1DD4A

Crystal structure of ribosomal protein l12 from thermotoga maritim
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
total genus 39
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd4A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd4A02
3GQ1A 1DD4A 3O2OA 2WA9A 4YJXA 1RQSA 1LZWA 3G19A 3G3PA 4YKAA 3O2BA 2W9RA 3GQ0A 1MG9A 1R6QC 3O1FA 4YJMA 1CTFA 3O1FB 1R6OC 3G1BA 3GW1A 1RQUA 1MBUC 1DD3A 3DNJA 1RQVA 1MBVB 2WA8A 3O2HA 1MBXC
chains in the Genus database with same CATH superfamily
1LGHB 1LTAC 2MJZA 3CMEP 5AW6B 5KTBA 2FXOA 1S4XA 3GHGA 1K73Q 3G71W 4R4LA 5AW8B 4EIJA 5L8RJ 1VQLW 3IF4A 1JOCA 2N1TC 3FWLA 2Y0EA 2WT7B 3NFQA 5TISE 3CMAP 1EZVG 3CCUP 1NTZK 1OXZA 1M90X 4Y99B 4BL2A 3BRVB 2ZJQW 1WRGA 2W6BA 3AECC 1YJ9W 4WY4B 3WU2H 1HGZA 1MBUC 4IOIH 2LKMA 3TNUB 2YKQA 1URQD 3H1HJ 3U1CA 1LT1A 4BRYA 3U59A 3WUTA 1BCCE 2AXTE 3L73J 1A02F 4YJMA 1JY2P 1GK6A 4C7RA 2QJYB 1NTMG 1L4AB 2AXTH 3A0HH 2KP8A 4UY8Z 1J1DB 2I1KA 4CPGA 1MG9A 2O3JA 3J7ZZ 1U7MA 1K8AX 4I2LC 1W2BO 3CCSP 3A0HE 1D7MA 2ZT9C 1FS0E 2ZFCA 4GDOA 5CJ0A 3ZDMA 5CBNA 1LWUC 2Y0DA 3FXEA 5GW7A 3I5CA 1KILE 3HUSC 2Y0CA 5TJHA 3OA7A 3SFEC 5KKZC 4YXWH 4WB4A 1LTJC 5AW9B 4H0LB 2L5GB 2W6AA 3RK2C 2Y9YA 3CXHH 5CCGC 2M8RA 3L73G 4A7PA 1YYCA 1H0TB 1YJNP 1OZHA 1YTZT 1IJDB 1SQPE 2C9LY 1G2CA 3JC22 2GUVA 4H13C 1YHQW 1ZR2A 1YITW 3CXHE 2IYOA 3H1LG 3TF5A 1Q7YQ 1ZN5A 3L75E 4CJNA 3D71A 1IK7A 1W5CE 2PP6A 1BCCJ 1GU4A 1RF1A 3DNJA 2WVRA 3AE7C 3KZIE 1NYHA 5APVA 1SQXG 3JCUE 2QE7H 3SSUA 3II6A 1S1CX 4XA4A 4Y28J 5GTIH 1MUUA 2YO2A 1ZXGA 2OYHA 2NPSA 4IO9W 3JCUH 1CZQA 1KYOI 1JJ2V 1FDIA 4WFAW 2P7JA 4EYYQ 5M19A 1M1JA 2B87A 2ZVOB 2HR3A 4GOEA 3O2BA 3L74D 3ZG0A 1NVOA 3QWOC 2WPRA 3GG2A 1R6OC 3H1JE 2Q1KA 5GAHa 3RK3D 4KJMA 1J2JB 2QRXA 3CWBJ 2H88C 3AE3C 2QJYC 4L75A 2GM4A 3HE4A 1NTMD 1BXYA 4HJGH 5B5EH 1LP1B 5CCGD 1J1DC 2HODA 4OWFA 1MFZA 2A06E 5CJ4A 2RN0A 1K73X 1G1IA 2B88A 2OYIC 1RF0C 1SQPD 2ZYDA 4I1LA 1VQ7W 3GF3A 2GUSA 3L75G 2HPCA 3LIEA 1AQTA 5DJTB 1AQ5A 3B5NC 5JVHW 2NZ2A 3BATA 3L70J 5AW4B 5CBOA 3H1KD 1M90Q 1M1JC 5KKZB 1EZVD 2WA8A 1VQNW 5GTHE 3CLQA 4WFBW 1PIXA 2QJPC 2NPSC 3GMAA 3G3ZA 1GL2B 3L37A 2R32A 4PD4D 2A45G 5GADa 1MWSA 1GDTA 1LT9C 2LXBA 4L73A 3PJSK 1VDFA 2OYIA 1SQBK 4B86A 2M5AB 1KB9E 1X22A 1IFIA 4GODA 2HFED 1SLQA 4U3FE 2QVAA 1KMIZ 4DZOA 3L70D 1HF9A 1KZUB 1PGPA 2FFDC 2JR8A 3EFGA 2WSCH 3HD7D 3NMDA 3T97A 2WMMA 5CHXA 3L74E 1QLED 1GL2D 2IFNA 1KYOD 2JO1A 3LW5H 2K9JB 4H44B 1A02J 2KSEA 1JTHA 1KQGB 2YIUB 4UB8H 2FYNC 1VQLP 1NU1G 3G6EP 3L75J 1YHQP 2W27A 2BEZF 2WQYC 2V7QH 1PP9G 2Z5IA 1JTHB 3W7SA 3B8EB 4UB8E 1SQVJ 2IBZG 2DW3A 2K9JA 3IR9A 1UIIA 3TGUD 1K8AQ 1DH3A 1L2PA 3WUUA 3ABVC 3AE6C 1USDA 4M3LA 3H1HE 3AEGC 3RBXA 1IFJA 1EZVE 2OTLP 1PFIA 1JY3N 3CCRW 2NPSD 4C46A 2M5AA 3A5TA 1L0LG 2D2CC 3GQ1A 2KS1A 3CPWV 3L36A 3L75D 2OYIB 1SFCB 3D6ZA 2V4HA 1KILB 2M3BA 3O6QB 1LTIC 1LJ2A 5E79E 1U57A 1ZMEC 1SQVD 2I8DA 2WPSA 2K9YA 2YO3A 1JY3P 1X9VA 3BRTB 2E75C 1L4AD 4JYCA 2AEMA 3QH9A 1OFCX 1PL5A 1Q81Q 1GL2C 1SQQJ 1DD3A 2ZJPW 1YBKA 2J59M 2C9NY 1FZGA 4I7ZC 1G1JA 3H25A 1W2EA 2R3CA 2FFDA 1BSHA 3HD7B 2E76B 2POHA 3C1LA 2E74B 5HL7W 1LP1A 2KYVA 1PZQA 1S2EA 5JVGW 1T3JA 2JWDA 3MHVA 3W7XA 2MKVA 1YITP 1FDOA 2KZIA 4K3AA 4ZKUA 3H1ID 2P2UA 3AEAC 3AE4C 1M1KQ 4IL6E 3TGUE 3AEFC 4JYBA 3CL3D 5APSA 2WSEJ 5AVWB 2B87B 3A7OA 3V5BA 3EFFK 3H1HD 1VQPP 2Z4EA 5TISH 1SQVK 3LW5J 2IZ1A 1OX3A 1VF5D 2E74D 3G9RA 1NO4A 4HYTB 1HTLC 3CXHD 3Q1MA 4OH8B 1M56D 4ASWA 3CC7W 1NKNA 1AVYA 1NTZG 5KAIE 3CC2W 1USEA 2YMYA 2HG5D 3CCEW 2IDBA 3RK2D 2FKWB 1MWRA 3VP8A 3VMZA 4DKIA 5APUA 3WUVA 1FZCB 1NJIQ 2BCCJ 3D70A 3V2RA 1BGYJ 3S9OA 4D6TE 3PP5A 5AVSB 1SQQK 3CC7P 4OVNF 1MFTA 1K9MX 2C0WA 3KQGA 3GW1A 1Q81X 4DCKA 1SP4A 3I56P 1VQKW 3F5HA 1KYOE 1PGJA 4DT0A 1NTMJ 3G19A 2QM7A 1ZOYC 1VQ8W 1URQB 1FBMA 1KB9I 3H1JD 3L70G 2OYHC 1YTZI 1L0LJ 1VQ6P 3H32A 3S4RA 2BCCD 1N73C 1BGYG 3I55W 3CX5D 1KTMA 3P8CD 4HH2A 3W7WA 3CCRP 5H2FE 1IZNB 3G3PA 3TGUG 2YMKA 1Q82Q 3CWBE 2KNCB 4RESB 1FC2C 2E76C 2A06D 1SQBE 2XNXA 1VF5C 1S72W 2E74C 1JUNA 1QX8A 1LNQA 3V4QA 2QA4W 3RBZA 1OIPA 1L4AA 3GLMA 3RK3C 1FJKA 1N7SA 1JB0J 1N7SC 1HWTC 4NPEA 1FZBA 4IOAW 1ZW0A 2P67A 2QG4A 3KYQA 1L0NJ 3HE5B 2ZJRW 1LTBC 3LIDA 2JP3A 4H13D 3KZIH 2Q3IA 3TNUA 2K1AA 2B9BA 1SQPG 1VQ5W 1GW4A 3E1IA 5CCGA 1Z56A 2I1JA 4NPDA 4WVZA 3L74J 1FZFA 4WY4A 4AQRD 3SWYA 1IFNA 5AVYB 4PD4E 3GF7A 1QVFV 4CPKA 1LTGC 1VQ8P 3L72D 1N73A 3B5ND 3AEEC 5APWA 1S9KD 5DM7W 4BXLA 4ZMDA 1PV3A 4IL6X 3VOPA 5DM6W 4OGQD 1OW8A 1ZLLA 4N78D 4EI2A 3KHUA 1SQPJ 1R5SA 1IFDA 3Q5SA 3VMXA 4R4MA 1S72P 1QL2A 5B66E 5AVQB 1YJWW 4WFNW 2YNYA 4WCEW 3CMAW 2FXMA 3H1KJ 5K5GB 3DLLW 3MIWA 2WSFJ 2OTLW 1JO5A 1EDIA 1FU1A 5BVZA 1NH4A 2RKLA 1PPJG 2FYZA 2ZYGA 3WMM0 3CD6P 1NTZJ 3C9IA 2UWJE 2ZT9B 4TT3H 1NU1E 2R3SA 2LXCB 1W2BV 4D6TJ 1JNMA 4U7JA 1N73B 5GTHH 3H6PA 3CXHI 1GK4A 5KLVK 1KYOH 1YQ3C 2CPSA 3E7KA 1R5LA 3MUDC 1LTJB 1YJNW 4W80A 4H0LC 2QSIA 3BCCJ 1ZV8A 2Q6QA 2O01J 2IZ0A 1VF5B 3GHGC 1HVVA 2Q7CA 2N9YB 1SVFA 4YPCA 3HE5A 2WPQA 1JEKA 1FOSF 1TU3F 4H44D 3B4SA 3MZWB 5CCHA 1NHLA 1GD2E 2YXRB 3FWNA 2JWAA 2W90A 1VQQA 2WZ7A 1VQ4W 1SQQD 4EDFA 1N7SB 3L72E 2W6JH 1JY2N 4D6TD 2KIKA 2WSEH 5KLVG 5AVXB 3CCVP 1EDKA 3R2PA 1Q2NA 1WMKA 1SQXD 3TK1A 1YIJW 1BDDA 2P1JA 3AE8C 4IFDK 1DEEG 4OGQC 5CCHD 2H89C 2RMZA 3AE9C 4KT0J 1KD1Q 3H1LJ 2M3EA 1NTZE 3V6IA 2KNCA 1VQOP 3M9QA 2O01H 2H43A 3TGUJ 1K04A 2OTKE 2WSSH 3N4XA 1T2KC 2QIWA 1NJIX 3CD6W 4O9BA 2WWWA 2N9BA 2KUBA 4GKGA 3CC4W 3H32B 3CCVW 4ASVA 2PRRA 1YIJP 4PV1D 3K5BA 1KD1X 1URQA 1BDCA 3CX5E 1NTKG 1XTGB 3EQ2A 2W83C 2H7HA 2A06G 3AE1C 5AVRB 1SQXJ 3AE5C 3CCLW 1U7JA 1IFPA 3IAOA 1RQUA 1NTKD 2BASA 3CCMP 1CW5A 1QVFO 1KV4A 1QEXA 1MBXC 1IO4A 2YXQB 2QJKB 1Y8AA 1NGMB 1YI2P 5GAGa 1VQMW 2AXCA 4IL6H 3W7UA 4IOCW 1FZCA 3O1FA 1P84E 3FX0A 5E79H 4YXDC 1N2DC 2A45I 4UB6E 2FYUE 5M1AA 3L4FA 1P84H 1NWQA 2O01N 1M8OB 4K35A 2FY8A 3ZFZA 5C39A 3CC2P 1SQXE 1FZEA 3USSA 2FYUJ 3G71P 2IPPA 2QJPB 2Q9IA 2KK7A 1RQSA 1S9KE 3E1RA 3H1IJ 2Y9ZA 1Q90D 1QVGO 3VMAA 3GW6A 2LR2A 1EXJA 4AYCA 4MN4C 3M9BA 3PRJA 1LT9B 2ZXXA 1L0LD 3IN6A 3A0BH 1MBVB 3D6YA 1BE3J 2AEFA 5KAFH 1S5LH 4PD4H 1GW3A 1KN7A 3PLNA 1KQLA 3RK3E 2OTJW 3OJAB 5AVTB 4OGQB 1IK9A 3JSVC 1NTME 5KJ7A 1S5LE 3HD7A 2FFDB 2N1TB 1VQMP 1AFOA 2OGUA 3P8CE 1YJ9P 1BCCG 5B5EE 1PP9E 5APTA 2XDJA 4KHXA 4U67W 3Q5RA 1DX7A 1SQBD 4RKUJ 1BE3G 5B66H 3CCUW 2FYNB 5KLVJ 1L0ND 1MZ9A 4C7NB 1EQ7A 2QEXW 3H1KE 1DIPA 5KAIH 4L74A 5AW5B 2JJLA 3A2AA 5AW7B 5APYA 3RL0D 2KXPB 3ITKA 5AW3B 3O6QA 2RH0A 1BE3E 1KILA 3Q3DA 1SFCA 1JY2O 3SFDC 3L72J 2KS1B 3EWKA 4UB6H 4PD4I 3IFMA 3M0DA 1L0LK 2G3AA 1K05A 2L91A 3G6EW 2D2CB 4W7ZA 1PGOA 2CK3H 3W67A 2OARA 1UIXA 2PGDA 3PTZA 1Q82X 4U3FD 1KILC 1N86A 2K88A 1EXIA 2ZVNB 1LWUB 1E79H 3RL0g 1AJYA 1JCDA 3G4SW 1HJBA 3A3YB 3FGAD 2ZYAA 3G1BA 1NOHA 5KLIC 2E5YA 5GAEa 2IFMA 3TDKA 2E75B 3NTNA 2KLVA 1NKZB 3O8ZA 1OVUA 2A45H 1JY3O 3B5NA 2XU6A 3OW2V 4HKZH 3Q5PA 2H8PD 5APQA 1H89A 1YI2W 1LTSC 1RQVA 3VP9A 1RF0A 1M57D 3T97B 4LGDE 4YJXA 1ZRTE 3ZG5A 1RF1C 1SQQG 1QL1A 1M7LA 3KPEA 1NTKE 1L0NE 4PJ0E 2O1KA 1NU1D 3M0DC 2FYUG 1SS1A 3HTKA 3BVHA 3Q2YA 3H1JG 2KLUA 4JPZB 3HRNA 3CCQW 1BSNA 2HLOA 3VN0A 1P84D 1R8EA 3V2PA 3CPWO 1FOSE 3PIOW 1GL2A 1FZAA 1NTMK 3BCCE 1P84I 2GA1A 1X8YA 2KB7P 2IBZI 2M0BA 1FAVA 2Q5UA 2R44A 1VQOW 4AUWA 1JCCA 1T8ZA 1LTTC 1Y47A 1KQSO 4N6JA 2HPCB 1NU1J 3CC4P 2OTJP 4IFFA 2WSFH 1KB9D 1MKMA 1PP9J 4H0LD 1RE3C 1YQ4C 5CA3A 3L70E 3HTKB 5EFWB 2AEJA 3P8MC 2FYUK 1EZVI 2D2CD 2HODB 3CX5I 1J1EB 1NTZD 2KZJA 3H1LE 4RO0A 4L76A 2VRSA 5AVVB 3L71J 3HE4B 3M91A 3W68A 1NU1K 3CCJP 1RE3A 2PFXA 4GT1A 3L73D 3VMYA 2WSCJ 2B89A 2KI7B 3C8VA 2J58A 4JQ0D 5APXA 4IFMA 4D6TG 3B5NB 1VQ7P 3SWKA 5KLIB 3L72G 1M1JB 1DD4A 1PP9D 3A0BE 2YKOA 4WBAA 1HUCA 1NAYA 4BL3A 1L0NK 3VTPC 4N3YB 1NAFA 2NPSB 5GTIE 2OYHB 1VQNP 2K37A 2E5TA 4W7YA 3VYIA 1LWUA 3V4WA 4DOJA 2W8ZA 2XV5A 1ZR4A 4YKAA 5M18A 1RF1B 2ITAA 1IC2A 4GOFA 3MGNA 1KFMA 3CI9A 2FYUD 1EC5A 3CXCV 1KFNA 2O1JA 3RK3B 3S1KA 1FJPA 5KAFE 1XTCC 2NRGA 3NXSA 1RY3A 1SQVE 3RGUA 1CSBA 3CF5W 1VQ6W 1PPJE 2WITA 3CX5H 1G2CB 4H44C 3KDPB 5AVUB 1JM0A 4JF7A 3D3IA 1H0TA 2YIUC 3L71E 1BGYD 5BU8B 2K3RA 4C7NA 1H8AA 1NTKK 2SPZA 3M0AA 3MUDA 1HGVA 1EDJA 1R6QC 2OYOA 3P32A 1KB9H 1L0LE 1NTKJ 2WPVB 1WT6A 1VQ5P 1Q7YX 2PAJA 3V2NA 4WWIA 2ZJSE 1RE4A 3H1HG 2C0XA 2N1TA 1KQSV 2E43A 1T2KD 1X79B 1HJ0A 2Z5HA 2BEQD 3H1JJ 1N7LA 1SQBJ 1M1KX 1J1EC 1JMMA 4QMAA 3B71A 5KLVD 1AA0A 2IBZE 3TSIA 3P7KA 3H1IE 3CWBG 4PV1C 1OW6A 1RHZB 3PHLA 4WF9W 3OW2O 1SFCC 2QM8A 3BASA 1LT9A 1FE6A 1MWTA 2P58A 1MV8A 4LLHA 2OQQA 2KOGA 2G8YA 4TLFA 3PIPW 1AV1A 4BRYB 1OWAA 1T6AA 4WY4D 1GZLA 5AW1B 5BU5A 1YJWP 2ZXEB 1OVVA 1ZP0C 3H1KG 5CMZA 1CTFA 4EOTA 3CMEW 1JMBA 3L71G 1KC8X 2QEXP 3PH0A 1BE3D 3G4SP 3O2HA 4U3FJ 1SQBG 3O2OA 2E76D 3AEDC 1DEBA 2WT7A 4BWNA 4I7ZB 3F89A 1SQPK 1BCCD 3KXDA 1GU5A 2YKPA 1SQVG 3CCJW 3HD7C 1K9MQ 3O1FB 5AW0B 5KJ7C 1BGYE 3GHGB 1EDLA 2P10A 1H88A 3RL0C 3AEBC 2Q3EA 1VQ4P 1N7SD 2HYNA 3MP7B 1LZWA 1FDMA 1KQFB 4XE5B 3M06A 1AVOA 1MWUA 5AW2B 1VQ9W 2WTYA 1Q86Q 4N78E 5AVZB 1GMJA 1X0TA 3CCEP 1HH0A 3L74G 1OW7A 1IFMA 1HBWA 3FXDA 4Z1MH 1S5LX 2JEEA 4U3FG 5H2FH 2BCCE 3U1AA 1KILD 2IBZD 5DJUB 2CPBA 1VQPW 1N8RX 1SFCD 2ZAEB 1VQ9P 3W7TA 1QGKB 3CWBD 2R5BA 3HUSA 2KSJA 1ZRTD 4Y99C 2BCCG 3CCSW 1VQKP 3I56W 4ZKPA 4WY4C 2XZRA 1SQXK 4ZNCA 2E42A 5M1BA 1FZCC 3OAKA 1CI6B 2JKVA 3UIAA 2WA9A 2IX7C 1RH5B 2XKMA 2N1TD 3MTUE 4PV1B 1GTWA 3MD0A 4PJ0H 3WU2E 3GQ0A 2FBWC 4DJGA 2E75D 3BCCD 3CCQP 1L4AC 4I6MC 2QJKC 1Q86X 4GIFA 4JBZA 1CI6A 1SQQE 5KJ7D 1Y9BA 1S3JA 3V2QA 1VPCA 1PPJD 2V7QJ 3CCMW 1KORA 2QA4P 1LTJA 2FXPA 3L35A 1URQC 3AE2C 4HB1A 3CCLP 1RE4C 3L71D 3BCCG 3HUSB 4RJTA 2JDIH 1QVGV 4NPFX 1PGQA 1OVRA 3I55P 3H1LD 2XNDH 3N7NA 2IYPA 4YTPC 3RK2B 1KC8Q 1VL2A 1OMIA 3M9HA 4LC1A 4XFJA 3RL0B 2R5DA 1L0NG 3SWFA 3TYYA 4H13B 2ZT9D 3L73E 2W9RA 2J5UA 5KLVE 3H1IG 1E5WA 3R4YA 1T3UA 5CCHC 1N8RQ
chains in the Genus database with same CATH topology
4GDOA 1KTMA 3GQ1A 2YIUC 3O2OA 1WMKA 3T97B 2WA9A 4YJXA 3D6ZA 1ZRTE 3LW5J 2E76D 3G3PA 3AEDC 3AE8C 4PV1B 1DIPA 3Q5SA 1KILE 1VF5D 4R4MA 2YMKA 2E74D 3G9RA 4OGQC 3O2BA 4I7ZB 2H89C 3GQ0A 4R4LA 2FBWC 2WSCJ 3AE9C 1R6QC 3SFEC 4KT0J 1U57A 3O1FB 5L8RJ 1ZMEC 1KMIZ 5KKZC 2E76C 1R6OC 2E75D 3C8VA 1VF5C 1HF9A 2E74C 2WPVB 3Q1MA 2K9YA 2QJKC 4H0LB 2P10A 3O6QA 1K04A 2WSFJ 3Q2YA 2H88C 3AE3C 3Q3DA 3AEBC 1DD4A 2QJYC 3SFDC 3EWKA 2QIWA 2E75C 1Y9BA 1RQSA 1LZWA 3GLMA 1KQFB 2G3AA 2V7QJ 1K05A 2IDBA 2JO1A 1Q90D 1R8EA 1KORA 1HJ0A 1JB0J 1EXJA 2FXPA 1PL5A 3AECC 4H44B 2BEQD 4H13C 4PV1D 3AE2C 1GMJA 2ZT9B 2D2CB 4TT3H 1MBUC 1DD3A 3IN6A 1KQGB 1OW7A 3B71A 3D6YA 1MBVB 1UIXA 3D70A 4U7JA 2FYNC 2JP3A 4H13D 4PV1C 3AE1C 3S9OA 1OW6A 1EXIA 3AE5C 4Z1MH 3RK3E 1S5LX 4I7ZC 1YQ3C 3H25A 4YKAA 3GF3A 2BEZF 2WQYC 3RL0g 3D71A 1IK7A 2E76B 1AJYA 4OGQB 4YJMA 2E74B 2OQQA 3IAOA 3FGAD 4H0LC 3G1BA 2G8YA 3GW1A 1RQUA 2NZ2A 2QSIA 4YTPC 3GF7A 5KLIC 3DNJA 2O01J 2WA8A 1VL2A 3AE7C 1NYHA 1VF5B 1OMIA 2E75B 1MBXC 1MKMA 1PIXA 4XFJA 1NGMB 4H0LD 2MKVA 2QJPC 1S1CX 3G19A 4Y28J 3ABVC 3AEEC 1FDOA 1YQ4C 1ZOYC 1TU3F 3AE6C 4H44D 3GMAA 3AEAC 1ZP0C 3AEGC 4H13B 2ZT9D 3Q5PA 2D2CD 2W9RA 3AE4C 1MG9A 3O1FA 1PV3A 2J5UA 4IL6X 1CTFA 3Q5RA 3AEFC 4RKUJ 4YXDC 2WSEJ 3R4YA 4H44C 1RQVA 2ZT9C 2D2CC 5M1BA 4OGQD 3O2HA 1OW8A 1FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ1 A;  1DD4 A;  3O2O A;  2WA9 A;  4YJX A;  1RQS A;  1LZW A;  3G19 A;  3G3P A;  4YKA A;  3O2B A;  2W9R A;  3GQ0 A;  1MG9 A;  1R6Q C;  3O1F A;  4YJM A;  1CTF A;  3O1F B;  1R6O C;  3G1B A;  3GW1 A;  1RQU A;  1MBU C;  1DD3 A;  3DNJ A;  1RQV A;  1MBV B;  2WA8 A;  3O2H A;  1MBX C; 
#chains in the Genus database with same CATH topology
 1LGH B;  1LTA C;  2MJZ A;  3CME P;  5AW6 B;  5KTB A;  2FXO A;  1S4X A;  3GHG A;  1K73 Q;  3G71 W;  4R4L A;  5AW8 B;  4EIJ A;  5L8R J;  1VQL W;  3IF4 A;  1JOC A;  2N1T C;  3FWL A;  2Y0E A;  2WT7 B;  3NFQ A;  5TIS E;  3CMA P;  1EZV G;  3CCU P;  1NTZ K;  1OXZ A;  1M90 X;  4Y99 B;  4BL2 A;  3BRV B;  2ZJQ W;  1WRG A;  2W6B A;  3AEC C;  1YJ9 W;  4WY4 B;  3WU2 H;  1HGZ A;  1MBU C;  4IOI H;  2LKM A;  3TNU B;  2YKQ A;  1URQ D;  3H1H J;  3U1C A;  1LT1 A;  4BRY A;  3U59 A;  3WUT A;  1BCC E;  2AXT E;  3L73 J;  1A02 F;  4YJM A;  1JY2 P;  1GK6 A;  4C7R A;  2QJY B;  1NTM G;  1L4A B;  2AXT H;  3A0H H;  2KP8 A;  4UY8 Z;  1J1D B;  2I1K A;  4CPG A;  1MG9 A;  2O3J A;  3J7Z Z;  1U7M A;  1K8A X;  4I2L C;  1W2B O;  3CCS P;  3A0H E;  1D7M A;  2ZT9 C;  1FS0 E;  2ZFC A;  4GDO A;  5CJ0 A;  3ZDM A;  5CBN A;  1LWU C;  2Y0D A;  3FXE A;  5GW7 A;  3I5C A;  1KIL E;  3HUS C;  2Y0C A;  5TJH A;  3OA7 A;  3SFE C;  5KKZ C;  4YXW H;  4WB4 A;  1LTJ C;  5AW9 B;  4H0L B;  2L5G B;  2W6A A;  3RK2 C;  2Y9Y A;  3CXH H;  5CCG C;  2M8R A;  3L73 G;  4A7P A;  1YYC A;  1H0T B;  1YJN P;  1OZH A;  1YTZ T;  1IJD B;  1SQP E;  2C9L Y;  1G2C A;  3JC2 2;  2GUV A;  4H13 C;  1YHQ W;  1ZR2 A;  1YIT W;  3CXH E;  2IYO A;  3H1L G;  3TF5 A;  1Q7Y Q;  1ZN5 A;  3L75 E;  4CJN A;  3D71 A;  1IK7 A;  1W5C E;  2PP6 A;  1BCC J;  1GU4 A;  1RF1 A;  3DNJ A;  2WVR A;  3AE7 C;  3KZI E;  1NYH A;  5APV A;  1SQX G;  3JCU E;  2QE7 H;  3SSU A;  3II6 A;  1S1C X;  4XA4 A;  4Y28 J;  5GTI H;  1MUU A;  2YO2 A;  1ZXG A;  2OYH A;  2NPS A;  4IO9 W;  3JCU H;  1CZQ A;  1KYO I;  1JJ2 V;  1FDI A;  4WFA W;  2P7J A;  4EYY Q;  5M19 A;  1M1J A;  2B87 A;  2ZVO B;  2HR3 A;  4GOE A;  3O2B A;  3L74 D;  3ZG0 A;  1NVO A;  3QWO C;  2WPR A;  3GG2 A;  1R6O C;  3H1J E;  2Q1K A;  5GAH a;  3RK3 D;  4KJM A;  1J2J B;  2QRX A;  3CWB J;  2H88 C;  3AE3 C;  2QJY C;  4L75 A;  2GM4 A;  3HE4 A;  1NTM D;  1BXY A;  4HJG H;  5B5E H;  1LP1 B;  5CCG D;  1J1D C;  2HOD A;  4OWF A;  1MFZ A;  2A06 E;  5CJ4 A;  2RN0 A;  1K73 X;  1G1I A;  2B88 A;  2OYI C;  1RF0 C;  1SQP D;  2ZYD A;  4I1L A;  1VQ7 W;  3GF3 A;  2GUS A;  3L75 G;  2HPC A;  3LIE A;  1AQT A;  5DJT B;  1AQ5 A;  3B5N C;  5JVH W;  2NZ2 A;  3BAT A;  3L70 J;  5AW4 B;  5CBO A;  3H1K D;  1M90 Q;  1M1J C;  5KKZ B;  1EZV D;  2WA8 A;  1VQN W;  5GTH E;  3CLQ A;  4WFB W;  1PIX A;  2QJP C;  2NPS C;  3GMA A;  3G3Z A;  1GL2 B;  3L37 A;  2R32 A;  4PD4 D;  2A45 G;  5GAD a;  1MWS A;  1GDT A;  1LT9 C;  2LXB A;  4L73 A;  3PJS K;  1VDF A;  2OYI A;  1SQB K;  4B86 A;  2M5A B;  1KB9 E;  1X22 A;  1IFI A;  4GOD A;  2HFE D;  1SLQ A;  4U3F E;  2QVA A;  1KMI Z;  4DZO A;  3L70 D;  1HF9 A;  1KZU B;  1PGP A;  2FFD C;  2JR8 A;  3EFG A;  2WSC H;  3HD7 D;  3NMD A;  3T97 A;  2WMM A;  5CHX A;  3L74 E;  1QLE D;  1GL2 D;  2IFN A;  1KYO D;  2JO1 A;  3LW5 H;  2K9J B;  4H44 B;  1A02 J;  2KSE A;  1JTH A;  1KQG B;  2YIU B;  4UB8 H;  2FYN C;  1VQL P;  1NU1 G;  3G6E P;  3L75 J;  1YHQ P;  2W27 A;  2BEZ F;  2WQY C;  2V7Q H;  1PP9 G;  2Z5I A;  1JTH B;  3W7S A;  3B8E B;  4UB8 E;  1SQV J;  2IBZ G;  2DW3 A;  2K9J A;  3IR9 A;  1UII A;  3TGU D;  1K8A Q;  1DH3 A;  1L2P A;  3WUU A;  3ABV C;  3AE6 C;  1USD A;  4M3L A;  3H1H E;  3AEG C;  3RBX A;  1IFJ A;  1EZV E;  2OTL P;  1PFI A;  1JY3 N;  3CCR W;  2NPS D;  4C46 A;  2M5A A;  3A5T A;  1L0L G;  2D2C C;  3GQ1 A;  2KS1 A;  3CPW V;  3L36 A;  3L75 D;  2OYI B;  1SFC B;  3D6Z A;  2V4H A;  1KIL B;  2M3B A;  3O6Q B;  1LTI C;  1LJ2 A;  5E79 E;  1U57 A;  1ZME C;  1SQV D;  2I8D A;  2WPS A;  2K9Y A;  2YO3 A;  1JY3 P;  1X9V A;  3BRT B;  2E75 C;  1L4A D;  4JYC A;  2AEM A;  3QH9 A;  1OFC X;  1PL5 A;  1Q81 Q;  1GL2 C;  1SQQ J;  1DD3 A;  2ZJP W;  1YBK A;  2J59 M;  2C9N Y;  1FZG A;  4I7Z C;  1G1J A;  3H25 A;  1W2E A;  2R3C A;  2FFD A;  1BSH A;  3HD7 B;  2E76 B;  2POH A;  3C1L A;  2E74 B;  5HL7 W;  1LP1 A;  2KYV A;  1PZQ A;  1S2E A;  5JVG W;  1T3J A;  2JWD A;  3MHV A;  3W7X A;  2MKV A;  1YIT P;  1FDO A;  2KZI A;  4K3A A;  4ZKU A;  3H1I D;  2P2U A;  3AEA C;  3AE4 C;  1M1K Q;  4IL6 E;  3TGU E;  3AEF C;  4JYB A;  3CL3 D;  5APS A;  2WSE J;  5AVW B;  2B87 B;  3A7O A;  3V5B A;  3EFF K;  3H1H D;  1VQP P;  2Z4E A;  5TIS H;  1SQV K;  3LW5 J;  2IZ1 A;  1OX3 A;  1VF5 D;  2E74 D;  3G9R A;  1NO4 A;  4HYT B;  1HTL C;  3CXH D;  3Q1M A;  4OH8 B;  1M56 D;  4ASW A;  3CC7 W;  1NKN A;  1AVY A;  1NTZ G;  5KAI E;  3CC2 W;  1USE A;  2YMY A;  2HG5 D;  3CCE W;  2IDB A;  3RK2 D;  2FKW B;  1MWR A;  3VP8 A;  3VMZ A;  4DKI A;  5APU A;  3WUV A;  1FZC B;  1NJI Q;  2BCC J;  3D70 A;  3V2R A;  1BGY J;  3S9O A;  4D6T E;  3PP5 A;  5AVS B;  1SQQ K;  3CC7 P;  4OVN F;  1MFT A;  1K9M X;  2C0W A;  3KQG A;  3GW1 A;  1Q81 X;  4DCK A;  1SP4 A;  3I56 P;  1VQK W;  3F5H A;  1KYO E;  1PGJ A;  4DT0 A;  1NTM J;  3G19 A;  2QM7 A;  1ZOY C;  1VQ8 W;  1URQ B;  1FBM A;  1KB9 I;  3H1J D;  3L70 G;  2OYH C;  1YTZ I;  1L0L J;  1VQ6 P;  3H32 A;  3S4R A;  2BCC D;  1N73 C;  1BGY G;  3I55 W;  3CX5 D;  1KTM A;  3P8C D;  4HH2 A;  3W7W A;  3CCR P;  5H2F E;  1IZN B;  3G3P A;  3TGU G;  2YMK A;  1Q82 Q;  3CWB E;  2KNC B;  4RES B;  1FC2 C;  2E76 C;  2A06 D;  1SQB E;  2XNX A;  1VF5 C;  1S72 W;  2E74 C;  1JUN A;  1QX8 A;  1LNQ A;  3V4Q A;  2QA4 W;  3RBZ A;  1OIP A;  1L4A A;  3GLM A;  3RK3 C;  1FJK A;  1N7S A;  1JB0 J;  1N7S C;  1HWT C;  4NPE A;  1FZB A;  4IOA W;  1ZW0 A;  2P67 A;  2QG4 A;  3KYQ A;  1L0N J;  3HE5 B;  2ZJR W;  1LTB C;  3LID A;  2JP3 A;  4H13 D;  3KZI H;  2Q3I A;  3TNU A;  2K1A A;  2B9B A;  1SQP G;  1VQ5 W;  1GW4 A;  3E1I A;  5CCG A;  1Z56 A;  2I1J A;  4NPD A;  4WVZ A;  3L74 J;  1FZF A;  4WY4 A;  4AQR D;  3SWY A;  1IFN A;  5AVY B;  4PD4 E;  3GF7 A;  1QVF V;  4CPK A;  1LTG C;  1VQ8 P;  3L72 D;  1N73 A;  3B5N D;  3AEE C;  5APW A;  1S9K D;  5DM7 W;  4BXL A;  4ZMD A;  1PV3 A;  4IL6 X;  3VOP A;  5DM6 W;  4OGQ D;  1OW8 A;  1ZLL A;  4N78 D;  4EI2 A;  3KHU A;  1SQP J;  1R5S A;  1IFD A;  3Q5S A;  3VMX A;  4R4M A;  1S72 P;  1QL2 A;  5B66 E;  5AVQ B;  1YJW W;  4WFN W;  2YNY A;  4WCE W;  3CMA W;  2FXM A;  3H1K J;  5K5G B;  3DLL W;  3MIW A;  2WSF J;  2OTL W;  1JO5 A;  1EDI A;  1FU1 A;  5BVZ A;  1NH4 A;  2RKL A;  1PPJ G;  2FYZ A;  2ZYG A;  3WMM 0;  3CD6 P;  1NTZ J;  3C9I A;  2UWJ E;  2ZT9 B;  4TT3 H;  1NU1 E;  2R3S A;  2LXC B;  1W2B V;  4D6T J;  1JNM A;  4U7J A;  1N73 B;  5GTH H;  3H6P A;  3CXH I;  1GK4 A;  5KLV K;  1KYO H;  1YQ3 C;  2CPS A;  3E7K A;  1R5L A;  3MUD C;  1LTJ B;  1YJN W;  4W80 A;  4H0L C;  2QSI A;  3BCC J;  1ZV8 A;  2Q6Q A;  2O01 J;  2IZ0 A;  1VF5 B;  3GHG C;  1HVV A;  2Q7C A;  2N9Y B;  1SVF A;  4YPC A;  3HE5 A;  2WPQ A;  1JEK A;  1FOS F;  1TU3 F;  4H44 D;  3B4S A;  3MZW B;  5CCH A;  1NHL A;  1GD2 E;  2YXR B;  3FWN A;  2JWA A;  2W90 A;  1VQQ A;  2WZ7 A;  1VQ4 W;  1SQQ D;  4EDF A;  1N7S B;  3L72 E;  2W6J H;  1JY2 N;  4D6T D;  2KIK A;  2WSE H;  5KLV G;  5AVX B;  3CCV P;  1EDK A;  3R2P A;  1Q2N A;  1WMK A;  1SQX D;  3TK1 A;  1YIJ W;  1BDD A;  2P1J A;  3AE8 C;  4IFD K;  1DEE G;  4OGQ C;  5CCH D;  2H89 C;  2RMZ A;  3AE9 C;  4KT0 J;  1KD1 Q;  3H1L J;  2M3E A;  1NTZ E;  3V6I A;  2KNC A;  1VQO P;  3M9Q A;  2O01 H;  2H43 A;  3TGU J;  1K04 A;  2OTK E;  2WSS H;  3N4X A;  1T2K C;  2QIW A;  1NJI X;  3CD6 W;  4O9B A;  2WWW A;  2N9B A;  2KUB A;  4GKG A;  3CC4 W;  3H32 B;  3CCV W;  4ASV A;  2PRR A;  1YIJ P;  4PV1 D;  3K5B A;  1KD1 X;  1URQ A;  1BDC A;  3CX5 E;  1NTK G;  1XTG B;  3EQ2 A;  2W83 C;  2H7H A;  2A06 G;  3AE1 C;  5AVR B;  1SQX J;  3AE5 C;  3CCL W;  1U7J A;  1IFP A;  3IAO A;  1RQU A;  1NTK D;  2BAS A;  3CCM P;  1CW5 A;  1QVF O;  1KV4 A;  1QEX A;  1MBX C;  1IO4 A;  2YXQ B;  2QJK B;  1Y8A A;  1NGM B;  1YI2 P;  5GAG a;  1VQM W;  2AXC A;  4IL6 H;  3W7U A;  4IOC W;  1FZC A;  3O1F A;  1P84 E;  3FX0 A;  5E79 H;  4YXD C;  1N2D C;  2A45 I;  4UB6 E;  2FYU E;  5M1A A;  3L4F A;  1P84 H;  1NWQ A;  2O01 N;  1M8O B;  4K35 A;  2FY8 A;  3ZFZ A;  5C39 A;  3CC2 P;  1SQX E;  1FZE A;  3USS A;  2FYU J;  3G71 P;  2IPP A;  2QJP B;  2Q9I A;  2KK7 A;  1RQS A;  1S9K E;  3E1R A;  3H1I J;  2Y9Z A;  1Q90 D;  1QVG O;  3VMA A;  3GW6 A;  2LR2 A;  1EXJ A;  4AYC A;  4MN4 C;  3M9B A;  3PRJ A;  1LT9 B;  2ZXX A;  1L0L D;  3IN6 A;  3A0B H;  1MBV B;  3D6Y A;  1BE3 J;  2AEF A;  5KAF H;  1S5L H;  4PD4 H;  1GW3 A;  1KN7 A;  3PLN A;  1KQL A;  3RK3 E;  2OTJ W;  3OJA B;  5AVT B;  4OGQ B;  1IK9 A;  3JSV C;  1NTM E;  5KJ7 A;  1S5L E;  3HD7 A;  2FFD B;  2N1T B;  1VQM P;  1AFO A;  2OGU A;  3P8C E;  1YJ9 P;  1BCC G;  5B5E E;  1PP9 E;  5APT A;  2XDJ A;  4KHX A;  4U67 W;  3Q5R A;  1DX7 A;  1SQB D;  4RKU J;  1BE3 G;  5B66 H;  3CCU W;  2FYN B;  5KLV J;  1L0N D;  1MZ9 A;  4C7N B;  1EQ7 A;  2QEX W;  3H1K E;  1DIP A;  5KAI H;  4L74 A;  5AW5 B;  2JJL A;  3A2A A;  5AW7 B;  5APY A;  3RL0 D;  2KXP B;  3ITK A;  5AW3 B;  3O6Q A;  2RH0 A;  1BE3 E;  1KIL A;  3Q3D A;  1SFC A;  1JY2 O;  3SFD C;  3L72 J;  2KS1 B;  3EWK A;  4UB6 H;  4PD4 I;  3IFM A;  3M0D A;  1L0L K;  2G3A A;  1K05 A;  2L91 A;  3G6E W;  2D2C B;  4W7Z A;  1PGO A;  2CK3 H;  3W67 A;  2OAR A;  1UIX A;  2PGD A;  3PTZ A;  1Q82 X;  4U3F D;  1KIL C;  1N86 A;  2K88 A;  1EXI A;  2ZVN B;  1LWU B;  1E79 H;  3RL0 g;  1AJY A;  1JCD A;  3G4S W;  1HJB A;  3A3Y B;  3FGA D;  2ZYA A;  3G1B A;  1NOH A;  5KLI C;  2E5Y A;  5GAE a;  2IFM A;  3TDK A;  2E75 B;  3NTN A;  2KLV A;  1NKZ B;  3O8Z A;  1OVU A;  2A45 H;  1JY3 O;  3B5N A;  2XU6 A;  3OW2 V;  4HKZ H;  3Q5P A;  2H8P D;  5APQ A;  1H89 A;  1YI2 W;  1LTS C;  1RQV A;  3VP9 A;  1RF0 A;  1M57 D;  3T97 B;  4LGD E;  4YJX A;  1ZRT E;  3ZG5 A;  1RF1 C;  1SQQ G;  1QL1 A;  1M7L A;  3KPE A;  1NTK E;  1L0N E;  4PJ0 E;  2O1K A;  1NU1 D;  3M0D C;  2FYU G;  1SS1 A;  3HTK A;  3BVH A;  3Q2Y A;  3H1J G;  2KLU A;  4JPZ B;  3HRN A;  3CCQ W;  1BSN A;  2HLO A;  3VN0 A;  1P84 D;  1R8E A;  3V2P A;  3CPW O;  1FOS E;  3PIO W;  1GL2 A;  1FZA A;  1NTM K;  3BCC E;  1P84 I;  2GA1 A;  1X8Y A;  2KB7 P;  2IBZ I;  2M0B A;  1FAV A;  2Q5U A;  2R44 A;  1VQO W;  4AUW A;  1JCC A;  1T8Z A;  1LTT C;  1Y47 A;  1KQS O;  4N6J A;  2HPC B;  1NU1 J;  3CC4 P;  2OTJ P;  4IFF A;  2WSF H;  1KB9 D;  1MKM A;  1PP9 J;  4H0L D;  1RE3 C;  1YQ4 C;  5CA3 A;  3L70 E;  3HTK B;  5EFW B;  2AEJ A;  3P8M C;  2FYU K;  1EZV I;  2D2C D;  2HOD B;  3CX5 I;  1J1E B;  1NTZ D;  2KZJ A;  3H1L E;  4RO0 A;  4L76 A;  2VRS A;  5AVV B;  3L71 J;  3HE4 B;  3M91 A;  3W68 A;  1NU1 K;  3CCJ P;  1RE3 A;  2PFX A;  4GT1 A;  3L73 D;  3VMY A;  2WSC J;  2B89 A;  2KI7 B;  3C8V A;  2J58 A;  4JQ0 D;  5APX A;  4IFM A;  4D6T G;  3B5N B;  1VQ7 P;  3SWK A;  5KLI B;  3L72 G;  1M1J B;  1DD4 A;  1PP9 D;  3A0B E;  2YKO A;  4WBA A;  1HUC A;  1NAY A;  4BL3 A;  1L0N K;  3VTP C;  4N3Y B;  1NAF A;  2NPS B;  5GTI E;  2OYH B;  1VQN P;  2K37 A;  2E5T A;  4W7Y A;  3VYI A;  1LWU A;  3V4W A;  4DOJ A;  2W8Z A;  2XV5 A;  1ZR4 A;  4YKA A;  5M18 A;  1RF1 B;  2ITA A;  1IC2 A;  4GOF A;  3MGN A;  1KFM A;  3CI9 A;  2FYU D;  1EC5 A;  3CXC V;  1KFN A;  2O1J A;  3RK3 B;  3S1K A;  1FJP A;  5KAF E;  1XTC C;  2NRG A;  3NXS A;  1RY3 A;  1SQV E;  3RGU A;  1CSB A;  3CF5 W;  1VQ6 W;  1PPJ E;  2WIT A;  3CX5 H;  1G2C B;  4H44 C;  3KDP B;  5AVU B;  1JM0 A;  4JF7 A;  3D3I A;  1H0T A;  2YIU C;  3L71 E;  1BGY D;  5BU8 B;  2K3R A;  4C7N A;  1H8A A;  1NTK K;  2SPZ A;  3M0A A;  3MUD A;  1HGV A;  1EDJ A;  1R6Q C;  2OYO A;  3P32 A;  1KB9 H;  1L0L E;  1NTK J;  2WPV B;  1WT6 A;  1VQ5 P;  1Q7Y X;  2PAJ A;  3V2N A;  4WWI A;  2ZJS E;  1RE4 A;  3H1H G;  2C0X A;  2N1T A;  1KQS V;  2E43 A;  1T2K D;  1X79 B;  1HJ0 A;  2Z5H A;  2BEQ D;  3H1J J;  1N7L A;  1SQB J;  1M1K X;  1J1E C;  1JMM A;  4QMA A;  3B71 A;  5KLV D;  1AA0 A;  2IBZ E;  3TSI A;  3P7K A;  3H1I E;  3CWB G;  4PV1 C;  1OW6 A;  1RHZ B;  3PHL A;  4WF9 W;  3OW2 O;  1SFC C;  2QM8 A;  3BAS A;  1LT9 A;  1FE6 A;  1MWT A;  2P58 A;  1MV8 A;  4LLH A;  2OQQ A;  2KOG A;  2G8Y A;  4TLF A;  3PIP W;  1AV1 A;  4BRY B;  1OWA A;  1T6A A;  4WY4 D;  1GZL A;  5AW1 B;  5BU5 A;  1YJW P;  2ZXE B;  1OVV A;  1ZP0 C;  3H1K G;  5CMZ A;  1CTF A;  4EOT A;  3CME W;  1JMB A;  3L71 G;  1KC8 X;  2QEX P;  3PH0 A;  1BE3 D;  3G4S P;  3O2H A;  4U3F J;  1SQB G;  3O2O A;  2E76 D;  3AED C;  1DEB A;  2WT7 A;  4BWN A;  4I7Z B;  3F89 A;  1SQP K;  1BCC D;  3KXD A;  1GU5 A;  2YKP A;  1SQV G;  3CCJ W;  3HD7 C;  1K9M Q;  3O1F B;  5AW0 B;  5KJ7 C;  1BGY E;  3GHG B;  1EDL A;  2P10 A;  1H88 A;  3RL0 C;  3AEB C;  2Q3E A;  1VQ4 P;  1N7S D;  2HYN A;  3MP7 B;  1LZW A;  1FDM A;  1KQF B;  4XE5 B;  3M06 A;  1AVO A;  1MWU A;  5AW2 B;  1VQ9 W;  2WTY A;  1Q86 Q;  4N78 E;  5AVZ B;  1GMJ A;  1X0T A;  3CCE P;  1HH0 A;  3L74 G;  1OW7 A;  1IFM A;  1HBW A;  3FXD A;  4Z1M H;  1S5L X;  2JEE A;  4U3F G;  5H2F H;  2BCC E;  3U1A A;  1KIL D;  2IBZ D;  5DJU B;  2CPB A;  1VQP W;  1N8R X;  1SFC D;  2ZAE B;  1VQ9 P;  3W7T A;  1QGK B;  3CWB D;  2R5B A;  3HUS A;  2KSJ A;  1ZRT D;  4Y99 C;  2BCC G;  3CCS W;  1VQK P;  3I56 W;  4ZKP A;  4WY4 C;  2XZR A;  1SQX K;  4ZNC A;  2E42 A;  5M1B A;  1FZC C;  3OAK A;  1CI6 B;  2JKV A;  3UIA A;  2WA9 A;  2IX7 C;  1RH5 B;  2XKM A;  2N1T D;  3MTU E;  4PV1 B;  1GTW A;  3MD0 A;  4PJ0 H;  3WU2 E;  3GQ0 A;  2FBW C;  4DJG A;  2E75 D;  3BCC D;  3CCQ P;  1L4A C;  4I6M C;  2QJK C;  1Q86 X;  4GIF A;  4JBZ A;  1CI6 A;  1SQQ E;  5KJ7 D;  1Y9B A;  1S3J A;  3V2Q A;  1VPC A;  1PPJ D;  2V7Q J;  3CCM W;  1KOR A;  2QA4 P;  1LTJ A;  2FXP A;  3L35 A;  1URQ C;  3AE2 C;  4HB1 A;  3CCL P;  1RE4 C;  3L71 D;  3BCC G;  3HUS B;  4RJT A;  2JDI H;  1QVG V;  4NPF X;  1PGQ A;  1OVR A;  3I55 P;  3H1L D;  2XND H;  3N7N A;  2IYP A;  4YTP C;  3RK2 B;  1KC8 Q;  1VL2 A;  1OMI A;  3M9H A;  4LC1 A;  4XFJ A;  3RL0 B;  2R5D A;  1L0N G;  3SWF A;  3TYY A;  4H13 B;  2ZT9 D;  3L73 E;  2W9R A;  2J5U A;  5KLV E;  3H1I G;  1E5W A;  3R4Y A;  1T3U A;  5CCH C;  1N8R Q; 
#chains in the Genus database with same CATH homology
 4GDO A;  1KTM A;  3GQ1 A;  2YIU C;  3O2O A;  1WMK A;  3T97 B;  2WA9 A;  4YJX A;  3D6Z A;  1ZRT E;  3LW5 J;  2E76 D;  3G3P A;  3AED C;  3AE8 C;  4PV1 B;  1DIP A;  3Q5S A;  1KIL E;  1VF5 D;  4R4M A;  2YMK A;  2E74 D;  3G9R A;  4OGQ C;  3O2B A;  4I7Z B;  2H89 C;  3GQ0 A;  4R4L A;  2FBW C;  2WSC J;  3AE9 C;  1R6Q C;  3SFE C;  4KT0 J;  1U57 A;  3O1F B;  5L8R J;  1ZME C;  1KMI Z;  5KKZ C;  2E76 C;  1R6O C;  2E75 D;  3C8V A;  1VF5 C;  1HF9 A;  2E74 C;  2WPV B;  3Q1M A;  2K9Y A;  2QJK C;  4H0L B;  2P10 A;  3O6Q A;  1K04 A;  2WSF J;  3Q2Y A;  2H88 C;  3AE3 C;  3Q3D A;  3AEB C;  1DD4 A;  2QJY C;  3SFD C;  3EWK A;  2QIW A;  2E75 C;  1Y9B A;  1RQS A;  1LZW A;  3GLM A;  1KQF B;  2G3A A;  2V7Q J;  1K05 A;  2IDB A;  2JO1 A;  1Q90 D;  1R8E A;  1KOR A;  1HJ0 A;  1JB0 J;  1EXJ A;  2FXP A;  1PL5 A;  3AEC C;  4H44 B;  2BEQ D;  4H13 C;  4PV1 D;  3AE2 C;  1GMJ A;  2ZT9 B;  2D2C B;  4TT3 H;  1MBU C;  1DD3 A;  3IN6 A;  1KQG B;  1OW7 A;  3B71 A;  3D6Y A;  1MBV B;  1UIX A;  3D70 A;  4U7J A;  2FYN C;  2JP3 A;  4H13 D;  4PV1 C;  3AE1 C;  3S9O A;  1OW6 A;  1EXI A;  3AE5 C;  4Z1M H;  3RK3 E;  1S5L X;  4I7Z C;  1YQ3 C;  3H25 A;  4YKA A;  3GF3 A;  2BEZ F;  2WQY C;  3RL0 g;  3D71 A;  1IK7 A;  2E76 B;  1AJY A;  4OGQ B;  4YJM A;  2E74 B;  2OQQ A;  3IAO A;  3FGA D;  4H0L C;  3G1B A;  2G8Y A;  3GW1 A;  1RQU A;  2NZ2 A;  2QSI A;  4YTP C;  3GF7 A;  5KLI C;  3DNJ A;  2O01 J;  2WA8 A;  1VL2 A;  3AE7 C;  1NYH A;  1VF5 B;  1OMI A;  2E75 B;  1MBX C;  1MKM A;  1PIX A;  4XFJ A;  1NGM B;  4H0L D;  2MKV A;  2QJP C;  1S1C X;  3G19 A;  4Y28 J;  3ABV C;  3AEE C;  1FDO A;  1YQ4 C;  1ZOY C;  1TU3 F;  3AE6 C;  4H44 D;  3GMA A;  3AEA C;  1ZP0 C;  3AEG C;  4H13 B;  2ZT9 D;  3Q5P A;  2D2C D;  2W9R A;  3AE4 C;  1MG9 A;  3O1F A;  1PV3 A;  2J5U A;  4IL6 X;  1CTF A;  3Q5R A;  3AEF C;  4RKU J;  4YXD C;  2WSE J;  3R4Y A;  4H44 C;  1RQV A;  2ZT9 C;  2D2C C;  5M1B A;  4OGQ D;  3O2H A;  1OW8 A;  1FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...