1DD4A

Crystal structure of ribosomal protein l12 from thermotoga maritim
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd4A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd4A02
4YKAA 3O1FA 3O2OA 3O1FB 2W9RA 4YJMA 1DD4A 1RQVA 3DNJA 3O2BA 3GQ0A 1MBUC 1R6QC 1RQUA 3G1BA 3G3PA 1MBVB 3GQ1A 3GW1A 1DD3A 2WA8A 3G19A 1LZWA 1MG9A 1R6OC 4YJXA 1CTFA 3O2HA 1MBXC 1RQSA 2WA9A
chains in the Genus database with same CATH superfamily
1IFIA 1L0LJ 3CMEP 1VQPW 3VMYA 4AUWA 3AE8C 1VQ4W 1IZNB 2P67A 2LR2A 3HTKA 2HPCA 2SPZA 1K05A 4I2LC 4U3FJ 2Y9YA 1QVFO 3CCQW 3CCMW 3CX5I 1KN7A 3L74G 5GAEa 1M1KX 1SQVK 3FGAD 5KTBA 2W83C 5C39A 3L70J 3L72D 1T2KC 4UB8E 2P2UA 3HE5A 1MBVB 1YI2P 1NGMB 3FXEA 2OYHC 3NFQA 1AQTA 3L75J 4LLHA 2OYIC 1BCCG 1SP4A 3TNUA 1VQOW 3CCLP 1KB9H 4U3FD 1VQ8P 2N1TD 4OVNF 2AXCA 1SQQE 1CW5A 3M0DC 3RK3D 1BGYE 1MZ9A 2YXRB 2AXTH 2D2CC 1URQA 3ZG5A 2E75C 5AVXB 3CCJW 3I56W 1Q82X 1H88A 3MGNA 1KC8X 4W7YA 2QG4A 2E74C 3MHVA 3CWBG 1FZCB 2MKVA 1GL2D 2JP3A 3S4RA 1R8EA 1JO5A 3HE4A 3L74J 5B66E 3H6PA 2O01H 2A45G 3D6ZA 3W7XA 1SQVG 1GDTA 1MWUA 5AW0B 4ZKUA 1AVOA 2KSEA 1JY2N 3TGUE 2IBZD 4N78D 2QVAA 1IC2A 4L75A 4RO0A 3W7TA 2M5AB 4NPDA 1JOCA 3MP7B 2Y0CA 3FWNA 2WSSH 1BCCJ 4JBZA 1WMKA 1J1DB 2Y9ZA 1JY2O 3L73G 2HYNA 1FJKA 3KYQA 2GUVA 2K1AA 3P8MC 2N1TC 4HH2A 1PP9G 1L0NK 5TISE 1GMJA 3RK3C 4D6TG 1OW8A 2KLUA 1LTJC 1M7LA 2OTLP 1UIXA 1NWQA 3BRTB 5CCHD 1GW4A 2ZXXA 3CWBJ 1ZMEC 5K5GB 1YJ9P 1G2CB 5CJ0A 3AE3C 5KLVK 2GM4A 1Q2NA 1GL2C 1BDCA 1SQVJ 1NTKK 3H1HE 4MN4C 3CCSW 2YKOA 3CC4P 3B5ND 4XFJA 1OMIA 1JY3P 3HUSA 1X0TA 1OZHA 3A5TA 1OFCX 1EZVE 1JY3N 5DM7W 1P84D 3NTNA 4BL2A 3H1KD 2O1KA 3W7WA 3L73J 5AW1B 2ZVNB 4IL6H 3CCEW 1OXZA 1HH0A 2XNDH 2FXMA 2H89C 1HBWA 3AE5C 5HL7W 1PP9J 2MJZA 1SQXD 3GHGB 1JY3O 1NAYA 3M0AA 3W7SA 3V2NA 4D6TJ 3RGUA 4IOIH 1NU1K 1KQFB 3G19A 5GTHH 4PV1C 2OARA 5EFWB 3JC22 5DJTB 1LT9A 5CCHC 1L2PA 1U57A 3AECC 3MD0A 3L71E 1FZCA 4TLFA 2Z5IA 1RE4C 5KLVG 1N7SA 1IJDB 1NTMK 3BCCE 3IAOA 3G6EP 3V4WA 1NTKG 4UB6E 1FC2C 3CX5D 4LGDE 1FZAA 2WMMA 1HVVA 1QGKB 2FXOA 1SFCA 2YO2A 1NH4A 2J5UA 4Y28J 1YHQW 3B5NC 2WQYC 3B71A 3TSIA 3AEBC 3M9HA 3GHGC 2O01N 2L5GB 3A0HH 1N7LA 2FY8A 1AVYA 1L4AC 2NPSB 2QJYC 3KPEA 1H8AA 1SQQD 2KUBA 4WB4A 2ZJQW 1KMIZ 1BGYD 4GDOA 3V5BA 4ZMDA 5BU8B 4L76A 4JYBA 3H1JE 2C0WA 2IYPA 1MBXC 1NU1G 4YTPC 2FFDA 1SLQA 1N8RQ 1LWUB 2K9YA 2L91A 2KIKA 3CC7P 2ZFCA 2E76D 1KILA 3CCUP 5AW7B 4C7RA 1FJPA 4NPFX 4DCKA 1NTZG 3ZDMA 3CLQA 3VMAA 1VQLW 4B86A 2HODA 2W9RA 2V4HA 3MZWB 2AEFA 1M90X 3TGUD 4AQRD 4JF7A 3RK2D 1NTKJ 1RF1B 3W67A 3HD7A 3HTKB 1RF0A 1L0LK 4BWNA 2E76B 3D6YA 2R32A 2JDIH 2FYZA 4WFNW 3G3ZA 2FYUG 3CXHE 1KFNA 3R2PA 2PGDA 4DT0A 3CPWV 3AEFC 2A06G 4HYTB 3RK2B 3ZFZA 3Q5SA 4PD4E 1S3JA 5CJ4A 3A0BH 5APWA 1IFNA 3PP5A 2Q7CA 1M1JA 1X79B 1JCDA 3TNUB 2WT7A 3DNJA 5APYA 4PJ0H 1NU1J 1VQPP 1JNMA 1VQ4P 3G71W 3CCRW 1PV3A 5KLIC 2OYOA 2ZYAA 4C46A 4YJXA 1MWRA 1KYOH 2XDJA 5AVQB 3O2HA 4IOCW 1LGHB 1EDJA 1URQB 3CCMP 5JVGW 1SQPE 2Q6QA 2CPBA 5CMZA 1NTZJ 1EXIA 4RESB 1S1CX 1ZP0C 1N2DC 3L72G 5KAIE 4A7PA 1AFOA 1OVVA 3H1HD 2P7JA 1BSHA 5GTIE 3N7NA 3WU2E 1OIPA 3M91A 2KXPB 3HE4B 2FYUJ 1EZVD 1Y9BA 1VQOP 1M57D 3LIEA 3C9IA 2FYNB 1NJIQ 3QH9A 5B5EE 5DJUB 2IZ0A 1PL5A 2B88A 5H2FH 1OW6A 3H1LE 1YJWW 1GW3A 1W2EA 3AEAC 2CPSA 2JKVA 3AEDC 2KNCA 1PFIA 3CCJP 3I56P 2XNXA 4KT0J 2A45H 1KORA 2P10A 1RE3A 2RMZA 4I7ZC 1S5LH 2Z4EA 3P8CE 2H8PD 1X9VA 1K8AX 3L71D 3SFEC 3GW1A 2Q3IA 3ABVC 1HF9A 3L72J 3BCCD 1IFDA 1IK9A 1FZGA 2WVRA 3M06A 1QL2A 5AW5B 4HJGH 3CI9A 3LW5J 1RF1A 2OGUA 1HWTC 3G3PA 2HG5D 5CCGD 1S5LE 3Q1MA 2V7QJ 4EYYQ 4WY4A 4DZOA 3V6IA 4GIFA 4UY8Z 3GF7A 4NPEA 1LTSC 2WITA 3ZG0A 2KK7A 4IFFA 3HUSB 4OWFA 3OA7A 3H1JD 5BU5A 1K9MQ 3SWFA 1VF5C 4N3YB 1N73C 1K73Q 2JWDA 1G1IA 1BE3E 1PGOA 2QJPC 2VRSA 1VQ9W 1RHZB 1PPJE 2KZIA 3DLLW 2RH0A 5AVVB 2WSFJ 3FX0A 1LP1A 3CCSP 1MBUC 3IF4A 1LT9B 3Q2YA 4CJNA 1FDOA 4CPKA 2YMKA 3IR9A 4GKGA 4EIJA 1Q81X 1KB9E 3H1KG 1N7SB 3AEGC 5CCGC 3CCEP 1YITP 2QM8A 2BEQD 1VL2A 5AVSB 2AXTE 1XTCC 4H0LB 3CC2W 1SQXG 2QSIA 3MUDC 1KQSO 1SFCB 4PD4D 1GTWA 3V4QA 3VMZA 2WSEJ 4M3LA 1VQ6W 2QIWA 1VQ5W 2C9LY 1ZW0A 1D7MA 3FWLA 2IFNA 2LXBA 5KJ7A 3CPWO 1L0NE 3BRVB 2XU6A 1S72W 1OVRA 1SQPD 3NMDA 4K35A 1W5CE 2C0XA 2QEXW 1KZUB 1H89A 1IK7A 1EDIA 1ZOYC 2G8YA 3AE7C 1FZCC 2FFDB 1HTLC 2FBWC 3H32A 1AQ5A 2R3SA 3TDKA 1DX7A 4H13B 2QJKB 1KILB 3CD6W 4JPZB 2WPQA 3PHLA 3EQ2A 1YHQP 5AVYB 1CI6B 2KP8A 3WMM0 3CF5W 2XKMA 1VQMW 3H1KJ 2OYHA 2IPPA 2HODB 2YIUB 1KQLA 2B89A 1OWAA 5AW6B 3A2AA 1W2BV 2W8ZA 1SQQG 3A3YB 3HD7B 2H88C 5APQA 3O8ZA 3H1LD 1BGYG 1SQXJ 4BL3A 3GLMA 1EZVI 1J1DC 1VQ8W 3ITKA 1WRGA 5AW4B 4DOJA 2BCCE 3M0DA 4YJMA 4N6JA 5M18A 3E7KA 5CBOA 2IFMA 1PGPA 3H1IE 3KXDA 4QMAA 1YIJW 3P8CD 1ZRTE 3H25A 1WT6A 2OTJW 4L74A 4BRYA 2IDBA 1M1JB 1DD4A 1VQLP 1FU1A 3HRNA 2WT7B 4LC1A 2PP6A 1U7MA 1VQ7W 2E5TA 3TGUG 3OW2O 1Q86Q 3J7ZZ 1SS1A 1MG9A 2ZYGA 3CCVW 1QVGO 1RF0C 2G3AA 3D71A 5AW8B 1U7JA 2QRXA 2ZVOB 4IL6E 3O6QA 1NTZK 4OGQD 1YBKA 3BATA 1SQQJ 2BASA 1BGYJ 4DKIA 2NPSD 3TYYA 2RN0A 1PGJA 3T97A 1AA0A 1DEEG 1MFTA 2K9JA 2UWJE 4W7ZA 4H44B 2OQQA 1VQKW 2N1TA 5GTHE 4GODA 5AVUB 1GK4A 1Q7YQ 1G1JA 2FYUK 2YKPA 3G71P 2CK3H 1LTJA 3CCRP 5TJHA 4OGQB 5CBNA 1BE3D 3RL0B 3P7KA 1X22A 2HFED 3GQ0A 4IO9W 3U1CA 3LW5H 1LTAC 3MTUE 2KNCB 4C7NA 1KD1Q 1QLED 2V7QH 4XE5B 3Q5PA 3TGUJ 1SQBE 3H1HG 1MUUA 1CZQA 1BXYA 1T3UA 2ZT9D 1GL2A 1RY3A 3G9RA 2AEMA 1EZVG 2M3EA 2J58A 1KB9D 3A0HE 3WUTA 2M3BA 4EOTA 1L0LE 3VP8A 1KV4A 1CI6A 1TU3F 3IN6A 3USSA 1YJWP 2ZT9B 1JB0J 2AEJA 4U3FE 3CXHI 4GT1A 3PJSK 1USEA 2NPSC 3W68A 4WY4B 1NKNA 3L70E 2WSFH 2Z5HA 3SWYA 1L0ND 5M19A 2NZ2A 4PD4I 5KKZB 4IOAW 1X8YA 4DJGA 3L75E 3L71G 5CA3A 1LWUC 2P58A 2YNYA 1FDMA 5CCHA 2R44A 1URQD 3BCCG 3H1HJ 3AE2C 1S4XA 4GOFA 3CMAW 1K04A 1RE4A 2ZYDA 3E1RA 5APSA 2R5DA 2O3JA 5E79H 1KILE 1FDIA 2IBZE 1RF1C 2WSEH 3FXDA 3V2QA 2POHA 4R4LA 4ZKPA 4Y99B 1MV8A 3CCQP 2E76C 3GF3A 3B5NA 4EI2A 1RQVA 1LP1B 4U67W 1T3JA 4I1LA 3I5CA 4IFDK 4WFBW 3A0BE 1L4AA 1H0TA 2BCCD 2O1JA 3H1JG 3L74E 4PJ0E 3RK2C 3D3IA 1N8RX 2LKMA 2P1JA 1MWSA 2ZJRW 5GW7A 1R5LA 1M1KQ 5KJ7D 3H1ID 3JCUH 3G1BA 3VP9A 3L4FA 1KYOE 1J1EB 1W2BO 3VN0A 1ZRTD 1SQPK 1VQ9P 3VOPA 3L71J 1LTIC 1BCCE 3GMAA 1P84H 3SWKA 4ASWA 3BCCJ 2QA4W 1URQC 4KHXA 5KAFH 5APTA 1QEXA 3EFGA 3E1IA 2B9BA 2HR3A 3I55W 1DEBA 2C9NY 2ZJSE 3V2RA 2JWAA 3PRJA 3M9BA 1HGVA 3OAKA 2N9BA 1Q82Q 4HKZH 3H32B 1KC8Q 2FKWB 4I6MC 5H2FE 3Q5RA 3GQ1A 1DIPA 1P84E 3CWBE 4CPGA 1ZN5A 3IFMA 3MIWA 2FYNC 2R3CA 2YMYA 1VQ6P 3H1JJ 3EWKA 2ZAEB 1IFMA 2OYHB 1VQ5P 1SQVE 2ZJPW 1VPCA 1J2JB 2OYIB 3UIAA 3RL0g 1MWTA 3G4SW 3KZIH 4UB8H 1S5LX 2QE7H 3B4SA 3CX5H 3N4XA 2YXQB 3R4YA 3K5BA 1FZEA 1Y47A 1S72P 1YJNW 1SQPG 3PTZA 2QEXP 1SQXK 2WWWA 2D2CB 1HGZA 2E75B 3L73E 1SQBD 1NOHA 4L73A 2HLOA 4WVZA 2JJLA 1Q90D 2YO3A 3SFDC 3CD6P 2KI7B 3JSVC 2E74B 2DW3A 1PP9E 4W80A 4BRYB 3KZIE 4D6TE 1VQMP 3CX5E 4IFMA 1NJIX 4XA4A 2I1KA 3TK1A 1L0LD 1MFZA 4AYCA 1N7SD 1RH5B 1NKZB 3OJAB 3QWOC 3H1LG 4YKAA 2IX7C 4Z1MH 3PLNA 2WSCJ 3S9OA 4H0LD 1KB9I 1GK6A 1FS0E 2K3RA 2W6AA 1SFCD 1GZLA 5B66H 3L37A 3WUVA 2NRGA 2W90A 3O6QB 1EDLA 3L70D 5AVTB 3B8EB 3HUSC 3CXHD 2JO1A 3Q3DA 4BXLA 4ASVA 1AJYA 1YIJP 1LJ2A 3AEEC 1SVFA 5BVZA 3RBXA 2OTJP 1XTGB 5APVA 3T97B 1SQQK 1SQPJ 2K9JB 3L75D 4JQ0D 4U7JA 2N1TB 1VQNW 2WZ7A 2J59M 2LXCB 1VQ7P 3RK3B 3TF5A 1LTJB 1VDFA 3KDPB 2KS1A 3CCVP 1JY2P 2K88A 1FAVA 4H13D 1RQUA 4WCEW 1AV1A 1KILD 4C7NB 5TISH 1JCCA 3GW6A 1YTZT 2BEZF 1LT9C 3CMEW 1T8ZA 3O1FB 1GL2B 3H1LJ 3HD7D 3KHUA 1N7SC 1HJ0A 3BASA 1VQKP 3L74D 1K9MX 3L35A 5KLVE 4H0LC 1K73X 1RQSA 1R5SA 3GG2A 1NTKE 1SFCC 4PV1D 1BE3G 1JEKA 1YQ3C 1KYOD 1YI2W 2PRRA 2OYIA 1OW7A 1N73A 2KYVA 1S9KE 1PPJG 1BCCD 5DM6W 3CCLW 1IFJA 2GA1A 3LIDA 1CSBA 3V2PA 4PV1B 3C8VA 2M8RA 1VQQA 2FFDC 1JJ2V 1NHLA 4RJTA 1M8OB 1GU5A 4H13C 2QJKC 1GU4A 2YKQA 1NU1E 1KILC 2FXPA 2KZJA 1JMMA 3RBZA 1JTHB 5AVRB 1S2EA 1OX3A 1EDKA 1GD2E 1L4AD 3CWBD 3PIPW 1Z56A 5AW3B 1A02F 1QX8A 2E42A 5CCGA 2W27A 2GUSA 2YIUC 1NTZE 1YITW 1CTFA 3F5HA 3HD7C 2B87B 3MUDA 4WFAW 4YXDC 4H44D 1SQVD 1NTME 3B5NB 2PAJA 2Q9IA 1YQ4C 1M90Q 4UB6H 3AE4C 1BE3J 1L0NG 5M1AA 4IL6X 1L4AB 1N86A 3L36A 1H0TB 2QJYB 3RL0D 2H43A 2QM7A 2Y0DA 2FYUE 4KJMA 2IZ1A 1NO4A 3L73D 2A06E 4O9BA 1LTGC 5APUA 1PGQA 3CMAP 1ZR4A 3A7OA 2KOGA 1M1JC 1QVFV 1T6AA 1PP9D 1FE6A 4K3AA 2WA9A 5L8RJ 4D6TD 1HUCA 2OTLW 2XV5A 1E5WA 2I1JA 1ZLLA 1PPJD 3SSUA 1OVUA 3II6A 1BDDA 2M5AA 3AE6C 1YJ9W 3O1FA 2H7HA 2BCCG 3AE9C 2K37A 3M9QA 1KFMA 4WBAA 2ZXEB 4RKUJ 3D70A 2Q5UA 1ZV8A 2KB7P 3L72E 3H1IG 4HB1A 1FZBA 4WY4D 1DD3A 1L0NJ 1FOSF 3CC4W 4H44C 4YXWH 1DH3A 1KQGB 2JR8A 1IFPA 2O01J 2RKLA 1ZXGA 5GADa 4OH8B 3CXHH 2PFXA 1Q86X 4OGQC 3RL0C 1SQBK 1UIIA 2QA4P 1FBMA 2WTYA 3RK3E 2M0BA 1JMBA 3I55P 5KLVJ 1NTMG 5M1BA 5KLIB 2Y0EA 4PD4H 5AW2B 2WSCH 3PH0A 1ZR2A 3F89A 1G2CA 3PIOW 1RE3C 4ZNCA 1MKMA 2HPCB 1NAFA 1KQSV 2E43A 2KLVA 2R5BA 1LZWA 4YPCA 1LTTC 1E79H 2KSJA 2IBZI 3O2BA 1JTHA 4JYCA 5GAHa 3S1KA 3W7UA 2BCCJ 1FZFA 1QL1A 2WPSA 3C1LA 1K8AQ 1Q7YX 3HE5B 5KLVD 2WA8A 1FOSE 1PIXA 2ZT9C 3H1IJ 5KAIH 3G6EW 4N78E 3G4SP 1NTKD 1USDA 1BSNA 2OTKE 2B87A 1NVOA 1HJBA 1YYCA 3O2OA 2I8DA 4WY4C 5CHXA 1YJNP 4TT3H 3KQGA 5GTIH 1S9KD 3GHGA 3VYIA 1NYHA 3WU2H 1KD1X 1LNQA 3VTPC 1EC5A 1SQBG 3VMXA 2XZRA 1KYOI 5B5EH 5KKZC 4GOEA 5E79E 3P32A 1M56D 1NTMJ 4I7ZB 4WF9W 2Q3EA 1R6OC 3EFFK 1L0LG 1NU1D 3NXSA 5AVZB 5AW9B 3CC7W 2Q1KA 2KS1B 3CCUW 3WUUA 2W6JH 4U3FG 4Y99C 4EDFA 1IO4A 1EXJA 1NTZD 1T2KD 4R4MA 5GAGa 4WWIA 2JEEA 2ITAA 3CXCV 1EQ7A 3L70G 3JCUE 1NTMD 1YTZI 1PZQA 1P84I 2NPSA 2IYOA 1VF5D 5JVHW 1R6QC 2WPRA 3OW2V 3L75G 3CL3D 2E5YA 2A45I 2FYUD 1A02J 5APXA 1LT1A 3CC2P 1VQNP 1QVGV 3H1KE 1Q81Q 1J1EC 3AE1C 1LWUA 1SQBJ 5KAFE 2A06D 1JUNA 2D2CD 2E75D 2WPVB 5AVWB 3U59A 2N9YB 3BVHA 1VF5B 1Y8AA 3U1AA 1SQXE 1N73B 1LTBC 1JM0A 2IBZG 2E74D 1KTMA 2W6BA 5KJ7C 2QJPB
chains in the Genus database with same CATH topology
3O1FB 4XFJA 4YXDC 4H44D 1OMIA 3AE8C 2O01J 3DNJA 2QJYC 1MBUC 2NZ2A 3Q2YA 3D6ZA 4H44B 2OQQA 3SFEC 1FDOA 1YQ4C 4OGQC 3AE4C 4I7ZB 1KMIZ 1HJ0A 1K05A 3GW1A 1PV3A 2YMKA 2H88C 3ABVC 4GDOA 4IL6X 5KLIC 1HF9A 1R6OC 4YJXA 3RK3E 3GLMA 4H0LC 3O2HA 1MBXC 1RQSA 4OGQB 3AEGC 4YKAA 4YTPC 4Z1MH 3FGAD 4YJMA 2H89C 3AE2C 2WSCJ 1EXIA 5M1BA 4PV1D 2K9YA 3S9OA 1K04A 1S1CX 4H0LD 1YQ3C 2BEQD 3AE5C 3LW5J 3GQ0A 1ZP0C 1VL2A 2E76D 1WMKA 1MKMA 3G3PA 1OW7A 4H0LB 1MBVB 3Q5RA 3Q1MA 1NGMB 2V7QJ 1DIPA 3GQ1A 1KILE 2QSIA 1EXJA 1FDIA 1KQFB 4R4MA 3Q5PA 1LZWA 3G19A 2WSEJ 1R8EA 2JO1A 1ZRTE 4PV1C 3H25A 3Q3DA 4R4LA 2FYNC 2QIWA 2ZT9D 2WA9A 3GF7A 5L8RJ 1AJYA 2E76C 3AEEC 3GF3A 2W9RA 3EWKA 2IDBA 1DD4A 1RQVA 3O2BA 1GMJA 1VF5D 1OW8A 1Y9BA 3T97B 1R6QC 3G9RA 4PV1B 1U57A 4U7JA 1UIXA 3C8VA 3AECC 3RL0g 2E76B 3D6YA 2WA8A 1PIXA 1S5LX 1PL5A 2ZT9C 1MG9A 3AE6C 3R4YA 2D2CC 1OW6A 2E75C 2QJKC 3IAOA 4H13C 1VF5C 2G3AA 3GMAA 3O1FA 3AE1C 3O2OA 3AE9C 3AEAC 1IK7A 1ZOYC 2FXPA 1TU3F 2G8YA 1ZMEC 3AE7C 3IN6A 3D71A 4RKUJ 2D2CD 2ZT9B 1JB0J 2FBWC 3AEDC 3D70A 2E75D 2WPVB 4H13D 4TT3H 1RQUA 3G1BA 3AEFC 1NYHA 2E74C 2QJPC 2D2CB 2E75B 4H13B 3AE3C 1VF5B 3O6QA 4KT0J 1DD3A 3Q5SA 1KORA 2J5UA 4Y28J 2YIUC 2P10A 4OGQD 2WQYC 2BEZF 3B71A 2E74D 1Q90D 3AEBC 4H44C 3SFDC 2MKVA 1KTMA 1CTFA 4I7ZC 2JP3A 2E74B 2WSFJ 5KKZC 1KQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKA A;  3O1F A;  3O2O A;  3O1F B;  2W9R A;  4YJM A;  1DD4 A;  1RQV A;  3DNJ A;  3O2B A;  3GQ0 A;  1MBU C;  1R6Q C;  1RQU A;  3G1B A;  3G3P A;  1MBV B;  3GQ1 A;  3GW1 A;  1DD3 A;  2WA8 A;  3G19 A;  1LZW A;  1MG9 A;  1R6O C;  4YJX A;  1CTF A;  3O2H A;  1MBX C;  1RQS A;  2WA9 A; 
#chains in the Genus database with same CATH topology
 1IFI A;  1L0L J;  3CME P;  1VQP W;  3VMY A;  4AUW A;  3AE8 C;  1VQ4 W;  1IZN B;  2P67 A;  2LR2 A;  3HTK A;  2HPC A;  2SPZ A;  1K05 A;  4I2L C;  4U3F J;  2Y9Y A;  1QVF O;  3CCQ W;  3CCM W;  3CX5 I;  1KN7 A;  3L74 G;  5GAE a;  1M1K X;  1SQV K;  3FGA D;  5KTB A;  2W83 C;  5C39 A;  3L70 J;  3L72 D;  1T2K C;  4UB8 E;  2P2U A;  3HE5 A;  1MBV B;  1YI2 P;  1NGM B;  3FXE A;  2OYH C;  3NFQ A;  1AQT A;  3L75 J;  4LLH A;  2OYI C;  1BCC G;  1SP4 A;  3TNU A;  1VQO W;  3CCL P;  1KB9 H;  4U3F D;  1VQ8 P;  2N1T D;  4OVN F;  2AXC A;  1SQQ E;  1CW5 A;  3M0D C;  3RK3 D;  1BGY E;  1MZ9 A;  2YXR B;  2AXT H;  2D2C C;  1URQ A;  3ZG5 A;  2E75 C;  5AVX B;  3CCJ W;  3I56 W;  1Q82 X;  1H88 A;  3MGN A;  1KC8 X;  4W7Y A;  2QG4 A;  2E74 C;  3MHV A;  3CWB G;  1FZC B;  2MKV A;  1GL2 D;  2JP3 A;  3S4R A;  1R8E A;  1JO5 A;  3HE4 A;  3L74 J;  5B66 E;  3H6P A;  2O01 H;  2A45 G;  3D6Z A;  3W7X A;  1SQV G;  1GDT A;  1MWU A;  5AW0 B;  4ZKU A;  1AVO A;  2KSE A;  1JY2 N;  3TGU E;  2IBZ D;  4N78 D;  2QVA A;  1IC2 A;  4L75 A;  4RO0 A;  3W7T A;  2M5A B;  4NPD A;  1JOC A;  3MP7 B;  2Y0C A;  3FWN A;  2WSS H;  1BCC J;  4JBZ A;  1WMK A;  1J1D B;  2Y9Z A;  1JY2 O;  3L73 G;  2HYN A;  1FJK A;  3KYQ A;  2GUV A;  2K1A A;  3P8M C;  2N1T C;  4HH2 A;  1PP9 G;  1L0N K;  5TIS E;  1GMJ A;  3RK3 C;  4D6T G;  1OW8 A;  2KLU A;  1LTJ C;  1M7L A;  2OTL P;  1UIX A;  1NWQ A;  3BRT B;  5CCH D;  1GW4 A;  2ZXX A;  3CWB J;  1ZME C;  5K5G B;  1YJ9 P;  1G2C B;  5CJ0 A;  3AE3 C;  5KLV K;  2GM4 A;  1Q2N A;  1GL2 C;  1BDC A;  1SQV J;  1NTK K;  3H1H E;  4MN4 C;  3CCS W;  2YKO A;  3CC4 P;  3B5N D;  4XFJ A;  1OMI A;  1JY3 P;  3HUS A;  1X0T A;  1OZH A;  3A5T A;  1OFC X;  1EZV E;  1JY3 N;  5DM7 W;  1P84 D;  3NTN A;  4BL2 A;  3H1K D;  2O1K A;  3W7W A;  3L73 J;  5AW1 B;  2ZVN B;  4IL6 H;  3CCE W;  1OXZ A;  1HH0 A;  2XND H;  2FXM A;  2H89 C;  1HBW A;  3AE5 C;  5HL7 W;  1PP9 J;  2MJZ A;  1SQX D;  3GHG B;  1JY3 O;  1NAY A;  3M0A A;  3W7S A;  3V2N A;  4D6T J;  3RGU A;  4IOI H;  1NU1 K;  1KQF B;  3G19 A;  5GTH H;  4PV1 C;  2OAR A;  5EFW B;  3JC2 2;  5DJT B;  1LT9 A;  5CCH C;  1L2P A;  1U57 A;  3AEC C;  3MD0 A;  3L71 E;  1FZC A;  4TLF A;  2Z5I A;  1RE4 C;  5KLV G;  1N7S A;  1IJD B;  1NTM K;  3BCC E;  3IAO A;  3G6E P;  3V4W A;  1NTK G;  4UB6 E;  1FC2 C;  3CX5 D;  4LGD E;  1FZA A;  2WMM A;  1HVV A;  1QGK B;  2FXO A;  1SFC A;  2YO2 A;  1NH4 A;  2J5U A;  4Y28 J;  1YHQ W;  3B5N C;  2WQY C;  3B71 A;  3TSI A;  3AEB C;  3M9H A;  3GHG C;  2O01 N;  2L5G B;  3A0H H;  1N7L A;  2FY8 A;  1AVY A;  1L4A C;  2NPS B;  2QJY C;  3KPE A;  1H8A A;  1SQQ D;  2KUB A;  4WB4 A;  2ZJQ W;  1KMI Z;  1BGY D;  4GDO A;  3V5B A;  4ZMD A;  5BU8 B;  4L76 A;  4JYB A;  3H1J E;  2C0W A;  2IYP A;  1MBX C;  1NU1 G;  4YTP C;  2FFD A;  1SLQ A;  1N8R Q;  1LWU B;  2K9Y A;  2L91 A;  2KIK A;  3CC7 P;  2ZFC A;  2E76 D;  1KIL A;  3CCU P;  5AW7 B;  4C7R A;  1FJP A;  4NPF X;  4DCK A;  1NTZ G;  3ZDM A;  3CLQ A;  3VMA A;  1VQL W;  4B86 A;  2HOD A;  2W9R A;  2V4H A;  3MZW B;  2AEF A;  1M90 X;  3TGU D;  4AQR D;  4JF7 A;  3RK2 D;  1NTK J;  1RF1 B;  3W67 A;  3HD7 A;  3HTK B;  1RF0 A;  1L0L K;  4BWN A;  2E76 B;  3D6Y A;  2R32 A;  2JDI H;  2FYZ A;  4WFN W;  3G3Z A;  2FYU G;  3CXH E;  1KFN A;  3R2P A;  2PGD A;  4DT0 A;  3CPW V;  3AEF C;  2A06 G;  4HYT B;  3RK2 B;  3ZFZ A;  3Q5S A;  4PD4 E;  1S3J A;  5CJ4 A;  3A0B H;  5APW A;  1IFN A;  3PP5 A;  2Q7C A;  1M1J A;  1X79 B;  1JCD A;  3TNU B;  2WT7 A;  3DNJ A;  5APY A;  4PJ0 H;  1NU1 J;  1VQP P;  1JNM A;  1VQ4 P;  3G71 W;  3CCR W;  1PV3 A;  5KLI C;  2OYO A;  2ZYA A;  4C46 A;  4YJX A;  1MWR A;  1KYO H;  2XDJ A;  5AVQ B;  3O2H A;  4IOC W;  1LGH B;  1EDJ A;  1URQ B;  3CCM P;  5JVG W;  1SQP E;  2Q6Q A;  2CPB A;  5CMZ A;  1NTZ J;  1EXI A;  4RES B;  1S1C X;  1ZP0 C;  1N2D C;  3L72 G;  5KAI E;  4A7P A;  1AFO A;  1OVV A;  3H1H D;  2P7J A;  1BSH A;  5GTI E;  3N7N A;  3WU2 E;  1OIP A;  3M91 A;  2KXP B;  3HE4 B;  2FYU J;  1EZV D;  1Y9B A;  1VQO P;  1M57 D;  3LIE A;  3C9I A;  2FYN B;  1NJI Q;  3QH9 A;  5B5E E;  5DJU B;  2IZ0 A;  1PL5 A;  2B88 A;  5H2F H;  1OW6 A;  3H1L E;  1YJW W;  1GW3 A;  1W2E A;  3AEA C;  2CPS A;  2JKV A;  3AED C;  2KNC A;  1PFI A;  3CCJ P;  3I56 P;  2XNX A;  4KT0 J;  2A45 H;  1KOR A;  2P10 A;  1RE3 A;  2RMZ A;  4I7Z C;  1S5L H;  2Z4E A;  3P8C E;  2H8P D;  1X9V A;  1K8A X;  3L71 D;  3SFE C;  3GW1 A;  2Q3I A;  3ABV C;  1HF9 A;  3L72 J;  3BCC D;  1IFD A;  1IK9 A;  1FZG A;  2WVR A;  3M06 A;  1QL2 A;  5AW5 B;  4HJG H;  3CI9 A;  3LW5 J;  1RF1 A;  2OGU A;  1HWT C;  3G3P A;  2HG5 D;  5CCG D;  1S5L E;  3Q1M A;  2V7Q J;  4EYY Q;  4WY4 A;  4DZO A;  3V6I A;  4GIF A;  4UY8 Z;  3GF7 A;  4NPE A;  1LTS C;  2WIT A;  3ZG0 A;  2KK7 A;  4IFF A;  3HUS B;  4OWF A;  3OA7 A;  3H1J D;  5BU5 A;  1K9M Q;  3SWF A;  1VF5 C;  4N3Y B;  1N73 C;  1K73 Q;  2JWD A;  1G1I A;  1BE3 E;  1PGO A;  2QJP C;  2VRS A;  1VQ9 W;  1RHZ B;  1PPJ E;  2KZI A;  3DLL W;  2RH0 A;  5AVV B;  2WSF J;  3FX0 A;  1LP1 A;  3CCS P;  1MBU C;  3IF4 A;  1LT9 B;  3Q2Y A;  4CJN A;  1FDO A;  4CPK A;  2YMK A;  3IR9 A;  4GKG A;  4EIJ A;  1Q81 X;  1KB9 E;  3H1K G;  1N7S B;  3AEG C;  5CCG C;  3CCE P;  1YIT P;  2QM8 A;  2BEQ D;  1VL2 A;  5AVS B;  2AXT E;  1XTC C;  4H0L B;  3CC2 W;  1SQX G;  2QSI A;  3MUD C;  1KQS O;  1SFC B;  4PD4 D;  1GTW A;  3V4Q A;  3VMZ A;  2WSE J;  4M3L A;  1VQ6 W;  2QIW A;  1VQ5 W;  2C9L Y;  1ZW0 A;  1D7M A;  3FWL A;  2IFN A;  2LXB A;  5KJ7 A;  3CPW O;  1L0N E;  3BRV B;  2XU6 A;  1S72 W;  1OVR A;  1SQP D;  3NMD A;  4K35 A;  1W5C E;  2C0X A;  2QEX W;  1KZU B;  1H89 A;  1IK7 A;  1EDI A;  1ZOY C;  2G8Y A;  3AE7 C;  1FZC C;  2FFD B;  1HTL C;  2FBW C;  3H32 A;  1AQ5 A;  2R3S A;  3TDK A;  1DX7 A;  4H13 B;  2QJK B;  1KIL B;  3CD6 W;  4JPZ B;  2WPQ A;  3PHL A;  3EQ2 A;  1YHQ P;  5AVY B;  1CI6 B;  2KP8 A;  3WMM 0;  3CF5 W;  2XKM A;  1VQM W;  3H1K J;  2OYH A;  2IPP A;  2HOD B;  2YIU B;  1KQL A;  2B89 A;  1OWA A;  5AW6 B;  3A2A A;  1W2B V;  2W8Z A;  1SQQ G;  3A3Y B;  3HD7 B;  2H88 C;  5APQ A;  3O8Z A;  3H1L D;  1BGY G;  1SQX J;  4BL3 A;  3GLM A;  1EZV I;  1J1D C;  1VQ8 W;  3ITK A;  1WRG A;  5AW4 B;  4DOJ A;  2BCC E;  3M0D A;  4YJM A;  4N6J A;  5M18 A;  3E7K A;  5CBO A;  2IFM A;  1PGP A;  3H1I E;  3KXD A;  4QMA A;  1YIJ W;  3P8C D;  1ZRT E;  3H25 A;  1WT6 A;  2OTJ W;  4L74 A;  4BRY A;  2IDB A;  1M1J B;  1DD4 A;  1VQL P;  1FU1 A;  3HRN A;  2WT7 B;  4LC1 A;  2PP6 A;  1U7M A;  1VQ7 W;  2E5T A;  3TGU G;  3OW2 O;  1Q86 Q;  3J7Z Z;  1SS1 A;  1MG9 A;  2ZYG A;  3CCV W;  1QVG O;  1RF0 C;  2G3A A;  3D71 A;  5AW8 B;  1U7J A;  2QRX A;  2ZVO B;  4IL6 E;  3O6Q A;  1NTZ K;  4OGQ D;  1YBK A;  3BAT A;  1SQQ J;  2BAS A;  1BGY J;  4DKI A;  2NPS D;  3TYY A;  2RN0 A;  1PGJ A;  3T97 A;  1AA0 A;  1DEE G;  1MFT A;  2K9J A;  2UWJ E;  4W7Z A;  4H44 B;  2OQQ A;  1VQK W;  2N1T A;  5GTH E;  4GOD A;  5AVU B;  1GK4 A;  1Q7Y Q;  1G1J A;  2FYU K;  2YKP A;  3G71 P;  2CK3 H;  1LTJ A;  3CCR P;  5TJH A;  4OGQ B;  5CBN A;  1BE3 D;  3RL0 B;  3P7K A;  1X22 A;  2HFE D;  3GQ0 A;  4IO9 W;  3U1C A;  3LW5 H;  1LTA C;  3MTU E;  2KNC B;  4C7N A;  1KD1 Q;  1QLE D;  2V7Q H;  4XE5 B;  3Q5P A;  3TGU J;  1SQB E;  3H1H G;  1MUU A;  1CZQ A;  1BXY A;  1T3U A;  2ZT9 D;  1GL2 A;  1RY3 A;  3G9R A;  2AEM A;  1EZV G;  2M3E A;  2J58 A;  1KB9 D;  3A0H E;  3WUT A;  2M3B A;  4EOT A;  1L0L E;  3VP8 A;  1KV4 A;  1CI6 A;  1TU3 F;  3IN6 A;  3USS A;  1YJW P;  2ZT9 B;  1JB0 J;  2AEJ A;  4U3F E;  3CXH I;  4GT1 A;  3PJS K;  1USE A;  2NPS C;  3W68 A;  4WY4 B;  1NKN A;  3L70 E;  2WSF H;  2Z5H A;  3SWY A;  1L0N D;  5M19 A;  2NZ2 A;  4PD4 I;  5KKZ B;  4IOA W;  1X8Y A;  4DJG A;  3L75 E;  3L71 G;  5CA3 A;  1LWU C;  2P58 A;  2YNY A;  1FDM A;  5CCH A;  2R44 A;  1URQ D;  3BCC G;  3H1H J;  3AE2 C;  1S4X A;  4GOF A;  3CMA W;  1K04 A;  1RE4 A;  2ZYD A;  3E1R A;  5APS A;  2R5D A;  2O3J A;  5E79 H;  1KIL E;  1FDI A;  2IBZ E;  1RF1 C;  2WSE H;  3FXD A;  3V2Q A;  2POH A;  4R4L A;  4ZKP A;  4Y99 B;  1MV8 A;  3CCQ P;  2E76 C;  3GF3 A;  3B5N A;  4EI2 A;  1RQV A;  1LP1 B;  4U67 W;  1T3J A;  4I1L A;  3I5C A;  4IFD K;  4WFB W;  3A0B E;  1L4A A;  1H0T A;  2BCC D;  2O1J A;  3H1J G;  3L74 E;  4PJ0 E;  3RK2 C;  3D3I A;  1N8R X;  2LKM A;  2P1J A;  1MWS A;  2ZJR W;  5GW7 A;  1R5L A;  1M1K Q;  5KJ7 D;  3H1I D;  3JCU H;  3G1B A;  3VP9 A;  3L4F A;  1KYO E;  1J1E B;  1W2B O;  3VN0 A;  1ZRT D;  1SQP K;  1VQ9 P;  3VOP A;  3L71 J;  1LTI C;  1BCC E;  3GMA A;  1P84 H;  3SWK A;  4ASW A;  3BCC J;  2QA4 W;  1URQ C;  4KHX A;  5KAF H;  5APT A;  1QEX A;  3EFG A;  3E1I A;  2B9B A;  2HR3 A;  3I55 W;  1DEB A;  2C9N Y;  2ZJS E;  3V2R A;  2JWA A;  3PRJ A;  3M9B A;  1HGV A;  3OAK A;  2N9B A;  1Q82 Q;  4HKZ H;  3H32 B;  1KC8 Q;  2FKW B;  4I6M C;  5H2F E;  3Q5R A;  3GQ1 A;  1DIP A;  1P84 E;  3CWB E;  4CPG A;  1ZN5 A;  3IFM A;  3MIW A;  2FYN C;  2R3C A;  2YMY A;  1VQ6 P;  3H1J J;  3EWK A;  2ZAE B;  1IFM A;  2OYH B;  1VQ5 P;  1SQV E;  2ZJP W;  1VPC A;  1J2J B;  2OYI B;  3UIA A;  3RL0 g;  1MWT A;  3G4S W;  3KZI H;  4UB8 H;  1S5L X;  2QE7 H;  3B4S A;  3CX5 H;  3N4X A;  2YXQ B;  3R4Y A;  3K5B A;  1FZE A;  1Y47 A;  1S72 P;  1YJN W;  1SQP G;  3PTZ A;  2QEX P;  1SQX K;  2WWW A;  2D2C B;  1HGZ A;  2E75 B;  3L73 E;  1SQB D;  1NOH A;  4L73 A;  2HLO A;  4WVZ A;  2JJL A;  1Q90 D;  2YO3 A;  3SFD C;  3CD6 P;  2KI7 B;  3JSV C;  2E74 B;  2DW3 A;  1PP9 E;  4W80 A;  4BRY B;  3KZI E;  4D6T E;  1VQM P;  3CX5 E;  4IFM A;  1NJI X;  4XA4 A;  2I1K A;  3TK1 A;  1L0L D;  1MFZ A;  4AYC A;  1N7S D;  1RH5 B;  1NKZ B;  3OJA B;  3QWO C;  3H1L G;  4YKA A;  2IX7 C;  4Z1M H;  3PLN A;  2WSC J;  3S9O A;  4H0L D;  1KB9 I;  1GK6 A;  1FS0 E;  2K3R A;  2W6A A;  1SFC D;  1GZL A;  5B66 H;  3L37 A;  3WUV A;  2NRG A;  2W90 A;  3O6Q B;  1EDL A;  3L70 D;  5AVT B;  3B8E B;  3HUS C;  3CXH D;  2JO1 A;  3Q3D A;  4BXL A;  4ASV A;  1AJY A;  1YIJ P;  1LJ2 A;  3AEE C;  1SVF A;  5BVZ A;  3RBX A;  2OTJ P;  1XTG B;  5APV A;  3T97 B;  1SQQ K;  1SQP J;  2K9J B;  3L75 D;  4JQ0 D;  4U7J A;  2N1T B;  1VQN W;  2WZ7 A;  2J59 M;  2LXC B;  1VQ7 P;  3RK3 B;  3TF5 A;  1LTJ B;  1VDF A;  3KDP B;  2KS1 A;  3CCV P;  1JY2 P;  2K88 A;  1FAV A;  4H13 D;  1RQU A;  4WCE W;  1AV1 A;  1KIL D;  4C7N B;  5TIS H;  1JCC A;  3GW6 A;  1YTZ T;  2BEZ F;  1LT9 C;  3CME W;  1T8Z A;  3O1F B;  1GL2 B;  3H1L J;  3HD7 D;  3KHU A;  1N7S C;  1HJ0 A;  3BAS A;  1VQK P;  3L74 D;  1K9M X;  3L35 A;  5KLV E;  4H0L C;  1K73 X;  1RQS A;  1R5S A;  3GG2 A;  1NTK E;  1SFC C;  4PV1 D;  1BE3 G;  1JEK A;  1YQ3 C;  1KYO D;  1YI2 W;  2PRR A;  2OYI A;  1OW7 A;  1N73 A;  2KYV A;  1S9K E;  1PPJ G;  1BCC D;  5DM6 W;  3CCL W;  1IFJ A;  2GA1 A;  3LID A;  1CSB A;  3V2P A;  4PV1 B;  3C8V A;  2M8R A;  1VQQ A;  2FFD C;  1JJ2 V;  1NHL A;  4RJT A;  1M8O B;  1GU5 A;  4H13 C;  2QJK C;  1GU4 A;  2YKQ A;  1NU1 E;  1KIL C;  2FXP A;  2KZJ A;  1JMM A;  3RBZ A;  1JTH B;  5AVR B;  1S2E A;  1OX3 A;  1EDK A;  1GD2 E;  1L4A D;  3CWB D;  3PIP W;  1Z56 A;  5AW3 B;  1A02 F;  1QX8 A;  2E42 A;  5CCG A;  2W27 A;  2GUS A;  2YIU C;  1NTZ E;  1YIT W;  1CTF A;  3F5H A;  3HD7 C;  2B87 B;  3MUD A;  4WFA W;  4YXD C;  4H44 D;  1SQV D;  1NTM E;  3B5N B;  2PAJ A;  2Q9I A;  1YQ4 C;  1M90 Q;  4UB6 H;  3AE4 C;  1BE3 J;  1L0N G;  5M1A A;  4IL6 X;  1L4A B;  1N86 A;  3L36 A;  1H0T B;  2QJY B;  3RL0 D;  2H43 A;  2QM7 A;  2Y0D A;  2FYU E;  4KJM A;  2IZ1 A;  1NO4 A;  3L73 D;  2A06 E;  4O9B A;  1LTG C;  5APU A;  1PGQ A;  3CMA P;  1ZR4 A;  3A7O A;  2KOG A;  1M1J C;  1QVF V;  1T6A A;  1PP9 D;  1FE6 A;  4K3A A;  2WA9 A;  5L8R J;  4D6T D;  1HUC A;  2OTL W;  2XV5 A;  1E5W A;  2I1J A;  1ZLL A;  1PPJ D;  3SSU A;  1OVU A;  3II6 A;  1BDD A;  2M5A A;  3AE6 C;  1YJ9 W;  3O1F A;  2H7H A;  2BCC G;  3AE9 C;  2K37 A;  3M9Q A;  1KFM A;  4WBA A;  2ZXE B;  4RKU J;  3D70 A;  2Q5U A;  1ZV8 A;  2KB7 P;  3L72 E;  3H1I G;  4HB1 A;  1FZB A;  4WY4 D;  1DD3 A;  1L0N J;  1FOS F;  3CC4 W;  4H44 C;  4YXW H;  1DH3 A;  1KQG B;  2JR8 A;  1IFP A;  2O01 J;  2RKL A;  1ZXG A;  5GAD a;  4OH8 B;  3CXH H;  2PFX A;  1Q86 X;  4OGQ C;  3RL0 C;  1SQB K;  1UII A;  2QA4 P;  1FBM A;  2WTY A;  3RK3 E;  2M0B A;  1JMB A;  3I55 P;  5KLV J;  1NTM G;  5M1B A;  5KLI B;  2Y0E A;  4PD4 H;  5AW2 B;  2WSC H;  3PH0 A;  1ZR2 A;  3F89 A;  1G2C A;  3PIO W;  1RE3 C;  4ZNC A;  1MKM A;  2HPC B;  1NAF A;  1KQS V;  2E43 A;  2KLV A;  2R5B A;  1LZW A;  4YPC A;  1LTT C;  1E79 H;  2KSJ A;  2IBZ I;  3O2B A;  1JTH A;  4JYC A;  5GAH a;  3S1K A;  3W7U A;  2BCC J;  1FZF A;  1QL1 A;  2WPS A;  3C1L A;  1K8A Q;  1Q7Y X;  3HE5 B;  5KLV D;  2WA8 A;  1FOS E;  1PIX A;  2ZT9 C;  3H1I J;  5KAI H;  3G6E W;  4N78 E;  3G4S P;  1NTK D;  1USD A;  1BSN A;  2OTK E;  2B87 A;  1NVO A;  1HJB A;  1YYC A;  3O2O A;  2I8D A;  4WY4 C;  5CHX A;  1YJN P;  4TT3 H;  3KQG A;  5GTI H;  1S9K D;  3GHG A;  3VYI A;  1NYH A;  3WU2 H;  1KD1 X;  1LNQ A;  3VTP C;  1EC5 A;  1SQB G;  3VMX A;  2XZR A;  1KYO I;  5B5E H;  5KKZ C;  4GOE A;  5E79 E;  3P32 A;  1M56 D;  1NTM J;  4I7Z B;  4WF9 W;  2Q3E A;  1R6O C;  3EFF K;  1L0L G;  1NU1 D;  3NXS A;  5AVZ B;  5AW9 B;  3CC7 W;  2Q1K A;  2KS1 B;  3CCU W;  3WUU A;  2W6J H;  4U3F G;  4Y99 C;  4EDF A;  1IO4 A;  1EXJ A;  1NTZ D;  1T2K D;  4R4M A;  5GAG a;  4WWI A;  2JEE A;  2ITA A;  3CXC V;  1EQ7 A;  3L70 G;  3JCU E;  1NTM D;  1YTZ I;  1PZQ A;  1P84 I;  2NPS A;  2IYO A;  1VF5 D;  5JVH W;  1R6Q C;  2WPR A;  3OW2 V;  3L75 G;  3CL3 D;  2E5Y A;  2A45 I;  2FYU D;  1A02 J;  5APX A;  1LT1 A;  3CC2 P;  1VQN P;  1QVG V;  3H1K E;  1Q81 Q;  1J1E C;  3AE1 C;  1LWU A;  1SQB J;  5KAF E;  2A06 D;  1JUN A;  2D2C D;  2E75 D;  2WPV B;  5AVW B;  3U59 A;  2N9Y B;  3BVH A;  1VF5 B;  1Y8A A;  3U1A A;  1SQX E;  1N73 B;  1LTB C;  1JM0 A;  2IBZ G;  2E74 D;  1KTM A;  2W6B A;  5KJ7 C;  2QJP B; 
#chains in the Genus database with same CATH homology
 3O1F B;  4XFJ A;  4YXD C;  4H44 D;  1OMI A;  3AE8 C;  2O01 J;  3DNJ A;  2QJY C;  1MBU C;  2NZ2 A;  3Q2Y A;  3D6Z A;  4H44 B;  2OQQ A;  3SFE C;  1FDO A;  1YQ4 C;  4OGQ C;  3AE4 C;  4I7Z B;  1KMI Z;  1HJ0 A;  1K05 A;  3GW1 A;  1PV3 A;  2YMK A;  2H88 C;  3ABV C;  4GDO A;  4IL6 X;  5KLI C;  1HF9 A;  1R6O C;  4YJX A;  3RK3 E;  3GLM A;  4H0L C;  3O2H A;  1MBX C;  1RQS A;  4OGQ B;  3AEG C;  4YKA A;  4YTP C;  4Z1M H;  3FGA D;  4YJM A;  2H89 C;  3AE2 C;  2WSC J;  1EXI A;  5M1B A;  4PV1 D;  2K9Y A;  3S9O A;  1K04 A;  1S1C X;  4H0L D;  1YQ3 C;  2BEQ D;  3AE5 C;  3LW5 J;  3GQ0 A;  1ZP0 C;  1VL2 A;  2E76 D;  1WMK A;  1MKM A;  3G3P A;  1OW7 A;  4H0L B;  1MBV B;  3Q5R A;  3Q1M A;  1NGM B;  2V7Q J;  1DIP A;  3GQ1 A;  1KIL E;  2QSI A;  1EXJ A;  1FDI A;  1KQF B;  4R4M A;  3Q5P A;  1LZW A;  3G19 A;  2WSE J;  1R8E A;  2JO1 A;  1ZRT E;  4PV1 C;  3H25 A;  3Q3D A;  4R4L A;  2FYN C;  2QIW A;  2ZT9 D;  2WA9 A;  3GF7 A;  5L8R J;  1AJY A;  2E76 C;  3AEE C;  3GF3 A;  2W9R A;  3EWK A;  2IDB A;  1DD4 A;  1RQV A;  3O2B A;  1GMJ A;  1VF5 D;  1OW8 A;  1Y9B A;  3T97 B;  1R6Q C;  3G9R A;  4PV1 B;  1U57 A;  4U7J A;  1UIX A;  3C8V A;  3AEC C;  3RL0 g;  2E76 B;  3D6Y A;  2WA8 A;  1PIX A;  1S5L X;  1PL5 A;  2ZT9 C;  1MG9 A;  3AE6 C;  3R4Y A;  2D2C C;  1OW6 A;  2E75 C;  2QJK C;  3IAO A;  4H13 C;  1VF5 C;  2G3A A;  3GMA A;  3O1F A;  3AE1 C;  3O2O A;  3AE9 C;  3AEA C;  1IK7 A;  1ZOY C;  2FXP A;  1TU3 F;  2G8Y A;  1ZME C;  3AE7 C;  3IN6 A;  3D71 A;  4RKU J;  2D2C D;  2ZT9 B;  1JB0 J;  2FBW C;  3AED C;  3D70 A;  2E75 D;  2WPV B;  4H13 D;  4TT3 H;  1RQU A;  3G1B A;  3AEF C;  1NYH A;  2E74 C;  2QJP C;  2D2C B;  2E75 B;  4H13 B;  3AE3 C;  1VF5 B;  3O6Q A;  4KT0 J;  1DD3 A;  3Q5S A;  1KOR A;  2J5U A;  4Y28 J;  2YIU C;  2P10 A;  4OGQ D;  2WQY C;  2BEZ F;  3B71 A;  2E74 D;  1Q90 D;  3AEB C;  4H44 C;  3SFD C;  2MKV A;  1KTM A;  1CTF A;  4I7Z C;  2JP3 A;  2E74 B;  2WSF J;  5KKZ C;  1KQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...