1DCQA

Crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
276
structure length
276
Chain Sequence
LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYK2-ASSOCIATED PROTEIN BETA
publication title Crystal structure of the ARF-GAP domain and ankyrin repeats of PYK2-associated protein beta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 93
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1dcqA02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 1dcqA01
1K1BA 2QYJA 3SUBA 2V5QC 5CBOA 5EILA 4BERA 2P57A 3TWVA 2DZOA 2F37A 3J5QB 3LVQE 1IKND 3V31A 3KEAA 3T8KA 5JA4D 5EYPF 2DVWA 5ENRD 1MYOA 4U8YD 3UTMA 1BU9A 3HRAA 4DX1A 5KNGA 3W9FA 4U8VD 3IXEA 2F8XK 3F6QA 1MX4A 1YMPA 3EHRA 3AJIA 2NYJA 5HRYA 4OAVB 1A5EA 3MDBC 5ENSD 3V2OA 3UI2A 3O47A 5ENPD 1SW6A 2KXPC 5AQBA 5AAOA 4HI8A 4K5BA 4O1PA 5KNHD 4GMRA 5AQ9A 4HQDA 5D66A 3ZUVB 3HG0D 3JUEA 3AAAC 4HI9A 5JMND 3TWWA 1S70B 2OWAA 2ZGDA 3JXJA 1N0QA 4HBDA 3Q9UC 2RFAA 3V30A 1N11A 4HB5A 5KWDA 3FEHA 1BLXB 3V79K 2AJAA 4A63B 5BXUA 1UOHA 2VGEA 2BKKB 1OY3D 3TWXA 3LJUX 4JB8P 5AQAA 2ETCA 5ENOD 5ENQD 2CRRA 2XENA 4ZFHA 3ZU7B 2Y1LE 1YYHA 5FINA 5EIDA 4QQIA 1MX2A 3D9HA 1WG0A 3C5RA 2A5EA 2Y0BG 4DRXE 2BKGA 1QYMA 4TUMA 4YDYA 1OT8A 1AP7A 4QFVA 5AARA 5AN8A 3TWTA 1BD8A 3UXGA 3LJNA 4Z68A 2HE0A 3J5PA 3Q9NC 4YDWA 4O1OA 5EYLA 4GPMA 3TWRA 3T9KA 4BSZB 4F6RD 3TWUA 1D9SA 5ITZF 4HRNA 1N0RA 5BXOA 1DC2A 3TWSA 2IQJA 2QC9A 4C48B 1WDYA 5HS0A 3V2XA 4OAUC 1K1AA 3FM8C 3SO8A 3JXIA 2P2CP 2XZDG 4HRLA 3DEOA 4NIKA 1MJ0A 1YCSB 3DWDA 4U95D 2KBXA 4BETA 1DCQA 4J8YA 3NBNB 2XZTG 1BI7B 4HLLA 4B93B 2PNNA 4G8LA 5KBAA 5CEDB 2ETBA 2JABA 4K5AB 3TWQA 4LNUD 4DX7D 4RLYA 4J7WA 4O60A 3ZKJA 5CEAA 2FO1E 2B0OE 4F1PA 1NFIE 3B7BA 4G8KA 2MYOA 5EN5D 3NOGD 3NOCD 5AQ7A 4LSZE 5CECB 1IXVA 3W9GA 4BEPA 4HNAD 5CERB 3DEPA 1IHBA 2RFMA 3EHQA 2XEEA 4UUCA 1AWCB 4DX6D 1MX6A 4U96D 5HKPA 4ATZD 4N5QA 4K5CA 4ZHBA 3EU9A 2V4HC 4DX2A 2ZGGA 3B95A 1K3ZD 2DWZA 4CZ2D 5CBNA 5ENTD 1TR4A 2F8YA 4DX5D 5EIBE 4CYMD 1SVXA 2CRWA 2L6BA 3ZNGA 4HRMB 2ETAA 4LG6A 1G3NB 5FIOA 4DUIA 4BESA 2XEHA 1BI8B 3LVRE 2DZNA 2J8SD
chains in the Genus database with same CATH superfamily
1EDUA 4S3OB 4S3OC 4KVOA 3T8KA 3LKUA 3FP3A 3EB5A 4CEMA 2XB1A 3UTMA 2NYJA 4H9DA 2WB2A 4U8HA 2Y69E 3AS5A 4I6EA 2LGLA 3E34A 1FBVA 5CHEE 1UN8A 3ZFWA 4OYSA 5KCMA 2YSMA 3ASHA 3MZLB 3FEHA 2UWJG 2WXPA 2KE1A 1Z3YA 3LJUX 5AIJA 4JW1A 2L75A 1Y6IA 1WEQA 2AXZA 2L80A 1SZAA 2ZIRA 4EZKA 4AXHA 3MHHA 3DSWA 2L9BA 2YQMA 4MBGA 3ZVYA 3S7FA 3TWUA 3EUVA 2YU4A 3QB2A 2IQJA 3T5VA 4HOUA 3CVVA 3G2UA 1O1RA 2XZDG 4GU5A 2NSZA 3FUFA 2QYUA 3HVEA 4AVXA 3TXMA 4BX9A 2ETBA 4U7EB 3EHMA 2JEKA 1ZBDB 3ASOE 4N2SA 2LAUA 3RU0A 5LKXA 3B7BA 3C3QA 1Z5SC 4U04A 3D9MA 1SQMA 3W9GA 5B75A 4UUCA 2M6MA 1MX6A 4DLQA 4BTBA 2XCCA 3EU9A 3ABME 2DWZA 2WMOA 4FU3A 1OUVA 2KATA 1OWNA 4LLBA 3LQIA 4KXKB 4Y6WA 3HVEB 1INZA 3CVUA 4L2YA 2V5FA 4G24A 5JHBA 1U6GB 1KZPA 1OCCE 2KGGA 3Q75A 1K2FA 1E8XA 2EINE 1HYJA 3ZXSA 2H6FA 3DRAA 3D9IA 5EX0A 2YT5A 3P2BA 1D8DA 4GMRA 1DCEA 3JUEA 4LUNU 3HCTA 4HI9A 4AOFA 5A6CA 3RSEG 4B89A 2P58C 3V79K 5BXUA 1V54E 2G45A 4JB8P 4ANUA 4Z0OA 1H2TC 4UI9B 4UI9C 1U3DA 3EIQC 3URZA 4GZCA 1HO8A 1QYMA 4GNFA 1QQEA 1XWHA 4LEUA 4KZ0A 1WEVA 4FLHA 4U63A 3U5MA 4GTRA 4FHJA 3NAWA 5B78A 1H19A 2MIQA 4GYOA 3HTKC 5FZSA 1YCSB 4WNFA 2M3HA 4FLBA 3SOXA 5AENA 4FHKA 4GTVA 1RZ4A 3SD5A 2I1JA 2M1RA 5LCWC 3D9OA 3DSUA 4XKBA 4LNGA 3O37A 1OCOE 2J4BA 3FH5A 2R02A 2RFMA 4HS2A 2XEEA 5B76A 5HKPA 2AXUA 3FANA 1PY1A 4MVTA 2VSYA 4CYMD 2QIZA 5JJ7A 4JEHA 2FUUA 4N3AA 4JHJA 1QZ2A 1TNBA 3S7BA 2J07A 4L1BA 4WNEA 4R8PK 1HU3A 2DVWA 1E8WA 1MYOA 5D0QD 3CLJA 2V0PA 2CHXA 4U8VD 3ESLA 3PUJA 1MX4A 1B89A 1SA4A 5BPPA 4C0MA 3GYZA 3VLDA 3Q49B 2AWIA 1YA0A 4O1PA 4HXIA 5JMND 2CSYA 2G6QA 5FZQA 1VDYA 2RFAA 3PZ3A 3QOUA 4C0EA 2QICA 5G04B 4GA0A 2KR4A 5G04C 1UOHA 4ILHB 3QWVA 4XI0A 3TWXA 3ZVVA 4Q69A 3FTSA 5EIDA 2WXMA 2HM8A 2VSOE 4PS7A 4DLOA 3TL5A 4R7EA 4XI9A 4RVBA 3Q9NC 3FUHA 3N71A 5JJ6A 4TRQA 5BNWA 4ACLA 5H1VA 2R03A 3T8MA 1WAO1 3O34A 1TNOA 2P2CP 4GTPA 4HRLA 1EYHA 3QKYA 2XGMA 2ZU6B 4G11A 3PZ1A 5JJTA 3QWPA 3SBTB 3PHDA 3QZVA 3BG1B 2R17C 1A17A 4I2WA 3HXBA 2M63A 2P9IG 3LEWA 4GTOA 1IXVA 3CHPA 2E6SA 4DPRA 2F6JA 2MA6A 4ATZD 4L58A 3GZ1A 2F8YA 3MYVA 2CSZA 1JWFA 5FIOA 3CVXA 3ASGA 4XI1A 1HX8A 3PRZA 3SUBA 1TJFA 5LKUA 3U5OA 3ZYMA 5CCLA 3FEXA 2GRPB 3LRQA 1VYXA 3CKCA 3GL6A 3HCSA 1X4JA 1HF8A 3FU3A 1WM5A 2DYRE 2GW1A 4KT6B 2C0LA 1CHCA 5ENPD 1WEPA 4J8EA 2EQXA 4N4FA 3Q5MA 3JXJA 2R5SA 3SF4A 1TN6A 3UIOC 2PUYA 4V3KC 2RI7A 2L7PA 3K9IA 4UWHA 3CHOA 5ENOD 1IQRA 3O33A 2GRNB 2CG2A 2PZIA 1OT8A 5IY5E 3FUDA 3HXCA 4HOSA 2VTBA 3Q73A 4PS8A 2X38A 3E37A 1NA3A 3ML8A 2LXHC 3T9KA 4BSZB 3PUQA 4UWKA 3DDTA 1KPSB 5I3LA 3RKVA 4OGEA 3EIJA 3RPGB 3RPGC 3CVYA 4PUCA 3FM8C 4FK5A 4JXTA 2H6IA 3JXIA 2XPYA 4IYPA 3ZRHA 3DEOA 4Q94A 2IOLA 1WENA 5J3XA 1LD8A 2XZTG 4YVQC 4GZ3A 4MKTA 5CEDB 5K3QA 1RMDA 2V8SE 1OXJA 4L9PA 4R7LA 5BV0A 2VTBB 4UQXA 1JOCA 1MZCA 3ZW3A 2LO6A 3CK9A 1FT1A 4I7BA 2MHKA 2XS8A 3PDNA 1WEWA 2ZXWE 1EPUA 2C0MA 3FUMA 4HRMB 1TNUA 4TXPA 3L22A 2J8SD 2IONA 2JUNA 5CBOA 3OXFA 2FBNA 1IKND 4UWGA 1IYGA 2EODA 4FP7A 2HYED 1UN9A 1BU9A 1Z2QA 2WXRA 3AJIA 4GB9A 4AYCA 3LYAA 4P5OB 1HG2A 2YYRA 5KJKA 2WQ7A 5G2NA 3LJ3A 1UJJA 4G2VA 3R9MA 2JLBA 2ZGDA 5BUZA 2EILE 1JUQA 3V30A 1HFAA 2J49A 4CRWA 2R05A 3N9OA 2BKKB 1N54A 2VSXE 2PM7A 4M3OA 4F1SA 4IN3B 1WG0A 3UT8A 3I4RB 2BKGA 4YNDA 1D8EA 1E7VA 5DKAA 4AYCB 3L08A 3FUJA 4I1OB 3T7LA 5E76A 3SOWA 4MRUA 3CIAA 4W4UA 3FH7A 2NAAA 3TWSA 2FFWA 3FHEA 5HS0A 4XX5A 3LQJA 4GCNA 2WXGA 2IY0C 5JG6A 3B13A 2GRQB 1TEZA 2B0OE 4J8FA 2I2OA 4CA1A 1PAQA 3NOCD 4HNAD 3DEPA 2P9UG 3MV3B 2I1KA 2LRIC 3ZPJA 4H7YA 3U64A 3L13A 1O1TA 1MM3A 3RTRB 2ETAA 1G3NB 2EGPA 2DYSE 4CCAA 4UP5A 2LGVA 5B77A 3LVRE 2BTDA 2QYJA 1S63A 4C9ZA 3UIPC 4X3GA 2DZOA 2F37A 3UUXA 2PNXA 2XOZA 1WIMA 1H6PA 3TG4A 2ZETC 3NQPA 3DSTA 2KCKA 2IJGX 3IXEA 3PZDA 4NN2A 3LY9A 5ANLA 3MDBC 3V2OA 5B3SE 2EXUA 4YATA 1SW6A 3SZ7A 2KZTB 4K5BA 2MRIA 1VFYA 4PTBA 3ZUVB 4NACA 5AYWD 2VJ8A 4PDXA 2M85A 1IQUA 1WEUA 2LAIA 1N94A 3KV5A 1OY3D 5AQAA 3V43A 2Y0BG 3ZVZB 2WXQA 4YDYA 1X4UA 3C3OA 3D9PA 3IEGA 3PEVB 4YDWA 4O1OA 2FUIA 2ECGA 2K4DA 5ITZF 1BPOA 2RD0A 4HOQA 4JVSA 4OAUC 4H7XA 3S7JA 4NIKA 2I6HA 2X6HA 2DSMA 2YHOA 3VK6A 4CDNA 4O60A 3ZKJA 5CEAA 3MA5A 5H7PA 4ATGA 3O48A 5AQ7A 4GNEA 1ZU2A 4LSZE 3ZYKA 3Q47B 2X6JA 3B7TA 1WY6A 4K5CA 4CT0A 5EIBE 2XEVA 4JZYA 2IEJA 3LDZA 3PNLB 2HDPA 2UZGA 4BESA 4JHKA 1KLXA 3BEEA 3BUAA 3ISMC 2D8SA 2CHWA 1OWPA 1TNZA 4I17A 4B8AA 2IDAA 3KEZA 4QF2A 4ACKA 5D1LB 2K1JA 3S7DA 3CGHA 5FZRA 3L82A 3OXGA 4GTSA 1YMPA 2EGMA 2YQ8A 2NXPA 3MGBA 2BUGA 2YURA 4LK9A 5AAOA 4HI8A 3O70A 3SNXA 2MNYA 3Q15A 4HB5A 3NB2A 4UWLA 4JL0A 2VGEA 5LFAA 4URKA 2VNFA 4HLEA 3I3NA 2Y1MA 3NF1A 4EZJA 3FFLA 5EYAF 4QFVA 4BWRA 4HRNA 4ILIA 1DC2A 2C2LA 2GRLA 1DVPA 2P9LG 2CONA 2C2VS 1N4SA 3FJUB 3D9JA 3ONLA 3D3MA 1DCQA 3VTXA 4CT4A 4WZ0A 2EIKE 5KJLA 3EDTB 2FULA 2E6RA 4LNUD 3ULQA 4GYYA 4C9BB 3U3WA 3RIBA 4JA7A 5J08A 4J6IA 2KWJA 3UQ3A 3O35A 2DIWA 5CECB 3JQ0A 3KV6A 5CERB 1IHBA 3P1UA 5G0FA 3FEYA 4GZDA 3LXUX 3CVWA 2ZGGA 5FQ8A 3B95A 5ENTD 4BHWA 4U0ZA 3E4BA 3KQIA 3ESKA 3FTYA 5AJDA 3UX4A 3ABLE 3BG0B 3GZ2A 1FCHA 2F0YA 3ULYA 1ELWA 5FT9A 3B7SA 4RQIA 5ENRD 4GNGA 2GRMA 4BT9A 2PQRA 2KIZA 3IBEA 2CHZA 4L7TA 3CHRA 4YDEA 3C6WA 2KFTA 5TBNA 5FB0A 1V55E 3C72A 5LKZA 5FWQA 1JPLA 3JUIA 1UW4B 3AAAC 4BBQA 5C11A 1HYIA 4XE0A 2FSAA 4G23A 3Q78A 3M62A 3MKQA 1TNYA 1NL4A 4WWOA 3FULA 3I5PA 4ZFHA 3PREA 1YYHA 4D10C 4YDOA 3CK8A 4DRXE 4TUMA 4AY6A 1WEMA 5J90A 3ASLA 3O36A 2KWOA 3E32A 1Y8MA 1WGMA 2PM6A 3TG5A 5EYLA 4UP0A 2RG8A 4FJYA 3FU5A 5KH3A 2KC7A 4YBSA 3MKQB 2KYUA 3VLEA 2IF4A 3FTWA 2A5UA 3M7KA 3DWLG 4HLLA 3UM0A 4G8LA 2OCCE 4K5AB 4I9EA 3LQHA 2MD7B 3HXDA 2VPDA 1O5MA 4J0UA 1NFIE 3AS8A 2YSJA 3SHBA 4A55A 2YW8A 3MJWA 4A49A 3U9WA 3L1ZB 3OXLA 2ECNA 3ULEG 3I4GA 4I1AA 4BFRA 5T4YA 3G2SA 3RRUA 3CVQA 3SI5A 2X6KA 4DUIA 2WXKA 3LCAA 3HCUA 1BI8B 5AJLA 3U66A 2R59A 4BY6A 2X3MA 4I6GA 3L16A 1NI1A 3BQOA 3DSVA 1K8KG 4Y6CA 4BERA 3KD7A 1HH8A 3CSFA 4LNBA 4PH4B 3GV4A 4O64A 4LERA 4DX1A 1MQSA 4GZ6A 3F6QA 5ARGA 5LOZA 5HRYA 4AM9A 2CT2A 2KM4A 5D1MB 1X81A 5EX3A 2XPIA 5TDWA 4FULA 3ZPVE 2KXPC 2X6FA 2KGIA 5AQ9A 4ZDTA 2X6IA 4GPKA 1E96B 1WESA 1S70B 2HYZA 5C2YA 3MEKA 4HBDA 3HHMA 5ARFA 4APFA 5DBKA 3QNKA 1WEEA 5G55A 2G43A 3JYSA 2Y3AA 4A3TA 3ZU7B 1WEOA 2Y1LE 4F7AA 2A5EA 5B8DA 3PH0C 5KJNA 4EBAA 2IQCA 3FTZA 1BD8A 3SOUA 3PE4A 4IULA 3R9AB 3FTXA 2Y4UA 4XZ4A 4E6HA 3LY8A 2ONDA 4C48B 3CHSA 3TXNA 4HOTA 1LF8A 3Q7FA 4HFGA 3FY4A 2XRYA 4G26A 1MBMA 1LDJB 4O62A 4J7WA 1ELKA 2OV8A 2LDRA 2WXHA 4N2QA 1UJKA 3EHQA 3NG2A 3WG7E 4DX6D 2BEDA 4Z0RA 3M63A 2L0TB 3LS8A 4UQZA 3E2DA 2GRRB 1TYQG 4ABNA 2LNIA 5ENNA 2WXIA 3T6RA 1OWLA 1E8ZA 5C1DA 2JMDA 2DBAA 2FO7A 2Y43A 3J5QB 5EYPF 4G25A 2ECTA 2VJFA 1W3BA 3EHNA 2LXLA 3QARA 4O6FA 4NQ0A 3L54A 3CV0A 3ZHEA 1FVHA 2EA6A 5G05J 3OAWA 3IKOB 2YHNA 5AQBA 4EPZA 2ILRA 1LTXA 2K16A 3D9LA 4P29A 3DSXA 4WNGA 4APOA 3EB6A 5FTPA 1N11A 2RR4A 4ANVA 1JCSA 4I43A 4A1SA 3ENEA 4WWNA 1S0PA 2VJFB 2CRRA 1KT1A 2XENA 4A3VA 1FPPA 3C5RA 2YHEA 3ZHEB 5AARA 2WXFA 4AIFA 4HORA 3DXMG 1ZB1A 2AVPA 3HXFA 2QY7A 1WDYA 3UINC 1FT2A 1K1AA 4UI9J 4AV7A 3PVLA 2MD8C 2KBXA 4V3IA 4J8YA 3N9PA 2XQ0A 4B7YC 1IHGA 5FB1A 2XEUA 3UM3A 2JABA 4I7DA 3UM2A 4DX7D 4OVUA 4GZ5A 3FTUA 3M99A 1H0AA 4IC3A 4KYOB 5LP0A 3B7RL 4FJCA 1QNFA 4OVVA 2OVBA 2PL2A 4U96D 3C3RA 1SVXA 2L6BA 3KNVA 1RW2A 4Q96A 2BF0X 3MKRA 5LCWJ 2DZNA 3FTVA 1N87A 2YREA 4GA1A 2I50A 2P57A 1MHQA 5FJYA 4DJAA 5B79A 2DX8A 5JA4D 5TDRA 3RAUA 2OEWA 1X4IA 3Q1DA 2B6CA 3W9FA 3DSSA 3EHRA 2P9PG 3O47A 4R2YA 4YAXA 2LXPC 2KZTA 2J9QA 4CDRA 1E90A 3L11A 3ASNE 3NZUA 3R7QA 3ZYQA 2H0DB 4BT8A 2LN0A 2F6NA 3ZYLA 2OEVA 2UY1A 1H2UA 1MX2A 3D9HA 5FQ4A 2EIJE 1TN7A 5LKTA 1MM2A 3LJNA 4Z68A 3J5PA 3PLWA 5KH7A 1HS6A 4JPSA 3DBSA 4ANWA 3TWRA 5H1TA 2IFUA 4GA2A 1N0RA 3U4TA 2CSVA 3PUKA 2VGYA 3RK6A 3V2XA 3ZTGA 3ABKE 3FH8A 3LY7A 4U95D 4BETA 2UY1B 2L5UA 1BI7B 3TAXA 3CR3A 4JEUA 3X2QE 4L23A 3U5NA 4GCOA 2FO1E 4JC8A 1FVFA 4F1PA 2MYOA 2LQ6A 3U5PA 4N3CA 2FF4A 4BEPA 3UT7A 3ZGQA 3CHMA 4ZHBA 2L0IA 2V4HC 4DX2A 2WXNA 1K3ZD 1XGWA 3L17A 2YNQA 2FD4A 2XEHA 2MNZA 4WAFA 4N39A 2H6HA 3MCXA 3LVQE 5ANRA 3PEUB 2LGKA 3KEAA 3QJZA 5TRBA 4JD2G 4NURA 2XGOA 4U8YD 3SGHA 1OCRE 2F42A 1WFKA 1O1SA 2ECJA 3FWVA 3AU4A 3FUKA 3UM1A 2WM9A 4IRUA 2M13A 4WZ3B 2EIME 3DPLR 2HO1A 4E85A 4HVBA 4GYWA 3PZ2A 4YABA 2OWAA 2BAYA 2LSVA 3FUNA 3Q9UC 2H6GA 2P9SG 5KWDA 4TUUA 2ECIA 4I1MA 4Q6FA 1ZBPA 5FINA 2A4ZA 2IO2C 4F3VA 1E7UA 4I6JA 4L2LA 3I2DA 3UXGA 1Z60A 2WPVA 2L43A 2QZAA 2HE0A 4U0UA 5CRUA 1D9SA 3QK0A 3CSTA 4U0SA 5BXOA 3SFYA 4CGWA 3L9TA 1DNPA 2L0BA 3EU5A 4WWPA 1JCRA 4XKCA 1NP7A 2I9CA 4FIPA 3Q79A 1VD4A 4K03A 4B93B 5G05B 5G05C 3TJPA 1N4RA 2VQ2A 3APDA 2DCPA 2YUCA 4UI9K 1H6KA 3WXXA 4YADA 5EKQD 4N3WA 3APFA 4W9RA 4J8DA 3QDNA 1HG5A 4I2ZA 4RG9A 4DX5D 1HXIA 5D2MC 3AG2E 5LX8A 2WQHA 4L7XA 1TJCA 2K17A 2GGFA 3NZSA 2KWNA 3Q7AA 3MX3A 3UKUG 3GW4A 2XS1A 4PS3A 4QF3A 3G2WA 4B94A 3E30A 4MS6A 5SVXA 5KNGA 5HI7A 2QFCA 3KS2A 3UKRG 4KBQA 1A5EA 5ENSD 4RG6A 2Y1NA 1N9AA 2FEZA 4EECA 3AS4A 4X8QA 2RSDA 3CKBA 2XPZA 3PS6A 3JQ1A 3TWWA 1LDKC 3FUIA 3UPVA 3KAEA 3D9KA 3IHPA 3RO2A 3FU6A 2WMNA 5SVYA 4KZCA 1T1HA 1EF1C 1X5BA 1KZOA 1JWGA 3QC1A 5FQ7A 3CVNA 3T5XA 5AIUA 1Q2ZA 5LCWB 4GTQA 2V4LA 3LPZA 4I9CA 1GW6A 4GPMA 5FQ6A 5D0OD 1N4QA 2QC9A 2WXJA 4UWFA 2LXMA 2ZISA 3RRMB 4FO9A 4B8CB 5EDSA 2CG3A 2P9NG 4K0RA 5KH9A 1Z6TA 5KBAA 3TWQA 3BU8A 4AJWA 2JRJA 2NC9A 4V3LC 4BX8A 2KU3A 4MLPA 3FU0A 5EN5D 5AITA 1N4PA 3ASFA 2P9KG 4TV3A 1AWCB 3JCKC 3VTYA 4DK5A 4FA6A 4CZ2D 2XGSA 2MKEA 5CRVA 4LG6A 2XRZA 3UT4A 2Q7FA 5BV1A 4F52B 3TGOA 4TXRA 3O4ZA 4BSXA 4XEIG 4GAAA 5DINA 3IHVA 2KWKA 5D1KB 2E61A 4UQYA 2CFZA 2PQNA 1U3CA 3KSLA 2LV9A 1OWMA 3LDYA 4CCGX 4ANXA 4AEZC 4GNDA 3E33A 3FDHA 1OCZE 5KNHD 3ASDA 3O7AA 3CK7A 3HG0D 4IC2A 2VPBA 3CHQA 4CDMA 3FUEA 1JM7A 1N0QA 3RRNB 1P5QA 4DI4A 4WA6A 5JHAA 2AJAA 2VPEA 3FL2A 3HDXA 3HYMB 3ZIMA 4LKAA 3N9LA 3Q4AB 2KCVA 4QQIA 1L5JA 2R2LA 2LAHA 5A23A 1AP7A 3H7HA 3ZEFA 2XHEA 4J8SA 3EJNA 4AY5A 4A1GA 1JM7B 4ME2A 2XOCA 5CMWA 5E75A 1N95A 4YBTA 1MJ0A 2KKYA 3SY2A 2JMIA 1XNFA 3NBNB 1V87A 2PNNA 4N3BA 5HQ8A 4RLYA 1N52A 3KSQA 5T8IA 4FADA 3ZXPA 5BT1A 2IOSA 4F53A 4ZQLA 4LJNA 1JCQA 4DI3A 2WVIA 4QQ4A 2HR2A 4OGCA 4N5QA 5T3RA 3C5KA 2CRWA 3SQVA 4G1TA 2CKLA 1NZNA 2E2EA 3ZNGA 2VJEA 4FC8A 1K1BA 2XCBA 2V5QC 4B86C 4A4BA 5EILA 5BW8C 3QAQA 2IO3C 2J09A 4FJZA 3IV0A 2AW6A 4PPEA 3MHSA 1E4UA 3DQVR 1LD7A 5SVIA 3ONKA 4RSYA 2F8XK 4WNDA 5B1AE 2KKXA 4TXQA 2JM3A 3UI2A 3ZNIA 3R7RA 1WILA 3CVPA 1PC2A 2CKLB 3L6AA 2VJEB 3HXEA 3SFZA 5D66A 4GTMA 2YVRA 2YQLA 2VYIA 3ZN3A 5DIZA 4EZLA 3N9NA 3G2TA 1SA5A 2D8UA 3VLFA 2KREA 4KMOA 2ECWA 5FERA 3SFXA 4YVOA 2ETCA 1FP0A 5ENQD 4B0ZA 5SVIB 1U2VG 5FEYA 3RO3A 3IHYA 4ILGA 4TKPB 3OTNA 4A0CD 1S64A 5AN8A 3TWTA 3APCA 4YBMA 3C98A 4U07A 3FAOA 4F6RD 2ECVA 3PNTB 2RKKA 4EQFA 3AG4E 2VPGA 2LUHA 3SHFA 3RJVA 2XOYA 3PZ4A 4EHMA 4YC9A 3KDEC 3DWDA 2GROB 4XIFA 4KVMA 2LGGA 4GMJA 3QWWA 4N5CA 4G8KA 4LRZA 2J08A 2XP0A 5C13A 1IYMA 1TN8A 3B7UX 4CGVA 1KT0A 1QBQA 2AN6A 2OVFA 4WUYA 4LADB 3CEQA 1HZ4A 1H6OA 1TR4A 3DPDA 2WQ6A 1HE8A 1BORA 1WE9A 3DXKG 3UMVA 3L1XA 3DPYA 4M7CA 4LCTA 3MV2B 2MA5A 2MOWA 3TWVA 3V31A 3CQCB 5TABA 2LSUA 2MUMA 2E0IA 3ZPV1 3HRAA 3AG1E 2YHCA 4AP4A 2VP7A 5CMYA 4OAVB 1NA0A 2QJ0A 3PURA 2Y4TA 3PE3A 5KJMA 1ELRA 2OOEA 3SBSA 2VSNA 1G25A 4HQDA 1H2VC 3G2VA 2H0DA 5H1UA 2J4DA 5B1BE 4AUQB 1SZ9A 2AXVA 1BLXB 4A63B 4EBAG 3CQGB 1Z3XA 3N9MA 3S2AA 4JA9A 4ZUXU 3AU5A 4GTTA 2OXQC 3N9QA 2FI7A 2CFUA 1Z6UA 3CVLA 4NRHB 4A4CA 3SO8A 3ML9A 2VGXA 2MT5A 2YINA 2KCLA 5H9MA 2WXLA 4AP2A 5CCMA 4I7CA 4MSXA 1F62A 3NOGD 3GZSA 5M72A 5G04J 2DJAA 4JHRA 2JMJA 4BTAA 4WZ2A 1E8YA 2L6JA 2IU1A 2WXOA 3AG3E 5CBNA 3HIZA 2VGXB 5A7DB 4GB0A 1UG3A 3D9NA 4GMLA 1OWOA
chains in the Genus database with same CATH topology
1K1BA 2QYJA 2JUNA 2V5QC 3SUBA 5CBOA 2YREA 5EILA 4BERA 2P57A 3TWVA 2DZOA 2F37A 3J5QB 2XOZA 1IKND 3V31A 3LVQE 3KEAA 3T8KA 5JA4D 5EYPF 2DVWA 5ENRD 1MYOA 4U8YD 3UTMA 1BU9A 3Q1DA 3HRAA 4DX1A 5KNGA 2E61A 5SVIA 5SVXA 3W9FA 4U8VD 3IXEA 2F8XK 3F6QA 1MX4A 1YMPA 3EHRA 3AJIA 2NYJA 5HRYA 4OAVB 1A5EA 2EGMA 4H9DA 2KKXA 3MDBC 5ENSD 3V2OA 2JM3A 3UI2A 3LDYA 2EXUA 2M13A 3O47A 5ENPD 1SW6A 2KXPC 5AQBA 5AAOA 4HI8A 4K5BA 4O1PA 5KNHD 4GMRA 5AQ9A 4HQDA 5D66A 3ZUVB 2YVRA 3HG0D 3JUEA 3AAAC 4HI9A 5JMND 3TWWA 1S70B 2OWAA 2ZGDA 3JXJA 3E2DA 1N0QA 4HBDA 3Q9UC 2RFAA 3V30A 1N11A 4HB5A 2RR4A 2D8UA 5KWDA 3FEHA 1BLXB 3V79K 2AJAA 4A63B 5BXUA 2L7PA 1UOHA 2VGEA 2BKKB 1OY3D 3TWXA 3LJUX 4JB8P 5AQAA 2ETCA 4Z0OA 5ENOD 5ENQD 2CRRA 2XENA 4ZFHA 3ZU7B 2Y1LE 1YYHA 5FINA 5EIDA 5SVIB 4QQIA 1MX2A 3D9HA 1WG0A 3C5RA 2A5EA 2Y0BG 4DRXE 2BKGA 1QYMA 5SVYA 4TUMA 4YDYA 1OT8A 1AP7A 4QFVA 3H7HA 5AARA 5AN8A 3TWTA 1BD8A 3UXGA 3LJNA 4Z68A 2HE0A 3J5PA 3Q9NC 3PLWA 4YDWA 4O1OA 5EYLA 4GPMA 3TWRA 3T9KA 4BSZB 4F6RD 3TWUA 1D9SA 5ITZF 4HRNA 3DDTA 1N0RA 2CSVA 5BXOA 1DC2A 3TWSA 2IQJA 2FFWA 2QC9A 4C48B 2XOYA 1WDYA 5HS0A 3V2XA 4OGEA 2XOCA 4OAUC 2CONA 1K1AA 3FM8C 3SO8A 3JXIA 3FJUB 2P2CP 2XZDG 4HRLA 3KDEC 3DEOA 4NIKA 1MJ0A 1YCSB 2KKYA 4U95D 2KBXA 4BETA 1DCQA 4J8YA 3DWDA 3M7KA 3NBNB 2XZTG 1BI7B 4HLLA 4B93B 2PNNA 4G8LA 5KBAA 5CEDB 2ETBA 2JABA 4K5AB 3TWQA 5K3QA 4LNUD 4O62A 4DX7D 4RLYA 4J7WA 4O60A 3ZKJA 5CEAA 2FO1E 2LAUA 2B0OE 4F1PA 1NFIE 3B7BA 4G8KA 2XP0A 2MYOA 5EN5D 3NOGD 3NOCD 5AQ7A 4LSZE 5CECB 1IXVA 3W9GA 4BEPA 4HNAD 5CERB 2DJAA 3DEPA 1IHBA 2RFMA 3EHQA 4QQ4A 2XEEA 4UUCA 1AWCB 4DX6D 1MX6A 4OGCA 4U96D 5HKPA 4ATZD 4N5QA 4K5CA 4ZHBA 3EU9A 2V4HC 4DX2A 4Z0RA 2ZGGA 3B95A 1K3ZD 2DWZA 4CZ2D 5CBNA 5ENTD 1TR4A 2F8YA 4DX5D 5EIBE 4CYMD 1SVXA 2CRWA 2MKEA 2L6BA 3ZNGA 4HRMB 2ETAA 4LG6A 1G3NB 5FIOA 4DUIA 2FD4A 4BESA 2XEHA 1BI8B 3LVRE 2DZNA 2J8SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1B A;  2QYJ A;  3SUB A;  2V5Q C;  5CBO A;  5EIL A;  4BER A;  2P57 A;  3TWV A;  2DZO A;  2F37 A;  3J5Q B;  3LVQ E;  1IKN D;  3V31 A;  3KEA A;  3T8K A;  5JA4 D;  5EYP F;  2DVW A;  5ENR D;  1MYO A;  4U8Y D;  3UTM A;  1BU9 A;  3HRA A;  4DX1 A;  5KNG A;  3W9F A;  4U8V D;  3IXE A;  2F8X K;  3F6Q A;  1MX4 A;  1YMP A;  3EHR A;  3AJI A;  2NYJ A;  5HRY A;  4OAV B;  1A5E A;  3MDB C;  5ENS D;  3V2O A;  3UI2 A;  3O47 A;  5ENP D;  1SW6 A;  2KXP C;  5AQB A;  5AAO A;  4HI8 A;  4K5B A;  4O1P A;  5KNH D;  4GMR A;  5AQ9 A;  4HQD A;  5D66 A;  3ZUV B;  3HG0 D;  3JUE A;  3AAA C;  4HI9 A;  5JMN D;  3TWW A;  1S70 B;  2OWA A;  2ZGD A;  3JXJ A;  1N0Q A;  4HBD A;  3Q9U C;  2RFA A;  3V30 A;  1N11 A;  4HB5 A;  5KWD A;  3FEH A;  1BLX B;  3V79 K;  2AJA A;  4A63 B;  5BXU A;  1UOH A;  2VGE A;  2BKK B;  1OY3 D;  3TWX A;  3LJU X;  4JB8 P;  5AQA A;  2ETC A;  5ENO D;  5ENQ D;  2CRR A;  2XEN A;  4ZFH A;  3ZU7 B;  2Y1L E;  1YYH A;  5FIN A;  5EID A;  4QQI A;  1MX2 A;  3D9H A;  1WG0 A;  3C5R A;  2A5E A;  2Y0B G;  4DRX E;  2BKG A;  1QYM A;  4TUM A;  4YDY A;  1OT8 A;  1AP7 A;  4QFV A;  5AAR A;  5AN8 A;  3TWT A;  1BD8 A;  3UXG A;  3LJN A;  4Z68 A;  2HE0 A;  3J5P A;  3Q9N C;  4YDW A;  4O1O A;  5EYL A;  4GPM A;  3TWR A;  3T9K A;  4BSZ B;  4F6R D;  3TWU A;  1D9S A;  5ITZ F;  4HRN A;  1N0R A;  5BXO A;  1DC2 A;  3TWS A;  2IQJ A;  2QC9 A;  4C48 B;  1WDY A;  5HS0 A;  3V2X A;  4OAU C;  1K1A A;  3FM8 C;  3SO8 A;  3JXI A;  2P2C P;  2XZD G;  4HRL A;  3DEO A;  4NIK A;  1MJ0 A;  1YCS B;  3DWD A;  4U95 D;  2KBX A;  4BET A;  1DCQ A;  4J8Y A;  3NBN B;  2XZT G;  1BI7 B;  4HLL A;  4B93 B;  2PNN A;  4G8L A;  5KBA A;  5CED B;  2ETB A;  2JAB A;  4K5A B;  3TWQ A;  4LNU D;  4DX7 D;  4RLY A;  4J7W A;  4O60 A;  3ZKJ A;  5CEA A;  2FO1 E;  2B0O E;  4F1P A;  1NFI E;  3B7B A;  4G8K A;  2MYO A;  5EN5 D;  3NOG D;  3NOC D;  5AQ7 A;  4LSZ E;  5CEC B;  1IXV A;  3W9G A;  4BEP A;  4HNA D;  5CER B;  3DEP A;  1IHB A;  2RFM A;  3EHQ A;  2XEE A;  4UUC A;  1AWC B;  4DX6 D;  1MX6 A;  4U96 D;  5HKP A;  4ATZ D;  4N5Q A;  4K5C A;  4ZHB A;  3EU9 A;  2V4H C;  4DX2 A;  2ZGG A;  3B95 A;  1K3Z D;  2DWZ A;  4CZ2 D;  5CBN A;  5ENT D;  1TR4 A;  2F8Y A;  4DX5 D;  5EIB E;  4CYM D;  1SVX A;  2CRW A;  2L6B A;  3ZNG A;  4HRM B;  2ETA A;  4LG6 A;  1G3N B;  5FIO A;  4DUI A;  4BES A;  2XEH A;  1BI8 B;  3LVR E;  2DZN A;  2J8S D; 
#chains in the Genus database with same CATH topology
 1EDU A;  4S3O B;  4S3O C;  4KVO A;  3T8K A;  3LKU A;  3FP3 A;  3EB5 A;  4CEM A;  2XB1 A;  3UTM A;  2NYJ A;  4H9D A;  2WB2 A;  4U8H A;  2Y69 E;  3AS5 A;  4I6E A;  2LGL A;  3E34 A;  1FBV A;  5CHE E;  1UN8 A;  3ZFW A;  4OYS A;  5KCM A;  2YSM A;  3ASH A;  3MZL B;  3FEH A;  2UWJ G;  2WXP A;  2KE1 A;  1Z3Y A;  3LJU X;  5AIJ A;  4JW1 A;  2L75 A;  1Y6I A;  1WEQ A;  2AXZ A;  2L80 A;  1SZA A;  2ZIR A;  4EZK A;  4AXH A;  3MHH A;  3DSW A;  2L9B A;  2YQM A;  4MBG A;  3ZVY A;  3S7F A;  3TWU A;  3EUV A;  2YU4 A;  3QB2 A;  2IQJ A;  3T5V A;  4HOU A;  3CVV A;  3G2U A;  1O1R A;  2XZD G;  4GU5 A;  2NSZ A;  3FUF A;  2QYU A;  3HVE A;  4AVX A;  3TXM A;  4BX9 A;  2ETB A;  4U7E B;  3EHM A;  2JEK A;  1ZBD B;  3ASO E;  4N2S A;  2LAU A;  3RU0 A;  5LKX A;  3B7B A;  3C3Q A;  1Z5S C;  4U04 A;  3D9M A;  1SQM A;  3W9G A;  5B75 A;  4UUC A;  2M6M A;  1MX6 A;  4DLQ A;  4BTB A;  2XCC A;  3EU9 A;  3ABM E;  2DWZ A;  2WMO A;  4FU3 A;  1OUV A;  2KAT A;  1OWN A;  4LLB A;  3LQI A;  4KXK B;  4Y6W A;  3HVE B;  1INZ A;  3CVU A;  4L2Y A;  2V5F A;  4G24 A;  5JHB A;  1U6G B;  1KZP A;  1OCC E;  2KGG A;  3Q75 A;  1K2F A;  1E8X A;  2EIN E;  1HYJ A;  3ZXS A;  2H6F A;  3DRA A;  3D9I A;  5EX0 A;  2YT5 A;  3P2B A;  1D8D A;  4GMR A;  1DCE A;  3JUE A;  4LUN U;  3HCT A;  4HI9 A;  4AOF A;  5A6C A;  3RSE G;  4B89 A;  2P58 C;  3V79 K;  5BXU A;  1V54 E;  2G45 A;  4JB8 P;  4ANU A;  4Z0O A;  1H2T C;  4UI9 B;  4UI9 C;  1U3D A;  3EIQ C;  3URZ A;  4GZC A;  1HO8 A;  1QYM A;  4GNF A;  1QQE A;  1XWH A;  4LEU A;  4KZ0 A;  1WEV A;  4FLH A;  4U63 A;  3U5M A;  4GTR A;  4FHJ A;  3NAW A;  5B78 A;  1H19 A;  2MIQ A;  4GYO A;  3HTK C;  5FZS A;  1YCS B;  4WNF A;  2M3H A;  4FLB A;  3SOX A;  5AEN A;  4FHK A;  4GTV A;  1RZ4 A;  3SD5 A;  2I1J A;  2M1R A;  5LCW C;  3D9O A;  3DSU A;  4XKB A;  4LNG A;  3O37 A;  1OCO E;  2J4B A;  3FH5 A;  2R02 A;  2RFM A;  4HS2 A;  2XEE A;  5B76 A;  5HKP A;  2AXU A;  3FAN A;  1PY1 A;  4MVT A;  2VSY A;  4CYM D;  2QIZ A;  5JJ7 A;  4JEH A;  2FUU A;  4N3A A;  4JHJ A;  1QZ2 A;  1TNB A;  3S7B A;  2J07 A;  4L1B A;  4WNE A;  4R8P K;  1HU3 A;  2DVW A;  1E8W A;  1MYO A;  5D0Q D;  3CLJ A;  2V0P A;  2CHX A;  4U8V D;  3ESL A;  3PUJ A;  1MX4 A;  1B89 A;  1SA4 A;  5BPP A;  4C0M A;  3GYZ A;  3VLD A;  3Q49 B;  2AWI A;  1YA0 A;  4O1P A;  4HXI A;  5JMN D;  2CSY A;  2G6Q A;  5FZQ A;  1VDY A;  2RFA A;  3PZ3 A;  3QOU A;  4C0E A;  2QIC A;  5G04 B;  4GA0 A;  2KR4 A;  5G04 C;  1UOH A;  4ILH B;  3QWV A;  4XI0 A;  3TWX A;  3ZVV A;  4Q69 A;  3FTS A;  5EID A;  2WXM A;  2HM8 A;  2VSO E;  4PS7 A;  4DLO A;  3TL5 A;  4R7E A;  4XI9 A;  4RVB A;  3Q9N C;  3FUH A;  3N71 A;  5JJ6 A;  4TRQ A;  5BNW A;  4ACL A;  5H1V A;  2R03 A;  3T8M A;  1WAO 1;  3O34 A;  1TNO A;  2P2C P;  4GTP A;  4HRL A;  1EYH A;  3QKY A;  2XGM A;  2ZU6 B;  4G11 A;  3PZ1 A;  5JJT A;  3QWP A;  3SBT B;  3PHD A;  3QZV A;  3BG1 B;  2R17 C;  1A17 A;  4I2W A;  3HXB A;  2M63 A;  2P9I G;  3LEW A;  4GTO A;  1IXV A;  3CHP A;  2E6S A;  4DPR A;  2F6J A;  2MA6 A;  4ATZ D;  4L58 A;  3GZ1 A;  2F8Y A;  3MYV A;  2CSZ A;  1JWF A;  5FIO A;  3CVX A;  3ASG A;  4XI1 A;  1HX8 A;  3PRZ A;  3SUB A;  1TJF A;  5LKU A;  3U5O A;  3ZYM A;  5CCL A;  3FEX A;  2GRP B;  3LRQ A;  1VYX A;  3CKC A;  3GL6 A;  3HCS A;  1X4J A;  1HF8 A;  3FU3 A;  1WM5 A;  2DYR E;  2GW1 A;  4KT6 B;  2C0L A;  1CHC A;  5ENP D;  1WEP A;  4J8E A;  2EQX A;  4N4F A;  3Q5M A;  3JXJ A;  2R5S A;  3SF4 A;  1TN6 A;  3UIO C;  2PUY A;  4V3K C;  2RI7 A;  2L7P A;  3K9I A;  4UWH A;  3CHO A;  5ENO D;  1IQR A;  3O33 A;  2GRN B;  2CG2 A;  2PZI A;  1OT8 A;  5IY5 E;  3FUD A;  3HXC A;  4HOS A;  2VTB A;  3Q73 A;  4PS8 A;  2X38 A;  3E37 A;  1NA3 A;  3ML8 A;  2LXH C;  3T9K A;  4BSZ B;  3PUQ A;  4UWK A;  3DDT A;  1KPS B;  5I3L A;  3RKV A;  4OGE A;  3EIJ A;  3RPG B;  3RPG C;  3CVY A;  4PUC A;  3FM8 C;  4FK5 A;  4JXT A;  2H6I A;  3JXI A;  2XPY A;  4IYP A;  3ZRH A;  3DEO A;  4Q94 A;  2IOL A;  1WEN A;  5J3X A;  1LD8 A;  2XZT G;  4YVQ C;  4GZ3 A;  4MKT A;  5CED B;  5K3Q A;  1RMD A;  2V8S E;  1OXJ A;  4L9P A;  4R7L A;  5BV0 A;  2VTB B;  4UQX A;  1JOC A;  1MZC A;  3ZW3 A;  2LO6 A;  3CK9 A;  1FT1 A;  4I7B A;  2MHK A;  2XS8 A;  3PDN A;  1WEW A;  2ZXW E;  1EPU A;  2C0M A;  3FUM A;  4HRM B;  1TNU A;  4TXP A;  3L22 A;  2J8S D;  2ION A;  2JUN A;  5CBO A;  3OXF A;  2FBN A;  1IKN D;  4UWG A;  1IYG A;  2EOD A;  4FP7 A;  2HYE D;  1UN9 A;  1BU9 A;  1Z2Q A;  2WXR A;  3AJI A;  4GB9 A;  4AYC A;  3LYA A;  4P5O B;  1HG2 A;  2YYR A;  5KJK A;  2WQ7 A;  5G2N A;  3LJ3 A;  1UJJ A;  4G2V A;  3R9M A;  2JLB A;  2ZGD A;  5BUZ A;  2EIL E;  1JUQ A;  3V30 A;  1HFA A;  2J49 A;  4CRW A;  2R05 A;  3N9O A;  2BKK B;  1N54 A;  2VSX E;  2PM7 A;  4M3O A;  4F1S A;  4IN3 B;  1WG0 A;  3UT8 A;  3I4R B;  2BKG A;  4YND A;  1D8E A;  1E7V A;  5DKA A;  4AYC B;  3L08 A;  3FUJ A;  4I1O B;  3T7L A;  5E76 A;  3SOW A;  4MRU A;  3CIA A;  4W4U A;  3FH7 A;  2NAA A;  3TWS A;  2FFW A;  3FHE A;  5HS0 A;  4XX5 A;  3LQJ A;  4GCN A;  2WXG A;  2IY0 C;  5JG6 A;  3B13 A;  2GRQ B;  1TEZ A;  2B0O E;  4J8F A;  2I2O A;  4CA1 A;  1PAQ A;  3NOC D;  4HNA D;  3DEP A;  2P9U G;  3MV3 B;  2I1K A;  2LRI C;  3ZPJ A;  4H7Y A;  3U64 A;  3L13 A;  1O1T A;  1MM3 A;  3RTR B;  2ETA A;  1G3N B;  2EGP A;  2DYS E;  4CCA A;  4UP5 A;  2LGV A;  5B77 A;  3LVR E;  2BTD A;  2QYJ A;  1S63 A;  4C9Z A;  3UIP C;  4X3G A;  2DZO A;  2F37 A;  3UUX A;  2PNX A;  2XOZ A;  1WIM A;  1H6P A;  3TG4 A;  2ZET C;  3NQP A;  3DST A;  2KCK A;  2IJG X;  3IXE A;  3PZD A;  4NN2 A;  3LY9 A;  5ANL A;  3MDB C;  3V2O A;  5B3S E;  2EXU A;  4YAT A;  1SW6 A;  3SZ7 A;  2KZT B;  4K5B A;  2MRI A;  1VFY A;  4PTB A;  3ZUV B;  4NAC A;  5AYW D;  2VJ8 A;  4PDX A;  2M85 A;  1IQU A;  1WEU A;  2LAI A;  1N94 A;  3KV5 A;  1OY3 D;  5AQA A;  3V43 A;  2Y0B G;  3ZVZ B;  2WXQ A;  4YDY A;  1X4U A;  3C3O A;  3D9P A;  3IEG A;  3PEV B;  4YDW A;  4O1O A;  2FUI A;  2ECG A;  2K4D A;  5ITZ F;  1BPO A;  2RD0 A;  4HOQ A;  4JVS A;  4OAU C;  4H7X A;  3S7J A;  4NIK A;  2I6H A;  2X6H A;  2DSM A;  2YHO A;  3VK6 A;  4CDN A;  4O60 A;  3ZKJ A;  5CEA A;  3MA5 A;  5H7P A;  4ATG A;  3O48 A;  5AQ7 A;  4GNE A;  1ZU2 A;  4LSZ E;  3ZYK A;  3Q47 B;  2X6J A;  3B7T A;  1WY6 A;  4K5C A;  4CT0 A;  5EIB E;  2XEV A;  4JZY A;  2IEJ A;  3LDZ A;  3PNL B;  2HDP A;  2UZG A;  4BES A;  4JHK A;  1KLX A;  3BEE A;  3BUA A;  3ISM C;  2D8S A;  2CHW A;  1OWP A;  1TNZ A;  4I17 A;  4B8A A;  2IDA A;  3KEZ A;  4QF2 A;  4ACK A;  5D1L B;  2K1J A;  3S7D A;  3CGH A;  5FZR A;  3L82 A;  3OXG A;  4GTS A;  1YMP A;  2EGM A;  2YQ8 A;  2NXP A;  3MGB A;  2BUG A;  2YUR A;  4LK9 A;  5AAO A;  4HI8 A;  3O70 A;  3SNX A;  2MNY A;  3Q15 A;  4HB5 A;  3NB2 A;  4UWL A;  4JL0 A;  2VGE A;  5LFA A;  4URK A;  2VNF A;  4HLE A;  3I3N A;  2Y1M A;  3NF1 A;  4EZJ A;  3FFL A;  5EYA F;  4QFV A;  4BWR A;  4HRN A;  4ILI A;  1DC2 A;  2C2L A;  2GRL A;  1DVP A;  2P9L G;  2CON A;  2C2V S;  1N4S A;  3FJU B;  3D9J A;  3ONL A;  3D3M A;  1DCQ A;  3VTX A;  4CT4 A;  4WZ0 A;  2EIK E;  5KJL A;  3EDT B;  2FUL A;  2E6R A;  4LNU D;  3ULQ A;  4GYY A;  4C9B B;  3U3W A;  3RIB A;  4JA7 A;  5J08 A;  4J6I A;  2KWJ A;  3UQ3 A;  3O35 A;  2DIW A;  5CEC B;  3JQ0 A;  3KV6 A;  5CER B;  1IHB A;  3P1U A;  5G0F A;  3FEY A;  4GZD A;  3LXU X;  3CVW A;  2ZGG A;  5FQ8 A;  3B95 A;  5ENT D;  4BHW A;  4U0Z A;  3E4B A;  3KQI A;  3ESK A;  3FTY A;  5AJD A;  3UX4 A;  3ABL E;  3BG0 B;  3GZ2 A;  1FCH A;  2F0Y A;  3ULY A;  1ELW A;  5FT9 A;  3B7S A;  4RQI A;  5ENR D;  4GNG A;  2GRM A;  4BT9 A;  2PQR A;  2KIZ A;  3IBE A;  2CHZ A;  4L7T A;  3CHR A;  4YDE A;  3C6W A;  2KFT A;  5TBN A;  5FB0 A;  1V55 E;  3C72 A;  5LKZ A;  5FWQ A;  1JPL A;  3JUI A;  1UW4 B;  3AAA C;  4BBQ A;  5C11 A;  1HYI A;  4XE0 A;  2FSA A;  4G23 A;  3Q78 A;  3M62 A;  3MKQ A;  1TNY A;  1NL4 A;  4WWO A;  3FUL A;  3I5P A;  4ZFH A;  3PRE A;  1YYH A;  4D10 C;  4YDO A;  3CK8 A;  4DRX E;  4TUM A;  4AY6 A;  1WEM A;  5J90 A;  3ASL A;  3O36 A;  2KWO A;  3E32 A;  1Y8M A;  1WGM A;  2PM6 A;  3TG5 A;  5EYL A;  4UP0 A;  2RG8 A;  4FJY A;  3FU5 A;  5KH3 A;  2KC7 A;  4YBS A;  3MKQ B;  2KYU A;  3VLE A;  2IF4 A;  3FTW A;  2A5U A;  3M7K A;  3DWL G;  4HLL A;  3UM0 A;  4G8L A;  2OCC E;  4K5A B;  4I9E A;  3LQH A;  2MD7 B;  3HXD A;  2VPD A;  1O5M A;  4J0U A;  1NFI E;  3AS8 A;  2YSJ A;  3SHB A;  4A55 A;  2YW8 A;  3MJW A;  4A49 A;  3U9W A;  3L1Z B;  3OXL A;  2ECN A;  3ULE G;  3I4G A;  4I1A A;  4BFR A;  5T4Y A;  3G2S A;  3RRU A;  3CVQ A;  3SI5 A;  2X6K A;  4DUI A;  2WXK A;  3LCA A;  3HCU A;  1BI8 B;  5AJL A;  3U66 A;  2R59 A;  4BY6 A;  2X3M A;  4I6G A;  3L16 A;  1NI1 A;  3BQO A;  3DSV A;  1K8K G;  4Y6C A;  4BER A;  3KD7 A;  1HH8 A;  3CSF A;  4LNB A;  4PH4 B;  3GV4 A;  4O64 A;  4LER A;  4DX1 A;  1MQS A;  4GZ6 A;  3F6Q A;  5ARG A;  5LOZ A;  5HRY A;  4AM9 A;  2CT2 A;  2KM4 A;  5D1M B;  1X81 A;  5EX3 A;  2XPI A;  5TDW A;  4FUL A;  3ZPV E;  2KXP C;  2X6F A;  2KGI A;  5AQ9 A;  4ZDT A;  2X6I A;  4GPK A;  1E96 B;  1WES A;  1S70 B;  2HYZ A;  5C2Y A;  3MEK A;  4HBD A;  3HHM A;  5ARF A;  4APF A;  5DBK A;  3QNK A;  1WEE A;  5G55 A;  2G43 A;  3JYS A;  2Y3A A;  4A3T A;  3ZU7 B;  1WEO A;  2Y1L E;  4F7A A;  2A5E A;  5B8D A;  3PH0 C;  5KJN A;  4EBA A;  2IQC A;  3FTZ A;  1BD8 A;  3SOU A;  3PE4 A;  4IUL A;  3R9A B;  3FTX A;  2Y4U A;  4XZ4 A;  4E6H A;  3LY8 A;  2OND A;  4C48 B;  3CHS A;  3TXN A;  4HOT A;  1LF8 A;  3Q7F A;  4HFG A;  3FY4 A;  2XRY A;  4G26 A;  1MBM A;  1LDJ B;  4O62 A;  4J7W A;  1ELK A;  2OV8 A;  2LDR A;  2WXH A;  4N2Q A;  1UJK A;  3EHQ A;  3NG2 A;  3WG7 E;  4DX6 D;  2BED A;  4Z0R A;  3M63 A;  2L0T B;  3LS8 A;  4UQZ A;  3E2D A;  2GRR B;  1TYQ G;  4ABN A;  2LNI A;  5ENN A;  2WXI A;  3T6R A;  1OWL A;  1E8Z A;  5C1D A;  2JMD A;  2DBA A;  2FO7 A;  2Y43 A;  3J5Q B;  5EYP F;  4G25 A;  2ECT A;  2VJF A;  1W3B A;  3EHN A;  2LXL A;  3QAR A;  4O6F A;  4NQ0 A;  3L54 A;  3CV0 A;  3ZHE A;  1FVH A;  2EA6 A;  5G05 J;  3OAW A;  3IKO B;  2YHN A;  5AQB A;  4EPZ A;  2ILR A;  1LTX A;  2K16 A;  3D9L A;  4P29 A;  3DSX A;  4WNG A;  4APO A;  3EB6 A;  5FTP A;  1N11 A;  2RR4 A;  4ANV A;  1JCS A;  4I43 A;  4A1S A;  3ENE A;  4WWN A;  1S0P A;  2VJF B;  2CRR A;  1KT1 A;  2XEN A;  4A3V A;  1FPP A;  3C5R A;  2YHE A;  3ZHE B;  5AAR A;  2WXF A;  4AIF A;  4HOR A;  3DXM G;  1ZB1 A;  2AVP A;  3HXF A;  2QY7 A;  1WDY A;  3UIN C;  1FT2 A;  1K1A A;  4UI9 J;  4AV7 A;  3PVL A;  2MD8 C;  2KBX A;  4V3I A;  4J8Y A;  3N9P A;  2XQ0 A;  4B7Y C;  1IHG A;  5FB1 A;  2XEU A;  3UM3 A;  2JAB A;  4I7D A;  3UM2 A;  4DX7 D;  4OVU A;  4GZ5 A;  3FTU A;  3M99 A;  1H0A A;  4IC3 A;  4KYO B;  5LP0 A;  3B7R L;  4FJC A;  1QNF A;  4OVV A;  2OVB A;  2PL2 A;  4U96 D;  3C3R A;  1SVX A;  2L6B A;  3KNV A;  1RW2 A;  4Q96 A;  2BF0 X;  3MKR A;  5LCW J;  2DZN A;  3FTV A;  1N87 A;  2YRE A;  4GA1 A;  2I50 A;  2P57 A;  1MHQ A;  5FJY A;  4DJA A;  5B79 A;  2DX8 A;  5JA4 D;  5TDR A;  3RAU A;  2OEW A;  1X4I A;  3Q1D A;  2B6C A;  3W9F A;  3DSS A;  3EHR A;  2P9P G;  3O47 A;  4R2Y A;  4YAX A;  2LXP C;  2KZT A;  2J9Q A;  4CDR A;  1E90 A;  3L11 A;  3ASN E;  3NZU A;  3R7Q A;  3ZYQ A;  2H0D B;  4BT8 A;  2LN0 A;  2F6N A;  3ZYL A;  2OEV A;  2UY1 A;  1H2U A;  1MX2 A;  3D9H A;  5FQ4 A;  2EIJ E;  1TN7 A;  5LKT A;  1MM2 A;  3LJN A;  4Z68 A;  3J5P A;  3PLW A;  5KH7 A;  1HS6 A;  4JPS A;  3DBS A;  4ANW A;  3TWR A;  5H1T A;  2IFU A;  4GA2 A;  1N0R A;  3U4T A;  2CSV A;  3PUK A;  2VGY A;  3RK6 A;  3V2X A;  3ZTG A;  3ABK E;  3FH8 A;  3LY7 A;  4U95 D;  4BET A;  2UY1 B;  2L5U A;  1BI7 B;  3TAX A;  3CR3 A;  4JEU A;  3X2Q E;  4L23 A;  3U5N A;  4GCO A;  2FO1 E;  4JC8 A;  1FVF A;  4F1P A;  2MYO A;  2LQ6 A;  3U5P A;  4N3C A;  2FF4 A;  4BEP A;  3UT7 A;  3ZGQ A;  3CHM A;  4ZHB A;  2L0I A;  2V4H C;  4DX2 A;  2WXN A;  1K3Z D;  1XGW A;  3L17 A;  2YNQ A;  2FD4 A;  2XEH A;  2MNZ A;  4WAF A;  4N39 A;  2H6H A;  3MCX A;  3LVQ E;  5ANR A;  3PEU B;  2LGK A;  3KEA A;  3QJZ A;  5TRB A;  4JD2 G;  4NUR A;  2XGO A;  4U8Y D;  3SGH A;  1OCR E;  2F42 A;  1WFK A;  1O1S A;  2ECJ A;  3FWV A;  3AU4 A;  3FUK A;  3UM1 A;  2WM9 A;  4IRU A;  2M13 A;  4WZ3 B;  2EIM E;  3DPL R;  2HO1 A;  4E85 A;  4HVB A;  4GYW A;  3PZ2 A;  4YAB A;  2OWA A;  2BAY A;  2LSV A;  3FUN A;  3Q9U C;  2H6G A;  2P9S G;  5KWD A;  4TUU A;  2ECI A;  4I1M A;  4Q6F A;  1ZBP A;  5FIN A;  2A4Z A;  2IO2 C;  4F3V A;  1E7U A;  4I6J A;  4L2L A;  3I2D A;  3UXG A;  1Z60 A;  2WPV A;  2L43 A;  2QZA A;  2HE0 A;  4U0U A;  5CRU A;  1D9S A;  3QK0 A;  3CST A;  4U0S A;  5BXO A;  3SFY A;  4CGW A;  3L9T A;  1DNP A;  2L0B A;  3EU5 A;  4WWP A;  1JCR A;  4XKC A;  1NP7 A;  2I9C A;  4FIP A;  3Q79 A;  1VD4 A;  4K03 A;  4B93 B;  5G05 B;  5G05 C;  3TJP A;  1N4R A;  2VQ2 A;  3APD A;  2DCP A;  2YUC A;  4UI9 K;  1H6K A;  3WXX A;  4YAD A;  5EKQ D;  4N3W A;  3APF A;  4W9R A;  4J8D A;  3QDN A;  1HG5 A;  4I2Z A;  4RG9 A;  4DX5 D;  1HXI A;  5D2M C;  3AG2 E;  5LX8 A;  2WQH A;  4L7X A;  1TJC A;  2K17 A;  2GGF A;  3NZS A;  2KWN A;  3Q7A A;  3MX3 A;  3UKU G;  3GW4 A;  2XS1 A;  4PS3 A;  4QF3 A;  3G2W A;  4B94 A;  3E30 A;  4MS6 A;  5SVX A;  5KNG A;  5HI7 A;  2QFC A;  3KS2 A;  3UKR G;  4KBQ A;  1A5E A;  5ENS D;  4RG6 A;  2Y1N A;  1N9A A;  2FEZ A;  4EEC A;  3AS4 A;  4X8Q A;  2RSD A;  3CKB A;  2XPZ A;  3PS6 A;  3JQ1 A;  3TWW A;  1LDK C;  3FUI A;  3UPV A;  3KAE A;  3D9K A;  3IHP A;  3RO2 A;  3FU6 A;  2WMN A;  5SVY A;  4KZC A;  1T1H A;  1EF1 C;  1X5B A;  1KZO A;  1JWG A;  3QC1 A;  5FQ7 A;  3CVN A;  3T5X A;  5AIU A;  1Q2Z A;  5LCW B;  4GTQ A;  2V4L A;  3LPZ A;  4I9C A;  1GW6 A;  4GPM A;  5FQ6 A;  5D0O D;  1N4Q A;  2QC9 A;  2WXJ A;  4UWF A;  2LXM A;  2ZIS A;  3RRM B;  4FO9 A;  4B8C B;  5EDS A;  2CG3 A;  2P9N G;  4K0R A;  5KH9 A;  1Z6T A;  5KBA A;  3TWQ A;  3BU8 A;  4AJW A;  2JRJ A;  2NC9 A;  4V3L C;  4BX8 A;  2KU3 A;  4MLP A;  3FU0 A;  5EN5 D;  5AIT A;  1N4P A;  3ASF A;  2P9K G;  4TV3 A;  1AWC B;  3JCK C;  3VTY A;  4DK5 A;  4FA6 A;  4CZ2 D;  2XGS A;  2MKE A;  5CRV A;  4LG6 A;  2XRZ A;  3UT4 A;  2Q7F A;  5BV1 A;  4F52 B;  3TGO A;  4TXR A;  3O4Z A;  4BSX A;  4XEI G;  4GAA A;  5DIN A;  3IHV A;  2KWK A;  5D1K B;  2E61 A;  4UQY A;  2CFZ A;  2PQN A;  1U3C A;  3KSL A;  2LV9 A;  1OWM A;  3LDY A;  4CCG X;  4ANX A;  4AEZ C;  4GND A;  3E33 A;  3FDH A;  1OCZ E;  5KNH D;  3ASD A;  3O7A A;  3CK7 A;  3HG0 D;  4IC2 A;  2VPB A;  3CHQ A;  4CDM A;  3FUE A;  1JM7 A;  1N0Q A;  3RRN B;  1P5Q A;  4DI4 A;  4WA6 A;  5JHA A;  2AJA A;  2VPE A;  3FL2 A;  3HDX A;  3HYM B;  3ZIM A;  4LKA A;  3N9L A;  3Q4A B;  2KCV A;  4QQI A;  1L5J A;  2R2L A;  2LAH A;  5A23 A;  1AP7 A;  3H7H A;  3ZEF A;  2XHE A;  4J8S A;  3EJN A;  4AY5 A;  4A1G A;  1JM7 B;  4ME2 A;  2XOC A;  5CMW A;  5E75 A;  1N95 A;  4YBT A;  1MJ0 A;  2KKY A;  3SY2 A;  2JMI A;  1XNF A;  3NBN B;  1V87 A;  2PNN A;  4N3B A;  5HQ8 A;  4RLY A;  1N52 A;  3KSQ A;  5T8I A;  4FAD A;  3ZXP A;  5BT1 A;  2IOS A;  4F53 A;  4ZQL A;  4LJN A;  1JCQ A;  4DI3 A;  2WVI A;  4QQ4 A;  2HR2 A;  4OGC A;  4N5Q A;  5T3R A;  3C5K A;  2CRW A;  3SQV A;  4G1T A;  2CKL A;  1NZN A;  2E2E A;  3ZNG A;  2VJE A;  4FC8 A;  1K1B A;  2XCB A;  2V5Q C;  4B86 C;  4A4B A;  5EIL A;  5BW8 C;  3QAQ A;  2IO3 C;  2J09 A;  4FJZ A;  3IV0 A;  2AW6 A;  4PPE A;  3MHS A;  1E4U A;  3DQV R;  1LD7 A;  5SVI A;  3ONK A;  4RSY A;  2F8X K;  4WND A;  5B1A E;  2KKX A;  4TXQ A;  2JM3 A;  3UI2 A;  3ZNI A;  3R7R A;  1WIL A;  3CVP A;  1PC2 A;  2CKL B;  3L6A A;  2VJE B;  3HXE A;  3SFZ A;  5D66 A;  4GTM A;  2YVR A;  2YQL A;  2VYI A;  3ZN3 A;  5DIZ A;  4EZL A;  3N9N A;  3G2T A;  1SA5 A;  2D8U A;  3VLF A;  2KRE A;  4KMO A;  2ECW A;  5FER A;  3SFX A;  4YVO A;  2ETC A;  1FP0 A;  5ENQ D;  4B0Z A;  5SVI B;  1U2V G;  5FEY A;  3RO3 A;  3IHY A;  4ILG A;  4TKP B;  3OTN A;  4A0C D;  1S64 A;  5AN8 A;  3TWT A;  3APC A;  4YBM A;  3C98 A;  4U07 A;  3FAO A;  4F6R D;  2ECV A;  3PNT B;  2RKK A;  4EQF A;  3AG4 E;  2VPG A;  2LUH A;  3SHF A;  3RJV A;  2XOY A;  3PZ4 A;  4EHM A;  4YC9 A;  3KDE C;  3DWD A;  2GRO B;  4XIF A;  4KVM A;  2LGG A;  4GMJ A;  3QWW A;  4N5C A;  4G8K A;  4LRZ A;  2J08 A;  2XP0 A;  5C13 A;  1IYM A;  1TN8 A;  3B7U X;  4CGV A;  1KT0 A;  1QBQ A;  2AN6 A;  2OVF A;  4WUY A;  4LAD B;  3CEQ A;  1HZ4 A;  1H6O A;  1TR4 A;  3DPD A;  2WQ6 A;  1HE8 A;  1BOR A;  1WE9 A;  3DXK G;  3UMV A;  3L1X A;  3DPY A;  4M7C A;  4LCT A;  3MV2 B;  2MA5 A;  2MOW A;  3TWV A;  3V31 A;  3CQC B;  5TAB A;  2LSU A;  2MUM A;  2E0I A;  3ZPV 1;  3HRA A;  3AG1 E;  2YHC A;  4AP4 A;  2VP7 A;  5CMY A;  4OAV B;  1NA0 A;  2QJ0 A;  3PUR A;  2Y4T A;  3PE3 A;  5KJM A;  1ELR A;  2OOE A;  3SBS A;  2VSN A;  1G25 A;  4HQD A;  1H2V C;  3G2V A;  2H0D A;  5H1U A;  2J4D A;  5B1B E;  4AUQ B;  1SZ9 A;  2AXV A;  1BLX B;  4A63 B;  4EBA G;  3CQG B;  1Z3X A;  3N9M A;  3S2A A;  4JA9 A;  4ZUX U;  3AU5 A;  4GTT A;  2OXQ C;  3N9Q A;  2FI7 A;  2CFU A;  1Z6U A;  3CVL A;  4NRH B;  4A4C A;  3SO8 A;  3ML9 A;  2VGX A;  2MT5 A;  2YIN A;  2KCL A;  5H9M A;  2WXL A;  4AP2 A;  5CCM A;  4I7C A;  4MSX A;  1F62 A;  3NOG D;  3GZS A;  5M72 A;  5G04 J;  2DJA A;  4JHR A;  2JMJ A;  4BTA A;  4WZ2 A;  1E8Y A;  2L6J A;  2IU1 A;  2WXO A;  3AG3 E;  5CBN A;  3HIZ A;  2VGX B;  5A7D B;  4GB0 A;  1UG3 A;  3D9N A;  4GML A;  1OWO A; 
#chains in the Genus database with same CATH homology
 1K1B A;  2QYJ A;  2JUN A;  2V5Q C;  3SUB A;  5CBO A;  2YRE A;  5EIL A;  4BER A;  2P57 A;  3TWV A;  2DZO A;  2F37 A;  3J5Q B;  2XOZ A;  1IKN D;  3V31 A;  3LVQ E;  3KEA A;  3T8K A;  5JA4 D;  5EYP F;  2DVW A;  5ENR D;  1MYO A;  4U8Y D;  3UTM A;  1BU9 A;  3Q1D A;  3HRA A;  4DX1 A;  5KNG A;  2E61 A;  5SVI A;  5SVX A;  3W9F A;  4U8V D;  3IXE A;  2F8X K;  3F6Q A;  1MX4 A;  1YMP A;  3EHR A;  3AJI A;  2NYJ A;  5HRY A;  4OAV B;  1A5E A;  2EGM A;  4H9D A;  2KKX A;  3MDB C;  5ENS D;  3V2O A;  2JM3 A;  3UI2 A;  3LDY A;  2EXU A;  2M13 A;  3O47 A;  5ENP D;  1SW6 A;  2KXP C;  5AQB A;  5AAO A;  4HI8 A;  4K5B A;  4O1P A;  5KNH D;  4GMR A;  5AQ9 A;  4HQD A;  5D66 A;  3ZUV B;  2YVR A;  3HG0 D;  3JUE A;  3AAA C;  4HI9 A;  5JMN D;  3TWW A;  1S70 B;  2OWA A;  2ZGD A;  3JXJ A;  3E2D A;  1N0Q A;  4HBD A;  3Q9U C;  2RFA A;  3V30 A;  1N11 A;  4HB5 A;  2RR4 A;  2D8U A;  5KWD A;  3FEH A;  1BLX B;  3V79 K;  2AJA A;  4A63 B;  5BXU A;  2L7P A;  1UOH A;  2VGE A;  2BKK B;  1OY3 D;  3TWX A;  3LJU X;  4JB8 P;  5AQA A;  2ETC A;  4Z0O A;  5ENO D;  5ENQ D;  2CRR A;  2XEN A;  4ZFH A;  3ZU7 B;  2Y1L E;  1YYH A;  5FIN A;  5EID A;  5SVI B;  4QQI A;  1MX2 A;  3D9H A;  1WG0 A;  3C5R A;  2A5E A;  2Y0B G;  4DRX E;  2BKG A;  1QYM A;  5SVY A;  4TUM A;  4YDY A;  1OT8 A;  1AP7 A;  4QFV A;  3H7H A;  5AAR A;  5AN8 A;  3TWT A;  1BD8 A;  3UXG A;  3LJN A;  4Z68 A;  2HE0 A;  3J5P A;  3Q9N C;  3PLW A;  4YDW A;  4O1O A;  5EYL A;  4GPM A;  3TWR A;  3T9K A;  4BSZ B;  4F6R D;  3TWU A;  1D9S A;  5ITZ F;  4HRN A;  3DDT A;  1N0R A;  2CSV A;  5BXO A;  1DC2 A;  3TWS A;  2IQJ A;  2FFW A;  2QC9 A;  4C48 B;  2XOY A;  1WDY A;  5HS0 A;  3V2X A;  4OGE A;  2XOC A;  4OAU C;  2CON A;  1K1A A;  3FM8 C;  3SO8 A;  3JXI A;  3FJU B;  2P2C P;  2XZD G;  4HRL A;  3KDE C;  3DEO A;  4NIK A;  1MJ0 A;  1YCS B;  2KKY A;  4U95 D;  2KBX A;  4BET A;  1DCQ A;  4J8Y A;  3DWD A;  3M7K A;  3NBN B;  2XZT G;  1BI7 B;  4HLL A;  4B93 B;  2PNN A;  4G8L A;  5KBA A;  5CED B;  2ETB A;  2JAB A;  4K5A B;  3TWQ A;  5K3Q A;  4LNU D;  4O62 A;  4DX7 D;  4RLY A;  4J7W A;  4O60 A;  3ZKJ A;  5CEA A;  2FO1 E;  2LAU A;  2B0O E;  4F1P A;  1NFI E;  3B7B A;  4G8K A;  2XP0 A;  2MYO A;  5EN5 D;  3NOG D;  3NOC D;  5AQ7 A;  4LSZ E;  5CEC B;  1IXV A;  3W9G A;  4BEP A;  4HNA D;  5CER B;  2DJA A;  3DEP A;  1IHB A;  2RFM A;  3EHQ A;  4QQ4 A;  2XEE A;  4UUC A;  1AWC B;  4DX6 D;  1MX6 A;  4OGC A;  4U96 D;  5HKP A;  4ATZ D;  4N5Q A;  4K5C A;  4ZHB A;  3EU9 A;  2V4H C;  4DX2 A;  4Z0R A;  2ZGG A;  3B95 A;  1K3Z D;  2DWZ A;  4CZ2 D;  5CBN A;  5ENT D;  1TR4 A;  2F8Y A;  4DX5 D;  5EIB E;  4CYM D;  1SVX A;  2CRW A;  2MKE A;  2L6B A;  3ZNG A;  4HRM B;  2ETA A;  4LG6 A;  1G3N B;  5FIO A;  4DUI A;  2FD4 A;  4BES A;  2XEH A;  1BI8 B;  3LVR E;  2DZN A;  2J8S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...