1DD9A

Structure of the dnag catalytic core
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
314
structure length
310
Chain Sequence
TLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMASE
publication title Structure of the RNA polymerase domain of E. coli primase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 96
structure length 310
sequence length 314
ec nomenclature ec 2.7.7.-:
pdb deposition date 1999-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08275 Toprim_N DNA primase catalytic core, N-terminal domain
A PF10410 DnaB_bind DnaB-helicase binding domain of primase
A PF13155 Toprim_2 Toprim-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.20 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 1dd9A03
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 1dd9A02
3.90.980.10 Alpha Beta Alpha-Beta Complex DNA primase DNAg catalytic core, N-terminal domain DNA primase, catalytic core, N-terminal domain 1dd9A01
4E2KA 4EDGA 1D3YA 2V1CA 4EDKA 2Q2EA 4JCVA 1VDDA 4EDRA 1EQNA 4EDTA 1T6T1 4O6OA 1DD9A 2AU3A 3VDPA 5GUJA 2ZBKA 4EDVA 1DDEA 3B39A 4O6PB 3VE5A 4EE1A 3VDUA
chains in the Genus database with same CATH superfamily
2JMSA 4E2KA 4EDGA 1D3YA 2NSWA 2V1CA 2KK2A 2LMKA 2FCJA 4EDKA 2I5RA 2Q2EA 1ERCA 3KXRA 4JCVA 4EDRA 1VDDA 1EQNA 3CU7A 4EDTA 2KC6A 1T6T1 4O6OA 2AU3A 1DD9A 3VDPA 5GUJA 3KLSA 2NSVA 2ZBKA 4EDVA 1DDEA 3B39A 2ERLA 4O6PB 2B39A 3VE5A 4EE1A 3VDUA
chains in the Genus database with same CATH topology
2JMSA 4E2KA 4EDGA 1D3YA 2NSWA 2V1CA 2KK2A 2LMKA 4EDKA 2Q2EA 1ERCA 3KXRA 4JCVA 4EDRA 1VDDA 1EQNA 3CU7A 4EDTA 2KC6A 1T6T1 4O6OA 2AU3A 1DD9A 3VDPA 5GUJA 3KLSA 2NSVA 2ZBKA 4EDVA 1DDEA 3B39A 2ERLA 4O6PB 2B39A 3VE5A 4EE1A 3VDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2K A;  4EDG A;  1D3Y A;  2V1C A;  4EDK A;  2Q2E A;  4JCV A;  1VDD A;  4EDR A;  1EQN A;  4EDT A;  1T6T 1;  4O6O A;  1DD9 A;  2AU3 A;  3VDP A;  5GUJ A;  2ZBK A;  4EDV A;  1DDE A;  3B39 A;  4O6P B;  3VE5 A;  4EE1 A;  3VDU A; 
#chains in the Genus database with same CATH topology
 2JMS A;  4E2K A;  4EDG A;  1D3Y A;  2NSW A;  2V1C A;  2KK2 A;  2LMK A;  2FCJ A;  4EDK A;  2I5R A;  2Q2E A;  1ERC A;  3KXR A;  4JCV A;  4EDR A;  1VDD A;  1EQN A;  3CU7 A;  4EDT A;  2KC6 A;  1T6T 1;  4O6O A;  2AU3 A;  1DD9 A;  3VDP A;  5GUJ A;  3KLS A;  2NSV A;  2ZBK A;  4EDV A;  1DDE A;  3B39 A;  2ERL A;  4O6P B;  2B39 A;  3VE5 A;  4EE1 A;  3VDU A; 
#chains in the Genus database with same CATH homology
 2JMS A;  4E2K A;  4EDG A;  1D3Y A;  2NSW A;  2V1C A;  2KK2 A;  2LMK A;  4EDK A;  2Q2E A;  1ERC A;  3KXR A;  4JCV A;  4EDR A;  1VDD A;  1EQN A;  3CU7 A;  4EDT A;  2KC6 A;  1T6T 1;  4O6O A;  2AU3 A;  1DD9 A;  3VDP A;  5GUJ A;  3KLS A;  2NSV A;  2ZBK A;  4EDV A;  1DDE A;  3B39 A;  2ERL A;  4O6P B;  2B39 A;  3VE5 A;  4EE1 A;  3VDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...