA 2WXPA 5JJ6A 3CVUA 5EYAF 3JXJA 2KE1A 4CT0A 4L9PA 3IKOB 4A1SA 1HO8A 1O1TA 2XPIA 3CHMA 4U0UA 4GA0A 3DSSA 4IYPA 4MBGA 4EBAA 2DJAA 5LKXA 3ZYMA 2XRZA 4GA1A 1N54A 3UM0A 3N71A 3SOWA 2JABA 1O1RA 2YYRA 1U3DA 3AAAC 3PUQA 3E2DA 2CSYA 3CVXA 3V79K 3SHBA 4R7EA 5FZQA 3FEHA 2L5UA 2VPGA 3KD7A 2I1JA 2PQNA 3DEPA 3FTUA 1N11A 3MHSA 2AWIA 2K16A 3C3OA 3SY2A 5AIJA 4AIFA 2EILE 3UKUG 3ZTGA 3M63A 3TG4A 4JW1A 3SNXA 5LOZA 3UX4A 4G8KA 1Z3XA 4TRQA 4BETA 5TDWA 3MZLB 1L5JA 4TXRA 4UQYA 5AJLA 4YVOA 1RW2A 3CQGB 1KT1A 3DPDA 3L54A 2YQ8A 2X3MA 3IHVA 4OYSA 4TXPA 4RQIA 4O1PA 2QJ0A 3LCAA 2LGGA 3T8KA 4WZ3B 3GYZA 1IYGA 2A5EA 2XB1A 4QFVA 2LDRA 4LJNA 2KYUA 4LK9A 2HDPA 3FEXA 3HCSA 1U3CA 2QY7A 4BT8A 2V5FA 2IJGX 3ASNE 4U96D 1TNZA 2LXLA 3N9MA 1D8DA 1EYHA 1WAO1 1OT8A 1V54E 3K9IA 4WWPA 2JUNA 5KH7A 3N9QA 2YSJA 2WXIA 3HXEA 3CK9A 2ETCA 1OWPA 4J8SA 4CRWA 3RAUA 3HXBA 4R7LA 4DLOA 1JCQA 4LERA 2FFWA 2VJEB 4X3GA 3SI5A 2LXMA 5FQ7A 3PUKA 5D0OD 4FA6A 4CDRA 3FFLA 3UPVA 2EQXA 4YABA 3KS2A 4L7XA 2ECJA 5ENOD 2XCCA 5BV0A 1F62A 1JCSA 5B79A 4DLQA 3FUHA 2K4DA 5FQ4A 4ILGA 1RZ4A 2YSMA 4PS7A 3RTRB 4APOA 4GTSA 5BXOA 4JD2G 4UWFA 2RI7A 2LO6A 3CIAA 3S7DA 3ULYA 2MD7B 4GNDA 3JUIA 4GMRA 3L08A 1K1BA 1WEPA 5FQ8A 2YHCA 3CKBA 3NBNB 3U9WA 1H19A 5G05C 2F42A 4UI9C 3ZFWA 3E37A 4I17A 2P9IG 3DPYA 4P29A 2VJFA 3SOXA 4S3OC 2WXOA 4RG6A 2RR4A 4NIKA 3DQVR 2FF4A 5ENPD 3NQPA 3PZ1A 5J90A 1Z2QA 2WQHA 4KVOA 1WG0A 3E30A 3M99A 3SO8A 2DZOA 4WNGA 5EYPF 2P2CP 2RFAA 3SUBA 3AS5A 2R59A 4JEHA 3B7RL 4RSYA 3HVEB 2VGXB 2BUGA 3APCA 3HHMA 3MV3B 3RSEG 3ZEFA 4PTBA 3UT4A 1MX6A 3E33A 4DX1A 4PS8A 1MM3A 2FULA 3EIJA 4YATA 4GB9A 1TYQG 2PQRA 3RJVA 4ZFHA 4GNEA 1TNYA 3FTYA 3V30A 2LGVA 4ATGA 3CVYA 1N94A 4XZ4A 3S7JA 5LP0A 2P9PG 5BNWA 3LEWA 2FUUA 4A63B 2VGYA 2M6MA 5B1AE 1A5EA 3MYVA 3ULQA 4PH4B 4PUCA 1T1HA 2YINA 4XE0A 2AW6A 2M1RA 1S0PA 4M3OA 4LKAA 2GRPB 1N4PA 2CKLB 5B77A 3LDZA 4DI4A 1LD7A 4ACLA 3U4TA 1EDUA 3PUJA 3DSTA 3EU9A 3GV4A 2XOCA 3LDYA 3OXGA 3CVNA 3LRQA 3Q49B 4GCOA 3DDTA 3OXFA 1V87A 4OGCA 3Q7FA 1ZBDB 3PZ3A 3O48A 2VTBB 1LDKC 3FUKA 4F52B 3FTSA 5E76A 2L6JA 4O60A 2P9NG 3D9OA 3WG7E 2HR2A 2IY0C 3PNTB 4J8DA 4DX5D 2WVIA 2F6JA 4BWRA 2KREA 2JLBA 1AWCB 3PDNA 2J4DA 4XIFA 2A4ZA 3RRUA 1JOCA 3GL6A 3QDNA 2BF0X 5A7DB 3D9LA 3PURA 2NXPA 3AG1E 2J8SD 5JA4D 4GTRA 4AVXA 2L43A 2V0PA 3N9OA 4PPEA 4WNFA 2P9UG 4W4UA 2PM7A 4B89A 3HCTA 5K3QA 4CA1A 1HH8A 3CHOA 5EIDA 1WEWA 5LKZA 1BPOA 3I4RB 4GZ6A 3CVLA 4BTAA 2RG8A 2BTDA 2WXLA 3DPLR 1B89A 4KMOA 2MRIA 2YQLA 2HO1A 3ZVZB 3V2XA 3QWVA 1TNUA 4AXHA 4V3LC 3P1UA 4BESA 2GRQB 4XEIG 5G2NA 3MX3A 3SD5A 3U3WA 1X5BA 2WPVA 4QQ4A 3ZHEA 5CCLA 4LLBA 3C5KA 3JCKC 4CZ2D 4ANUA 4RG9A 2KZTA 3MKRA 4ANVA 4CCAA 1JWGA 2I1KA 2QC9A 3SFZA 1X4UA 4N4FA 3EIQC 3ASDA 4J6IA 4XI0A 3PLWA 2M63A 1CHCA 4HORA 3FUMA 2Y4TA 1H2UA 3ZXSA 4KT6B 3UI2A 5AITA 4I6EA 3NG2A 3F6QA 2HYED 1IYMA 4LSZE 4TKPB 2Y3AA 4KYOB 3QAQA 2XGSA 1EPUA 3CVWA 2XEVA 3LQJA 2AJAA 5SVYA 4G25A 4Y6CA 3FH7A 3KV5A 1U6GB 2OCCE 1NZNA 2JMJA 3EDTB 5KJNA 3JXIA 3PS6A 2ECWA 2L0BA 3FUNA 4WZ0A 3PRZA 4U07A 4HNAD 3FANA 4K0RA 4DJAA 2F6NA 4L7TA 2H6FA 4HLLA 5EN5D 3C5RA 1K3ZD 1SZ9A 4FJYA 2EA6A 1WEUA 1LF8A 2ZGDA 2E6SA 5HI7A 5KCMA 4PS3A 4DX7D 3TJPA 4H9DA 1OCZE 2WMNA 3UT8A 2HYZA 2FI7A 3UM3A 4FJCA 1ZBPA 1PY1A 2L9BA 1HU3A 2IF4A 1HFAA 3UINC 3L82A 1FCHA 2VNFA 3N9NA 2GRMA 5KBAA 4N3BA 3IEGA 5AQBA 2JMDA 2UWJG 5C13A 2WXRA 3CV0A 1TN6A 3G2SA 1N4SA 1YYHA 1Y8MA 1FBVA 1Q2ZA 5B3SE 4N3CA 4F1SA 1GW6A 2DBAA 3DSVA 4E6HA 1X81A 3O36A 3DSUA 2IU1A 5EKQD 4LCTA 1OCRE 4EPZA 2J08A 4HXIA 2L75A 1DCQA 2WXGA 3D9HA 4ILHB 3RIBA 1FVFA 5CEAA 1HF8A 2VPDA 3AG4E 4J8YA 3ZUVB 1G3NB 4HI8A 1NI1A 2UY1B 4TXQA 5DIZA 2L7PA 4CGVA 3RKVA 4HOQA 3S7BA 2A5UA 5B78A 1H0AA 4Z0RA 2KXPC 2YW8A 2G45A 5TDRA 3NOCD 1Z3YA 4X8QA 2B6CA 2XEHA 3APDA 1ELRA 2MKEA 3D9KA 3RPGB 4I6GA 4HS2A 1H6KA 4GU5A 1N4QA 1WILA 3TL5A 1WEMA 2L80A 4JC8A 5CMYA 3FUJA 3HXFA 1KZPA 1K1AA 1FP0A 2BKKB 4YNDA 3SOUA 2BKGA 3ASFA 3M62A 3Q7AA 4FJZA 3TWTA 4GNGA 2XHEA 4ANWA 5CCMA 4B7YC 2R2LA 3R9AB 2QYJA 5ANLA 5BV1A 2V8SE 4LADB 5LCWC 4AV7A 2J09A 3LY8A 3CLJA 3HYMB 3C72A 1LD8A 2FEZA 4L1BA 2VJFB 1OUVA 5EIBE 2KWJA 3CHPA 1VFYA 2PL2A 4JA9A 4AM9A 4Z0OA 4GCNA 3MJWA 4QF2A 2CRWA 4UP5A 5LKTA 1E96B 2AN6A 4NRHB 3CGHA 2X6IA 2XOYA 4OAUC 5CMWA 3HG0D 4L2LA 2KKYA 1TJFA 2P9KG 2M13A 2HM8A 5H1UA 2M3HA 3UQ3A 5ARGA 4XI9A 3R7RA 4HRLA 1E8XA 4FHJA 1OY3D 5G04J 4B8CB 2IO3C 4KXKB 3ZPJA 1TN8A 3P2BA 3QNKA 2YUCA 3C3RA 1QQEA 3V2OA 1HE8A 3ABME 3MCXA 5TABA 3UMVA 2OVBA 3U5PA 2LAHA 4CDMA 2H0DA 3Q75A 1BI8B 4B8AA 1N52A 5JJ7A 2K17A 2LSUA 4GTPA 2V4LA 1BLXB 2PNXA 5J3XA 3QJZA 4Q6FA 1E90A 3AG2E 3UXGA 3CK7A 5KJLA 2OWAA 3EB6A 4G1TA 3ZXPA 2OXQC 3IHYA 5EDSA 5FINA 4DI3A 4ZDTA 3J5PA 3ZU7B 5AAOA 1WY6A 4N39A 5ENSD 3FH5A 1YA0A 2ZISA 3CHQA 5D1MB 3EHRA 4XKCA 1BORA 3FU6A 1UJKA 4UWKA 1OWNA 2X6HA 3ZGQA 2MNZA 5FWQA 3T8MA 3B7BA 3EB5A 5B76A 1NA3A 2R02A 3IV0A 5HQ8A 3T9KA 2KR4A 5AENA 3BEEA 2KCLA
chains in the Genus database with same CATH topology
4DX6D 4BERA 1WG0A 1MX4A 2ZGGA 2XP0A 3LVQE 5ITZF 3SO8A 2L6BA 3NOCD 3M7KA 2XEHA 2MYOA 3FM8C 2DZOA 1DC2A 3HRAA 5KNHD 2MKEA 4U96D 5K3QA 4OAVB 4F6RD 5EYPF 3TWSA 1S70B 1MX2A 2P2CP 4HRLA 4OGCA 2RFAA 2YREA 4HLLA 5JMND 2Y1LE 3SUBA 2XEEA 1OT8A 4HBDA 3Q9NC 5EIDA 1IHBA 1K3ZD 1OY3D 3C5RA 5EN5D 5KNGA 2JUNA 2LAUA 5AN8A 4O62A 4U8YD 4H9DA 4DUIA 2ZGDA 4BEPA 2FD4A 5HRYA 3LJUX 4DX7D 1D9SA 2XOZA 2CRRA 2ETCA 1QYMA 2XZDG 1MX6A 5AARA 3JXJA 5EILA 1SVXA 5ENPD 1K1AA 3V2OA 4DX1A 4Z68A 1SW6A 2CSVA 2KKXA 2DZNA 2V5QC 4HRMB 3ZKJA 1N0RA 2HE0A 2F37A 3V2XA 2BKKB 2EGMA 2FFWA 1BI7B 4ZFHA 1AP7A 2BKGA 5ENRD 2NYJA 4BESA 5AQ7A 3V30A 1N0QA 3MDBC 4LNUD 4YDYA 2DJAA 1BI8B 4HB5A 3TWTA 5CERB 4QQ4A 2JABA 3TWQA 4C48B 3KEAA 4BSZB 5EYLA 4CZ2D 2F8YA 3AAAC 4GPMA 5KWDA 2XZTG 4UUCA 2EXUA 4JB8P 5KBAA 3E2DA 4A63B 5D66A 5AQ9A 5AQBA 5CBNA 2DWZA 2RFMA 5ENOD 2IQJA 1A5EA 2QYJA 5SVXA 4K5BA 3V79K 4F1PA 4G8LA 1BLXB 3TWXA 4HQDA 2JM3A 2QC9A 3FEHA 1WDYA 3LVRE 3UXGA 4B93B 1YYHA 2B0OE 3AJIA 1NFIE 3TWUA 3DEPA 3DEOA 3FJUB 3PLWA 3H7HA 4U8VD 1N11A 4J7WA 4RLYA 5ENQD 5EIBE 2OWAA 5SVIB 2FO1E 5BXOA 2DVWA 2F8XK 2ETAA 2E61A 5FIOA 2KBXA 2XENA 5FINA 3UTMA 5CEDB 2VGEA 3V31A 4DRXE 3EU9A 5HKPA 1IXVA 2XOCA 3LDYA 3J5PA 4QQIA 5BXUA 3TWVA 3UI2A 1MJ0A 1YMPA 3TWWA 3ZU7B 5AAOA 2P57A 5ENSD 4G8KA 2Y0BG 3F6QA 2CONA 4Z0OA 4BETA 1UOHA 3LJNA 4HI9A 3DDTA 5CECB 4LG6A 3KDEC 3DWDA 1BD8A 4GMRA 1K1BA 3EHRA 4LSZE 3B95A 4DX2A 3Q9UC 2PNNA 2CRWA 4TUMA 4YDWA 4CYMD 2D8UA 1MYOA 1DCQA 3W9FA 1IKND 3EHQA 5CBOA 3NOGD 2YVRA 3D9HA 3NBNB 4OGEA 2ETBA 3TWRA 4O60A 5CEAA 2AJAA 4O1OA 4O1PA 1YCSB 5ENTD 5SVYA 1TR4A 1BU9A 3T8KA 2XOYA 4DX5D 4OAUC 3ZNGA 3B7BA 3IXEA 3J5QB 4J8YA 1G3NB 4HI8A 3ZUVB 2A5EA 3HG0D 5HS0A 4ZHBA 4QFVA 4N5QA 1AWCB 5SVIA 2KKYA 3JXIA 2L7PA 2V4HC 3JUEA 5AQAA 4K5CA 4U95D 2RR4A 3T9KA 4NIKA 4ATZD 4HNAD 4HRNA 2J8SD 3Q1DA 5JA4D 3O47A 4Z0RA 2KXPC 4K5AB 2M13A 3W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX6 D;  4BER A;  1WG0 A;  1MX4 A;  2ZGG A;  3LVQ E;  5ITZ F;  3SO8 A;  2L6B A;  3NOC D;  2XEH A;  2MYO A;  3FM8 C;  2DZO A;  1DC2 A;  3HRA A;  5KNH D;  4U96 D;  4OAV B;  4F6R D;  5EYP F;  3TWS A;  1S70 B;  1MX2 A;  2P2C P;  4HRL A;  2RFA A;  4HLL A;  5JMN D;  2Y1L E;  3SUB A;  2XEE A;  1OT8 A;  4HBD A;  3Q9N C;  5EID A;  1IHB A;  1K3Z D;  1OY3 D;  3C5R A;  5EN5 D;  5KNG A;  5AN8 A;  4U8Y D;  4DUI A;  2ZGD A;  4BEP A;  5HRY A;  3LJU X;  4DX7 D;  1D9S A;  2CRR A;  2ETC A;  1QYM A;  2XZD G;  1MX6 A;  5AAR A;  3JXJ A;  5EIL A;  1SVX A;  5ENP D;  1K1A A;  3V2O A;  4DX1 A;  4Z68 A;  1SW6 A;  2DZN A;  2V5Q C;  4HRM B;  3ZKJ A;  1N0R A;  2HE0 A;  2F37 A;  3V2X A;  2BKK B;  1BI7 B;  4ZFH A;  1AP7 A;  2BKG A;  5ENR D;  2NYJ A;  4BES A;  5AQ7 A;  3V30 A;  1N0Q A;  3MDB C;  4LNU D;  4YDY A;  1BI8 B;  4HB5 A;  3TWT A;  5CER B;  2JAB A;  3TWQ A;  4C48 B;  3KEA A;  4BSZ B;  5EYL A;  4CZ2 D;  2F8Y A;  3AAA C;  4GPM A;  5KWD A;  2XZT G;  4UUC A;  4JB8 P;  5KBA A;  4A63 B;  5D66 A;  5AQ9 A;  5AQB A;  5CBN A;  2DWZ A;  2RFM A;  5ENO D;  2IQJ A;  1A5E A;  2QYJ A;  4K5B A;  3V79 K;  4F1P A;  4G8L A;  1BLX B;  3TWX A;  4HQD A;  2QC9 A;  3FEH A;  1WDY A;  3LVR E;  3UXG A;  4B93 B;  1YYH A;  2B0O E;  3AJI A;  1NFI E;  3TWU A;  3DEP A;  3DEO A;  4U8V D;  1N11 A;  4J7W A;  4RLY A;  5ENQ D;  5EIB E;  2OWA A;  2FO1 E;  5BXO A;  2DVW A;  2F8X K;  2ETA A;  5FIO A;  2KBX A;  2XEN A;  5FIN A;  3UTM A;  5CED B;  2VGE A;  3V31 A;  4DRX E;  3EU9 A;  5HKP A;  1IXV A;  3J5P A;  4QQI A;  5BXU A;  3TWV A;  3UI2 A;  1MJ0 A;  1YMP A;  3TWW A;  3ZU7 B;  5AAO A;  2P57 A;  5ENS D;  4G8K A;  2Y0B G;  3F6Q A;  4BET A;  1UOH A;  3LJN A;  4HI9 A;  5CEC B;  4LG6 A;  3DWD A;  1BD8 A;  4GMR A;  1K1B A;  3EHR A;  4LSZ E;  3B95 A;  4DX2 A;  3Q9U C;  2PNN A;  2CRW A;  4TUM A;  4YDW A;  4CYM D;  1MYO A;  1DCQ A;  3W9F A;  1IKN D;  3EHQ A;  5CBO A;  3NOG D;  3D9H A;  3NBN B;  2ETB A;  3TWR A;  4O60 A;  5CEA A;  2AJA A;  4O1O A;  4O1P A;  1YCS B;  5ENT D;  1TR4 A;  1BU9 A;  3T8K A;  4DX5 D;  4OAU C;  3ZNG A;  3B7B A;  3IXE A;  3J5Q B;  4J8Y A;  1G3N B;  4HI8 A;  3ZUV B;  2A5E A;  3HG0 D;  5HS0 A;  4ZHB A;  4QFV A;  4N5Q A;  1AWC B;  3JXI A;  2V4H C;  3JUE A;  5AQA A;  4K5C A;  4U95 D;  3T9K A;  4NIK A;  4ATZ D;  4HNA D;  4HRN A;  2J8S D;  5JA4 D;  3O47 A;  2KXP C;  4K5A B;  3W9G A; 
#chains in the Genus database with same CATH topology
 3O33 A;  4NAC A;  2AVP A;  3ZHE B;  3ONK A;  3FHE A;  3I3N A;  4WWN A;  3ONL A;  2H6I A;  3O37 A;  2KZT B;  3D9M A;  2EIJ E;  2KGI A;  1KPS B;  5D0Q D;  4GB0 A;  3Q79 A;  3O70 A;  5FQ6 A;  2JEK A;  5DBK A;  5EIL A;  2R03 A;  3ESL A;  2LXP C;  1WFK A;  2F37 A;  5J08 A;  5D2M C;  4HFG A;  2IOL A;  1OWM A;  3OTN A;  4C9B B;  4WWO A;  3APF A;  2YUR A;  4AYC A;  4MVT A;  3ENE A;  4C48 B;  3R7Q A;  3VK6 A;  2P9S G;  4GPM A;  4UP0 A;  2OEW A;  4QF3 A;  3AU5 A;  4APF A;  3L13 A;  4EZL A;  2KWK A;  1WM5 A;  2GRO B;  1OWO A;  4GYW A;  2IQC A;  1NP7 A;  2YQM A;  3TWU A;  3N9L A;  4V3K C;  3FTW A;  3CSF A;  3AS4 A;  2R17 C;  3RRN B;  2KCV A;  4F3V A;  5FIO A;  3ZIM A;  3PH0 C;  5TRB A;  1MZC A;  2KAT A;  3QAR A;  4HI9 A;  3W9F A;  3NOG D;  5G05 B;  4U0S A;  2ETB A;  3TWR A;  4UI9 B;  2EGP A;  4KBQ A;  4AJW A;  3BG1 B;  5CRV A;  2AXU A;  3Q73 A;  1WEO A;  3ZNG A;  3GZ2 A;  4RVB A;  4S3O B;  4L58 A;  2J49 A;  3I5P A;  5SVI A;  2V4H C;  3NAW A;  2RD0 A;  3CK8 A;  4YBT A;  2JRJ A;  4G24 A;  1Z60 A;  3ZYK A;  1XNF A;  4FC8 A;  2WQ7 A;  4OAV B;  4F6R D;  3LYA A;  2PM6 A;  1MX2 A;  4JVS A;  5JMN D;  3BQO A;  3O34 A;  5KNG A;  3PE3 A;  2WXM A;  1EF1 C;  3FH8 A;  4DUI A;  2ZIR A;  2VPE A;  3WXX A;  5FZR A;  1D9S A;  2XOZ A;  3L6A A;  2FUI A;  1QYM A;  2CSV A;  2YNQ A;  2C2V S;  3I2D A;  1KZO A;  1O5M A;  4GZ5 A;  2DX8 A;  5ENR D;  5A6C A;  4B86 C;  3CVP A;  2I50 A;  3IHP A;  1SA4 A;  2VJE A;  3SF4 A;  1P5Q A;  1PAQ A;  1JM7 A;  2C2L A;  4EBA G;  2MOW A;  3MV2 B;  4F1P A;  1INZ A;  4JXT A;  1KLX A;  2ECN A;  3AJI A;  1NFI E;  5E75 A;  2KWO A;  2VYI A;  3HIZ A;  4GTT A;  3C98 A;  4MS6 A;  3VTX A;  2GRN B;  4NQ0 A;  2XQ0 A;  1OCO E;  2R5S A;  2EIK E;  1N87 A;  3L17 A;  4U8H A;  2KU3 A;  1MJ0 A;  1IQU A;  4WA6 A;  2LSV A;  3G2V A;  4GA2 A;  3PZ4 A;  3ASO E;  3Q9U C;  3EHQ A;  3ABK E;  2F0Y A;  3FUI A;  4E85 A;  3UKR G;  4L23 A;  1TR4 A;  2FBN A;  2E0I A;  3VTY A;  4A1G A;  5G55 A;  4BFR A;  2G43 A;  3L1X A;  2KC7 A;  4NN2 A;  1ELW A;  1IHG A;  2KIZ A;  4A0C D;  4JHK A;  3AG3 E;  2IO2 C;  3O35 A;  3PZD A;  4ATZ D;  3QKY A;  5CRU A;  3UM1 A;  1Z6T A;  4LNB A;  4Q96 A;  2AXZ A;  3KSQ A;  5T8I A;  2CFU A;  3NZS A;  4I2Z A;  2LGL A;  2WXK A;  3PVL A;  5D1K B;  4HBD A;  5LX8 A;  3LJ3 A;  4AP2 A;  4WND A;  2FO7 A;  1TJC A;  1ZB1 A;  2FD4 A;  1HXI A;  5KH9 A;  3FL2 A;  3FTV A;  3ML8 A;  2MHK A;  3ZNI A;  2KM4 A;  4URK A;  3DXM G;  5B75 A;  2EGM A;  4Z68 A;  1SVX A;  1VYX A;  2DZN A;  4A49 A;  3TXN A;  4FLH A;  2M85 A;  3FU5 A;  3TAX A;  3X2Q E;  3FAO A;  4LNG A;  2C0L A;  4IRU A;  1WIM A;  4BSZ B;  4JB8 P;  3G2U A;  3MKQ A;  4JZY A;  3HXD A;  5CBN A;  1TNO A;  2DWZ A;  4G11 A;  4K5B A;  4YDE A;  4MRU A;  4I2W A;  2B0O E;  2WM9 A;  2XGO A;  3DEO A;  5DIN A;  4RLY A;  4GAA A;  4KVM A;  1LDJ B;  3SBT B;  2QYU A;  4WNE A;  2LXH C;  4ZUX U;  4F7A A;  3I4G A;  1QZ2 A;  2Y4U A;  2P57 A;  1YMP A;  4UWH A;  2CON A;  4GYO A;  4V3I A;  1IQR A;  3D9P A;  3KDE C;  4IUL A;  3U5N A;  4YBM A;  4BX9 A;  2Y1M A;  4OGE A;  5JG6 A;  2J4B A;  1XGW A;  3TXM A;  3EU5 A;  2LGK A;  3D9I A;  3J5Q B;  4I1A A;  2C0M A;  1S63 A;  3U66 A;  1OWL A;  3TGO A;  3LQI A;  4K5C A;  3EJN A;  4U95 D;  4TUU A;  4HRN A;  3O47 A;  3LPZ A;  3W9G A;  3UUX A;  2CHX A;  3D9J A;  5H1T A;  1DC2 A;  3LKU A;  4A3V A;  3NF1 A;  2XEE A;  4HVB A;  1U2V G;  1JWF A;  5HRY A;  1JUQ A;  3T6R A;  3KEZ A;  2PUY A;  4LEU A;  3LY7 A;  3IBE A;  4YC9 A;  4WUY A;  3ZKJ A;  4HRM B;  3R9M A;  3ISM C;  3URZ A;  3MDB C;  4Q69 A;  4FHK A;  5DKA A;  1MQS A;  4M7C A;  3AU4 A;  5FER A;  2NAA A;  3JYS A;  3CKC A;  1HZ4 A;  4H7Y A;  4ZQL A;  2XCB A;  4HQD A;  4JL0 A;  2JM3 A;  1QBQ A;  3CHR A;  4GTQ A;  5EX0 A;  3QC1 A;  3B7U X;  3PNL B;  4N5C A;  2WXQ A;  4FLB A;  2XEN A;  3UTM A;  4IC3 A;  5CED B;  2JMI A;  2AXV A;  4EEC A;  5FTP A;  4DRX E;  2VPB A;  5HKP A;  3S2A A;  3JQ0 A;  3U5O A;  1DVP A;  4BHW A;  4UQX A;  4LG6 A;  3ZW3 A;  1WES A;  2D8U A;  4I6J A;  2PZI A;  5G05 J;  2LV9 A;  2XS8 A;  5BUZ A;  2XPZ A;  4UI9 J;  1X4I A;  5ENT D;  2XRY A;  2X38 A;  3FUF A;  3ASH A;  4EQF A;  3D3M A;  2MT5 A;  4XX5 A;  4FIP A;  2J07 A;  3QOU A;  3FM8 C;  4AYC B;  3DXK G;  2XS1 A;  3OAW A;  3ZYQ A;  2Y1L E;  5FT9 A;  4YAX A;  5AN8 A;  4ABN A;  3LJU X;  2YHE A;  4HOT A;  2CT2 A;  1ZU2 A;  3BG0 B;  2WXF A;  5CER B;  4W9R A;  4ZHB A;  2X6J A;  3SZ7 A;  1SW6 A;  1SZA A;  4A3T A;  3FUE A;  2NYJ A;  3B7S A;  4GNF A;  2DCP A;  4G2V A;  2OEV A;  1DNP A;  2KGG A;  2GGF A;  3S7F A;  2CHZ A;  2LRI C;  4GML A;  4YDO A;  3QWP A;  2X6K A;  2YHO A;  5KWD A;  3EHM A;  2CG3 A;  3O7A A;  2ECI A;  2ZET C;  4UQZ A;  5AQ9 A;  2IOS A;  2RFM A;  2Q7F A;  4G8L A;  5LCW B;  3V43 A;  3TWX A;  2ECV A;  1WDY A;  3LVR E;  1NL4 A;  1JPL A;  5C11 A;  2DSM A;  3LS8 A;  5SVI B;  4J7W A;  1UG3 A;  1UW4 B;  3L22 A;  3SFY A;  3KQI A;  1PC2 A;  3KV6 A;  4KZC A;  4DK5 A;  2UZG A;  4EZJ A;  3N9P A;  2EIN E;  2VGE A;  1HYI A;  3V31 A;  1XWH A;  5LFA A;  2YHN A;  1WEQ A;  2Y0B G;  1UOH A;  4HOU A;  5CEC B;  3C6W A;  4YBS A;  1WEE A;  4CYM D;  2R05 A;  5FEY A;  5AYW D;  3RO3 A;  2EIM E;  1H6O A;  3LQH A;  3IXE A;  2BAY A;  4ACK A;  3L11 A;  4N5Q A;  3VLD A;  1E8Z A;  4CGW A;  3CEQ A;  2UY1 A;  2CSZ A;  3Q1D A;  4XI1 A;  4K5A B;  4GTM A;  2LAI A;  4DX6 D;  4J8E A;  4AOF A;  2LQ6 A;  3QK0 A;  1SA5 A;  3ZVV A;  3SFX A;  5KNH D;  1JM7 B;  4HOS A;  5ANR A;  2QIZ A;  1K8K G;  1UN8 A;  3ML9 A;  4B0Z A;  2LAU A;  4KZ0 A;  4U8Y D;  1Z6U A;  5C2Y A;  4BEP A;  2QIC A;  2G6Q A;  1E4U A;  3G2T A;  5AAR A;  4BBQ A;  5T3R A;  3FTX A;  5A23 A;  4PDX A;  1FVH A;  1MHQ A;  3EUV A;  3KAE A;  3U64 A;  5EYL A;  3Q78 A;  2VSO E;  3ZRH A;  5D66 A;  2NSZ A;  4MLP A;  5SVX A;  3PZ2 A;  1H2V C;  1DCE A;  5BPP A;  3TG5 A;  3B13 A;  5KJK A;  2IFU A;  4A4B A;  3FDH A;  4B93 B;  2CHW A;  4WZ2 A;  3PE4 A;  4BT9 A;  2H6H A;  3JQ1 A;  5KH3 A;  3GZS A;  1WEV A;  2DVW A;  2F8X K;  2MA6 A;  2ETA A;  3UT7 A;  2E61 A;  2DYS E;  2MA5 A;  2P58 C;  1E7U A;  4H7X A;  2WMO A;  4I7B A;  2ILR A;  5B1B E;  4LUN U;  4A4C A;  2DIW A;  2FSA A;  3TWV A;  3LY9 A;  3QB2 A;  4C9Z A;  1UJJ A;  3ZN3 A;  2D8S A;  4R8P K;  1MYO A;  1IKN D;  4GTV A;  3L16 A;  1E8W A;  4JHR A;  4GTO A;  3DSX A;  1FT1 A;  1KT0 A;  1HG5 A;  5ARF A;  1RMD A;  3FUD A;  4U04 A;  4N3A A;  2K1J A;  5ENQ D;  1Z5S C;  3FTZ A;  1MX4 A;  2XP0 A;  4YAD A;  3ASL A;  4N3W A;  4JPS A;  2MYO A;  3DRA A;  1H6P A;  4CDN A;  2WXJ A;  3L1Z B;  4K03 A;  3MKQ B;  4O64 A;  1IHB A;  4XKB A;  5G04 C;  2MUM A;  1FT2 A;  2LN0 A;  2L0T B;  1E8Y A;  4FU3 A;  1SQM A;  4AY6 A;  3SQV A;  2CRR A;  2XZD G;  3MGB A;  4N2S A;  1N0R A;  3OXL A;  2OND A;  1BI7 B;  3CST A;  2L0I A;  1N0Q A;  4LNU D;  5B8D A;  4FK5 A;  4BY6 A;  2P9L G;  4BTB A;  3HDX A;  2ION A;  5IY5 E;  3ASG A;  1TEZ A;  2YT5 A;  2XEU A;  2WXH A;  4NUR A;  2IQJ A;  1G25 A;  3ESK A;  3Q47 B;  4P5O B;  4GPK A;  5I3L A;  4DPR A;  2WB2 A;  1OXJ A;  1A17 A;  2VP7 A;  5ENN A;  4JEU A;  4CCG X;  1K2F A;  3CR3 A;  2QFC A;  4I43 A;  3RU0 A;  4R2Y A;  4G23 A;  3ZVY A;  5TBN A;  1W3B A;  4QQI A;  5AIU A;  3DBS A;  4I7D A;  4Y6W A;  3ZPV 1;  4FP7 A;  4YDW A;  3E32 A;  2IEJ A;  5JHA A;  4EZK A;  2XPY A;  4I7C A;  4L2Y A;  3Q15 A;  4EHM A;  5JJT A;  5G04 B;  3MHH A;  4I1M A;  2X6F A;  2Y1N A;  5AJD A;  3DWL G;  5AQA A;  3SHF A;  4AEZ C;  3PRE A;  3KSL A;  3FY4 A;  2MD8 C;  2ZGG A;  3LVQ E;  2MIQ A;  3UM2 A;  2WQ6 A;  3T7L A;  3PEV B;  3HRA A;  4UWL A;  1X4J A;  1S70 B;  1TN7 A;  1MBM A;  1N9A A;  2CFZ A;  3CQC B;  2RSD A;  1UN9 A;  3Q9N C;  2ZXW E;  4G26 A;  3T5V A;  4O62 A;  3NZU A;  3VLE A;  4U63 A;  1D8E A;  3FWV A;  4LRZ A;  5FJY A;  2E2E A;  1WE9 A;  2KKX A;  5JHB A;  4U7E B;  2V5Q C;  2GRL A;  3UIO C;  1HX8 A;  4YVQ C;  3EHN A;  2IDA A;  3MA5 A;  1AP7 A;  1MM2 A;  3BUA A;  5AQ7 A;  2EOD A;  3HTK C;  4YDY A;  3BU8 A;  4HB5 A;  3CVV A;  3TWQ A;  5H1V A;  3FUL A;  3KEA A;  2VSX E;  2XZT G;  4FUL A;  2YU4 A;  1S64 A;  3QWW A;  4CT4 A;  2XGM A;  3FU3 A;  1N4R A;  5LCW J;  3G2W A;  3GW4 A;  3HVE A;  2VGX A;  4BSX A;  5H9M A;  4N2Q A;  4MKT A;  2KFT A;  4D10 C;  3FJU B;  2E6R A;  1V55 E;  3FP3 A;  4C0M A;  2FO1 E;  2LNI A;  3E34 A;  3MEK A;  2VSY A;  2KWN A;  5LKU A;  5M72 A;  2KBX A;  4B94 A;  3ZYL A;  1NA0 A;  3E4B A;  3D9N A;  4A55 A;  1JCR A;  2VSN A;  5BT1 A;  2ZU6 B;  3LJN A;  5FB1 A;  3RRM B;  4J8F A;  3DWD A;  5KJM A;  1BD8 A;  2PNN A;  4TUM A;  2YVR A;  4I1O B;  5CHE E;  3SGH A;  4O1O A;  1VDY A;  1YCS B;  1BU9 A;  3ULE G;  5EX3 A;  5HS0 A;  5FB0 A;  3GZ1 A;  4GMJ A;  2CKL A;  1N95 A;  5BW8 C;  4U0Z A;  4BER A;  1E7V A;  2OVF A;  5H7P A;  1ELK A;  5ITZ F;  3C3Q A;  3M7K A;  2OV8 A;  1WEN A;  5G0F A;  3ZPV E;  2MNY A;  3FU0 A;  3HCU A;  1HS6 A;  1WGM A;  2H6G A;  2VTB A;  4HLE A;  2ECG A;  2QZA A;  1QNF A;  4J0U A;  3RPG C;  2WXN A;  3PEU B;  1TNB A;  3AS8 A;  5T4Y A;  2LUH A;  4I9E A;  4JA7 A;  4GYY A;  2H0D B;  2HE0 A;  2Y69 E;  3NB2 A;  4AP4 A;  3KNV A;  4CEM A;  2ECT A;  4AUQ B;  4GZC A;  2OOE A;  1O1S A;  4F53 A;  4C0E A;  4JHJ A;  5C1D A;  2F8Y A;  2CG2 A;  4UWG A;  4UUC A;  2EXU A;  4MSX A;  3L9T A;  3VLF A;  4ME2 A;  2GRR B;  2KCK A;  1HYJ A;  3T5X A;  4Q94 A;  3RO2 A;  3H7H A;  4U8V D;  4FAD A;  4IN3 B;  2VQ2 A;  4IC2 A;  3CVQ A;  2GW1 A;  3SBS A;  1IXV A;  5BXU A;  3TWW A;  4WAF A;  5D1L B;  2Y43 A;  4UI9 K;  1VD4 A;  2I9C A;  3B95 A;  4DX2 A;  5CBO A;  1LTX A;  4OVV A;  2DYR E;  4TV3 A;  5FZS A;  4I9C A;  2VJ8 A;  1H2T C;  4O6F A;  2J9Q A;  1HG2 A;  3PHD A;  4AY5 A;  3ABL E;  3Q4A B;  3CHS A;  3O4Z A;  3QZV A;  1OCC E;  2RKK A;  3JUE A;  3RK6 A;  3Q5M A;  2I2O A;  4GZ3 A;  3U5M A;  3B7T A;  2L6B A;  2I6H A;  4OVU A;  3HXC A;  4GZD A;  1FPP A;  3DSW A;  3TWS A;  3UIP C;  3LXU X;  2NC9 A;  2YRE A;  4ANX A;  3FEY A;  4BX8 A;  2BED A;  4ILI A;  4FO9 A;  1Y6I A;  2WXP A;  5JJ6 A;  3CVU A;  5EYA F;  3JXJ A;  2KE1 A;  4CT0 A;  4L9P A;  3IKO B;  4A1S A;  1HO8 A;  1O1T A;  2XPI A;  3CHM A;  4U0U A;  4GA0 A;  3DSS A;  4IYP A;  4MBG A;  4EBA A;  2DJA A;  5LKX A;  3ZYM A;  2XRZ A;  4GA1 A;  1N54 A;  3UM0 A;  3N71 A;  3SOW A;  2JAB A;  1O1R A;  2YYR A;  1U3D A;  3AAA C;  3PUQ A;  3E2D A;  2CSY A;  3CVX A;  3V79 K;  3SHB A;  4R7E A;  5FZQ A;  3FEH A;  2L5U A;  2VPG A;  3KD7 A;  2I1J A;  2PQN A;  3DEP A;  3FTU A;  1N11 A;  3MHS A;  2AWI A;  2K16 A;  3C3O A;  3SY2 A;  5AIJ A;  4AIF A;  2EIL E;  3UKU G;  3ZTG A;  3M63 A;  3TG4 A;  4JW1 A;  3SNX A;  5LOZ A;  3UX4 A;  4G8K A;  1Z3X A;  4TRQ A;  4BET A;  5TDW A;  3MZL B;  1L5J A;  4TXR A;  4UQY A;  5AJL A;  4YVO A;  1RW2 A;  3CQG B;  1KT1 A;  3DPD A;  3L54 A;  2YQ8 A;  2X3M A;  3IHV A;  4OYS A;  4TXP A;  4RQI A;  4O1P A;  2QJ0 A;  3LCA A;  2LGG A;  3T8K A;  4WZ3 B;  3GYZ A;  1IYG A;  2A5E A;  2XB1 A;  4QFV A;  2LDR A;  4LJN A;  2KYU A;  4LK9 A;  2HDP A;  3FEX A;  3HCS A;  1U3C A;  2QY7 A;  4BT8 A;  2V5F A;  2IJG X;  3ASN E;  4U96 D;  1TNZ A;  2LXL A;  3N9M A;  1D8D A;  1EYH A;  1WAO 1;  1OT8 A;  1V54 E;  3K9I A;  4WWP A;  2JUN A;  5KH7 A;  3N9Q A;  2YSJ A;  2WXI A;  3HXE A;  3CK9 A;  2ETC A;  1OWP A;  4J8S A;  4CRW A;  3RAU A;  3HXB A;  4R7L A;  4DLO A;  1JCQ A;  4LER A;  2FFW A;  2VJE B;  4X3G A;  3SI5 A;  2LXM A;  5FQ7 A;  3PUK A;  5D0O D;  4FA6 A;  4CDR A;  3FFL A;  3UPV A;  2EQX A;  4YAB A;  3KS2 A;  4L7X A;  2ECJ A;  5ENO D;  2XCC A;  5BV0 A;  1F62 A;  1JCS A;  5B79 A;  4DLQ A;  3FUH A;  2K4D A;  5FQ4 A;  4ILG A;  1RZ4 A;  2YSM A;  4PS7 A;  3RTR B;  4APO A;  4GTS A;  5BXO A;  4JD2 G;  4UWF A;  2RI7 A;  2LO6 A;  3CIA A;  3S7D A;  3ULY A;  2MD7 B;  4GND A;  3JUI A;  4GMR A;  3L08 A;  1K1B A;  1WEP A;  5FQ8 A;  2YHC A;  3CKB A;  3NBN B;  3U9W A;  1H19 A;  5G05 C;  2F42 A;  4UI9 C;  3ZFW A;  3E37 A;  4I17 A;  2P9I G;  3DPY A;  4P29 A;  2VJF A;  3SOX A;  4S3O C;  2WXO A;  4RG6 A;  2RR4 A;  4NIK A;  3DQV R;  2FF4 A;  5ENP D;  3NQP A;  3PZ1 A;  5J90 A;  1Z2Q A;  2WQH A;  4KVO A;  1WG0 A;  3E30 A;  3M99 A;  3SO8 A;  2DZO A;  4WNG A;  5EYP F;  2P2C P;  2RFA A;  3SUB A;  3AS5 A;  2R59 A;  4JEH A;  3B7R L;  4RSY A;  3HVE B;  2VGX B;  2BUG A;  3APC A;  3HHM A;  3MV3 B;  3RSE G;  3ZEF A;  4PTB A;  3UT4 A;  1MX6 A;  3E33 A;  4DX1 A;  4PS8 A;  1MM3 A;  2FUL A;  3EIJ A;  4YAT A;  4GB9 A;  1TYQ G;  2PQR A;  3RJV A;  4ZFH A;  4GNE A;  1TNY A;  3FTY A;  3V30 A;  2LGV A;  4ATG A;  3CVY A;  1N94 A;  4XZ4 A;  3S7J A;  5LP0 A;  2P9P G;  5BNW A;  3LEW A;  2FUU A;  4A63 B;  2VGY A;  2M6M A;  5B1A E;  1A5E A;  3MYV A;  3ULQ A;  4PH4 B;  4PUC A;  1T1H A;  2YIN A;  4XE0 A;  2AW6 A;  2M1R A;  1S0P A;  4M3O A;  4LKA A;  2GRP B;  1N4P A;  2CKL B;  5B77 A;  3LDZ A;  4DI4 A;  1LD7 A;  4ACL A;  3U4T A;  1EDU A;  3PUJ A;  3DST A;  3EU9 A;  3GV4 A;  2XOC A;  3LDY A;  3OXG A;  3CVN A;  3LRQ A;  3Q49 B;  4GCO A;  3DDT A;  3OXF A;  1V87 A;  4OGC A;  3Q7F A;  1ZBD B;  3PZ3 A;  3O48 A;  2VTB B;  1LDK C;  3FUK A;  4F52 B;  3FTS A;  5E76 A;  2L6J A;  4O60 A;  2P9N G;  3D9O A;  3WG7 E;  2HR2 A;  2IY0 C;  3PNT B;  4J8D A;  4DX5 D;  2WVI A;  2F6J A;  4BWR A;  2KRE A;  2JLB A;  1AWC B;  3PDN A;  2J4D A;  4XIF A;  2A4Z A;  3RRU A;  1JOC A;  3GL6 A;  3QDN A;  2BF0 X;  5A7D B;  3D9L A;  3PUR A;  2NXP A;  3AG1 E;  2J8S D;  5JA4 D;  4GTR A;  4AVX A;  2L43 A;  2V0P A;  3N9O A;  4PPE A;  4WNF A;  2P9U G;  4W4U A;  2PM7 A;  4B89 A;  3HCT A;  5K3Q A;  4CA1 A;  1HH8 A;  3CHO A;  5EID A;  1WEW A;  5LKZ A;  1BPO A;  3I4R B;  4GZ6 A;  3CVL A;  4BTA A;  2RG8 A;  2BTD A;  2WXL A;  3DPL R;  1B89 A;  4KMO A;  2MRI A;  2YQL A;  2HO1 A;  3ZVZ B;  3V2X A;  3QWV A;  1TNU A;  4AXH A;  4V3L C;  3P1U A;  4BES A;  2GRQ B;  4XEI G;  5G2N A;  3MX3 A;  3SD5 A;  3U3W A;  1X5B A;  2WPV A;  4QQ4 A;  3ZHE A;  5CCL A;  4LLB A;  3C5K A;  3JCK C;  4CZ2 D;  4ANU A;  4RG9 A;  2KZT A;  3MKR A;  4ANV A;  4CCA A;  1JWG A;  2I1K A;  2QC9 A;  3SFZ A;  1X4U A;  4N4F A;  3EIQ C;  3ASD A;  4J6I A;  4XI0 A;  3PLW A;  2M63 A;  1CHC A;  4HOR A;  3FUM A;  2Y4T A;  1H2U A;  3ZXS A;  4KT6 B;  3UI2 A;  5AIT A;  4I6E A;  3NG2 A;  3F6Q A;  2HYE D;  1IYM A;  4LSZ E;  4TKP B;  2Y3A A;  4KYO B;  3QAQ A;  2XGS A;  1EPU A;  3CVW A;  2XEV A;  3LQJ A;  2AJA A;  5SVY A;  4G25 A;  4Y6C A;  3FH7 A;  3KV5 A;  1U6G B;  2OCC E;  1NZN A;  2JMJ A;  3EDT B;  5KJN A;  3JXI A;  3PS6 A;  2ECW A;  2L0B A;  3FUN A;  4WZ0 A;  3PRZ A;  4U07 A;  4HNA D;  3FAN A;  4K0R A;  4DJA A;  2F6N A;  4L7T A;  2H6F A;  4HLL A;  5EN5 D;  3C5R A;  1K3Z D;  1SZ9 A;  4FJY A;  2EA6 A;  1WEU A;  1LF8 A;  2ZGD A;  2E6S A;  5HI7 A;  5KCM A;  4PS3 A;  4DX7 D;  3TJP A;  4H9D A;  1OCZ E;  2WMN A;  3UT8 A;  2HYZ A;  2FI7 A;  3UM3 A;  4FJC A;  1ZBP A;  1PY1 A;  2L9B A;  1HU3 A;  2IF4 A;  1HFA A;  3UIN C;  3L82 A;  1FCH A;  2VNF A;  3N9N A;  2GRM A;  5KBA A;  4N3B A;  3IEG A;  5AQB A;  2JMD A;  2UWJ G;  5C13 A;  2WXR A;  3CV0 A;  1TN6 A;  3G2S A;  1N4S A;  1YYH A;  1Y8M A;  1FBV A;  1Q2Z A;  5B3S E;  4N3C A;  4F1S A;  1GW6 A;  2DBA A;  3DSV A;  4E6H A;  1X81 A;  3O36 A;  3DSU A;  2IU1 A;  5EKQ D;  4LCT A;  1OCR E;  4EPZ A;  2J08 A;  4HXI A;  2L75 A;  1DCQ A;  2WXG A;  3D9H A;  4ILH B;  3RIB A;  1FVF A;  5CEA A;  1HF8 A;  2VPD A;  3AG4 E;  4J8Y A;  3ZUV B;  1G3N B;  4HI8 A;  1NI1 A;  2UY1 B;  4TXQ A;  5DIZ A;  2L7P A;  4CGV A;  3RKV A;  4HOQ A;  3S7B A;  2A5U A;  5B78 A;  1H0A A;  4Z0R A;  2KXP C;  2YW8 A;  2G45 A;  5TDR A;  3NOC D;  1Z3Y A;  4X8Q A;  2B6C A;  2XEH A;  3APD A;  1ELR A;  2MKE A;  3D9K A;  3RPG B;  4I6G A;  4HS2 A;  1H6K A;  4GU5 A;  1N4Q A;  1WIL A;  3TL5 A;  1WEM A;  2L80 A;  4JC8 A;  5CMY A;  3FUJ A;  3HXF A;  1KZP A;  1K1A A;  1FP0 A;  2BKK B;  4YND A;  3SOU A;  2BKG A;  3ASF A;  3M62 A;  3Q7A A;  4FJZ A;  3TWT A;  4GNG A;  2XHE A;  4ANW A;  5CCM A;  4B7Y C;  2R2L A;  3R9A B;  2QYJ A;  5ANL A;  5BV1 A;  2V8S E;  4LAD B;  5LCW C;  4AV7 A;  2J09 A;  3LY8 A;  3CLJ A;  3HYM B;  3C72 A;  1LD8 A;  2FEZ A;  4L1B A;  2VJF B;  1OUV A;  5EIB E;  2KWJ A;  3CHP A;  1VFY A;  2PL2 A;  4JA9 A;  4AM9 A;  4Z0O A;  4GCN A;  3MJW A;  4QF2 A;  2CRW A;  4UP5 A;  5LKT A;  1E96 B;  2AN6 A;  4NRH B;  3CGH A;  2X6I A;  2XOY A;  4OAU C;  5CMW A;  3HG0 D;  4L2L A;  2KKY A;  1TJF A;  2P9K G;  2M13 A;  2HM8 A;  5H1U A;  2M3H A;  3UQ3 A;  5ARG A;  4XI9 A;  3R7R A;  4HRL A;  1E8X A;  4FHJ A;  1OY3 D;  5G04 J;  4B8C B;  2IO3 C;  4KXK B;  3ZPJ A;  1TN8 A;  3P2B A;  3QNK A;  2YUC A;  3C3R A;  1QQE A;  3V2O A;  1HE8 A;  3ABM E;  3MCX A;  5TAB A;  3UMV A;  2OVB A;  3U5P A;  2LAH A;  4CDM A;  2H0D A;  3Q75 A;  1BI8 B;  4B8A A;  1N52 A;  5JJ7 A;  2K17 A;  2LSU A;  4GTP A;  2V4L A;  1BLX B;  2PNX A;  5J3X A;  3QJZ A;  4Q6F A;  1E90 A;  3AG2 E;  3UXG A;  3CK7 A;  5KJL A;  2OWA A;  3EB6 A;  4G1T A;  3ZXP A;  2OXQ C;  3IHY A;  5EDS A;  5FIN A;  4DI3 A;  4ZDT A;  3J5P A;  3ZU7 B;  5AAO A;  1WY6 A;  4N39 A;  5ENS D;  3FH5 A;  1YA0 A;  2ZIS A;  3CHQ A;  5D1M B;  3EHR A;  4XKC A;  1BOR A;  3FU6 A;  1UJK A;  4UWK A;  1OWN A;  2X6H A;  3ZGQ A;  2MNZ A;  5FWQ A;  3T8M A;  3B7B A;  3EB5 A;  5B76 A;  1NA3 A;  2R02 A;  3IV0 A;  5HQ8 A;  3T9K A;  2KR4 A;  5AEN A;  3BEE A;  2KCL A; 
#chains in the Genus database with same CATH homology
 4DX6 D;  4BER A;  1WG0 A;  1MX4 A;  2ZGG A;  2XP0 A;  3LVQ E;  5ITZ F;  3SO8 A;  2L6B A;  3NOC D;  3M7K A;  2XEH A;  2MYO A;  3FM8 C;  2DZO A;  1DC2 A;  3HRA A;  5KNH D;  2MKE A;  4U96 D;  5K3Q A;  4OAV B;  4F6R D;  5EYP F;  3TWS A;  1S70 B;  1MX2 A;  2P2C P;  4HRL A;  4OGC A;  2RFA A;  2YRE A;  4HLL A;  5JMN D;  2Y1L E;  3SUB A;  2XEE A;  1OT8 A;  4HBD A;  3Q9N C;  5EID A;  1IHB A;  1K3Z D;  1OY3 D;  3C5R A;  5EN5 D;  5KNG A;  2JUN A;  2LAU A;  5AN8 A;  4O62 A;  4U8Y D;  4H9D A;  4DUI A;  2ZGD A;  4BEP A;  2FD4 A;  5HRY A;  3LJU X;  4DX7 D;  1D9S A;  2XOZ A;  2CRR A;  2ETC A;  1QYM A;  2XZD G;  1MX6 A;  5AAR A;  3JXJ A;  5EIL A;  1SVX A;  5ENP D;  1K1A A;  3V2O A;  4DX1 A;  4Z68 A;  1SW6 A;  2CSV A;  2KKX A;  2DZN A;  2V5Q C;  4HRM B;  3ZKJ A;  1N0R A;  2HE0 A;  2F37 A;  3V2X A;  2BKK B;  2EGM A;  2FFW A;  1BI7 B;  4ZFH A;  1AP7 A;  2BKG A;  5ENR D;  2NYJ A;  4BES A;  5AQ7 A;  3V30 A;  1N0Q A;  3MDB C;  4LNU D;  4YDY A;  2DJA A;  1BI8 B;  4HB5 A;  3TWT A;  5CER B;  4QQ4 A;  2JAB A;  3TWQ A;  4C48 B;  3KEA A;  4BSZ B;  5EYL A;  4CZ2 D;  2F8Y A;  3AAA C;  4GPM A;  5KWD A;  2XZT G;  4UUC A;  2EXU A;  4JB8 P;  5KBA A;  3E2D A;  4A63 B;  5D66 A;  5AQ9 A;  5AQB A;  5CBN A;  2DWZ A;  2RFM A;  5ENO D;  2IQJ A;  1A5E A;  2QYJ A;  5SVX A;  4K5B A;  3V79 K;  4F1P A;  4G8L A;  1BLX B;  3TWX A;  4HQD A;  2JM3 A;  2QC9 A;  3FEH A;  1WDY A;  3LVR E;  3UXG A;  4B93 B;  1YYH A;  2B0O E;  3AJI A;  1NFI E;  3TWU A;  3DEP A;  3DEO A;  3FJU B;  3PLW A;  3H7H A;  4U8V D;  1N11 A;  4J7W A;  4RLY A;  5ENQ D;  5EIB E;  2OWA A;  5SVI B;  2FO1 E;  5BXO A;  2DVW A;  2F8X K;  2ETA A;  2E61 A;  5FIO A;  2KBX A;  2XEN A;  5FIN A;  3UTM A;  5CED B;  2VGE A;  3V31 A;  4DRX E;  3EU9 A;  5HKP A;  1IXV A;  2XOC A;  3LDY A;  3J5P A;  4QQI A;  5BXU A;  3TWV A;  3UI2 A;  1MJ0 A;  1YMP A;  3TWW A;  3ZU7 B;  5AAO A;  2P57 A;  5ENS D;  4G8K A;  2Y0B G;  3F6Q A;  2CON A;  4Z0O A;  4BET A;  1UOH A;  3LJN A;  4HI9 A;  3DDT A;  5CEC B;  4LG6 A;  3KDE C;  3DWD A;  1BD8 A;  4GMR A;  1K1B A;  3EHR A;  4LSZ E;  3B95 A;  4DX2 A;  3Q9U C;  2PNN A;  2CRW A;  4TUM A;  4YDW A;  4CYM D;  2D8U A;  1MYO A;  1DCQ A;  3W9F A;  1IKN D;  3EHQ A;  5CBO A;  3NOG D;  2YVR A;  3D9H A;  3NBN B;  4OGE A;  2ETB A;  3TWR A;  4O60 A;  5CEA A;  2AJA A;  4O1O A;  4O1P A;  1YCS B;  5ENT D;  5SVY A;  1TR4 A;  1BU9 A;  3T8K A;  2XOY A;  4DX5 D;  4OAU C;  3ZNG A;  3B7B A;  3IXE A;  3J5Q B;  4J8Y A;  1G3N B;  4HI8 A;  3ZUV B;  2A5E A;  3HG0 D;  5HS0 A;  4ZHB A;  4QFV A;  4N5Q A;  1AWC B;  5SVI A;  2KKY A;  3JXI A;  2L7P A;  2V4H C;  3JUE A;  5AQA A;  4K5C A;  4U95 D;  2RR4 A;  3T9K A;  4NIK A;  4ATZ D;  4HNA D;  4HRN A;  2J8S D;  3Q1D A;  5JA4 D;  3O47 A;  4Z0R A;  2KXP C;  4K5A B;  2M13 A;  3W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...