1DD4A

Crystal structure of ribosomal protein l12 from thermotoga maritim
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
total genus 39
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd4A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd4A02
1MG9A 1RQVA 1R6OC 4YJMA 3GW1A 4YKAA 3O2HA 3O1FA 1MBUC 2WA8A 1R6QC 3G3PA 1RQSA 2WA9A 1DD3A 1MBXC 3G19A 4YJXA 1LZWA 1RQUA 3GQ0A 1MBVB 3GQ1A 3O2OA 3O1FB 2W9RA 1DD4A 3DNJA 3G1BA 3O2BA 1CTFA
chains in the Genus database with same CATH superfamily
1PL5A 2GM4A 1SQPG 2WA8A 2W6BA 4GKGA 2KYVA 3IN6A 1BGYG 1Y9BA 3MGNA 3S4RA 2WSEJ 1VL2A 4HKZH 1K8AX 4IFMA 3H1JJ 1X22A 3EFGA 1BCCE 1KILA 5APUA 4PD4E 3VMZA 4O9BA 1USDA 1IC2A 2Y0CA 4AUWA 2ZYGA 2R3SA 1KB9E 1SQBJ 1L4AC 4U3FG 3H25A 4W80A 1NTMK 2ZXEB 1IFDA 1GU4A 2B89A 1URQD 1NTZD 3RK2B 1VQOP 1LTAC 1R6QC 4JQ0D 2P2UA 1VQ4W 5E79E 3CL3D 1OIPA 5GTIE 3CWBJ 1KFMA 1AFOA 3L75D 1MUUA 1SFCB 3RK2C 1GW3A 1SQQE 1FZEA 3GHGB 3G3PA 4NPEA 5KLVK 1LTJC 1Y8AA 1LZWA 1VQKW 1KC8X 3GHGA 2GUSA 3L71J 3SWKA 3BRTB 5APVA 4U67W 3G9RA 3ZG5A 2FYUD 2WMMA 3CX5I 3IFMA 2N1TC 3AECC 1OWAA 1M56D 2K37A 1SQPD 3AE8C 2WSCJ 2IBZE 3SFEC 2OTJW 2QA4W 3WUTA 3CPWO 4WBAA 2BEQD 4UB8E 4DCKA 2OTLW 1S4XA 2AEMA 1SQPK 4OGQC 3HTKA 3V2QA 5KKZC 2JKVA 2KS1A 4PD4I 3CF5W 4L74A 3AEDC 2WZ7A 3O2OA 3A0HH 3CCVW 2ZT9B 4N78E 3P7KA 4EDFA 2OGUA 2Z5IA 2IDBA 5KAFE 1KTMA 1RE4C 4EYYQ 1R5SA 2QEXP 4WY4B 3VOPA 1GL2B 5CHXA 1SQQK 3C8VA 4DKIA 2BCCE 4H0LB 3BCCG 5AVVB 1U7JA 3A0HE 2ZYAA 3D6ZA 3T97B 5M1AA 3FWNA 3M0AA 2W27A 5CCHC 1LGHB 1S9KE 1SQQD 1QVGV 1H0TA 1HUCA 1EDKA 4U7JA 2KZIA 1OW7A 2K1AA 2WSCH 1KFNA 5AVYB 1RH5B 1VQ8P 1X79B 2AEJA 2ZT9D 1AQ5A 3RL0B 1T3JA 5AVZB 4CPKA 2CK3H 1PPJE 3WUUA 1Q90D 2NPSA 4H13B 5KLIC 3A2AA 1YJ9P 1NWQA 1KN7A 1JB0J 1USEA 1JY2O 1R6OC 5L8RJ 3AE2C 2QJYB 2XKMA 4C7RA 4YXDC 3VMYA 1FZBA 3CMAP 3D6YA 3AE6C 3KZIH 3CX5D 3T97A 2A06E 3VN0A 3W7TA 1PP9G 2B87B 4AQRD 2WT7A 1AQTA 5KLVE 1M8OB 2YIUB 4WF9W 1M1JB 1YJ9W 3BCCD 1JUNA 1URQA 5AW8B 3F89A 4RESB 1DEBA 3TGUD 4M3LA 3ITKA 3RK2D 5APQA 1KC8Q 3GQ0A 4IOAW 1W2EA 3FX0A 4OGQD 3O6QB 4C7NA 1XTCC 2WVRA 1L0NG 1AVYA 3LIEA 1Q82Q 2JP3A 2L5GB 3P8CE 1SFCD 1R8EA 2ZFCA 3ZDMA 3Q5SA 1LTSC 2WSEH 1JY2N 1NTZJ 1SFCC 5AW1B 5C39A 4H44C 1WMKA 1AJYA 4UB6E 2ZVOB 4C46A 2JDIH 2Z4EA 3M0DC 1CW5A 1NTZE 5B66H 5GADa 1G1JA 4H13C 5KLIB 1MFZA 5APSA 2OYIB 4WFNW 1KYOD 2QRXA 3DLLW 2PGDA 3L73G 2HODB 3U1CA 1SQQG 2KNCA 3PP5A 1FZCC 3WU2E 5CJ4A 1YIJP 3CCUP 1SQQJ 3CCSW 3VYIA 1CI6A 4WY4C 1SQBE 1PP9E 5B66E 4JPZB 2ZT9C 3HTKB 4H44D 3SWFA 5KLVD 3TGUJ 2IBZI 1NTMG 1BE3E 1ZLLA 4QMAA 2O3JA 1L0ND 5B5EH 3G4SP 1YITP 3TGUE 1VQLW 4WCEW 5CBNA 1NTZG 3CXCV 1SVFA 2IBZD 4PV1D 1Q7YX 4YJMA 2HLOA 1GW4A 1DEEG 2H88C 1KQLA 1QEXA 3CLQA 3D70A 2FYNB 3CWBE 2WSFH 3H1LD 1N7SA 1OW8A 3U59A 1VQ9P 2RH0A 1EDJA 1S2EA 2HR3A 3H32B 1YTZI 2ITAA 2Q1KA 1GK6A 4GIFA 3A0BH 2WSSH 3RL0C 4ASVA 1N2DC 1PZQA 1LWUC 2XV5A 3N4XA 3B8EB 5KTBA 3HE4B 2C0WA 2W6JH 1HTLC 1PPJG 2R5DA 4YKAA 3H1KE 3L72J 1YI2W 3P32A 1KV4A 1L0LG 2QJPB 1KYOI 2ZAEB 4IL6H 2I8DA 1FJKA 4H13D 3CC7W 3M9BA 1S9KD 1Q2NA 2H7HA 2P67A 2N9YB 1GL2A 1IFJA 1JJ2V 3KXDA 1NU1K 3O2BA 4IFDK 1NJIX 4N6JA 5DJUB 1VQLP 1YBKA 2PFXA 2Q7CA 2FY8A 1S5LH 3CC4P 1VQPP 4KT0J 1KQSV 1MWTA 1WRGA 1JY3P 1X9VA 1MBVB 2QJKB 3O1FB 5DM6W 3NTNA 2I1KA 1LP1B 4ZNCA 3SSUA 1RF0C 3L75G 1RE4A 3CD6W 1JNMA 2LXBA 1ZXGA 2WPVB 1KD1Q 2FXMA 1LWUB 4YJXA 2FXPA 3JC22 1PGJA 5DM7W 1VQ5W 4PD4D 5GW7A 1K04A 3H1LE 4XA4A 1KILC 1JO5A 1MBUC 2FKWB 1VQPW 1J1DC 3I55P 3MD0A 1KQSO 1L0LD 1S72W 1S5LE 3H32A 3SWYA 4HJGH 2ZJPW 1NJIQ 4IL6E 1N86A 3L71D 5APWA 5GAEa 1G2CA 1YHQP 1SQXK 2A45H 1EQ7A 3BASA 3CCJW 2R5BA 3CCMW 2NPSD 2XDJA 3HD7D 1JY3N 2OTKE 4CJNA 3TNUB 4L75A 4WB4A 2N9BA 3HUSC 5K5GB 1EZVG 3PIOW 1P84H 3B5ND 3R4YA 3GMAA 1EDLA 2P1JA 3V6IA 5AVRB 1VQ9W 3H1JD 3I5CA 3CPWV 1OVUA 3L71G 2KSEA 1YJNP 3RGUA 5BU8B 3TK1A 3BRVB 2V4HA 1BSNA 3VMXA 1Q82X 2R3CA 2J58A 3MUDA 2N1TA 1NTKG 2KNCB 2HODA 3MIWA 3H1IG 2KLUA 1BCCJ 5AW9B 1JTHA 1K05A 2M0BA 1JY3O 1HJ0A 3CWBG 1URQB 2PAJA 3OA7A 2POHA 4YTPC 2E74D 2Q5UA 1EZVI 1XTGB 1EZVE 4UB8H 4ZMDA 2OYHB 1RF0A 4EIJA 2JO1A 4ASWA 4L73A 3A0BE 1N73C 3CC2W 3W67A 3JCUH 4U3FJ 1MWRA 2KSJA 3L70D 1DD3A 1IK7A 3S1KA 1GDTA 4Y99B 2B88A 1YJWP 2C0XA 1LTBC 1MFTA 3S9OA 3CWBD 3H1JG 1LNQA 2KP8A 3P8MC 1BGYJ 1M7LA 2E74C 1ZMEC 1Q86X 2M5AB 2C9LY 1KMIZ 4AYCA 4RKUJ 1PGOA 4YPCA 3PRJA 1FE6A 2WT7B 1VQ5P 1NKZB 1MV8A 1JMBA 3NMDA 5KAIH 1W2BO 1VQNW 4D6TJ 1JEKA 1IO4A 3L75E 3HE5B 3PJSK 1LP1A 1X0TA 1MKMA 2O01H 5CCGC 3KDPB 1SQXE 5JVHW 2OTJP 1CSBA 3J7ZZ 3WU2H 5H2FE 3M9QA 2QIWA 1VQMP 2E75B 3CX5E 2A06D 3L73D 3L70G 1FAVA 2AXCA 2IYPA 3PH0A 2Y0EA 2BCCG 1EXIA 4BXLA 1BE3J 1EZVD 4K3AA 2C9NY 1NO4A 5CCHD 3V4WA 3MUDC 1R5LA 2AXTE 3CXHD 1NTKD 3L74J 1LWUA 2O01J 3H1HJ 2WQYC 3L74G 3G19A 3GLMA 4HYTB 1BE3G 1MZ9A 2YIUC 4BRYA 1GU5A 2BCCJ 3B5NA 3ABVC 1OZHA 1M90X 1GL2D 4MN4C 1VQMW 1IK9A 3RL0g 1NTME 2K3RA 4IL6X 3G6EP 2NZ2A 5H2FH 3RL0D 1ZRTE 1J1EC 4XFJA 3RK3C 1K9MQ 4N78D 1N73A 3CCEW 5KJ7A 2FFDA 3CMAW 2YMKA 2CPSA 2QSIA 1L4AD 3B5NB 5AVQB 1VQ6P 1VPCA 1FOSF 2RN0A 2W90A 5EFWB 2HYNA 3L71E 3H1HE 4U3FD 4OWFA 1NYHA 1YJWW 1BSHA 2A06G 3H1KJ 4KHXA 1HF9A 3PIPW 2M3EA 1BDDA 2IZ1A 1SQXD 5AVXB 2RKLA 1OVRA 3D3IA 2W8ZA 1SQBD 2RMZA 2IBZG 3K5BA 2HPCB 3N7NA 1FZFA 1KILE 1QX8A 1PFIA 1SQVG 5AW6B 1M1KQ 3FXEA 1NVOA 2UWJE 2E74B 5TJHA 5TISE 2G3AA 2HPCA 3PLNA 3WUVA 1J1EB 2W6AA 1AA0A 3D71A 3G1BA 3M91A 1X8YA 1RQVA 2FBWC 2V7QH 2W83C 1K73Q 4JYBA 5KKZB 1W5CE 2KLVA 1Z56A 5AW5B 2Q9IA 1BGYE 3VTPC 1NU1D 1IJDB 1NTMD 1RY3A 2D2CD 3NFQA 4RJTA 3A3YB 5AVTB 1NOHA 1KZUB 4H0LD 2KZJA 3NXSA 1MWUA 1ZR4A 2K88A 1SQVK 1BCCG 1S3JA 1N7SC 3CCVP 2E5TA 3H1IJ 3H1ID 1YI2P 2A45G 3HRNA 2QJYC 1NTKJ 3FWLA 3L74D 4L76A 1IFNA 1VQ6W 2K9YA 3LW5H 5AVUB 4A7PA 2ZXXA 3CCQW 1LJ2A 2P58A 3C9IA 2WPSA 1HWTC 3MHVA 4HH2A 3BVHA 3P8CD 5CMZA 4WFAW 4BRYB 1L2PA 2AXTH 4YXWH 3GF7A 1PGQA 1HJBA 4JYCA 2M8RA 3W7XA 4R4LA 5CA3A 1VF5B 2H8PD 4KJMA 1HVVA 2LKMA 5AW7B 4PV1B 2D2CC 1VQ8W 3B4SA 3CCJP 2Y0DA 2IFMA 5KLVJ 2Z5HA 3AE5C 1VQNP 4CPGA 1CI6B 1YIJW 1RHZB 3AE3C 1SQXG 3OW2V 2R44A 1JM0A 3CD6P 2WWWA 2E42A 1LT1A 2JWDA 2P10A 2QEXW 2KI7B 1VQ7W 1OFCX 2WPRA 1T2KC 2PRRA 2WITA 5AW3B 1QVGO 1MWSA 4BL3A 2FYNC 3M0DA 3JCUE 2QVAA 1NU1G 1FOSE 1L4AA 1OW6A 1Q7YQ 3BATA 3L72E 1L0NE 1W2BV 3H1IE 3CXHE 1L4AB 3L74E 1NTKE 3PTZA 3CC2P 2M5AA 3L75J 1NAFA 2FYUG 3L36A 3LW5J 4WFBW 2DW3A 4WY4A 4OVNF 2J5UA 3AE1C 1T3UA 1N73B 3EQ2A 4C7NB 1J1DB 4OGQB 4ZKPA 2WA9A 1H89A 2K9JB 5GAHa 3QH9A 3CXHH 2YKQA 5BU5A 5M1BA 3TSIA 3V2NA 1KB9D 1AVOA 2QJKC 5M18A 1M1JC 2R32A 3HD7C 3AEEC 1P84E 3GHGC 1CZQA 1VQQA 1SQVE 1NGMB 3V2RA 2LR2A 1L0LJ 3CCMP 3H1JE 3L72G 3HUSB 3H1HD 4U3FE 3H1LG 3HUSA 2E76D 1YJNW 3G71P 5GTIH 1L0LK 4I6MC 3KQGA 1TU3F 3W7SA 1FZGA 1JTHB 5GTHE 1FU1A 1RQSA 1OMIA 1BDCA 3M9HA 2OYIC 4IO9W 4I2LC 2G8YA 1VQOW 2NRGA 4BWNA 1U7MA 2FYZA 4GOEA 2AEFA 2BASA 4N3YB 4DT0A 4GDOA 1SQPE 4WY4D 1YITW 4LLHA 3KZIE 2JJLA 4JF7A 2XNDH 2IYOA 3UIAA 3TNUA 5CBOA 1QLED 1S72P 1OXZA 3C1LA 2L91A 1NTMJ 3H6PA 3HE4A 3G71W 3TGUG 2XU6A 3GQ1A 3RK3D 1T8ZA 3RBZA 1GD2E 3A7OA 1QL2A 1MG9A 3W68A 1JY2P 4PJ0H 1L0LE 2N1TB 3VP8A 5DJTB 1P84I 3E7KA 1H8AA 1SQVD 1L0NK 3L73J 3EFFK 5TISH 2FXOA 1ZP0C 1NTKK 2BCCD 3TYYA 5BVZA 1SP4A 2BEZF 2NPSC 3I55W 1QL1A 1MBXC 1M1JA 1FDOA 1GTWA 1Y47A 2QG4A 3VP9A 1YQ4C 1A02F 3AEBC 4GT1A 1VF5C 3MP7B 5E79H 2QE7H 1YYCA 1ZW0A 3L73E 3V5BA 2OTLP 1NH4A 2E75C 1IFIA 2YO2A 1YTZT 2XNXA 1L0NJ 1K9MX 3IAOA 5B5EE 4B86A 4D6TE 2SPZA 1UIXA 4Y28J 3VMAA 4GOFA 4HB1A 4R4MA 1HGZA 3L37A 1UIIA 1LTJA 3G6EW 1QVFO 2OYIA 3CC4W 2IFNA 1VQ4P 2WSFJ 1N8RQ 1ZN5A 3AEFC 1T6AA 3CCQP 1E79H 4OH8B 1SQBK 2Y9YA 3H1LJ 1PP9J 2KXPB 3B5NC 2E75D 2KK7A 3BCCE 2YO3A 3F5HA 3CI9A 1VDFA 2FYUE 2ZJSE 3II6A 3MZWB 2QM7A 4W7YA 3CCUW 3AE7C 1S5LX 2QM8A 1DD4A 4TT3H 3L70E 2LXCB 3OAKA 1FDIA 3E1IA 2YNYA 2PP6A 3O6QA 1M1KX 2VRSA 5APYA 1BXYA 2HG5D 1LT9C 4K35A 4XE5B 3TF5A 5APXA 1KB9H 2ZJQW 1NTZK 3E1RA 1KYOH 2V7QJ 2FYUJ 2GUVA 2YXRB 2OQQA 1JCDA 3CMEP 1KD1X 2E43A 5AW2B 1WT6A 3AEAC 2H43A 1JMMA 3FXDA 3L4FA 1LTGC 1NU1J 2ZJRW 1SLQA 5APTA 3BCCJ 3A5TA 1T2KD 3R2PA 4D6TD 1KYOE 1HH0A 2GA1A 3O1FA 3CCRP 5CCHA 3IF4A 1FZCB 2IPPA 1Q86Q 1LTJB 3CCLP 1FBMA 4PJ0E 1A02J 3CCRW 2JR8A 4H0LC 3Q5PA 4IOIH 2FYUK 5KAFH 3DNJA 1RE3A 1PP9D 1SQXJ 1IZNB 2B9BA 3AE9C 4PV1C 3U1AA 3CC7P 2I1JA 3GF3A 3CCSP 3KHUA 1M90Q 2YXQB 1NU1E 4NPFX 2WTYA 1NHLA 5KLVG 1K8AQ 4UY8Z 3L35A 1Q81Q 1RQUA 4Y99C 1BE3D 5AVSB 3RK3B 3HD7A 4IFFA 4IOCW 1PPJD 2OYHA 3CCEP 1HGVA 1HBWA 5CCGA 1GK4A 2MJZA 3O2HA 3AE4C 3Q5RA 1PV3A 1VF5D 4BL2A 1LT9B 2Q3IA 2HFED 1BCCD 2YKPA 1FC2C 3SFDC 3O8ZA 4TLFA 4Z1MH 3I56W 1N7SB 1ZOYC 1NKNA 3USSA 1ZRTD 5JVGW 2N1TD 2KB7P 1U57A 3I56P 4JBZA 1EC5A 2CPBA 4I1LA 2KUBA 1FJPA 3Q3DA 2H89C 4DOJA 1FDMA 2Y9ZA 1RF1A 1DH3A 1LT9A 2O1KA 4I7ZB 5M19A 1DX7A 3ZFZA 4DZOA 1YQ3C 3GW6A 1S1CX 1RF1B 1K73X 4WVZA 2ZVNB 5HL7W 5CJ0A 3FGAD 3G3ZA 5KJ7C 2FFDC 1SQBG 3KYQA 3V4QA 4I7ZC 1KQGB 2MKVA 1PIXA 4LC1A 2KIKA 3OJAB 3EWKA 1KILD 2K9JA 2M3BA 4LGDE 2IX7C 1SQVJ 5AVWB 1GZLA 3LIDA 3L72D 3CMEW 1IFMA 2D2CB 1FZCA 3G4SW 2QJPC 2E5YA 3CCLW 2O01N 1DIPA 5AW4B 1RE3C 2WPQA 1M57D 1SQPJ 1GMJA 2W9RA 2IZ0A 2XZRA 3HD7B 3KPEA 3PHLA 3OW2O 3Q2YA 3H1KG 3W7UA 3CXHI 3RBXA 1BGYD 2YMYA 3AEGC 3JSVC 1OX3A 1J2JB 2Q3EA 1OVVA 1IFPA 2OYHC 1G2CB 2QA4P 4WWIA 3TDKA 1PGPA 1SS1A 1P84D 2ZYDA 1FZAA 2A45I 3W7WA 5AW0B 1VQ7P 1KILB 3GW1A 4RO0A 2P7JA 1ZR2A 3GG2A 5GTHH 1VQKP 1QGKB 2E76C 3HE5A 1KQFB 1LTIC 1KB9I 2OARA 1N7LA 3MTUE 4W7ZA 1H0TB 2B87A 1URQC 1E5WA 3H1HG 1JOCA 4UB6H 1Q81X 2JWAA 3ZG0A 5KAIE 1YHQW 4EI2A 1RF1C 3V2PA 1FS0E 1N8RX 3Q1MA 4DJGA 3M06A 2Q6QA 2YKOA 1H88A 2KOGA 5KJ7D 5CCGD 1QVFV 2JEEA 2OYOA 2NPSB 3L70J 2FFDB 3H1KD 3B71A 1EDIA 1GL2C 1NAYA 4PD4H 3IR9A 1ZV8A 1AV1A 3WMM0 1CTFA 3QWOC 4H44B 1SFCA 1KORA 2O1JA 1EXJA 1D7MA 2KS1B 1G1IA 4ZKUA 4D6TG 3RK3E 4NPDA 4GODA 1JCCA 1LTTC 5GAGa 2J59M 2E76B 4EOTA 1N7SD 3CX5H
chains in the Genus database with same CATH topology
4H44C 1PL5A 3G9RA 1HJ0A 1WMKA 2J5UA 4R4MA 1AJYA 3GW1A 3AE1C 3O1FA 1MBUC 2QIWA 2WA8A 4YTPC 4I7ZB 2E75B 3AECC 2ZT9D 2E74D 4OGQB 2WA9A 3GF7A 3AE8C 3IN6A 2WSCJ 1YQ3C 1Y9BA 2WSFJ 1Q90D 4H13C 1S1CX 2WSEJ 3GQ1A 1VL2A 4H0LC 4H13B 4R4LA 5KLIC 5M1BA 2QJKC 3SFEC 3Q5PA 1EXIA 2E76C 1VF5B 3AEFC 3DNJA 2JO1A 3AEEC 1KILE 2BEQD 1KQFB 4PV1B 1JB0J 3AE9C 4PV1C 2D2CC 3FGAD 1MG9A 1R6OC 4YKAA 3GF3A 2E75D 3AE2C 5L8RJ 2E74B 4OGQC 4I7ZC 1KQGB 2MKVA 1PIXA 2O01J 4YXDC 2G3AA 5KKZC 1DD3A 2WQYC 1NGMB 3AE5C 1IK7A 3G19A 3D6YA 3AE6C 1RQUA 4H13D 3H25A 3AEDC 3EWKA 3GLMA 3O2OA 3AE7C 2E76D 3S9OA 3AE3C 3Q1MA 3D71A 1S5LX 1DD4A 2ZT9C 3G1BA 1ZP0C 2ZT9B 2YIUC 4TT3H 4H44D 3O2BA 1TU3F 3ABVC 2P10A 2FBWC 1RQVA 2D2CB 2IDBA 3O2HA 1FDIA 1KTMA 3O6QA 2BEZF 2E74C 2QJPC 3AE4C 3RL0g 3Q5RA 1R6QC 1PV3A 1ZMEC 1VF5D 1DIPA 1RQSA 4IL6X 1OMIA 1MBXC 2NZ2A 4KT0J 3B71A 1ZRTE 1FDOA 4XFJA 2D2CD 3GQ0A 1GMJA 3C8VA 1KMIZ 2FYNC 3R4YA 3GMAA 1MBVB 4RKUJ 3SFDC 4H0LB 1YQ4C 3O1FB 2W9RA 4H0LD 3AEBC 4OGQD 2V7QJ 2G8YA 2YMKA 1VF5C 4Z1MH 4PV1D 1CTFA 2QSIA 1ZOYC 2OQQA 4H44B 3Q2YA 4YJMA 1OW6A 3D6ZA 3T97B 1KORA 1EXJA 2QJYC 2E75C 3G3PA 2WPVB 2JP3A 1U57A 2H88C 3AEAC 3AEGC 3RK3E 4YJXA 2FXPA 1R8EA 1LZWA 1NYHA 4GDOA 1MKMA 3D70A 2K9YA 3Q5SA 3Q3DA 2H89C 4U7JA 3IAOA 2E76B 1HF9A 1OW7A 1K04A 1OW8A 1UIXA 3LW5J 1K05A 4Y28J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG9 A;  1RQV A;  1R6O C;  4YJM A;  3GW1 A;  4YKA A;  3O2H A;  3O1F A;  1MBU C;  2WA8 A;  1R6Q C;  3G3P A;  1RQS A;  2WA9 A;  1DD3 A;  1MBX C;  3G19 A;  4YJX A;  1LZW A;  1RQU A;  3GQ0 A;  1MBV B;  3GQ1 A;  3O2O A;  3O1F B;  2W9R A;  1DD4 A;  3DNJ A;  3G1B A;  3O2B A;  1CTF A; 
#chains in the Genus database with same CATH topology
 1PL5 A;  2GM4 A;  1SQP G;  2WA8 A;  2W6B A;  4GKG A;  2KYV A;  3IN6 A;  1BGY G;  1Y9B A;  3MGN A;  3S4R A;  2WSE J;  1VL2 A;  4HKZ H;  1K8A X;  4IFM A;  3H1J J;  1X22 A;  3EFG A;  1BCC E;  1KIL A;  5APU A;  4PD4 E;  3VMZ A;  4O9B A;  1USD A;  1IC2 A;  2Y0C A;  4AUW A;  2ZYG A;  2R3S A;  1KB9 E;  1SQB J;  1L4A C;  4U3F G;  3H25 A;  4W80 A;  1NTM K;  2ZXE B;  1IFD A;  1GU4 A;  2B89 A;  1URQ D;  1NTZ D;  3RK2 B;  1VQO P;  1LTA C;  1R6Q C;  4JQ0 D;  2P2U A;  1VQ4 W;  5E79 E;  3CL3 D;  1OIP A;  5GTI E;  3CWB J;  1KFM A;  1AFO A;  3L75 D;  1MUU A;  1SFC B;  3RK2 C;  1GW3 A;  1SQQ E;  1FZE A;  3GHG B;  3G3P A;  4NPE A;  5KLV K;  1LTJ C;  1Y8A A;  1LZW A;  1VQK W;  1KC8 X;  3GHG A;  2GUS A;  3L71 J;  3SWK A;  3BRT B;  5APV A;  4U67 W;  3G9R A;  3ZG5 A;  2FYU D;  2WMM A;  3CX5 I;  3IFM A;  2N1T C;  3AEC C;  1OWA A;  1M56 D;  2K37 A;  1SQP D;  3AE8 C;  2WSC J;  2IBZ E;  3SFE C;  2OTJ W;  2QA4 W;  3WUT A;  3CPW O;  4WBA A;  2BEQ D;  4UB8 E;  4DCK A;  2OTL W;  1S4X A;  2AEM A;  1SQP K;  4OGQ C;  3HTK A;  3V2Q A;  5KKZ C;  2JKV A;  2KS1 A;  4PD4 I;  3CF5 W;  4L74 A;  3AED C;  2WZ7 A;  3O2O A;  3A0H H;  3CCV W;  2ZT9 B;  4N78 E;  3P7K A;  4EDF A;  2OGU A;  2Z5I A;  2IDB A;  5KAF E;  1KTM A;  1RE4 C;  4EYY Q;  1R5S A;  2QEX P;  4WY4 B;  3VOP A;  1GL2 B;  5CHX A;  1SQQ K;  3C8V A;  4DKI A;  2BCC E;  4H0L B;  3BCC G;  5AVV B;  1U7J A;  3A0H E;  2ZYA A;  3D6Z A;  3T97 B;  5M1A A;  3FWN A;  3M0A A;  2W27 A;  5CCH C;  1LGH B;  1S9K E;  1SQQ D;  1QVG V;  1H0T A;  1HUC A;  1EDK A;  4U7J A;  2KZI A;  1OW7 A;  2K1A A;  2WSC H;  1KFN A;  5AVY B;  1RH5 B;  1VQ8 P;  1X79 B;  2AEJ A;  2ZT9 D;  1AQ5 A;  3RL0 B;  1T3J A;  5AVZ B;  4CPK A;  2CK3 H;  1PPJ E;  3WUU A;  1Q90 D;  2NPS A;  4H13 B;  5KLI C;  3A2A A;  1YJ9 P;  1NWQ A;  1KN7 A;  1JB0 J;  1USE A;  1JY2 O;  1R6O C;  5L8R J;  3AE2 C;  2QJY B;  2XKM A;  4C7R A;  4YXD C;  3VMY A;  1FZB A;  3CMA P;  3D6Y A;  3AE6 C;  3KZI H;  3CX5 D;  3T97 A;  2A06 E;  3VN0 A;  3W7T A;  1PP9 G;  2B87 B;  4AQR D;  2WT7 A;  1AQT A;  5KLV E;  1M8O B;  2YIU B;  4WF9 W;  1M1J B;  1YJ9 W;  3BCC D;  1JUN A;  1URQ A;  5AW8 B;  3F89 A;  4RES B;  1DEB A;  3TGU D;  4M3L A;  3ITK A;  3RK2 D;  5APQ A;  1KC8 Q;  3GQ0 A;  4IOA W;  1W2E A;  3FX0 A;  4OGQ D;  3O6Q B;  4C7N A;  1XTC C;  2WVR A;  1L0N G;  1AVY A;  3LIE A;  1Q82 Q;  2JP3 A;  2L5G B;  3P8C E;  1SFC D;  1R8E A;  2ZFC A;  3ZDM A;  3Q5S A;  1LTS C;  2WSE H;  1JY2 N;  1NTZ J;  1SFC C;  5AW1 B;  5C39 A;  4H44 C;  1WMK A;  1AJY A;  4UB6 E;  2ZVO B;  4C46 A;  2JDI H;  2Z4E A;  3M0D C;  1CW5 A;  1NTZ E;  5B66 H;  5GAD a;  1G1J A;  4H13 C;  5KLI B;  1MFZ A;  5APS A;  2OYI B;  4WFN W;  1KYO D;  2QRX A;  3DLL W;  2PGD A;  3L73 G;  2HOD B;  3U1C A;  1SQQ G;  2KNC A;  3PP5 A;  1FZC C;  3WU2 E;  5CJ4 A;  1YIJ P;  3CCU P;  1SQQ J;  3CCS W;  3VYI A;  1CI6 A;  4WY4 C;  1SQB E;  1PP9 E;  5B66 E;  4JPZ B;  2ZT9 C;  3HTK B;  4H44 D;  3SWF A;  5KLV D;  3TGU J;  2IBZ I;  1NTM G;  1BE3 E;  1ZLL A;  4QMA A;  2O3J A;  1L0N D;  5B5E H;  3G4S P;  1YIT P;  3TGU E;  1VQL W;  4WCE W;  5CBN A;  1NTZ G;  3CXC V;  1SVF A;  2IBZ D;  4PV1 D;  1Q7Y X;  4YJM A;  2HLO A;  1GW4 A;  1DEE G;  2H88 C;  1KQL A;  1QEX A;  3CLQ A;  3D70 A;  2FYN B;  3CWB E;  2WSF H;  3H1L D;  1N7S A;  1OW8 A;  3U59 A;  1VQ9 P;  2RH0 A;  1EDJ A;  1S2E A;  2HR3 A;  3H32 B;  1YTZ I;  2ITA A;  2Q1K A;  1GK6 A;  4GIF A;  3A0B H;  2WSS H;  3RL0 C;  4ASV A;  1N2D C;  1PZQ A;  1LWU C;  2XV5 A;  3N4X A;  3B8E B;  5KTB A;  3HE4 B;  2C0W A;  2W6J H;  1HTL C;  1PPJ G;  2R5D A;  4YKA A;  3H1K E;  3L72 J;  1YI2 W;  3P32 A;  1KV4 A;  1L0L G;  2QJP B;  1KYO I;  2ZAE B;  4IL6 H;  2I8D A;  1FJK A;  4H13 D;  3CC7 W;  3M9B A;  1S9K D;  1Q2N A;  2H7H A;  2P67 A;  2N9Y B;  1GL2 A;  1IFJ A;  1JJ2 V;  3KXD A;  1NU1 K;  3O2B A;  4IFD K;  1NJI X;  4N6J A;  5DJU B;  1VQL P;  1YBK A;  2PFX A;  2Q7C A;  2FY8 A;  1S5L H;  3CC4 P;  1VQP P;  4KT0 J;  1KQS V;  1MWT A;  1WRG A;  1JY3 P;  1X9V A;  1MBV B;  2QJK B;  3O1F B;  5DM6 W;  3NTN A;  2I1K A;  1LP1 B;  4ZNC A;  3SSU A;  1RF0 C;  3L75 G;  1RE4 A;  3CD6 W;  1JNM A;  2LXB A;  1ZXG A;  2WPV B;  1KD1 Q;  2FXM A;  1LWU B;  4YJX A;  2FXP A;  3JC2 2;  1PGJ A;  5DM7 W;  1VQ5 W;  4PD4 D;  5GW7 A;  1K04 A;  3H1L E;  4XA4 A;  1KIL C;  1JO5 A;  1MBU C;  2FKW B;  1VQP W;  1J1D C;  3I55 P;  3MD0 A;  1KQS O;  1L0L D;  1S72 W;  1S5L E;  3H32 A;  3SWY A;  4HJG H;  2ZJP W;  1NJI Q;  4IL6 E;  1N86 A;  3L71 D;  5APW A;  5GAE a;  1G2C A;  1YHQ P;  1SQX K;  2A45 H;  1EQ7 A;  3BAS A;  3CCJ W;  2R5B A;  3CCM W;  2NPS D;  2XDJ A;  3HD7 D;  1JY3 N;  2OTK E;  4CJN A;  3TNU B;  4L75 A;  4WB4 A;  2N9B A;  3HUS C;  5K5G B;  1EZV G;  3PIO W;  1P84 H;  3B5N D;  3R4Y A;  3GMA A;  1EDL A;  2P1J A;  3V6I A;  5AVR B;  1VQ9 W;  3H1J D;  3I5C A;  3CPW V;  1OVU A;  3L71 G;  2KSE A;  1YJN P;  3RGU A;  5BU8 B;  3TK1 A;  3BRV B;  2V4H A;  1BSN A;  3VMX A;  1Q82 X;  2R3C A;  2J58 A;  3MUD A;  2N1T A;  1NTK G;  2KNC B;  2HOD A;  3MIW A;  3H1I G;  2KLU A;  1BCC J;  5AW9 B;  1JTH A;  1K05 A;  2M0B A;  1JY3 O;  1HJ0 A;  3CWB G;  1URQ B;  2PAJ A;  3OA7 A;  2POH A;  4YTP C;  2E74 D;  2Q5U A;  1EZV I;  1XTG B;  1EZV E;  4UB8 H;  4ZMD A;  2OYH B;  1RF0 A;  4EIJ A;  2JO1 A;  4ASW A;  4L73 A;  3A0B E;  1N73 C;  3CC2 W;  3W67 A;  3JCU H;  4U3F J;  1MWR A;  2KSJ A;  3L70 D;  1DD3 A;  1IK7 A;  3S1K A;  1GDT A;  4Y99 B;  2B88 A;  1YJW P;  2C0X A;  1LTB C;  1MFT A;  3S9O A;  3CWB D;  3H1J G;  1LNQ A;  2KP8 A;  3P8M C;  1BGY J;  1M7L A;  2E74 C;  1ZME C;  1Q86 X;  2M5A B;  2C9L Y;  1KMI Z;  4AYC A;  4RKU J;  1PGO A;  4YPC A;  3PRJ A;  1FE6 A;  2WT7 B;  1VQ5 P;  1NKZ B;  1MV8 A;  1JMB A;  3NMD A;  5KAI H;  1W2B O;  1VQN W;  4D6T J;  1JEK A;  1IO4 A;  3L75 E;  3HE5 B;  3PJS K;  1LP1 A;  1X0T A;  1MKM A;  2O01 H;  5CCG C;  3KDP B;  1SQX E;  5JVH W;  2OTJ P;  1CSB A;  3J7Z Z;  3WU2 H;  5H2F E;  3M9Q A;  2QIW A;  1VQM P;  2E75 B;  3CX5 E;  2A06 D;  3L73 D;  3L70 G;  1FAV A;  2AXC A;  2IYP A;  3PH0 A;  2Y0E A;  2BCC G;  1EXI A;  4BXL A;  1BE3 J;  1EZV D;  4K3A A;  2C9N Y;  1NO4 A;  5CCH D;  3V4W A;  3MUD C;  1R5L A;  2AXT E;  3CXH D;  1NTK D;  3L74 J;  1LWU A;  2O01 J;  3H1H J;  2WQY C;  3L74 G;  3G19 A;  3GLM A;  4HYT B;  1BE3 G;  1MZ9 A;  2YIU C;  4BRY A;  1GU5 A;  2BCC J;  3B5N A;  3ABV C;  1OZH A;  1M90 X;  1GL2 D;  4MN4 C;  1VQM W;  1IK9 A;  3RL0 g;  1NTM E;  2K3R A;  4IL6 X;  3G6E P;  2NZ2 A;  5H2F H;  3RL0 D;  1ZRT E;  1J1E C;  4XFJ A;  3RK3 C;  1K9M Q;  4N78 D;  1N73 A;  3CCE W;  5KJ7 A;  2FFD A;  3CMA W;  2YMK A;  2CPS A;  2QSI A;  1L4A D;  3B5N B;  5AVQ B;  1VQ6 P;  1VPC A;  1FOS F;  2RN0 A;  2W90 A;  5EFW B;  2HYN A;  3L71 E;  3H1H E;  4U3F D;  4OWF A;  1NYH A;  1YJW W;  1BSH A;  2A06 G;  3H1K J;  4KHX A;  1HF9 A;  3PIP W;  2M3E A;  1BDD A;  2IZ1 A;  1SQX D;  5AVX B;  2RKL A;  1OVR A;  3D3I A;  2W8Z A;  1SQB D;  2RMZ A;  2IBZ G;  3K5B A;  2HPC B;  3N7N A;  1FZF A;  1KIL E;  1QX8 A;  1PFI A;  1SQV G;  5AW6 B;  1M1K Q;  3FXE A;  1NVO A;  2UWJ E;  2E74 B;  5TJH A;  5TIS E;  2G3A A;  2HPC A;  3PLN A;  3WUV A;  1J1E B;  2W6A A;  1AA0 A;  3D71 A;  3G1B A;  3M91 A;  1X8Y A;  1RQV A;  2FBW C;  2V7Q H;  2W83 C;  1K73 Q;  4JYB A;  5KKZ B;  1W5C E;  2KLV A;  1Z56 A;  5AW5 B;  2Q9I A;  1BGY E;  3VTP C;  1NU1 D;  1IJD B;  1NTM D;  1RY3 A;  2D2C D;  3NFQ A;  4RJT A;  3A3Y B;  5AVT B;  1NOH A;  1KZU B;  4H0L D;  2KZJ A;  3NXS A;  1MWU A;  1ZR4 A;  2K88 A;  1SQV K;  1BCC G;  1S3J A;  1N7S C;  3CCV P;  2E5T A;  3H1I J;  3H1I D;  1YI2 P;  2A45 G;  3HRN A;  2QJY C;  1NTK J;  3FWL A;  3L74 D;  4L76 A;  1IFN A;  1VQ6 W;  2K9Y A;  3LW5 H;  5AVU B;  4A7P A;  2ZXX A;  3CCQ W;  1LJ2 A;  2P58 A;  3C9I A;  2WPS A;  1HWT C;  3MHV A;  4HH2 A;  3BVH A;  3P8C D;  5CMZ A;  4WFA W;  4BRY B;  1L2P A;  2AXT H;  4YXW H;  3GF7 A;  1PGQ A;  1HJB A;  4JYC A;  2M8R A;  3W7X A;  4R4L A;  5CA3 A;  1VF5 B;  2H8P D;  4KJM A;  1HVV A;  2LKM A;  5AW7 B;  4PV1 B;  2D2C C;  1VQ8 W;  3B4S A;  3CCJ P;  2Y0D A;  2IFM A;  5KLV J;  2Z5H A;  3AE5 C;  1VQN P;  4CPG A;  1CI6 B;  1YIJ W;  1RHZ B;  3AE3 C;  1SQX G;  3OW2 V;  2R44 A;  1JM0 A;  3CD6 P;  2WWW A;  2E42 A;  1LT1 A;  2JWD A;  2P10 A;  2QEX W;  2KI7 B;  1VQ7 W;  1OFC X;  2WPR A;  1T2K C;  2PRR A;  2WIT A;  5AW3 B;  1QVG O;  1MWS A;  4BL3 A;  2FYN C;  3M0D A;  3JCU E;  2QVA A;  1NU1 G;  1FOS E;  1L4A A;  1OW6 A;  1Q7Y Q;  3BAT A;  3L72 E;  1L0N E;  1W2B V;  3H1I E;  3CXH E;  1L4A B;  3L74 E;  1NTK E;  3PTZ A;  3CC2 P;  2M5A A;  3L75 J;  1NAF A;  2FYU G;  3L36 A;  3LW5 J;  4WFB W;  2DW3 A;  4WY4 A;  4OVN F;  2J5U A;  3AE1 C;  1T3U A;  1N73 B;  3EQ2 A;  4C7N B;  1J1D B;  4OGQ B;  4ZKP A;  2WA9 A;  1H89 A;  2K9J B;  5GAH a;  3QH9 A;  3CXH H;  2YKQ A;  5BU5 A;  5M1B A;  3TSI A;  3V2N A;  1KB9 D;  1AVO A;  2QJK C;  5M18 A;  1M1J C;  2R32 A;  3HD7 C;  3AEE C;  1P84 E;  3GHG C;  1CZQ A;  1VQQ A;  1SQV E;  1NGM B;  3V2R A;  2LR2 A;  1L0L J;  3CCM P;  3H1J E;  3L72 G;  3HUS B;  3H1H D;  4U3F E;  3H1L G;  3HUS A;  2E76 D;  1YJN W;  3G71 P;  5GTI H;  1L0L K;  4I6M C;  3KQG A;  1TU3 F;  3W7S A;  1FZG A;  1JTH B;  5GTH E;  1FU1 A;  1RQS A;  1OMI A;  1BDC A;  3M9H A;  2OYI C;  4IO9 W;  4I2L C;  2G8Y A;  1VQO W;  2NRG A;  4BWN A;  1U7M A;  2FYZ A;  4GOE A;  2AEF A;  2BAS A;  4N3Y B;  4DT0 A;  4GDO A;  1SQP E;  4WY4 D;  1YIT W;  4LLH A;  3KZI E;  2JJL A;  4JF7 A;  2XND H;  2IYO A;  3UIA A;  3TNU A;  5CBO A;  1QLE D;  1S72 P;  1OXZ A;  3C1L A;  2L91 A;  1NTM J;  3H6P A;  3HE4 A;  3G71 W;  3TGU G;  2XU6 A;  3GQ1 A;  3RK3 D;  1T8Z A;  3RBZ A;  1GD2 E;  3A7O A;  1QL2 A;  1MG9 A;  3W68 A;  1JY2 P;  4PJ0 H;  1L0L E;  2N1T B;  3VP8 A;  5DJT B;  1P84 I;  3E7K A;  1H8A A;  1SQV D;  1L0N K;  3L73 J;  3EFF K;  5TIS H;  2FXO A;  1ZP0 C;  1NTK K;  2BCC D;  3TYY A;  5BVZ A;  1SP4 A;  2BEZ F;  2NPS C;  3I55 W;  1QL1 A;  1MBX C;  1M1J A;  1FDO A;  1GTW A;  1Y47 A;  2QG4 A;  3VP9 A;  1YQ4 C;  1A02 F;  3AEB C;  4GT1 A;  1VF5 C;  3MP7 B;  5E79 H;  2QE7 H;  1YYC A;  1ZW0 A;  3L73 E;  3V5B A;  2OTL P;  1NH4 A;  2E75 C;  1IFI A;  2YO2 A;  1YTZ T;  2XNX A;  1L0N J;  1K9M X;  3IAO A;  5B5E E;  4B86 A;  4D6T E;  2SPZ A;  1UIX A;  4Y28 J;  3VMA A;  4GOF A;  4HB1 A;  4R4M A;  1HGZ A;  3L37 A;  1UII A;  1LTJ A;  3G6E W;  1QVF O;  2OYI A;  3CC4 W;  2IFN A;  1VQ4 P;  2WSF J;  1N8R Q;  1ZN5 A;  3AEF C;  1T6A A;  3CCQ P;  1E79 H;  4OH8 B;  1SQB K;  2Y9Y A;  3H1L J;  1PP9 J;  2KXP B;  3B5N C;  2E75 D;  2KK7 A;  3BCC E;  2YO3 A;  3F5H A;  3CI9 A;  1VDF A;  2FYU E;  2ZJS E;  3II6 A;  3MZW B;  2QM7 A;  4W7Y A;  3CCU W;  3AE7 C;  1S5L X;  2QM8 A;  1DD4 A;  4TT3 H;  3L70 E;  2LXC B;  3OAK A;  1FDI A;  3E1I A;  2YNY A;  2PP6 A;  3O6Q A;  1M1K X;  2VRS A;  5APY A;  1BXY A;  2HG5 D;  1LT9 C;  4K35 A;  4XE5 B;  3TF5 A;  5APX A;  1KB9 H;  2ZJQ W;  1NTZ K;  3E1R A;  1KYO H;  2V7Q J;  2FYU J;  2GUV A;  2YXR B;  2OQQ A;  1JCD A;  3CME P;  1KD1 X;  2E43 A;  5AW2 B;  1WT6 A;  3AEA C;  2H43 A;  1JMM A;  3FXD A;  3L4F A;  1LTG C;  1NU1 J;  2ZJR W;  1SLQ A;  5APT A;  3BCC J;  3A5T A;  1T2K D;  3R2P A;  4D6T D;  1KYO E;  1HH0 A;  2GA1 A;  3O1F A;  3CCR P;  5CCH A;  3IF4 A;  1FZC B;  2IPP A;  1Q86 Q;  1LTJ B;  3CCL P;  1FBM A;  4PJ0 E;  1A02 J;  3CCR W;  2JR8 A;  4H0L C;  3Q5P A;  4IOI H;  2FYU K;  5KAF H;  3DNJ A;  1RE3 A;  1PP9 D;  1SQX J;  1IZN B;  2B9B A;  3AE9 C;  4PV1 C;  3U1A A;  3CC7 P;  2I1J A;  3GF3 A;  3CCS P;  3KHU A;  1M90 Q;  2YXQ B;  1NU1 E;  4NPF X;  2WTY A;  1NHL A;  5KLV G;  1K8A Q;  4UY8 Z;  3L35 A;  1Q81 Q;  1RQU A;  4Y99 C;  1BE3 D;  5AVS B;  3RK3 B;  3HD7 A;  4IFF A;  4IOC W;  1PPJ D;  2OYH A;  3CCE P;  1HGV A;  1HBW A;  5CCG A;  1GK4 A;  2MJZ A;  3O2H A;  3AE4 C;  3Q5R A;  1PV3 A;  1VF5 D;  4BL2 A;  1LT9 B;  2Q3I A;  2HFE D;  1BCC D;  2YKP A;  1FC2 C;  3SFD C;  3O8Z A;  4TLF A;  4Z1M H;  3I56 W;  1N7S B;  1ZOY C;  1NKN A;  3USS A;  1ZRT D;  5JVG W;  2N1T D;  2KB7 P;  1U57 A;  3I56 P;  4JBZ A;  1EC5 A;  2CPB A;  4I1L A;  2KUB A;  1FJP A;  3Q3D A;  2H89 C;  4DOJ A;  1FDM A;  2Y9Z A;  1RF1 A;  1DH3 A;  1LT9 A;  2O1K A;  4I7Z B;  5M19 A;  1DX7 A;  3ZFZ A;  4DZO A;  1YQ3 C;  3GW6 A;  1S1C X;  1RF1 B;  1K73 X;  4WVZ A;  2ZVN B;  5HL7 W;  5CJ0 A;  3FGA D;  3G3Z A;  5KJ7 C;  2FFD C;  1SQB G;  3KYQ A;  3V4Q A;  4I7Z C;  1KQG B;  2MKV A;  1PIX A;  4LC1 A;  2KIK A;  3OJA B;  3EWK A;  1KIL D;  2K9J A;  2M3B A;  4LGD E;  2IX7 C;  1SQV J;  5AVW B;  1GZL A;  3LID A;  3L72 D;  3CME W;  1IFM A;  2D2C B;  1FZC A;  3G4S W;  2QJP C;  2E5Y A;  3CCL W;  2O01 N;  1DIP A;  5AW4 B;  1RE3 C;  2WPQ A;  1M57 D;  1SQP J;  1GMJ A;  2W9R A;  2IZ0 A;  2XZR A;  3HD7 B;  3KPE A;  3PHL A;  3OW2 O;  3Q2Y A;  3H1K G;  3W7U A;  3CXH I;  3RBX A;  1BGY D;  2YMY A;  3AEG C;  3JSV C;  1OX3 A;  1J2J B;  2Q3E A;  1OVV A;  1IFP A;  2OYH C;  1G2C B;  2QA4 P;  4WWI A;  3TDK A;  1PGP A;  1SS1 A;  1P84 D;  2ZYD A;  1FZA A;  2A45 I;  3W7W A;  5AW0 B;  1VQ7 P;  1KIL B;  3GW1 A;  4RO0 A;  2P7J A;  1ZR2 A;  3GG2 A;  5GTH H;  1VQK P;  1QGK B;  2E76 C;  3HE5 A;  1KQF B;  1LTI C;  1KB9 I;  2OAR A;  1N7L A;  3MTU E;  4W7Z A;  1H0T B;  2B87 A;  1URQ C;  1E5W A;  3H1H G;  1JOC A;  4UB6 H;  1Q81 X;  2JWA A;  3ZG0 A;  5KAI E;  1YHQ W;  4EI2 A;  1RF1 C;  3V2P A;  1FS0 E;  1N8R X;  3Q1M A;  4DJG A;  3M06 A;  2Q6Q A;  2YKO A;  1H88 A;  2KOG A;  5KJ7 D;  5CCG D;  1QVF V;  2JEE A;  2OYO A;  2NPS B;  3L70 J;  2FFD B;  3H1K D;  3B71 A;  1EDI A;  1GL2 C;  1NAY A;  4PD4 H;  3IR9 A;  1ZV8 A;  1AV1 A;  3WMM 0;  1CTF A;  3QWO C;  4H44 B;  1SFC A;  1KOR A;  2O1J A;  1EXJ A;  1D7M A;  2KS1 B;  1G1I A;  4ZKU A;  4D6T G;  3RK3 E;  4NPD A;  4GOD A;  1JCC A;  1LTT C;  5GAG a;  2J59 M;  2E76 B;  4EOT A;  1N7S D;  3CX5 H; 
#chains in the Genus database with same CATH homology
 4H44 C;  1PL5 A;  3G9R A;  1HJ0 A;  1WMK A;  2J5U A;  4R4M A;  1AJY A;  3GW1 A;  3AE1 C;  3O1F A;  1MBU C;  2QIW A;  2WA8 A;  4YTP C;  4I7Z B;  2E75 B;  3AEC C;  2ZT9 D;  2E74 D;  4OGQ B;  2WA9 A;  3GF7 A;  3AE8 C;  3IN6 A;  2WSC J;  1YQ3 C;  1Y9B A;  2WSF J;  1Q90 D;  4H13 C;  1S1C X;  2WSE J;  3GQ1 A;  1VL2 A;  4H0L C;  4H13 B;  4R4L A;  5KLI C;  5M1B A;  2QJK C;  3SFE C;  3Q5P A;  1EXI A;  2E76 C;  1VF5 B;  3AEF C;  3DNJ A;  2JO1 A;  3AEE C;  1KIL E;  2BEQ D;  1KQF B;  4PV1 B;  1JB0 J;  3AE9 C;  4PV1 C;  2D2C C;  3FGA D;  1MG9 A;  1R6O C;  4YKA A;  3GF3 A;  2E75 D;  3AE2 C;  5L8R J;  2E74 B;  4OGQ C;  4I7Z C;  1KQG B;  2MKV A;  1PIX A;  2O01 J;  4YXD C;  2G3A A;  5KKZ C;  1DD3 A;  2WQY C;  1NGM B;  3AE5 C;  1IK7 A;  3G19 A;  3D6Y A;  3AE6 C;  1RQU A;  4H13 D;  3H25 A;  3AED C;  3EWK A;  3GLM A;  3O2O A;  3AE7 C;  2E76 D;  3S9O A;  3AE3 C;  3Q1M A;  3D71 A;  1S5L X;  1DD4 A;  2ZT9 C;  3G1B A;  1ZP0 C;  2ZT9 B;  2YIU C;  4TT3 H;  4H44 D;  3O2B A;  1TU3 F;  3ABV C;  2P10 A;  2FBW C;  1RQV A;  2D2C B;  2IDB A;  3O2H A;  1FDI A;  1KTM A;  3O6Q A;  2BEZ F;  2E74 C;  2QJP C;  3AE4 C;  3RL0 g;  3Q5R A;  1R6Q C;  1PV3 A;  1ZME C;  1VF5 D;  1DIP A;  1RQS A;  4IL6 X;  1OMI A;  1MBX C;  2NZ2 A;  4KT0 J;  3B71 A;  1ZRT E;  1FDO A;  4XFJ A;  2D2C D;  3GQ0 A;  1GMJ A;  3C8V A;  1KMI Z;  2FYN C;  3R4Y A;  3GMA A;  1MBV B;  4RKU J;  3SFD C;  4H0L B;  1YQ4 C;  3O1F B;  2W9R A;  4H0L D;  3AEB C;  4OGQ D;  2V7Q J;  2G8Y A;  2YMK A;  1VF5 C;  4Z1M H;  4PV1 D;  1CTF A;  2QSI A;  1ZOY C;  2OQQ A;  4H44 B;  3Q2Y A;  4YJM A;  1OW6 A;  3D6Z A;  3T97 B;  1KOR A;  1EXJ A;  2QJY C;  2E75 C;  3G3P A;  2WPV B;  2JP3 A;  1U57 A;  2H88 C;  3AEA C;  3AEG C;  3RK3 E;  4YJX A;  2FXP A;  1R8E A;  1LZW A;  1NYH A;  4GDO A;  1MKM A;  3D70 A;  2K9Y A;  3Q5S A;  3Q3D A;  2H89 C;  4U7J A;  3IAO A;  2E76 B;  1HF9 A;  1OW7 A;  1K04 A;  1OW8 A;  1UIX A;  3LW5 J;  1K05 A;  4Y28 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...