1DDNA

Diphtheria tox repressor (c102d mutant)/tox dna operator complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation/dna
molecule keywords 33 BASE DNA CONTAINING TOXIN OPERATOR
total genus 43
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ddnA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1ddnA02
2VBXA 3ABUA 4U0YA 1F1ZA 1U3EM 1XMKA 2ADUA 3BDDA 1SMTA 3H3ZA 1NHAA 2Y48A 5TRDA 1ZGAA 1SD7A 4HOBA 1USTA 1K78A 3HOTA 1ON2A 2EJRA 2Z3YA 2XROA 2CFXA 1LB2A 3GZ5A 2A5YB 1T39A 2CGPA 4A0XA 1ODDA 4O6JA 3GFLA 2V79A 1EH8A 4Q5SF 4HW0A 4HLXA 1D3YA 3IWZA 4EJTA 1S29A 3TOBA 2O8XA 3WTWC 4I09A 1Q1HA 1RUNA 4HQEA 1IZ1A 3W6JB 1ZLJA 3TKYA 2ISZA 3ZN1A 1LEBA 2A6EF 3I64A 3GW2A 3IKVA 5LHGA 1GVJA 3GEZA 2QENA 1ZN2A 4A5MA 3FF5A 1OYIA 1KU2A 1CF7A 1OPCA 3VB2A 1I5ZA 2K4JA 3S2WA 1XDSA 1IXRC 4M9SA 4QLCU 2R7FA 2EA4A 1X3UA 2DTRA 3F8CA 4I7HA 3EETA 2O0YA 5HDNA 1B4AA 2XUBA 5HVQC 1BC8C 2P6SA 2EV0A 3H92A 3H3UA 3WTZA 2PLYA 1H0MA 4P55A 3TQNA 5LRSA 4LK1F 4MEYF 2VXZA 1G6NA 1SD5A 3RIRA 3HRTA 2QZ8A 4XLNF 2UXNA 4G94A 2W25A 1HXDA 2DI3A 4UVCA 4I98B 1XN7A 1JGSA 4I0BA 3L2CA 3P9CA 2GAUA 3NEUA 2M8EA 2JZYA 2A61A 3KZYA 2O61A 3T8TA 5H20A 3FXRA 2V6CA 4GGGA 1FT9A 5HDKA 4R1HA 1ZYRF 1V4RA 1SFUA 2F2EA 1YIOA 1KU9A 3E6CC 3F72A 3OV8A 3ECHA 3MAJA 3JAMK 3B73A 3HSEA 3P9IA 1O7LA 2ZNZA 2EA2A 3V7RA 4BNCA 4KNYA 2P7VB 4HYEA 2FNAA 3WGIA 3QRFF 2ZCWA 3KP3A 4HF1A 1EV7A 3VODA 5E8IA 3LAPA 1FYMA 1K7AA 2YX4A 1OR7A 2NNYA 5DV5A 2V1UA 2DK8A 1U5TA 6PAXA 5FLXK 4UXNA 2PJPA 2GZWA 1FBSA 3CUQC 1FPQA 2OAZA 1USSA 4RB0A 1OYYA 4OIPF 2QBYB 2F5CA 3N97A 3ZMVA 4OMYA 1IXCA 4RB2C 1U78A 1QZZA 2FQ3A 1CGPA 1JHFA 1BI3A 1B6AA 1OKRA 1BI0A 3QP6A 1W5SA 4KIFA 4MTDA 1UFMA 4ENJA 3W6KB 3EQLF 1YQAA 1S7OA 3FXQA 3RYRA 4AIKA 4HA8A 3LQQA 1YS6A 4HX7A 4N9HA 3IKTA 2C6YA 4ZYEA 3T5XA 1FZPB 4Y17A 1P4XA 1R1UA 2RNJA 4EGYA 4IXAA 4XSXF 3T0YA 4CGZA 1SFEA 1ON1A 5CVUA 1KYZA 2XIGA 3FHZA 1DDNA 3WTYC 1G4DA 3DXJF 3GFMA 3U9GA 2D45A 1S8NA 2MLKA 3ZMDA 1R7JA 1WSUA 1EH7A 3CTAA 1K6OA 5E1ZB 3CO6C 5CJ9A 1AWCA 5ICFA 1B9NA 1B1BA 3HSFA 4LD5A 5BPDA 2XAHA 4RGSA 2NAZA 2M5WA 3V8JA 1HW1A 4RGUA 1PP8F 1TTYA 5D6FA 1ZLKA 3KP2A 1LDDA 5HS8A 3K1MA 3I58A 4K2EA 4AD9A 2L01A 3LA2A 3KLOA 5BQTA 2PI0A 3CLOA 1SFXA 1OYWA 5E18F 1P4AA 2XGXA 3F6VA 4KDPA 3J7AO 3O2PE 3GZ6A 1F9NA 5J6XA 3ML6A 3I4PA 1ZG1A 2PMHA 2V1XA 4JK1X 1U8RA 1ZARA 2H6BA 2QQBA 3RI4A 3C1DA 5E1XA 1BM9A 2F5FA 2PFBA 4HQMA 1XSVA 1XD7A 1MDMA 4GXOA 3ZMUA 4LGWA 1IRFA 4KYWA 2IPQX 4LLGF 1U6GA 2KIMA 2NRAC 4WXHA 5LGTA 2BYVE 1VTNC 2HKXA 2R7DA 3V8LA 4ZZDA 2HQNA 4AIHA 2X0LA 2F5EA 2EFPA 3E3VA 1STZA 3BJ6A 5IT3A 2RV8A 1XMAA 5EEHA 3BJOA 1SD4A 2A3SA 1FSEA 4BYYA 2Z33A 1P4WA 1R23A 2FBHA 1PP7U 3BPVA 3Q9VA 3IC7A 2K7LA 5BOXA 1MJ9A 2L4AA 1I1SA 3PFIA 4B8XA 4H0EA 5JI6A 2K4BA 3Q9SA 1RZ4A 1ZHFA 2UWMA 1UHWA 4G8XA 1XGMA 2VC1A 2ZJ2A 3GXOA 2H94A 1MGTA 3CUOA 5ICEA 4HDVA 2BGCA 2VOOA 2WV0A 4U0VA 3BPXA 3WGHA 3C7JA 1MDMB 2BBYA 3J80Z 3RTRA 3IRRA 3QPTA 1P6RA 3ZMSA 4U7DA 2PEXA 4O5VA 1KQ9A 2Q0OA 1KU3A 4LJZF 2VT3A 1YG2A 4M72A 3KP7A 5A2QK 3GYHX 3TO7A 4L9VA 1MZBA 2ZO4A 4EM1A 2FE3A 1Z1DA 1G3YA 3I54A 2Z5UA 2IRFG 3NQOA 3M8FA 1T38A 3ULQB 3ELKA 2OA4A 2P5KA 1Y0UA 2MBFA 4YFNF 2E7WA 1HQCA 1LEAA 3WG9A 4P9UA 2YX7A 3OOPA 2EWNA 3CUQB 2P6TA 1UB9A 2P4WA 3FM3A 2HR3A 3PQKA 4EM0B 5J8CA 2M1BA 4G7ZF 3GFJA 1U5TB 4KICA 5DEQA 1IN5A 4ZYGA 4WK8F 4DQ2A 2HQRA 1LJ9A 4UVBA 2CSOA 4PGHA 4RGRA 4RS8A 1IXSB 4A6EA 4YIIA 4MEXF 3LWFA 4HDUA 2K27A 4S05A 1Z7UA 2AS5F 3F3XA 5F64A 1J7KA 1J5YA 2VOPA 4Y15A 1IN6A 4HZFA 1YW7A 3BZ6A 3SXYA 4P5OA 2XAQA 3FMSA 2WC2A 4KN4X 4LK0F 3GVAA 2RGVA 3F21A 1ZH5A 2D2WA 1WRJA 3FWEA 4EM2A 5E8GA 2KRFA 1TW3A 1K79A 3ZMTA 1BC7C 2UXXA 2IA0A 4DNCA 2OQGA 3DV8A 1IN8A 5DUIA 1O7FA 3LAJA 2FEZA 4MHGA 1HSJA 1FX7A 3DPLC 5ICGA 5D8KB 2ZXJA 4BQAA 1LDKB 4EJVA 2FMLA 2ESHA 1T6SA 5HLHA 1DPUA 1FWZA 2P8TA 5ICCA 1B9MA 2J5PA 4N9IA 1E2XA 3MZHA 1TLHB 1TW2A 1YW9A 3MEXA 3WTSC 2L54A 3QOPA 1YW8A 4XLPF 1O3QA 3SFZA 4IVNA 4Z2YA 3RDIA 3LFKA 1MKMA 5LGUA 1YFHA 2H27A 2XV4S 2IT0A 4PGGA 4BHCA 3WGGA 3RYPA 4IRIA 2FF4A 2ETHA 4P9FA 5LEKA 4FX4A 4IJAA 2Y0MA 3ERED 3WU1B 5LLQA 4P96A 4ZYHA 3CJNA 4UHTA 3BWGA 1BOAA 1GXPA 3COAC 2GWRA 3RKWA 3KP5A 4PZJA 4A0ZA 2PQ8A 4EQQA 3KCCA 1IN7A 3BROA 2ELHA 2JPBA 4IPAA 2H6CA 5D4SA 5JR3A 5K5RA 2F5DA 4ON0A 3LSTA 2IW5A 2LSOA 3JTGA 2XASA 2CW0F 4EJUA 4RB1A 3JSPA 3QAHA 5BPIA 3K1NA 5HLIA 1EH6A 1H9GA 3EUHA 2MA3A 4NQWA 4YFXF 4Q4ZF 3WTTC 2HGCA 2HKOA 4L9NA 2L02A 4ENMA 4I2OA 2PBIA 4LLNA 1R5HA 1XSXA 2PG4A 4UNOA 5HS7A 5D5VB 1IW7F 3VFZA 4OOIA 4XBFA 4L5JA 1W7PA 1LNWA 3VEPA 3QP5A 4RGXA 1BI2A 4WX9A 2DAOA 2DO7A 1ULYA 4IF4A 3FZVA 5E17F 2VBWA 3MQ0A 1FBQA 3CO7C 2VONA 2EB7A 1T2KA 1OMIA 2XAFA 4S04A 2GIVA 3QU3A 5EEGA 2JTVA 5H6RA 1ZAOA 3LA3A 1JXSA 2CO5A 5DCFA 3RKXA 5K1YA 5D6EA 1WWXA 2XAGA 2E7XA 3TGNA 4BXUA 4U88A 4ESFA 2DLLA 3RKYA 1O3TA 2HDCA 1BIBA 3HTUA 4NB5A 3DPTA 3GF2A 1ZRDA 5J8FA 1L3LA 3IRQA 3QU6A 4ESJA 4A12A 4EMSA 2OD5A 1DP7P 4KFCA 3HRUA 1G3SA 1YS7A 4M73A 2KJCA 2ISYA 3M1EA 2IA1A 1S6LA 3F8MA 5L3FA 1HBXG 2MLGA 1XGOA 4G9YA 2RN7A 1LDJA 2IVMA 3HSRA 3R0JA 4CYDA 3MWMA 3HYIA 4ENKA 5LBQA 4LB5A 1I6XA 5LHIA 3D0SA 2RDPA 2P5LC 1J59A 3BP8A 4GYIA 2PMUA 2ZBKA 4GCVA 1JHHA 3HHHA 3ABTA 3QPHA 5FFXA 4TV7A 3KZZA 4ASNA 4WWCA 3R0AA 2EK5A 2STTA 2V1DA 3EDPA 2CQKA 1J9IA 4XRFA 5CLSA 4GO1A 4UV8A 5F6FA 3IHUA 2L4MA 4B09A 2QVOA 5D4RA 4R8HA 4UUVA 2IP2A 3BY6A 3I59B 2ZKZA 3FXUA 2OBPA 1QO0D 1S3JA 2HFHA 1S7AA 3FX3A 1F4KA 4YIFA 4AVPA 1E17A 1LVAA 1KQ0A 1KU7A 1R1VA 2P5VA 5IT9Z 1YLFA 4KT5C 4LLLA 2NNNA 3MZYA 4HLYA 5FGMA 2VBZA 3B02A 3E5QA 1JE8A 1HW2A 5L3CA 2A07F 3V4GA 5ERIA 4D0PA 4EV0A 1BN5A 3K0LA 1FNNA 5DD4A 4E70A 4YG2F 3ROUA 1R58A 3ZMZA 5CVJA 1O3RA 1KQ8A 1TQIA 3HOSA 4WF2A 4G6QA 2HOEA 1Z6RA 2HZTA 1SMYF 2QQ9A 3WE3A 2GXGA 1TBXA 5K5OA 5KK1A 2WWYA 2GXBA 4EJOA 2XAJA 2DQLA 3R60A 5LRRA 2FOKA 1QZYA 2QWWA 2X4HA 5CVVA 4M71A 2OQRA 2Q8KA 4WXCA 4MNUA 1T98A 5IT9K 2ACJA 3LA7A 3F22A 2QM3A 4L9JA 2ESNA 4CZZA 3HUGA 2GQQA 2YU3A 4ETSA 4OIRF 2E1NA 3G73A 5DUKA 5HLGA 3O3KA 3HIFA 2FA5A 3JAMZ 3RPUA 4HX4A 2A6HF 3O6BB 4PCQA 4L5IA 2G7HA 4A5NA 2DPDA 1RI7A 5JVTA 1FOKA 2B0LA 2W84A 2R3SA 3WU0A 5ILSA 2YPRA 1QGPA 2G7UA 2VE8A 1O57A 2BEOA 1XCBA 4HF0A 3T1BA 1QPMA 3CUQA 3L7WA 4KIBA 2LF8A 1MJBA 3ECOA 2CYYA 1ZG3A 4OMZA 5D5UB 2P7CB 5L3GA 5AIQA 3I5UA 2LDUA 2PN6A 4FT8A 3E6MA 4HAMA 4Q47A 3M7GA 5DYMA 2MD5A 5L3BA 1FP2A 5KVRA 4Y13A 2VBYA 5FD6A 5D5XB 2OZ6A 2MC3A 1DPRA 1ZGJA 4M9ZA 3F6OA 4UVAA 5FD5A 3DFGA 2DBBA 1QBJA 4RB3C 3IWFA 2FBKA 2AXLA 1ONVA 2D1HA 1IUYA 2DQRA 4N0BA 2M87A 5FFZA 3I0TA 3F8NA 1YTYA 3CDHA 3R4KA 4MQVA 2H09A 4KIGA 1I27A 2Q2EA 2UZKA 1W5TA 3J81Z 2HEOA 4AWXB 4HV6A 3GO5A 5ED4A 3JTHA 1HSTA 3FM5A 5FLXZ 3JSOA 3DEUA 1BIAA 2FMYA 3ZQ7A 1F5TA 5LGNA 3DKWA 4AIJA 3E5XA 1IF1A 5K5QA 1ZRFA 5LEJA 4IHTA 1A04A 2CG4A 4XSZF 3M9AA 2GA1A 5DDGA 1FP1D 5L3EA 3KP6A 3I53A 1KA8A 4EVIA 2EFQA 5ILVA 1SAXA 4BAYA 2VT2A 1T0FA 5D8LB 2RC4A 1V3FA 3KEOA 3F23A 4HF2A 2Y75A 3REOA 2EFOA 3WODF 2J5OA 3R6SA 2RKHA 1R5GA 5AIPA 1QNTA 3E97A 3SZTA 1FLIA 3WTVC 2D1VA 4MQ9F 5HOOA 5FB2A 2W24A 1P2FA 4RAZA 4R79A 2M30A 4OIOF 3DQVC 4G7OF 5DCMB 4U0WA 1R00A 4EGZA 3K1PA 1U5TC 4G7HF 1ZREA 3HTSB 2KIUA 4ENNA 2VODA 3SHFA 2FXAA 5LHHA 5E1WA 4HX8A 2DT5A 4OIQF 4KUMA 5JHUA 4O3MA 2O6GE 2QBYA 1HKSA 3N4MA 5HS9A 4LMYA 3KEQA 1C0WA 1REPC 1MJAA 4PDKA 4CICA 1LQ1A 2O03A 3WTXC 5H6QA 2XHKA 5ILUA 3C18A 3L9FA 2EV5A 2FRHA 2BE5F 3HRMA 2LKPA 3HHGA 4KN7X 4Q48A 2O3FA 2JT1A 3RJPA 3TO9A 3U2RA 4IRGA 2HS5A 2MH2A 3I59A 1WKMA 2TDXA 1Z91A 4M6XA 2E1CA 4OINF 5HDGA 3IL2A 2VC0A 1Z6TA 3GUDA 4JQFA 3SZPA 2A69F 3KLNA 3TOAA 5CVIA 4YFKF 1XGSA 1ZG5A 3D5LA 4ESBA 2RVCA 4KMFA 3K69A 2FBIA 1W7PB 3NRVA 1P92A 3HRSA 4GYGA 3Q5FA 2ZNYA 2WTEA 1KGSA 1K78B 3M8EA 4IHSA 3AAFA 2Z99A 1TNTA 2YSRA 4L18B 2KKOA 1BI1A 1UCRA 2JPCA 2MH9A 2OZUA 3ZN0A 4HBLA 2K86A 4M9XA 2STWA 2EFNA 2FU4A 4LB6B 2VN2A 3E6DA 1IN4A 4A6DA 1U2WA 3GWZA 1Z05A 1XGNA 1KYWA 4M74A 1D8KA 1FYLA 2NYXA 5E20A 1WI9A 3DF8A 1FY7A 4JBAA 1HW5A 1FC3A 4ZZLA 3SQNA 2M45A 3F8BA 3G3ZA 1GXQA 1D5VA 2L3DA 2KIFA 4L9TA 5TJJA 1R1TA 1R36A 1PDNC 5L3DA 3WE2A 4OU0A 2ZMEA 3ISPA 2EV6A 2OU2A 2BV6A 3MCZA 2XRNA 2DPUA 2XKPA 2IA2A 2HYGD 3EYIA 1AOYA 3FMRA 4CHUA 3R61A 3C3WA 2ZMEB 3TDUC 2QQAA 3FMQA 4KA4A 1BBYA 1DUXC 5BS6A 1SD6A 2KJBA 4RAYA 5D5WB 2NS0A 3P7NA 5F1RA 5FO5A 5JFRA 3K9TA 1XB4A 3L00A 1IAWA 3L09A 4MTEA 2A68F 2DK5A 2EFWA 1YO5C 1H9TA 3TO6A 1G3TA 1BJAA 4BH9A 2DU9A 3U1DA 1L0OC 2FNPA 4HV5A 1J75A 4WXDA 4BHPA 3ZP5A 1J2XA 4I0AA 4BHBA 2CWEA 1QQIA 3GFIA 4QWQA 4ZYDA 3ZPLA 3RPQA 3DP7A 4NHJA 1FBUA 3PQJA 2DW4A 4FHTA 4A2UA 1J0RA 3KP4A 4I02A 1RUOA 2V9VA 3KETA 1PUEE 2QLZA 5DCMA 4FX0A 4M6YA 3E5UA 2GA2A 1IRGA 1R22A 1G3WA 4WCGA 1UHMA 3GLXA 3LQRA 3I71A 1HKQA 2JSCA 2QUFA 4L0YB 3TDZC 2RQPA 4LFUA 2JRTA 5CYVA 1TQPA 4A0YA 4LG0A 3E6BA 3F8FA 1O3SA 4KMUX 3K2ZA 3KFWX 2G9WA 1MD0A 1ZRCA 2XKOA 1WQ2A 1TQMA 2XVCA 3VOEA 2QYOA 2K02A 2IJLA 1CF7B 1HKTA 1Z9CA 4MGRA 3V7CA 3P9KA 2HTJA 2ZFWA 2DFIA 4LG0B 3BOQA 2FSWA 3J81K 3MFKA 3EYYA 4U7BA 3J80K 4UV9A 3V7SA 4F7ZA 1FSHA 1B59A 1TNSA 2W57A 3V8KA 2YR2A 4ZH4F 2W85A 4EJWA 2HTSA 1I1GA 1XSDA 5AONA 3GX4X 1W7PD 4G6DA 2HWVA 1YYVA 4L0ZB 4CDGA 3KE2A 2COMA 3BJAA 2HYFA 2LNBA 2VE9A 1FYKA 1XCVA 5BMZA 1D8JA 1W4MA 2LF7A 5CVRA 1RNLA 4I01A 4CO8A 2Z9OA 4IRHA 5A2QZ 5DD8A 1RIOH 1XDUA 1GHCA 3JW4A 3WTUC 3T8RA 4CXFA
chains in the Genus database with same CATH superfamily
2VBXA 3ABUA 4U0YA 2IGKA 1F1ZA 2VQGA 1U3EM 3BCAA 1XMKA 2ADUA 2E36A 3BDDA 1SMTA 5CQGA 3H3ZA 1NHAA 2Y48A 2DOFA 5TRDA 1HCRA 3HOYJ 1ZGAA 1SD7A 4HOBA 1USTA 1K78A 1XTAA 3HOTA 1ON2A 2EJRA 2Z3YA 2XROA 1FMWA 1TWFJ 5BNGA 3OY9A 2CFXA 2KT0A 4DZJA 4AYBA 1VQOI 4XORA 1LB2A 1S9HA 3GZ5A 4F93B 2A5YB 1T39A 2CGPA 4A0XA 3O8GA 1ODDA 2I5UA 4O6JA 2LP0A 3H5NA 3ZCOA 3S15J 1MMSA 3GFLA 2V79A 2MVTA 1EH8A 4BJ5C 1X4OA 4Q5SF 4HW0A 4HLXA 4HG2A 1G8XA 1D3YA 3IWZA 4EJTA 1S29A 3TOBA 1KONA 2O8XA 4CA0A 2DDBA 3HM5A 3WTWC 2COBA 4I09A 1Q1HA 4BKXA 1RUNA 3S3NA 3HC7A 1IZ1A 3HEFA 4HQEA 2GOMA 1N25A 3W6JB 1ZLJA 3TKYA 4RAFA 2ISZA 2QF7A 3ZN1A 1LEBA 2E34A 2A6EF 3I64A 1SANA 3OYNA 3GW2A 2JUGA 3IKVA 5LHGA 1GVJA 3PO3J 3GEZA 5J1UA 2QENA 1ZN2A 4PSWA 2L7KA 3ZQHA 2XDVA 4A5MA 3FF5A 1MBJA 1OYIA 4CH7A 1KU2A 2XGDA 4A69C 4BY7J 1CF7A 1OPCA 2XB5A 3VB2A 4B44A 2R93J 1I5ZA 2K4JA 3Q0VA 1XDSA 1IXRC 3S2WA 4KISA 4M9SA 4QLCU 1WGXA 2R7FA 2EA4A 3S3MA 1N75A 3H3VK 4M3GA 3OYHA 1OQYA 1Q1VA 2IGMA 2I10A 1X3UA 3CCJI 2EIMH 2MW8A 3DTEA 1FOYA 2DTRA 2DJIA 3F8CA 1BJZA 3I4MJ 4I7HA 3EETA 2KHMA 2O0YA 1B4AA 2XUBA 5HDNA 1JJ6C 5HVQC 1BC8C 2P6SA 2F4IA 1HC8A 3BG5A 2EV0A 3H92A 3H3UA 4PJJA 2R5YB 3EUKL 3WTZA 3CCUI 1H8AC 1U9NA 4II3A 2PLYA 1H0MA 1ETKA 3JRBA 4P55A 3TQNA 5B66C 3BT9A 2VIXA 5LRSA 1JTXA 3ERMA 4LK1F 4MEYF 2ID6A 1FIAA 1G6NA 2HNHA 1SD5A 2VXZA 2GOXB 3SDBA 3RIRA 1WJBA 2ZXIA 3GZNB 1RPWA 3HRTA 3S93A 2QZ8A 4XLNF 4B48A 2UXNA 4G94A 3N05A 2W25A 4JOMA 1HXDA 1MW7A 2DI3A 2F4MB 4B47A 4UVCA 1UAAA 3A01B 1EJ9A 3MD2A 4LOCA 1IUFA 4I98B 2O8KA 1XN7A 4XM3A 1JGSA 1V5FA 1T56A 1ORKA 4I0BA 1HF0A 4CCKA 9ANTA 1YJWI 1MMAA 3L2CA 1Z77A 3VYTB 3P9CA 2GAUA 4C30A 1JUMA 3NEUA 5CKTA 2M8EA 2JZYA 1B72B 2A61A 3KZYA 1G59A 3BR2A 2O61A 3T8TA 3CLQA 5H20A 1VNDA 3FXRA 2XC7A 2V6CA 4GGGA 4XQFA 3PJRA 2VL8A 1R4MB 4ZDPA 3K4LA 1V5EA 1WZ2A 1FT9A 5HDKA 2LRDA 4R1HA 4M3BA 1ZYRF 4D7NA 3VPRA 4RLFA 1V4RA 4RM3A 2KZGA 2WV1A 1SFUA 2F2EA 3LOCA 1NH3A 2E2IJ 1YIOA 1KU9A 3E6CC 4DGWB 1WVRA 3F72A 2XSDC 3OV8A 3ECHA 4JYKA 3MAJA 2Y0SA 3QYBA 3JAMK 3B73A 3Q0UA 3QYFA 4CYCB 2BHYA 3HSEA 3P9IA 4V2FA 2ZNZA 1O7LA 2L9VA 2CJJA 2EA2A 3V7RA 2DA7A 3HZJA 4BNCA 4KNYA 2P7VB 4HYEA 1X2MA 1GV2A 2FNAA 3WGIA 2ZCWA 3KP3A 3QRFF 5EZGA 4Z6YA 1EV7A 3VODA 4HF1A 3K2AA 5E8IA 3LAPA 1FJLA 3H9GA 1R9TJ 1FYMA 1DU6A 2M35A 4I76A 1K7AA 2YX4A 1OR7A 2NNYA 1AKHB 5DV5A 2VJ4A 3J7YJ 2V1UA 3S1MJ 4D7MA 2DK8A 4OAYA 1U5TA 3FXKA 6PAXA 4UXNA 5FLXK 2JWTA 2PJPA 2QKLB 1N77A 3OIQA 3VYRB 1VQ9I 4LIUA 2GZWA 1I39A 1Y56A 1FBSA 1ENHA 2QKMB 1YRNB 3CUQC 1FPQA 2OAZA 1USSA 3S1NJ 3OYLA 2PJRB 4RB0A 1OYYA 2VI6A 5C4XJ 1IV8A 1JT6A 4OIPF 4HNTA 3OYAA 2QBYB 4II2A 3PNVA 2OV7A 2F5CA 3FISA 1B8IA 2R0QC 5FRMA 3N97A 5LFAA 1K61A 3ZMVA 3BQZA 4OMYA 3OS2A 3JR9A 1IXCA 3ZQGA 2D5VA 2CMPA 2F48A 2JUCA 3G2BA 1Y8QB 3IH4A 2NVXJ 3J7AY 4RB2C 3HBLA 1U78A 2K40A 3DBRB 1QZZA 2FQ3A 1CGPA 1JHFA 2VKVA 1BI3A 3IP4B 1B6AA 1OKRA 1BI0A 5KNLA 5KAFC 3QP6A 4J19A 2E19A 2DT6A 1W5SA 3FBIB 2BHZA 3ABLH 4KIFA 1POGA 4MTDA 1UFMA 5GTIC 3OSFA 3GTPJ 2XB0X 4ENJA 3H35A 2KZVA 4W97A 2MFZA 4E6KG 1UHSA 3W6KB 2XGEA 3EQLF 4XLFA 4HNUA 3OYMA 1YQAA 1S7OA 2RQQA 3LFUA 5IPAA 3FXQA 3MVPA 3RYRA 4AIKA 4HA8A 5HODA 3LQQA 1YS6A 4HX7A 4N9HA 3IKTA 2C6YA 4ZYEA 3T5XA 1MNEA 2QCOA 1FZPB 2M2EA 5E3LA 4Y17A 2BW3B 1P4XA 2WA0A 1R1UA 3VYUB 3W2VA 2QQ8A 4YIRX 2RNJA 2WAQA 3HOVJ 4EGYA 4IXAA 1VF9A 4XSXF 3T0YA 4CGZA 1OCZH 2QGUA 1SFEA 1ON1A 5CVUA 1D5YA 1KYZA 3A4CA 3TW6A 2XIGA 5EG0B 3FHZA 5FLXR 1DDNA 4UUSA 3CF2A 3GTJJ 3WTYC 1G4DA 3GFMA 3DXJF 3K10A 2LKSA 3U9GA 3JRDA 5B5EC 2D45A 4IKFA 1S8NA 5JVGF 3G1OA 1NG6A 2EZHA 2HOSA 2MLKA 3ZMDA 5JHFA 1R7JA 3EPZA 1WSUA 3ZOBA 3RKQA 4B1RA 2CV1A 4UUSB 1EH7A 3BZKA 3CTAA 2LYCA 4FETA 1K6OA 2KQRA 1FTTA 4IOCF 4LG3A 5E1ZB 3CO6C 5CJ9A 2EBIA 3BTCA 3JAMR 4DZPA 4F3QA 1YE9A 1AWCA 1MBEA 5ICFA 3H36A 4ANJA 2VPLA 3H9QA 1B9NA 1B1BA 2DOAA 2OCEA 3HSFA 3LMMA 4LD5A 3W2AA 4W1UA 2XAHA 5J4YA 4RDUA 5BPDA 1LE8A 4RGSA 2BW3A 2NAZA 2M5WA 2HPIA 3V8JA 4BEHB 1HW1A 4RGUA 4I99C 4XKWA 2CQXA 1PP8F 1TTYA 2HPMA 3BZCA 2JA7J 4AM3A 5D6FA 1ZLKA 4EATA 3D5RC 3KP2A 1LDDA 5HS8A 3K1MA 3I58A 4K2EA 4AD9A 2L01A 3LA2A 4HRIA 3KLOA 5BQTA 4A93J 2PI0A 3CLOA 1SFXA 1OYWA 1JKOC 3VDXA 5E18F 1P4AA 4B3XA 2XGXA 3F6VA 4KDPA 3C2HA 3KYCB 2VJ5A 3J7AO 4CCMA 3O2PE 3GZ6A 1F9NA 4IQ4A 1IDYA 2X6WA 5J6XA 3ML6A 4XNFA 3I4PA 1ZG1A 2PMHA 2V1XA 4JK1X 2JK3A 1U8RA 4AC0A 3UKGA 3I3LA 2R7SA 1OCOH 1X3ZB 1ZARA 1Z3YA 2H6BA 2QQBA 3RI4A 1S72I 3C1DA 5E1XA 1SEUA 1JGGA 3CC7I 1IG7A 1BM9A 2F5FA 2PFBA 4HQMA 1XSVA 4JX4A 1XD7A 1MDMA 3CC2I 4GXOA 1VQ7I 3LL7A 4NQWB 3ZMUA 2VQLA 2BXYA 3TEDA 2GBYA 1WJEA 2TCTA 4LGWA 1IRFA 3BR1A 3ZXSA 2PJRA 2HQAA 4KYWA 1D1AA 3OSGA 3DTKA 3IUOA 2IPQX 4M3FA 4C2TA 4LLGF 3TMOA 1U6GA 1ZKGA 3LSRA 2K9LA 2KIMA 2NRAC 4WXHA 3HOZJ 2HDDA 2X85A 1VQMI 4KITB 3HOXJ 4AVZA 3JREA 1ITYA 1QZEA 2BVLA 3JRHA 5LGTA 2BYVE 1XMXA 3B6CA 1MSEC 1VTNC 2HKXA 2R7DA 2OUMA 2E2HJ 3V8LA 4ZZDA 2CUJA 5FRNA 2VKEA 4CCLA 2HQNA 4AIHA 2X0LA 2F5EA 3MKZA 1AU7A 2NVUB 3TL4X 1TWHJ 2LY2A 4HSRA 3HOWJ 2EFPA 3E3VA 5HNFA 1YJNI 2NVTJ 1STZA 3BJ6A 5IT3A 4DYCA 2RV8A 1XMAA 3S3OA 2GLOA 2ECCA 2X6OA 5KCMA 5EEHA 5HNHA 3BR5A 3BJOA 3PNTA 2R5ZB 5J40A 5B3SH 1SD4A 2A3SA 1MSFC 2NS8A 2BZTA 1FSEA 4BYYA 2Z33A 4PJNA 1P4WA 3FKJA 4DBRA 1R23A 2FBHA 5DS9A 1PP7U 1SC7A 1VQ4I 1IDZA 3KYDB 3BPVA 1QA6A 5GAHJ 3Q9VA 3IC7A 2VJJA 2K7LA 4F92B 5BOXA 5J4VA 1MJ9A 2L4AA 1I1SA 2E71A 2R7UA 3PFIA 4ZTJA 1NTCA 3TBIA 1KZHA 4B8XA 4QTRA 4H0EA 3WG7H 1H89C 4JX5A 1MNMC 5JI6A 2K4BA 3Q9SA 1RZ4A 1ZHFA 4A3EJ 2UWMA 4YRVA 1UHWA 3F9KA 4IHXA 4CUGA 1RKWA 2LY9A 1BW6A 4G8XA 2IEKA 1MIJA 1XGMA 2VC1A 2LH9A 2ZJ2A 3GXOA 2H94A 4BDZA 3ZQQA 2VPRA 2HU9A 3DLAA 1MGTA 3CUOA 5ICEA 2L9SA 4HDVA 3CMMA 1W5CC 3BCBA 4XRMA 3MKWB 5HLTA 2BGCA 2VOOA 2WV0A 4U0VA 3DBHB 1WJDA 3BPXA 2LOOA 3WGHA 3C7JA 2R7VA 1M1EB 3I9V2 1YHQI 1MDMB 4BE0A 2BBYA 3K4KA 3J80Z 3RTRA 3IRRA 2VUMJ 2H1LA 1P6RA 3QPTA 4IHWA 2DYSH 2LC2A 3ZMSA 3OOUA 4U7DA 2PEXA 4O5VA 1KQ9A 1DU0A 2Q0OA 1KU3A 4LJZF 5KHDA 2VT3A 1ZR4A 4IHYA 2VASA 1YG2A 4M72A 3KP7A 3DBLB 2I8DA 5A2QK 3GYHX 3ZQCA 3S14J 2DODA 3TO7A 4L9VA 1MZBA 4XN3A 4BDYA 1BL0A 1UZCA 5K7ZA 2ZO4A 4EM1A 3CJRB 1R49A 2FE3A 1HLVA 1Z1DA 3HG9A 5FLMJ 3A02A 4RAGA 2F5VA 1G3YA 2Q2EB 1X19A 3CCEI 1N78A 3I54A 2Z5UA 2IRFG 3NQOA 1QHGA 3F0CA 2CQQA 3M8FA 2B7EA 2IS6A 3H0GJ 4XR6A 1OFCX 1T38A 3ULQB 3ELKA 1U8BA 2OA4A 3LSIA 4ZC3A 1X4PA 2M0MA 2P5KA 2CUFA 5FJ8J 2E60A 1E3HA 1Y0UA 4BE1A 2MBFA 3K4JA 4YFNF 3ASOH 2E7WA 1HQCA 2QSFX 2DDAA 1LEAA 3WG9A 4P9UA 2YX7A 2M4KA 3D1NI 3OIOA 3OOPA 4IL6C 2EWNA 4MFDA 3CUQB 2P6TA 1UB9A 2P4WA 2ZSHB 2CUEA 4C3IJ 3FM3A 3DLLF 1R71A 2HR3A 3PQKA 4EM0B 5J8CA 1W36D 2M1BA 3C2GA 4G7ZF 4FCYA 3ZR8X 3P5JA 2ELJA 3GFJA 5IYCJ 1U5TB 4YEJA 4KICA 5DEQA 1IN5A 3NWSA 4ZYGA 4WK8F 4DQ2A 2EZIA 4CSWA 2HQRA 1WPKA 1LJ9A 4UVBA 3CMEI 2CSOA 4BUPA 1X3WB 4PGHA 2FUG2 4RGRA 1MBHA 4XOPA 3BC8A 4A3GJ 1IJWC 2CFOA 2KRHA 1R6RA 4RS8A 4A3KJ 1IXSB 5EDNA 4A6EA 1OLTA 4YIIA 4MEXF 2EPFA 3LWFA 3JRGA 4HDUA 2K27A 1FIPA 2VQHA 5DTDA 4S05A 4ITVA 2CQ7A 5FKKA 3S2HJ 2ZMEC 1Z7UA 1IRZA 2AS5F 3F3XA 5F64A 3FXJA 1J7KA 1S5LC 2Q1ZB 3ONQA 1J5YA 2VOPA 4Y15A 2R7RA 5IYDJ 1SVMA 1IN6A 4HZFA 2M34A 2Y9ZA 1YW7A 3BZ6A 3LSHA 3BG7A 4Y33A 5EZHA 2IS2A 1FMVA 3SXYA 4P5OA 3FMSA 2XAQA 2WC2A 4KN4X 4D1QA 1TP4A 2ME0A 2X98A 3MMYB 4C3HJ 4LK0F 2A5WA 3GVAA 2RGVA 3F21A 1ZH5A 1YX5A 2D2WA 3PIOF 1WRJA 2WY8Q 3RQIA 1UJ8A 2JA8J 3FWEA 4EM2A 5E8GA 2KRFA 3LSMA 5F04A 2DMPA 3A2KA 2OPTA 4IEJA 1TW3A 1K79A 3ZMTA 1ETVA 1FEXA 2HVRA 1BC7C 2UXXA 2IA0A 4XOTA 4DNCA 2OQGA 2VXDA 3D5SC 3DV8A 1R5ID 2AO9A 3K70C 1X1PA 4E7HA 3HJEA 1IN8A 5DUIA 1TWGJ 3CMYA 1O7FA 3LAJA 2FEZA 3G71I 4MHGA 3OYCA 3X2QH 3S1QJ 1HSJA 1FX7A 2YUSA 3DPLC 4C2MJ 4BE2A 2CRGA 1H88C 4LITA 5ICGA 2ELKA 3L2RA 5D8KB 1OJLA 2ZXJA 5CQEA 4BQAA 1LDKB 2W48A 2LMDA 2MC4A 2FMLA 2BXZA 2ESHA 2RAEA 1X1DA 4EJVA 1T6SA 2Y30A 2M7BA 5HLHA 1DPUA 3EUHC 3A52A 1FWZA 2P8TA 3AG3H 5GP9A 3RCOA 5C44J 5ICCA 1B9MA 4E7ZA 2J5PA 3FBNB 4XN0A 4N9IA 4E4HA 5E79C 1E2XA 2KISA 3I4NJ 3MZHA 1TLHB 1AKHA 3PL8A 2CH0A 2K5CA 1TW2A 1YW9A 3MEXA 3WTSC 2L54A 3DU6A 3QOPA 1YW8A 4XLPF 1BR1A 1O3QA 3SFZA 4IVNA 3QPLA 4Y7NJ 2HXIA 4Z2YA 1K4SA 2LD5A 3RDIA 3LFKA 1MKMA 1TL8A 5LGUA 1YFHA 2MG4A 2H27A 4CYCA 4ZDOA 2XV4S 2IT0A 2LBFA 2W82A 4PGGA 1A36A 4BHCA 1PYVA 1R4NB 3WGGA 3RYPA 3I56I 4IRIA 2FF4A 1PUFB 2BY0A 4QIWN 4BQNA 2ETHA 2M7AA 4P9FA 4BEHA 5LEKA 4FX4A 5GPCA 1VQKI 4IJAA 2Y0MA 2LVSA 4ABZA 3ERED 3WU1B 2FX0A 5LLQA 3IH3A 4NC8A 4FTHA 2ZXWH 4P96A 4ZYHA 1DGRM 3CJNA 1HOMA 2K9SA 4UHTA 1SFKA 1PUFA 4BBRJ 3OYBA 3BWGA 3ZGKA 1BOAA 2M8GX 4HSTA 2HDWA 2UV1A 1GXPA 3COAC 3W6VA 4J00A 2GWRA 3RKWA 4XKBA 4IO9F 3KP5A 1MH3A 4PZJA 1JT0A 4A0ZA 1APLC 4S0HB 3MKLA 2PQ8A 4EQQA 3KCCA 2LTPA 1IN7A 1T0FC 5M5WJ 3BROA 5K7FA 1G2HA 2ELHA 2JPBA 3GMEA 1D0YA 3FKIJ 4IPAA 2H6CA 4V2GA 5D4SA 5F0HA 3RQ4A 5JR3A 3KYLA 5EG0A 5K5RA 2F5DA 4ON0A 5TISC 1VQ5I 3MN2A 3JRAA 3LSTA 2IW5A 2LSOA 3JTGA 2JVGA 2XASA 2CW0F 2V9KA 1MMDA 4A3BJ 3A0BC 4EJUA 2V4JC 4RB1A 3JSPA 1D0ZA 4FASD 5E3NA 3QAHA 4XRSA 3CJTB 5BPIA 3K1NA 5HLIA 1WCMJ 1EH6A 1H9GA 1NG7A 3EUHA 1WH7A 2MA3A 2JMWA 4NQWA 1GV5A 3G4SI 5LD2C 4YFXF 4Q4ZF 2H1KA 3WTTC 2HGCA 2HKOA 3SEQA 2VKHA 4L9NA 3K70D 2X9DA 2L02A 4ENMA 4M3DA 2JJ7A 4ZJZA 4I2OA 2PBIA 4LLNA 1R5HA 2DA1A 2O9LA 4PJLA 5M5YJ 4V19K 1XSXA 2PG4A 4UNOA 1MNDA 5HS7A 5D5VB 1IW7F 3VFZA 4OOIA 4XBFA 2YU9J 4L5JA 1Z67A 1W7PA 1LNWA 3VEPA 3QP5A 4RGXA 1BI2A 4WX9A 2ZJQF 2DAOA 2Z1DA 3AL0B 2DO7A 4BY1J 3S16J 1ULYA 4HPQA 4IF4A 2ZB9A 2IGOA 1Y1VJ 4OWRB 2TRTA 4XKVA 3FZVA 1VQNI 2FQ4A 4XKCA 5E17F 2VBWA 2XF5A 4BXXJ 3MQ0A 1FBQA 3FIWA 3CO7C 2VONA 3DU5A 2GXAA 1RR8C 1WFXA 3M07A 3KEYA 2EQRA 1OR7C 1RESA 1AA7A 2EB7A 1T2KA 1OMIA 3A03A 3CESA 2XAFA 2WAQN 4S04A 2GIVA 3QU3A 4F91B 5EEGA 2JTVA 5H6RA 2HOTA 1T95A 1ZAOA 3S17J 2M4GA 4MIMA 3LA3A 1YRNA 1JXSA 1QVUA 3SEZA 4X1EA 4BJTA 1YI2I 2CO5A 5DCFA 3RKXA 1Z3XA 5K1YA 5D6EA 1WWXA 2XAGA 4BACA 2E7XA 3TGNA 4BXUA 1P7IA 5M3FJ 4U88A 2XF7A 2DA4A 4ESFA 3RPUD 5IY5H 2DLLA 3H1CA 3RKYA 1O3TA 2HDCA 1BIBA 3RZDJ 3HTUA 2VQCA 1HDPA 4NB5A 3VSKA 4DYRA 2JA6J 3DPTA 3GF2A 4A3FJ 3ZQLA 3K4MA 1ZRDA 5J8FA 1IRXA 1A5JA 4CCJA 5GAEJ 3CCQI 1QVTA 1L3LA 2E5NA 2DXIA 2JN6A 3IRQA 2MGQA 3QU6A 4ESJA 5TGTA 4A12A 3PUBA 3HOUJ 4BGDA 5FLVA 2ICWG 4EMSA 4HNVA 2BY3A 2OD5A 1SAUA 1DP7P 4KFCA 3HRUA 1G3SA 1YS7A 4KT6A 3NAUA 2EIKH 4M73A 2KJCA 2M3AA 2V26A 2ISYA 3M1EA 2ZJRF 2IA1A 3QODA 1S6LA 5F0CA 1K4TA 5E3MA 1HDDC 3F8MA 1X1AA 1I6HJ 1MMGA 2DYRH 3E7LA 5L3FA 3S8PA 1HBXG 1OISA 2MLGA 1XGOA 4G9YA 2RN7A 1LDJA 2CUZA 2IVMA 3SJMA 2AHQA 3HSRA 2IS1A 3R0JA 4CYDA 3MWMA 3HYIA 4ENKA 2H8RA 5LBQA 1J09A 4Y3OA 4LB5A 3EUAA 5F0FA 1OCPA 1I6XA 2HXOA 5LHIA 3D0SA 2RDPA 2P5LC 1J59A 1NK2P 2AXTC 1QPIA 4A3IJ 3OL4A 4G12A 3BP8A 4GYIA 2PMUA 2W7NA 3ZRGA 2ZBKA 4GCVA 3K7AJ 1NK3P 4EEFG 3BTIA 1JHHA 3HHHA 4XIDA 1ETXA 2DT7B 3CJQB 4E7SA 3M1CA 3ABTA 3QPHA 5FFXA 4NNJA 4TV7A 3KZZA 1DQUA 4ASNA 3GTGJ 4WWCA 1BW5A 3R0AA 2EK5A 3HKZN 2STTA 1Y1WJ 1JKPC 2V1DA 3EDPA 4IQJA 2CQKA 4H4KC 1J9IA 2OCCH 4XRFA 5CLSA 2Y0SN 4GO1A 1ETYA 4UV8A 1LE8B 5F6FA 3IHUA 3LNQA 2DA5A 2L4MA 2UUZA 4JP0A 4B09A 2QVOA 4UB6C 2B9SA 2DFEA 5D4RA 2IXSA 4R8HA 2DA3A 5GTHC 1UMQA 2DTZA 2IP2A 2LG4A 4UUVA 3BY6A 3I59B 1D1CA 2ZKZA 3FXUA 2OBPA 4D9JA 4YELA 4XL9A 1QO0D 1S3JA 5GADJ 2HFHA 1S7AA 3FX3A 2EILH 3OWTA 4DYQA 1F4KA 1JJ8C 2KDOA 4AVPA 4YIFA 1E17A 5KAIC 3KIOA 4AU7A 1LVAA 1KQ0A 1KU7A 3BTJA 1R1VA 2P5VA 4CZCA 1E0EA 5IT9Z 1YLFA 3AL0C 2K3FA 5DM7F 4KT5C 4LLLA 2NNNA 1A35A 3MZYA 1SVOA 4GRIA 4HLYA 5FGMA 1WI3A 2VBZA 3B02A 3CP8A 4AYBN 1WJFA 2QEXI 5F27A 1I3AA 3E5QA 1JE8A 1HW2A 4B43A 5L3CA 2ID3A 2A07F 4RBOA 3V4GA 2Z2SB 1WJ5A 5ERIA 4D0PA 4EV0A 1BN5A 3OYJA 1VQLI 3K0LA 1OCRH 1FNNA 2E1MB 5DD4A 4E70A 2V9PA 5J1YA 2HI3A 4YG2F 1TZLA 3ROUA 1R58A 2ZJPF 3ZMZA 5CVJA 1O3RA 2FD5A 1KQ8A 1TQIA 3HOSA 4WF2A 4G6QA 1GUUA 2HOEA 1Z6RA 2WB1N 2HZTA 5J1RA 1SMYF 4B4CA 2QQ9A 2OC6A 2E35A 2L5QA 3WE3A 3DPUA 2GXGA 2DFFA 1TBXA 3OS1A 5K5OA 4PFPA 5KK1A 3RZOJ 2DA2A 2RREA 1RKTA 2WWYA 2HOAA 2GXBA 1RC9A 1MH4A 2LY1A 4EJOA 3LSJA 2XAJA 1MBKA 1RQ6A 2DQLA 3R60A 2IBDA 5EJCA 3CDLA 5LRRA 3J81R 2FOKA 2E5ZA 3L2UA 1QZYA 1W1WE 2QWWA 2X4HA 5CVVA 4M71A 2OQRA 2Q8KA 4WXCA 1LVKA 2HVQA 4MNUA 1T98A 3DTIA 2HZDA 5IT9K 2X6XA 2ACJA 1LUJB 2IAIA 3LA7A 3F22A 2KFDA 1RR7A 2QM3A 4L9JA 1I50J 2ESNA 4CZZA 2G0EA 3HUGA 2GQQA 3DWLE 2YU3A 4RA2A 2R5YA 4ETSA 1T08B 4OIRF 2ECBA 2E1NA 3G73A 1D1BA 5DUKA 5HLGA 2OTJI 2XPWA 3HIFA 3O3KA 2FA5A 1ZGWA 2VJIA 2MSYA 3ABMH 3CZ6A 3H5RA 3JAMZ 3RPUA 4HX4A 2KIQA 2A6HF 3O6BB 4MO7A 4PCQA 4XLHA 1U9OA 4A3DJ 4L5IA 2G7HA 3FDYA 2XPUA 4A5NA 5IP7J 2DPDA 3CCVI 2OJED 1XX5A 3PO2J 1RI7A 1QHHD 4MFEA 5JVTA 1BOBA 1FOKA 2B0LA 2L9NA 2W84A 2R3SA 1XC5A 3WU0A 5ILSA 2YPRA 1QGPA 2G7UA 2L2OA 2VE8A 1O57A 2BEOA 3L1PA 2XF6A 2JSPA 1XCBA 4HF0A 3T1BA 1QPMA 4BU2A 3CUQA 1ZQ3P 3L7WA 4BS9A 4KIBA 2LF8A 1MJBA 3ECOA 2CYYA 1ZG3A 4OMZA 5D5UB 4PUSA 5L3GA 2P7CB 2CS3A 2MD0A 2JA2A 5AIQA 4IOAF 4CCNA 3I5UA 2LDUA 2X1CA 3K4NA 2PN6A 2K3PA 4FT8A 4M6VA 3E6MA 3TW7A 1XPXA 1B72A 4NUBA 1P9QC 4HAMA 1TWAJ 3SDGA 4Q47A 3G1MA 3M7GA 2DMTA 5DYMA 5EYRA 2Y9YA 3JRCA 2MD5A 5L3BA 1FP2A 1O4XA 1HA8A 5KVRA 4Y13A 3L2VA 2VBYA 5FD6A 1FOXA 5D5XB 4F52A 3A01A 2OZ6A 2MC3A 3DCFA 1DPRA 4FISA 4XICA 1Z7LA 1ZGJA 4M9ZA 3F6OA 4UVAA 5FD5A 3DFGA 4A3MJ 4ZTFA 2DBBA 2A05A 5FKNA 5M5XJ 1QBJA 4RB3C 3IWFA 1YIJI 1A31A 2FBKA 2AXLA 3IAM2 4U87A 1ONVA 3MZ8A 4AUXA 3K4BA 4XONA 2D1HA 1IUYA 2DQRA 3HXLA 2X1DA 5GPAA 3HGGA 3CF5F 2NVQJ 4N0BA 2M87A 1FOWA 3I0TA 3F8NA 5FFZA 1YTYA 3CDHA 3R4KA 4MQVA 5F08A 2AQFA 2DMNA 5M3MJ 1W0UA 2H09A 2VLAA 1JTYA 4KIGA 3BG3A 1ETQA 1I27A 3OIPA 1JKRC 3M4OJ 2MUNA 5F1JA 2Q2EA 2UZKA 1W5TA 2KDZA 3J81Z 2CU7A 2PMZN 2HEOA 4AWXB 2MZ4A 4HV6A 3GO5A 1IO2A 2WAEA 4B3AA 5ED4A 3JTHA 4Y4RA 1ACIA 1HSTA 3FM5A 1V55H 5FLXZ 3JSOA 3DEUA 2XGCA 1W36C 2IGNA 3I55I 2KPMA 1BIAA 2R7XA 2BVMA 2FMYA 1ZELA 3VSLA 3ZQ7A 4PJ0C 5E3OA 2Y31A 1F5TA 5LGNA 3DKWA 4AIJA 3E5XA 4RM2A 1IF1A 2X51A 3WU2C 3BR3A 4NC7A 2VB6A 3GCMA 5K5QA 1ZRFA 1V5GA 2DMUA 5LEJA 1PVEA 2Z16A 4IHTA 1A04A 3OL3A 4P1WA 1UELB 2CG4A 4XSZF 5J47A 1LFUP 2R7OA 2F6CA 4QPOA 2KLOA 5FKOA 3G1LA 5FROA 2KMUA 3M9AA 4BL0B 2GA1A 5DDGA 4I6ZA 1FP1D 5L3EA 3KP6A 3I53A 1KA8A 4GDFA 4EVIA 2EFQA 2L7ZA 5ILVA 1QU3A 4XLCA 1F43A 2XSJC 1SAXA 1OCTC 2KP6A 4BAYA 2VT2A 1T0FA 4QPQA 2JVHA 5D8LB 2RC4A 1V3FA 3KEOA 4NDLA 3F23A 4HF2A 3O8HA 2OF7A 1U0JA 2Y75A 1F36A 3REOA 2QSHX 2EFOA 2RNGA 3WODF 4N4NB 2N8GA 3OYKA 2J5OA 3MKYB 3R6SA 2RKHA 1R5GA 5AIPA 1QNTA 3CC4I 3E97A 3CCRI 3SZTA 4BXFA 2NVYJ 4D5CA 4FQGA 1FLIA 1ZTRA 3WTVC 3E1SA 2D1VA 2V7FA 5EGOA 4MQ9F 3LSPA 5HOOA 5FB2A 2W24A 3QOEA 4IX7A 1P2FA 3UNGC 2WAFA 1BA5A 1IGNA 1TC3C 2HVSA 4RAZA 4R79A 3U1KA 3CQZJ 3GTLJ 1E3OC 2M30A 4OIOF 3DQVC 3CCMI 4G7OF 3PSFA 5DCMB 3DEWA 4U0WA 1R00A 4EGZA 2L7FP 3K1PA 1U5TC 4G7HF 3QYEA 2R4GA 2LFBA 1ZREA 2V1NA 2DFHA 3AG4H 3DKYA 3HTSB 2WBMA 2KIUA 5DM6F 4ENNA 2VODA 2XRLA 1ERDA 3SHFA 2FXAA 5LHHA 4HEA2 3KZIC 5E1WA 2EH3A 4HX8A 2DT5A 4OIQF 4KUMA 4AIDA 3H9JA 5JHUA 1V54H 2AQEA 3LSKA 2JA5J 3BTLA 5EGOB 4O3MA 4DIQA 2O6GE 2ZC2A 5IP6A 2QBYA 4RMNA 1HKSA 3N4MA 5HS9A 3SFIA 4LMYA 3ESWB 3KEQA 2CW8A 5IYBJ 1C0WA 1REPC 1MJAA 3TP0A 4NC6A 4PDKA 2W1OA 4QSHA 4CICA 2CW7A 1T8IA 1LQ1A 2O03A 3WTXC 5H6QA 3BLYA 5IP9J 2XHKA 5ILUA 3C18A 3L9FA 1Y8RB 2EV5A 2FRHA 2BE5F 3HRMA 3CCLI 1QRYA 2LKPA 4RLQA 3KX2A 2NXNB 3HHGA 3S2DJ 2BY2A 1DGWY 4KN7X 4Q48A 2O3FA 2JT1A 3RJPA 2QA4I 3TO9A 3U2RA 4IRGA 5J3LA 2HQ5A 2HS5A 2MYSA 2MH2A 5GAGJ 3FK6A 3I59A 1WKMA 2DCEA 2EINH 2TDXA 1Z91A 4M6XA 2E1CA 3BQYA 4OINF 5HDGA 3S32A 3OYGA 4PJMA 3HKZA 2CQNA 3IL2A 2ZXHA 2GM4A 3UR3C 1GLNA 2W00A 3PNYA 2FOWA 3OYEA 1EA3A 2VC0A 1Z6TA 3GUDA 4KJZA 1XS9A 3WHCA 4JQFA 1VQ8I 3SZPA 2PX9A 2A69F 3PSIA 3DKXA 4X6AJ 1JI8A 5CPRB 3KLNA 1YJ9I 3TOAA 1K83J 3WHBA 3J7AW 1TWCJ 5IOYA 3VWBA 4C9YA 5CVIA 4YFKF 1XGSA 1ZG5A 2DJNA 5JLWA 2KL4A 3Q0WA 4GFBA 2LREA 3D5LA 4ESBA 2RVCA 3CD6I 4KMFA 1MMNA 2Y69H 3K69A 3KPHA 4XMYA 1DP3A 2FBIA 1W7PB 3NRVA 1P92A 2P0TA 4DOZA 4C2UA 3HRSA 2M0CA 5H2FC 4GYGA 5C4JJ 3Q5FA 2ZNYA 2WTEA 1LFBA 1KGSA 1YX3A 3M8EA 3HPGA 3HGYA 2K9NA 1K78B 3J80R 4ZDLA 3E0JB 5K7HA 3JRFA 4IHSA 1I3QJ 3AAFA 1VQPI 2Z99A 3ZQFA 1TNTA 1VZ0A 2YSRA 4L18B 2KKOA 2H8WA 2WB1A 3IH2A 1MBFA 1BI1A 1UCRA 2JPCA 2LK2A 2MH9A 2OZUA 4BQOA 4IZZA 3OYIA 5A2QR 2E1MC 5FKLA 3QPSA 4HBLA 3ZN0A 1S7EA 2K86A 3CCYA 1GDTA 4M9XA 2YS9A 5B1AH 2STWA 2EFNA 1A6IA 2FU4A 2R7TA 4LB6B 4X0GA 3RSNA 2VN2A 3E6DA 4BJ6C 5C3EJ 3OYDA 1VI0A 1IN4A 2DOEA 2R7ZJ 3OMYA 3V42A 2E1OA 4A6DA 4XK4A 1U2WA 3GWZA 1Z05A 1IV6A 1XGNA 1KYWA 4M74A 4IHVA 1D8KA 3C2BA 1FYLA 2DMQA 2NYXA 5E20A 2A6TA 1WI9A 3DF8A 3AFHA 1FY7A 4JBAA 1HW5A 1FC3A 4ZZLA 4XRSG 3CP2A 3SQNA 4CCOA 2ME6A 2M45A 1LKXA 2B63J 3A0HC 3F8BA 3G3ZA 1GXQA 4A3LJ 1D5VA 4UB8C 3BR6A 2L3DA 3H0DA 2KIFA 3FXOA 2L7MP 4L9TA 4UUTA 1R1TA 5TJJA 1R36A 2LKXA 5L3DA 1PDNC 3WE2A 4OU0A 1TT0A 2IS4A 1IC8A 2ZMEA 3ISPA 2EV6A 3W2WA 3PM1A 2O7OA 3S1RJ 3BR0A 3NWTA 4DJAA 2OU2A 1OCCH 2VKDA 4FE7A 2JQ7A 1WHUA 2BV6A 3MCZA 2XRNA 2DPUA 1ETWA 2IA2A 1GVDA 2HYGD 2XKPA 4XLEA 4DBQA 3L2QA 4JX6A 3EYIA 1AOYA 3FMRA 2WY7Q 4CHUA 2PMZA 3R61A 3CDIA 3C3WA 2ZMEB 3TP3A 3TDUC 2QQAA 1ZK8A 3FMQA 1EF4A 4KA4A 1BBYA 1DUXC 5BS6A 1SD6A 2KJBA 4RAYA 5D5WB 4BBSJ 2NS0A 3P7NA 1TT5B 2GIZA 1ZR2A 3SZGA 1JKQC 5F1RA 3GTMJ 5FO5A 5JFRA 3K9TA 1BR4A 1XB4A 3L00A 2EIJH 2MABA 3G6EI 4E7KA 4A3JJ 1IAWA 1SFOJ 3OYFA 3L09A 4MTEA 1W0TA 2A68F 4ZYAA 2JRMA 2DK5A 3FXLA 2EFWA 1WJCA 1YO5C 1LPQA 1H9TA 2LR8A 3TO6A 1G3TA 1BJAA 3CMAI 3NARA 4BH9A 2QSGX 2DU9A 3U1DA 3OS0A 1L0OC 2BOLA 4J01A 2P81A 2FNPA 3PIPF 3HB9A 4HV5A 3HL2A 1J75A 4WXDA 4BHPA 3ZP5A 1WH5A 1J2XA 4I0AA 2E2JJ 4BHBA 2CWEA 4N4OB 1QQIA 1JUSA 4QWQA 3GFIA 2R7WA 4ZYDA 3ZPLA 2L0KA 3RPQA 3DP7A 1BR2A 4NHJA 1FBUA 3PQJA 2FJ1A 2EZKA 2DW4A 3AKZA 4FHTA 4A2UA 1J0RA 3KP4A 4I02A 4XLAA 1RUOA 1Z21A 3B6AA 5EF6A 2V9VA 3GTOJ 1EKEA 3KETA 1YOVB 1Y0NA 2W4SA 2CV0A 3M8JA 1E3PA 2R7QA 2DA6A 1PUEE 2QLZA 5DCMA 4FX0A 2NOJB 4M6YA 3VYSB 1RETA 1X1BA 3E5UA 2GA2A 3JCUC 1R22A 3J7ZI 1IRGA 1G3WA 3A1YA 2XPVA 3SYTA 2ZSIB 4E7IA 4WCGA 1UHMA 3GLXA 3LQRA 3CCSI 1VQ6I 4C3JJ 1A6QA 3I71A 2CV2A 3M3YJ 1HKQA 2JSCA 2QUFA 4L0YB 2LLKA 3TDZC 2RQPA 4M3EA 4LFUA 2JRTA 5CYVA 3U21A 4UY8I 2EZLA 2X6YA 4FE4A 1Z0XA 3ASNH 1TQPA 1B8IB 2Y2ZA 4A0YA 1T33A 3GBGA 1RRJA 2K85A 4LG0A 3E6BA 3F8FA 1O3SA 4DW6A 1K6YA 4KMUX 1AHDP 3K2ZA 3GTKJ 5B1BH 3Q3SA 3GTQJ 1D0XA 3KFWX 2G9WA 3HPHA 1MD0A 1ZRCA 2R92J 2XKOA 1WQ2A 2L9RA 2ZFUA 3FXMA 3OR1C 3PUFA 2XAUA 2F4OB 4LIVA 3L2WA 3QWLA 1XG1A 1TQMA 2XVCA 3VOEA 2QYOA 4OAZA 1FTZA 2K02A 2NOGA 5IT9R 4PFOA 1SVLA 2IJLA 1CF7B 3ZQIA 1HKTA 1Z9CA 1PJRA 3K6GA 4F55A 4PK4A 4MGRA 3V7CA 3P9KA 2HTJA 2ZFWA 2DFIA 4LG0B 3BOQA 2FSWA 3J81K 3MFKA 3EYYA 4U7BA 2OTLI 3HDDA 3J80K 1Y39A 1WJAA 2KRCA 4L5EA 4UV9A 1YITI 2O5RA 3ABKH 3V7SA 4Y52J 4PSXA 4F7ZA 1FSHA 1B59A 1LFPA 2V6EA 2DN0A 1X58A 1TNSA 2W57A 2R5ZA 3V8KA 2YR2A 3OR2C 2K9QA 3H5AA 4ZH4F 3BG9A 5IOZA 2X1EA 2W85A 1VFCA 2LBFB 4EJWA 1ETOA 2HTSA 1I1GA 1XSDA 3JRIA 5AONA 3GX4X 1JUPA 1W7PD 4G6DA 5JLXA 2BY1A 4D5FA 2HWVA 1YYVA 4L0ZB 1UG2A 4CDGA 1GT0C 2K9MA 3KE2A 1P7JA 2COMA 2HYJA 4A3CJ 3BJAA 2HYFA 3QQAA 2LNBA 4NBQA 2VE9A 2X48A 4E7JA 1FYKA 4E7LA 3GLLA 3AG2H 4MLOA 3IV5A 1X1CA 1XCVA 3FK7A 4G6TB 1UG0A 5BMZA 1MBGA 1D8JA 1W4MA 2LF7A 5CVRA 2WADA 1RNLA 4I01A 4CO8A 2Z9OA 3AG1H 4IRHA 5A2QZ 5DD8A 1RIOH 3BG6A 1XDUA 3DEEA 3FHNA 1GHCA 1X2NA 2M9HA 1Y6IA 5FKMA 3HUGB 2P0WA 3JW4A 3W3CA 3PFYA 3IAS2 1CQTA 3WTUC 4BQQA 2NS7A 3LSGA 3K4CA 5EEAA 3T8RA 4CXFA
chains in the Genus database with same CATH topology
2VBXA 3ABUA 4U0YA 1F1ZA 1U3EM 1XMKA 2ADUA 3BDDA 1SMTA 3H3ZA 1NHAA 2Y48A 5TRDA 1ZGAA 1SD7A 4HOBA 1USTA 1K78A 3HOTA 1ON2A 2EJRA 2Z3YA 2XROA 2CFXA 1LB2A 3GZ5A 2A5YB 1T39A 2CGPA 4A0XA 1ODDA 4O6JA 3GFLA 2V79A 1EH8A 4Q5SF 4HW0A 4HLXA 1D3YA 3IWZA 4EJTA 1S29A 3TOBA 2O8XA 3WTWC 4I09A 1Q1HA 1RUNA 4HQEA 1IZ1A 3W6JB 1ZLJA 3TKYA 2ISZA 3ZN1A 1LEBA 2A6EF 3I64A 3GW2A 3IKVA 5LHGA 1GVJA 3GEZA 2QENA 1ZN2A 4A5MA 3FF5A 1OYIA 1KU2A 1CF7A 1OPCA 3VB2A 1I5ZA 2K4JA 3S2WA 1XDSA 1IXRC 4M9SA 4QLCU 2R7FA 2EA4A 1X3UA 2DTRA 3F8CA 4I7HA 3EETA 2O0YA 5HDNA 1B4AA 2XUBA 5HVQC 1BC8C 2P6SA 2EV0A 3H92A 3H3UA 3WTZA 2PLYA 1H0MA 4P55A 3TQNA 5LRSA 4LK1F 4MEYF 2VXZA 1G6NA 1SD5A 3RIRA 3HRTA 2QZ8A 4XLNF 2UXNA 4G94A 2W25A 1HXDA 2DI3A 4UVCA 4I98B 1XN7A 1JGSA 4I0BA 3L2CA 3P9CA 2GAUA 3NEUA 2M8EA 2JZYA 2A61A 3KZYA 2O61A 3T8TA 5H20A 3FXRA 2V6CA 4GGGA 1FT9A 5HDKA 4R1HA 1ZYRF 1V4RA 1SFUA 2F2EA 1YIOA 1KU9A 3E6CC 3F72A 3OV8A 3ECHA 3MAJA 3JAMK 3B73A 3HSEA 3P9IA 1O7LA 2ZNZA 2EA2A 3V7RA 4BNCA 4KNYA 2P7VB 4HYEA 2FNAA 3WGIA 3QRFF 2ZCWA 3KP3A 4HF1A 1EV7A 3VODA 5E8IA 3LAPA 1FYMA 1K7AA 2YX4A 1OR7A 2NNYA 5DV5A 2V1UA 2DK8A 1U5TA 6PAXA 5FLXK 4UXNA 2PJPA 2GZWA 1FBSA 3CUQC 1FPQA 2OAZA 1USSA 4RB0A 1OYYA 4OIPF 2QBYB 2F5CA 3N97A 3ZMVA 4OMYA 1IXCA 4RB2C 1U78A 1QZZA 2FQ3A 1CGPA 1JHFA 1BI3A 1B6AA 1OKRA 1BI0A 3QP6A 1W5SA 4KIFA 4MTDA 1UFMA 4ENJA 3W6KB 3EQLF 1YQAA 1S7OA 3FXQA 3RYRA 4AIKA 4HA8A 3LQQA 1YS6A 4HX7A 4N9HA 3IKTA 2C6YA 4ZYEA 3T5XA 1FZPB 4Y17A 1P4XA 1R1UA 2RNJA 4EGYA 4IXAA 4XSXF 3T0YA 4CGZA 1SFEA 1ON1A 5CVUA 1KYZA 2XIGA 3FHZA 1DDNA 3WTYC 1G4DA 3DXJF 3GFMA 3U9GA 2D45A 1S8NA 2MLKA 3ZMDA 1R7JA 1WSUA 1EH7A 3CTAA 1K6OA 5E1ZB 3CO6C 5CJ9A 1AWCA 5ICFA 1B9NA 1B1BA 3HSFA 4LD5A 5BPDA 2XAHA 4RGSA 2NAZA 2M5WA 3V8JA 1HW1A 4RGUA 1PP8F 1TTYA 5D6FA 1ZLKA 3KP2A 1LDDA 5HS8A 3K1MA 3I58A 4K2EA 4AD9A 2L01A 3LA2A 3KLOA 5BQTA 2PI0A 3CLOA 1SFXA 1OYWA 5E18F 1P4AA 2XGXA 3F6VA 4KDPA 3J7AO 3O2PE 3GZ6A 1F9NA 5J6XA 3ML6A 3I4PA 1ZG1A 2PMHA 2V1XA 4JK1X 1U8RA 1ZARA 2H6BA 2QQBA 3RI4A 3C1DA 5E1XA 1BM9A 2F5FA 2PFBA 4HQMA 1XSVA 1XD7A 1MDMA 4GXOA 3ZMUA 4LGWA 1IRFA 4KYWA 2IPQX 4LLGF 1U6GA 2KIMA 2NRAC 4WXHA 5LGTA 2BYVE 1VTNC 2HKXA 2R7DA 3V8LA 4ZZDA 2HQNA 4AIHA 2X0LA 2F5EA 2EFPA 3E3VA 1STZA 3BJ6A 5IT3A 2RV8A 1XMAA 5EEHA 3BJOA 1SD4A 2A3SA 1FSEA 4BYYA 2Z33A 1P4WA 1R23A 2FBHA 1PP7U 3BPVA 3Q9VA 3IC7A 2K7LA 5BOXA 1MJ9A 2L4AA 1I1SA 3PFIA 4B8XA 4H0EA 5JI6A 2K4BA 3Q9SA 1RZ4A 1ZHFA 2UWMA 1UHWA 4G8XA 1XGMA 2VC1A 2ZJ2A 3GXOA 2H94A 1MGTA 3CUOA 5ICEA 4HDVA 2BGCA 2VOOA 2WV0A 4U0VA 3BPXA 3WGHA 3C7JA 1MDMB 2BBYA 3J80Z 3RTRA 3IRRA 3QPTA 1P6RA 3ZMSA 4U7DA 2PEXA 4O5VA 1KQ9A 2Q0OA 1KU3A 4LJZF 2VT3A 1YG2A 4M72A 3KP7A 5A2QK 3GYHX 3TO7A 4L9VA 1MZBA 2ZO4A 4EM1A 2FE3A 1Z1DA 1G3YA 3I54A 2Z5UA 2IRFG 3NQOA 3M8FA 1T38A 3ULQB 3ELKA 2OA4A 2P5KA 1Y0UA 2MBFA 4YFNF 2E7WA 1HQCA 1LEAA 3WG9A 4P9UA 2YX7A 3OOPA 2EWNA 3CUQB 2P6TA 1UB9A 2P4WA 3FM3A 2HR3A 3PQKA 4EM0B 5J8CA 2M1BA 4G7ZF 3GFJA 1U5TB 4KICA 5DEQA 1IN5A 4ZYGA 4WK8F 4DQ2A 2HQRA 1LJ9A 4UVBA 2CSOA 4PGHA 4RGRA 4RS8A 1IXSB 4A6EA 4YIIA 4MEXF 3LWFA 4HDUA 2K27A 4S05A 1Z7UA 2AS5F 3F3XA 5F64A 1J7KA 1J5YA 2VOPA 4Y15A 1IN6A 4HZFA 1YW7A 3BZ6A 3SXYA 4P5OA 2XAQA 3FMSA 2WC2A 4KN4X 4LK0F 3GVAA 2RGVA 3F21A 1ZH5A 2D2WA 1WRJA 3FWEA 4EM2A 5E8GA 2KRFA 1TW3A 1K79A 3ZMTA 1BC7C 2UXXA 2IA0A 4DNCA 2OQGA 3DV8A 1IN8A 5DUIA 1O7FA 3LAJA 2FEZA 4MHGA 1HSJA 1FX7A 3DPLC 5ICGA 5D8KB 2ZXJA 4BQAA 1LDKB 4EJVA 2FMLA 2ESHA 1T6SA 5HLHA 1DPUA 1FWZA 2P8TA 5ICCA 1B9MA 2J5PA 4N9IA 1E2XA 3MZHA 1TLHB 1TW2A 1YW9A 3MEXA 3WTSC 2L54A 3QOPA 1YW8A 4XLPF 1O3QA 3SFZA 4IVNA 4Z2YA 3RDIA 3LFKA 1MKMA 5LGUA 1YFHA 2H27A 2XV4S 2IT0A 4PGGA 4BHCA 3WGGA 3RYPA 4IRIA 2FF4A 2ETHA 4P9FA 5LEKA 4FX4A 4IJAA 2Y0MA 3ERED 3WU1B 5LLQA 4P96A 4ZYHA 3CJNA 4UHTA 3BWGA 1BOAA 1GXPA 3COAC 2GWRA 3RKWA 3KP5A 4PZJA 4A0ZA 2PQ8A 4EQQA 3KCCA 1IN7A 3BROA 2ELHA 2JPBA 4IPAA 2H6CA 5D4SA 5JR3A 5K5RA 2F5DA 4ON0A 3LSTA 2IW5A 2LSOA 3JTGA 2XASA 2CW0F 4EJUA 4RB1A 3JSPA 3QAHA 5BPIA 3K1NA 5HLIA 1EH6A 1H9GA 3EUHA 2MA3A 4NQWA 4YFXF 4Q4ZF 3WTTC 2HGCA 2HKOA 4L9NA 2L02A 4ENMA 4I2OA 2PBIA 4LLNA 1R5HA 1XSXA 2PG4A 4UNOA 5HS7A 5D5VB 1IW7F 3VFZA 4OOIA 4XBFA 4L5JA 1W7PA 1LNWA 3VEPA 3QP5A 4RGXA 1BI2A 4WX9A 2DAOA 2DO7A 1ULYA 4IF4A 3FZVA 5E17F 2VBWA 3MQ0A 1FBQA 3CO7C 2VONA 2EB7A 1T2KA 1OMIA 2XAFA 4S04A 2GIVA 3QU3A 5EEGA 2JTVA 5H6RA 1ZAOA 3LA3A 1JXSA 2CO5A 5DCFA 3RKXA 5K1YA 5D6EA 1WWXA 2XAGA 2E7XA 3TGNA 4BXUA 4U88A 4ESFA 2DLLA 3RKYA 1O3TA 2HDCA 1BIBA 3HTUA 4NB5A 3DPTA 3GF2A 1ZRDA 5J8FA 1L3LA 3IRQA 3QU6A 4ESJA 4A12A 4EMSA 2OD5A 1DP7P 4KFCA 3HRUA 1G3SA 1YS7A 4M73A 2KJCA 2ISYA 3M1EA 2IA1A 1S6LA 3F8MA 5L3FA 1HBXG 2MLGA 1XGOA 4G9YA 2RN7A 1LDJA 2IVMA 3HSRA 3R0JA 4CYDA 3MWMA 3HYIA 4ENKA 5LBQA 4LB5A 1I6XA 5LHIA 3D0SA 2RDPA 2P5LC 1J59A 3BP8A 4GYIA 2PMUA 2ZBKA 4GCVA 1JHHA 3HHHA 3ABTA 3QPHA 5FFXA 4TV7A 3KZZA 4ASNA 4WWCA 3R0AA 2EK5A 2STTA 2V1DA 3EDPA 2CQKA 1J9IA 4XRFA 5CLSA 4GO1A 4UV8A 5F6FA 3IHUA 2L4MA 4B09A 2QVOA 5D4RA 4R8HA 4UUVA 2IP2A 3BY6A 3I59B 2ZKZA 3FXUA 2OBPA 1QO0D 1S3JA 2HFHA 1S7AA 3FX3A 1F4KA 4YIFA 4AVPA 1E17A 1LVAA 1KQ0A 1KU7A 1R1VA 2P5VA 5IT9Z 1YLFA 4KT5C 4LLLA 2NNNA 3MZYA 4HLYA 5FGMA 2VBZA 3B02A 3E5QA 1JE8A 1HW2A 5L3CA 2A07F 3V4GA 5ERIA 4D0PA 4EV0A 1BN5A 3K0LA 1FNNA 5DD4A 4E70A 4YG2F 3ROUA 1R58A 3ZMZA 5CVJA 1O3RA 1KQ8A 1TQIA 3HOSA 4WF2A 4G6QA 2HOEA 1Z6RA 2HZTA 1SMYF 2QQ9A 3WE3A 2GXGA 1TBXA 5K5OA 5KK1A 2WWYA 2GXBA 4EJOA 2XAJA 2DQLA 3R60A 5LRRA 2FOKA 1QZYA 2QWWA 2X4HA 5CVVA 4M71A 2OQRA 2Q8KA 4WXCA 4MNUA 1T98A 5IT9K 2ACJA 3LA7A 3F22A 2QM3A 4L9JA 2ESNA 4CZZA 3HUGA 2GQQA 2YU3A 4ETSA 4OIRF 2E1NA 3G73A 5DUKA 5HLGA 3O3KA 3HIFA 2FA5A 3JAMZ 3RPUA 4HX4A 2A6HF 3O6BB 4PCQA 4L5IA 2G7HA 4A5NA 2DPDA 1RI7A 5JVTA 1FOKA 2B0LA 2W84A 2R3SA 3WU0A 5ILSA 2YPRA 1QGPA 2G7UA 2VE8A 1O57A 2BEOA 1XCBA 4HF0A 3T1BA 1QPMA 3CUQA 3L7WA 4KIBA 2LF8A 1MJBA 3ECOA 2CYYA 1ZG3A 4OMZA 5D5UB 2P7CB 5L3GA 5AIQA 3I5UA 2LDUA 2PN6A 4FT8A 3E6MA 4HAMA 4Q47A 3M7GA 5DYMA 2MD5A 5L3BA 1FP2A 5KVRA 4Y13A 2VBYA 5FD6A 5D5XB 2OZ6A 2MC3A 1DPRA 1ZGJA 4M9ZA 3F6OA 4UVAA 5FD5A 3DFGA 2DBBA 1QBJA 4RB3C 3IWFA 2FBKA 2AXLA 1ONVA 2D1HA 1IUYA 2DQRA 4N0BA 2M87A 5FFZA 3I0TA 3F8NA 1YTYA 3CDHA 3R4KA 4MQVA 2H09A 4KIGA 1I27A 2Q2EA 2UZKA 1W5TA 3J81Z 2HEOA 4AWXB 4HV6A 3GO5A 5ED4A 3JTHA 1HSTA 3FM5A 5FLXZ 3JSOA 3DEUA 1BIAA 2FMYA 3ZQ7A 1F5TA 5LGNA 3DKWA 4AIJA 3E5XA 1IF1A 5K5QA 1ZRFA 5LEJA 4IHTA 1A04A 2CG4A 4XSZF 3M9AA 2GA1A 5DDGA 1FP1D 5L3EA 3KP6A 3I53A 1KA8A 4EVIA 2EFQA 5ILVA 1SAXA 4BAYA 2VT2A 1T0FA 5D8LB 2RC4A 1V3FA 3KEOA 3F23A 4HF2A 2Y75A 3REOA 2EFOA 3WODF 2J5OA 3R6SA 2RKHA 1R5GA 5AIPA 1QNTA 3E97A 3SZTA 1FLIA 3WTVC 2D1VA 4MQ9F 5HOOA 5FB2A 2W24A 1P2FA 4RAZA 4R79A 2M30A 4OIOF 3DQVC 4G7OF 5DCMB 4U0WA 1R00A 4EGZA 3K1PA 1U5TC 4G7HF 1ZREA 3HTSB 2KIUA 4ENNA 2VODA 3SHFA 2FXAA 5LHHA 5E1WA 4HX8A 2DT5A 4OIQF 4KUMA 5JHUA 4O3MA 2O6GE 2QBYA 1HKSA 3N4MA 5HS9A 4LMYA 3KEQA 1C0WA 1REPC 1MJAA 4PDKA 4CICA 1LQ1A 2O03A 3WTXC 5H6QA 2XHKA 5ILUA 3C18A 3L9FA 2EV5A 2FRHA 2BE5F 3HRMA 2LKPA 3HHGA 4KN7X 4Q48A 2O3FA 2JT1A 3RJPA 3TO9A 3U2RA 4IRGA 2HS5A 2MH2A 3I59A 1WKMA 2TDXA 1Z91A 4M6XA 2E1CA 4OINF 5HDGA 3IL2A 2VC0A 1Z6TA 3GUDA 4JQFA 3SZPA 2A69F 3KLNA 3TOAA 5CVIA 4YFKF 1XGSA 1ZG5A 3D5LA 4ESBA 2RVCA 4KMFA 3K69A 2FBIA 1W7PB 3NRVA 1P92A 3HRSA 4GYGA 3Q5FA 2ZNYA 2WTEA 1KGSA 1K78B 3M8EA 4IHSA 3AAFA 2Z99A 1TNTA 2YSRA 4L18B 2KKOA 1BI1A 1UCRA 2JPCA 2MH9A 2OZUA 3ZN0A 4HBLA 2K86A 4M9XA 2STWA 2EFNA 2FU4A 4LB6B 2VN2A 3E6DA 1IN4A 4A6DA 1U2WA 3GWZA 1Z05A 1XGNA 1KYWA 4M74A 1D8KA 1FYLA 2NYXA 5E20A 1WI9A 3DF8A 1FY7A 4JBAA 1HW5A 1FC3A 4ZZLA 3SQNA 2M45A 3F8BA 3G3ZA 1GXQA 1D5VA 2L3DA 2KIFA 4L9TA 5TJJA 1R1TA 1R36A 1PDNC 5L3DA 3WE2A 4OU0A 2ZMEA 3ISPA 2EV6A 2OU2A 2BV6A 3MCZA 2XRNA 2DPUA 2XKPA 2IA2A 2HYGD 3EYIA 1AOYA 3FMRA 4CHUA 3R61A 3C3WA 2ZMEB 3TDUC 2QQAA 3FMQA 4KA4A 1BBYA 1DUXC 5BS6A 1SD6A 2KJBA 4RAYA 5D5WB 2NS0A 3P7NA 5F1RA 5FO5A 5JFRA 3K9TA 1XB4A 3L00A 1IAWA 3L09A 4MTEA 2A68F 2DK5A 2EFWA 1YO5C 1H9TA 3TO6A 1G3TA 1BJAA 4BH9A 2DU9A 3U1DA 1L0OC 2FNPA 4HV5A 1J75A 4WXDA 4BHPA 3ZP5A 1J2XA 4I0AA 4BHBA 2CWEA 1QQIA 3GFIA 4QWQA 4ZYDA 3ZPLA 3RPQA 3DP7A 4NHJA 1FBUA 3PQJA 2DW4A 4FHTA 4A2UA 1J0RA 3KP4A 4I02A 1RUOA 2V9VA 3KETA 1PUEE 2QLZA 5DCMA 4FX0A 4M6YA 3E5UA 2GA2A 1IRGA 1R22A 1G3WA 4WCGA 1UHMA 3GLXA 3LQRA 3I71A 1HKQA 2JSCA 2QUFA 4L0YB 3TDZC 2RQPA 4LFUA 2JRTA 5CYVA 1TQPA 4A0YA 4LG0A 3E6BA 3F8FA 1O3SA 4KMUX 3K2ZA 3KFWX 2G9WA 1MD0A 1ZRCA 2XKOA 1WQ2A 1TQMA 2XVCA 3VOEA 2QYOA 2K02A 2IJLA 1CF7B 1HKTA 1Z9CA 4MGRA 3V7CA 3P9KA 2HTJA 2ZFWA 2DFIA 4LG0B 3BOQA 2FSWA 3J81K 3MFKA 3EYYA 4U7BA 3J80K 4UV9A 3V7SA 4F7ZA 1FSHA 1B59A 1TNSA 2W57A 3V8KA 2YR2A 4ZH4F 2W85A 4EJWA 2HTSA 1I1GA 1XSDA 5AONA 3GX4X 1W7PD 4G6DA 2HWVA 1YYVA 4L0ZB 4CDGA 3KE2A 2COMA 3BJAA 2HYFA 2LNBA 2VE9A 1FYKA 1XCVA 5BMZA 1D8JA 1W4MA 2LF7A 5CVRA 1RNLA 4I01A 4CO8A 2Z9OA 4IRHA 5A2QZ 5DD8A 1RIOH 1XDUA 1GHCA 3JW4A 3WTUC 3T8RA 4CXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBX A;  3ABU A;  4U0Y A;  1F1Z A;  1U3E M;  1XMK A;  2ADU A;  3BDD A;  1SMT A;  3H3Z A;  1NHA A;  2Y48 A;  5TRD A;  1ZGA A;  1SD7 A;  4HOB A;  1UST A;  1K78 A;  3HOT A;  1ON2 A;  2EJR A;  2Z3Y A;  2XRO A;  2CFX A;  1LB2 A;  3GZ5 A;  2A5Y B;  1T39 A;  2CGP A;  4A0X A;  1ODD A;  4O6J A;  3GFL A;  2V79 A;  1EH8 A;  4Q5S F;  4HW0 A;  4HLX A;  1D3Y A;  3IWZ A;  4EJT A;  1S29 A;  3TOB A;  2O8X A;  3WTW C;  4I09 A;  1Q1H A;  1RUN A;  4HQE A;  1IZ1 A;  3W6J B;  1ZLJ A;  3TKY A;  2ISZ A;  3ZN1 A;  1LEB A;  2A6E F;  3I64 A;  3GW2 A;  3IKV A;  5LHG A;  1GVJ A;  3GEZ A;  2QEN A;  1ZN2 A;  4A5M A;  3FF5 A;  1OYI A;  1KU2 A;  1CF7 A;  1OPC A;  3VB2 A;  1I5Z A;  2K4J A;  3S2W A;  1XDS A;  1IXR C;  4M9S A;  4QLC U;  2R7F A;  2EA4 A;  1X3U A;  2DTR A;  3F8C A;  4I7H A;  3EET A;  2O0Y A;  5HDN A;  1B4A A;  2XUB A;  5HVQ C;  1BC8 C;  2P6S A;  2EV0 A;  3H92 A;  3H3U A;  3WTZ A;  2PLY A;  1H0M A;  4P55 A;  3TQN A;  5LRS A;  4LK1 F;  4MEY F;  2VXZ A;  1G6N A;  1SD5 A;  3RIR A;  3HRT A;  2QZ8 A;  4XLN F;  2UXN A;  4G94 A;  2W25 A;  1HXD A;  2DI3 A;  4UVC A;  4I98 B;  1XN7 A;  1JGS A;  4I0B A;  3L2C A;  3P9C A;  2GAU A;  3NEU A;  2M8E A;  2JZY A;  2A61 A;  3KZY A;  2O61 A;  3T8T A;  5H20 A;  3FXR A;  2V6C A;  4GGG A;  1FT9 A;  5HDK A;  4R1H A;  1ZYR F;  1V4R A;  1SFU A;  2F2E A;  1YIO A;  1KU9 A;  3E6C C;  3F72 A;  3OV8 A;  3ECH A;  3MAJ A;  3JAM K;  3B73 A;  3HSE A;  3P9I A;  1O7L A;  2ZNZ A;  2EA2 A;  3V7R A;  4BNC A;  4KNY A;  2P7V B;  4HYE A;  2FNA A;  3WGI A;  3QRF F;  2ZCW A;  3KP3 A;  4HF1 A;  1EV7 A;  3VOD A;  5E8I A;  3LAP A;  1FYM A;  1K7A A;  2YX4 A;  1OR7 A;  2NNY A;  5DV5 A;  2V1U A;  2DK8 A;  1U5T A;  6PAX A;  5FLX K;  4UXN A;  2PJP A;  2GZW A;  1FBS A;  3CUQ C;  1FPQ A;  2OAZ A;  1USS A;  4RB0 A;  1OYY A;  4OIP F;  2QBY B;  2F5C A;  3N97 A;  3ZMV A;  4OMY A;  1IXC A;  4RB2 C;  1U78 A;  1QZZ A;  2FQ3 A;  1CGP A;  1JHF A;  1BI3 A;  1B6A A;  1OKR A;  1BI0 A;  3QP6 A;  1W5S A;  4KIF A;  4MTD A;  1UFM A;  4ENJ A;  3W6K B;  3EQL F;  1YQA A;  1S7O A;  3FXQ A;  3RYR A;  4AIK A;  4HA8 A;  3LQQ A;  1YS6 A;  4HX7 A;  4N9H A;  3IKT A;  2C6Y A;  4ZYE A;  3T5X A;  1FZP B;  4Y17 A;  1P4X A;  1R1U A;  2RNJ A;  4EGY A;  4IXA A;  4XSX F;  3T0Y A;  4CGZ A;  1SFE A;  1ON1 A;  5CVU A;  1KYZ A;  2XIG A;  3FHZ A;  1DDN A;  3WTY C;  1G4D A;  3DXJ F;  3GFM A;  3U9G A;  2D45 A;  1S8N A;  2MLK A;  3ZMD A;  1R7J A;  1WSU A;  1EH7 A;  3CTA A;  1K6O A;  5E1Z B;  3CO6 C;  5CJ9 A;  1AWC A;  5ICF A;  1B9N A;  1B1B A;  3HSF A;  4LD5 A;  5BPD A;  2XAH A;  4RGS A;  2NAZ A;  2M5W A;  3V8J A;  1HW1 A;  4RGU A;  1PP8 F;  1TTY A;  5D6F A;  1ZLK A;  3KP2 A;  1LDD A;  5HS8 A;  3K1M A;  3I58 A;  4K2E A;  4AD9 A;  2L01 A;  3LA2 A;  3KLO A;  5BQT A;  2PI0 A;  3CLO A;  1SFX A;  1OYW A;  5E18 F;  1P4A A;  2XGX A;  3F6V A;  4KDP A;  3J7A O;  3O2P E;  3GZ6 A;  1F9N A;  5J6X A;  3ML6 A;  3I4P A;  1ZG1 A;  2PMH A;  2V1X A;  4JK1 X;  1U8R A;  1ZAR A;  2H6B A;  2QQB A;  3RI4 A;  3C1D A;  5E1X A;  1BM9 A;  2F5F A;  2PFB A;  4HQM A;  1XSV A;  1XD7 A;  1MDM A;  4GXO A;  3ZMU A;  4LGW A;  1IRF A;  4KYW A;  2IPQ X;  4LLG F;  1U6G A;  2KIM A;  2NRA C;  4WXH A;  5LGT A;  2BYV E;  1VTN C;  2HKX A;  2R7D A;  3V8L A;  4ZZD A;  2HQN A;  4AIH A;  2X0L A;  2F5E A;  2EFP A;  3E3V A;  1STZ A;  3BJ6 A;  5IT3 A;  2RV8 A;  1XMA A;  5EEH A;  3BJO A;  1SD4 A;  2A3S A;  1FSE A;  4BYY A;  2Z33 A;  1P4W A;  1R23 A;  2FBH A;  1PP7 U;  3BPV A;  3Q9V A;  3IC7 A;  2K7L A;  5BOX A;  1MJ9 A;  2L4A A;  1I1S A;  3PFI A;  4B8X A;  4H0E A;  5JI6 A;  2K4B A;  3Q9S A;  1RZ4 A;  1ZHF A;  2UWM A;  1UHW A;  4G8X A;  1XGM A;  2VC1 A;  2ZJ2 A;  3GXO A;  2H94 A;  1MGT A;  3CUO A;  5ICE A;  4HDV A;  2BGC A;  2VOO A;  2WV0 A;  4U0V A;  3BPX A;  3WGH A;  3C7J A;  1MDM B;  2BBY A;  3J80 Z;  3RTR A;  3IRR A;  3QPT A;  1P6R A;  3ZMS A;  4U7D A;  2PEX A;  4O5V A;  1KQ9 A;  2Q0O A;  1KU3 A;  4LJZ F;  2VT3 A;  1YG2 A;  4M72 A;  3KP7 A;  5A2Q K;  3GYH X;  3TO7 A;  4L9V A;  1MZB A;  2ZO4 A;  4EM1 A;  2FE3 A;  1Z1D A;  1G3Y A;  3I54 A;  2Z5U A;  2IRF G;  3NQO A;  3M8F A;  1T38 A;  3ULQ B;  3ELK A;  2OA4 A;  2P5K A;  1Y0U A;  2MBF A;  4YFN F;  2E7W A;  1HQC A;  1LEA A;  3WG9 A;  4P9U A;  2YX7 A;  3OOP A;  2EWN A;  3CUQ B;  2P6T A;  1UB9 A;  2P4W A;  3FM3 A;  2HR3 A;  3PQK A;  4EM0 B;  5J8C A;  2M1B A;  4G7Z F;  3GFJ A;  1U5T B;  4KIC A;  5DEQ A;  1IN5 A;  4ZYG A;  4WK8 F;  4DQ2 A;  2HQR A;  1LJ9 A;  4UVB A;  2CSO A;  4PGH A;  4RGR A;  4RS8 A;  1IXS B;  4A6E A;  4YII A;  4MEX F;  3LWF A;  4HDU A;  2K27 A;  4S05 A;  1Z7U A;  2AS5 F;  3F3X A;  5F64 A;  1J7K A;  1J5Y A;  2VOP A;  4Y15 A;  1IN6 A;  4HZF A;  1YW7 A;  3BZ6 A;  3SXY A;  4P5O A;  2XAQ A;  3FMS A;  2WC2 A;  4KN4 X;  4LK0 F;  3GVA A;  2RGV A;  3F21 A;  1ZH5 A;  2D2W A;  1WRJ A;  3FWE A;  4EM2 A;  5E8G A;  2KRF A;  1TW3 A;  1K79 A;  3ZMT A;  1BC7 C;  2UXX A;  2IA0 A;  4DNC A;  2OQG A;  3DV8 A;  1IN8 A;  5DUI A;  1O7F A;  3LAJ A;  2FEZ A;  4MHG A;  1HSJ A;  1FX7 A;  3DPL C;  5ICG A;  5D8K B;  2ZXJ A;  4BQA A;  1LDK B;  4EJV A;  2FML A;  2ESH A;  1T6S A;  5HLH A;  1DPU A;  1FWZ A;  2P8T A;  5ICC A;  1B9M A;  2J5P A;  4N9I A;  1E2X A;  3MZH A;  1TLH B;  1TW2 A;  1YW9 A;  3MEX A;  3WTS C;  2L54 A;  3QOP A;  1YW8 A;  4XLP F;  1O3Q A;  3SFZ A;  4IVN A;  4Z2Y A;  3RDI A;  3LFK A;  1MKM A;  5LGU A;  1YFH A;  2H27 A;  2XV4 S;  2IT0 A;  4PGG A;  4BHC A;  3WGG A;  3RYP A;  4IRI A;  2FF4 A;  2ETH A;  4P9F A;  5LEK A;  4FX4 A;  4IJA A;  2Y0M A;  3ERE D;  3WU1 B;  5LLQ A;  4P96 A;  4ZYH A;  3CJN A;  4UHT A;  3BWG A;  1BOA A;  1GXP A;  3COA C;  2GWR A;  3RKW A;  3KP5 A;  4PZJ A;  4A0Z A;  2PQ8 A;  4EQQ A;  3KCC A;  1IN7 A;  3BRO A;  2ELH A;  2JPB A;  4IPA A;  2H6C A;  5D4S A;  5JR3 A;  5K5R A;  2F5D A;  4ON0 A;  3LST A;  2IW5 A;  2LSO A;  3JTG A;  2XAS A;  2CW0 F;  4EJU A;  4RB1 A;  3JSP A;  3QAH A;  5BPI A;  3K1N A;  5HLI A;  1EH6 A;  1H9G A;  3EUH A;  2MA3 A;  4NQW A;  4YFX F;  4Q4Z F;  3WTT C;  2HGC A;  2HKO A;  4L9N A;  2L02 A;  4ENM A;  4I2O A;  2PBI A;  4LLN A;  1R5H A;  1XSX A;  2PG4 A;  4UNO A;  5HS7 A;  5D5V B;  1IW7 F;  3VFZ A;  4OOI A;  4XBF A;  4L5J A;  1W7P A;  1LNW A;  3VEP A;  3QP5 A;  4RGX A;  1BI2 A;  4WX9 A;  2DAO A;  2DO7 A;  1ULY A;  4IF4 A;  3FZV A;  5E17 F;  2VBW A;  3MQ0 A;  1FBQ A;  3CO7 C;  2VON A;  2EB7 A;  1T2K A;  1OMI A;  2XAF A;  4S04 A;  2GIV A;  3QU3 A;  5EEG A;  2JTV A;  5H6R A;  1ZAO A;  3LA3 A;  1JXS A;  2CO5 A;  5DCF A;  3RKX A;  5K1Y A;  5D6E A;  1WWX A;  2XAG A;  2E7X A;  3TGN A;  4BXU A;  4U88 A;  4ESF A;  2DLL A;  3RKY A;  1O3T A;  2HDC A;  1BIB A;  3HTU A;  4NB5 A;  3DPT A;  3GF2 A;  1ZRD A;  5J8F A;  1L3L A;  3IRQ A;  3QU6 A;  4ESJ A;  4A12 A;  4EMS A;  2OD5 A;  1DP7 P;  4KFC A;  3HRU A;  1G3S A;  1YS7 A;  4M73 A;  2KJC A;  2ISY A;  3M1E A;  2IA1 A;  1S6L A;  3F8M A;  5L3F A;  1HBX G;  2MLG A;  1XGO A;  4G9Y A;  2RN7 A;  1LDJ A;  2IVM A;  3HSR A;  3R0J A;  4CYD A;  3MWM A;  3HYI A;  4ENK A;  5LBQ A;  4LB5 A;  1I6X A;  5LHI A;  3D0S A;  2RDP A;  2P5L C;  1J59 A;  3BP8 A;  4GYI A;  2PMU A;  2ZBK A;  4GCV A;  1JHH A;  3HHH A;  3ABT A;  3QPH A;  5FFX A;  4TV7 A;  3KZZ A;  4ASN A;  4WWC A;  3R0A A;  2EK5 A;  2STT A;  2V1D A;  3EDP A;  2CQK A;  1J9I A;  4XRF A;  5CLS A;  4GO1 A;  4UV8 A;  5F6F A;  3IHU A;  2L4M A;  4B09 A;  2QVO A;  5D4R A;  4R8H A;  4UUV A;  2IP2 A;  3BY6 A;  3I59 B;  2ZKZ A;  3FXU A;  2OBP A;  1QO0 D;  1S3J A;  2HFH A;  1S7A A;  3FX3 A;  1F4K A;  4YIF A;  4AVP A;  1E17 A;  1LVA A;  1KQ0 A;  1KU7 A;  1R1V A;  2P5V A;  5IT9 Z;  1YLF A;  4KT5 C;  4LLL A;  2NNN A;  3MZY A;  4HLY A;  5FGM A;  2VBZ A;  3B02 A;  3E5Q A;  1JE8 A;  1HW2 A;  5L3C A;  2A07 F;  3V4G A;  5ERI A;  4D0P A;  4EV0 A;  1BN5 A;  3K0L A;  1FNN A;  5DD4 A;  4E70 A;  4YG2 F;  3ROU A;  1R58 A;  3ZMZ A;  5CVJ A;  1O3R A;  1KQ8 A;  1TQI A;  3HOS A;  4WF2 A;  4G6Q A;  2HOE A;  1Z6R A;  2HZT A;  1SMY F;  2QQ9 A;  3WE3 A;  2GXG A;  1TBX A;  5K5O A;  5KK1 A;  2WWY A;  2GXB A;  4EJO A;  2XAJ A;  2DQL A;  3R60 A;  5LRR A;  2FOK A;  1QZY A;  2QWW A;  2X4H A;  5CVV A;  4M71 A;  2OQR A;  2Q8K A;  4WXC A;  4MNU A;  1T98 A;  5IT9 K;  2ACJ A;  3LA7 A;  3F22 A;  2QM3 A;  4L9J A;  2ESN A;  4CZZ A;  3HUG A;  2GQQ A;  2YU3 A;  4ETS A;  4OIR F;  2E1N A;  3G73 A;  5DUK A;  5HLG A;  3O3K A;  3HIF A;  2FA5 A;  3JAM Z;  3RPU A;  4HX4 A;  2A6H F;  3O6B B;  4PCQ A;  4L5I A;  2G7H A;  4A5N A;  2DPD A;  1RI7 A;  5JVT A;  1FOK A;  2B0L A;  2W84 A;  2R3S A;  3WU0 A;  5ILS A;  2YPR A;  1QGP A;  2G7U A;  2VE8 A;  1O57 A;  2BEO A;  1XCB A;  4HF0 A;  3T1B A;  1QPM A;  3CUQ A;  3L7W A;  4KIB A;  2LF8 A;  1MJB A;  3ECO A;  2CYY A;  1ZG3 A;  4OMZ A;  5D5U B;  2P7C B;  5L3G A;  5AIQ A;  3I5U A;  2LDU A;  2PN6 A;  4FT8 A;  3E6M A;  4HAM A;  4Q47 A;  3M7G A;  5DYM A;  2MD5 A;  5L3B A;  1FP2 A;  5KVR A;  4Y13 A;  2VBY A;  5FD6 A;  5D5X B;  2OZ6 A;  2MC3 A;  1DPR A;  1ZGJ A;  4M9Z A;  3F6O A;  4UVA A;  5FD5 A;  3DFG A;  2DBB A;  1QBJ A;  4RB3 C;  3IWF A;  2FBK A;  2AXL A;  1ONV A;  2D1H A;  1IUY A;  2DQR A;  4N0B A;  2M87 A;  5FFZ A;  3I0T A;  3F8N A;  1YTY A;  3CDH A;  3R4K A;  4MQV A;  2H09 A;  4KIG A;  1I27 A;  2Q2E A;  2UZK A;  1W5T A;  3J81 Z;  2HEO A;  4AWX B;  4HV6 A;  3GO5 A;  5ED4 A;  3JTH A;  1HST A;  3FM5 A;  5FLX Z;  3JSO A;  3DEU A;  1BIA A;  2FMY A;  3ZQ7 A;  1F5T A;  5LGN A;  3DKW A;  4AIJ A;  3E5X A;  1IF1 A;  5K5Q A;  1ZRF A;  5LEJ A;  4IHT A;  1A04 A;  2CG4 A;  4XSZ F;  3M9A A;  2GA1 A;  5DDG A;  1FP1 D;  5L3E A;  3KP6 A;  3I53 A;  1KA8 A;  4EVI A;  2EFQ A;  5ILV A;  1SAX A;  4BAY A;  2VT2 A;  1T0F A;  5D8L B;  2RC4 A;  1V3F A;  3KEO A;  3F23 A;  4HF2 A;  2Y75 A;  3REO A;  2EFO A;  3WOD F;  2J5O A;  3R6S A;  2RKH A;  1R5G A;  5AIP A;  1QNT A;  3E97 A;  3SZT A;  1FLI A;  3WTV C;  2D1V A;  4MQ9 F;  5HOO A;  5FB2 A;  2W24 A;  1P2F A;  4RAZ A;  4R79 A;  2M30 A;  4OIO F;  3DQV C;  4G7O F;  5DCM B;  4U0W A;  1R00 A;  4EGZ A;  3K1P A;  1U5T C;  4G7H F;  1ZRE A;  3HTS B;  2KIU A;  4ENN A;  2VOD A;  3SHF A;  2FXA A;  5LHH A;  5E1W A;  4HX8 A;  2DT5 A;  4OIQ F;  4KUM A;  5JHU A;  4O3M A;  2O6G E;  2QBY A;  1HKS A;  3N4M A;  5HS9 A;  4LMY A;  3KEQ A;  1C0W A;  1REP C;  1MJA A;  4PDK A;  4CIC A;  1LQ1 A;  2O03 A;  3WTX C;  5H6Q A;  2XHK A;  5ILU A;  3C18 A;  3L9F A;  2EV5 A;  2FRH A;  2BE5 F;  3HRM A;  2LKP A;  3HHG A;  4KN7 X;  4Q48 A;  2O3F A;  2JT1 A;  3RJP A;  3TO9 A;  3U2R A;  4IRG A;  2HS5 A;  2MH2 A;  3I59 A;  1WKM A;  2TDX A;  1Z91 A;  4M6X A;  2E1C A;  4OIN F;  5HDG A;  3IL2 A;  2VC0 A;  1Z6T A;  3GUD A;  4JQF A;  3SZP A;  2A69 F;  3KLN A;  3TOA A;  5CVI A;  4YFK F;  1XGS A;  1ZG5 A;  3D5L A;  4ESB A;  2RVC A;  4KMF A;  3K69 A;  2FBI A;  1W7P B;  3NRV A;  1P92 A;  3HRS A;  4GYG A;  3Q5F A;  2ZNY A;  2WTE A;  1KGS A;  1K78 B;  3M8E A;  4IHS A;  3AAF A;  2Z99 A;  1TNT A;  2YSR A;  4L18 B;  2KKO A;  1BI1 A;  1UCR A;  2JPC A;  2MH9 A;  2OZU A;  3ZN0 A;  4HBL A;  2K86 A;  4M9X A;  2STW A;  2EFN A;  2FU4 A;  4LB6 B;  2VN2 A;  3E6D A;  1IN4 A;  4A6D A;  1U2W A;  3GWZ A;  1Z05 A;  1XGN A;  1KYW A;  4M74 A;  1D8K A;  1FYL A;  2NYX A;  5E20 A;  1WI9 A;  3DF8 A;  1FY7 A;  4JBA A;  1HW5 A;  1FC3 A;  4ZZL A;  3SQN A;  2M45 A;  3F8B A;  3G3Z A;  1GXQ A;  1D5V A;  2L3D A;  2KIF A;  4L9T A;  5TJJ A;  1R1T A;  1R36 A;  1PDN C;  5L3D A;  3WE2 A;  4OU0 A;  2ZME A;  3ISP A;  2EV6 A;  2OU2 A;  2BV6 A;  3MCZ A;  2XRN A;  2DPU A;  2XKP A;  2IA2 A;  2HYG D;  3EYI A;  1AOY A;  3FMR A;  4CHU A;  3R61 A;  3C3W A;  2ZME B;  3TDU C;  2QQA A;  3FMQ A;  4KA4 A;  1BBY A;  1DUX C;  5BS6 A;  1SD6 A;  2KJB A;  4RAY A;  5D5W B;  2NS0 A;  3P7N A;  5F1R A;  5FO5 A;  5JFR A;  3K9T A;  1XB4 A;  3L00 A;  1IAW A;  3L09 A;  4MTE A;  2A68 F;  2DK5 A;  2EFW A;  1YO5 C;  1H9T A;  3TO6 A;  1G3T A;  1BJA A;  4BH9 A;  2DU9 A;  3U1D A;  1L0O C;  2FNP A;  4HV5 A;  1J75 A;  4WXD A;  4BHP A;  3ZP5 A;  1J2X A;  4I0A A;  4BHB A;  2CWE A;  1QQI A;  3GFI A;  4QWQ A;  4ZYD A;  3ZPL A;  3RPQ A;  3DP7 A;  4NHJ A;  1FBU A;  3PQJ A;  2DW4 A;  4FHT A;  4A2U A;  1J0R A;  3KP4 A;  4I02 A;  1RUO A;  2V9V A;  3KET A;  1PUE E;  2QLZ A;  5DCM A;  4FX0 A;  4M6Y A;  3E5U A;  2GA2 A;  1IRG A;  1R22 A;  1G3W A;  4WCG A;  1UHM A;  3GLX A;  3LQR A;  3I71 A;  1HKQ A;  2JSC A;  2QUF A;  4L0Y B;  3TDZ C;  2RQP A;  4LFU A;  2JRT A;  5CYV A;  1TQP A;  4A0Y A;  4LG0 A;  3E6B A;  3F8F A;  1O3S A;  4KMU X;  3K2Z A;  3KFW X;  2G9W A;  1MD0 A;  1ZRC A;  2XKO A;  1WQ2 A;  1TQM A;  2XVC A;  3VOE A;  2QYO A;  2K02 A;  2IJL A;  1CF7 B;  1HKT A;  1Z9C A;  4MGR A;  3V7C A;  3P9K A;  2HTJ A;  2ZFW A;  2DFI A;  4LG0 B;  3BOQ A;  2FSW A;  3J81 K;  3MFK A;  3EYY A;  4U7B A;  3J80 K;  4UV9 A;  3V7S A;  4F7Z A;  1FSH A;  1B59 A;  1TNS A;  2W57 A;  3V8K A;  2YR2 A;  4ZH4 F;  2W85 A;  4EJW A;  2HTS A;  1I1G A;  1XSD A;  5AON A;  3GX4 X;  1W7P D;  4G6D A;  2HWV A;  1YYV A;  4L0Z B;  4CDG A;  3KE2 A;  2COM A;  3BJA A;  2HYF A;  2LNB A;  2VE9 A;  1FYK A;  1XCV A;  5BMZ A;  1D8J A;  1W4M A;  2LF7 A;  5CVR A;  1RNL A;  4I01 A;  4CO8 A;  2Z9O A;  4IRH A;  5A2Q Z;  5DD8 A;  1RIO H;  1XDU A;  1GHC A;  3JW4 A;  3WTU C;  3T8R A;  4CXF A; 
#chains in the Genus database with same CATH topology
 2VBX A;  3ABU A;  4U0Y A;  2IGK A;  1F1Z A;  2VQG A;  1U3E M;  3BCA A;  1XMK A;  2ADU A;  2E36 A;  3BDD A;  1SMT A;  5CQG A;  3H3Z A;  1NHA A;  2Y48 A;  2DOF A;  5TRD A;  1HCR A;  3HOY J;  1ZGA A;  1SD7 A;  4HOB A;  1UST A;  1K78 A;  1XTA A;  3HOT A;  1ON2 A;  2EJR A;  2Z3Y A;  2XRO A;  1FMW A;  1TWF J;  5BNG A;  3OY9 A;  2CFX A;  2KT0 A;  4DZJ A;  4AYB A;  1VQO I;  4XOR A;  1LB2 A;  1S9H A;  3GZ5 A;  4F93 B;  2A5Y B;  1T39 A;  2CGP A;  4A0X A;  3O8G A;  1ODD A;  2I5U A;  4O6J A;  2LP0 A;  3H5N A;  3ZCO A;  3S15 J;  1MMS A;  3GFL A;  2V79 A;  2MVT A;  1EH8 A;  4BJ5 C;  1X4O A;  4Q5S F;  4HW0 A;  4HLX A;  4HG2 A;  1G8X A;  1D3Y A;  3IWZ A;  4EJT A;  1S29 A;  3TOB A;  1KON A;  2O8X A;  4CA0 A;  2DDB A;  3HM5 A;  3WTW C;  2COB A;  4I09 A;  1Q1H A;  4BKX A;  1RUN A;  3S3N A;  3HC7 A;  1IZ1 A;  3HEF A;  4HQE A;  2GOM A;  1N25 A;  3W6J B;  1ZLJ A;  3TKY A;  4RAF A;  2ISZ A;  2QF7 A;  3ZN1 A;  1LEB A;  2E34 A;  2A6E F;  3I64 A;  1SAN A;  3OYN A;  3GW2 A;  2JUG A;  3IKV A;  5LHG A;  1GVJ A;  3PO3 J;  3GEZ A;  5J1U A;  2QEN A;  1ZN2 A;  4PSW A;  2L7K A;  3ZQH A;  2XDV A;  4A5M A;  3FF5 A;  1MBJ A;  1OYI A;  4CH7 A;  1KU2 A;  2XGD A;  4A69 C;  4BY7 J;  1CF7 A;  1OPC A;  2XB5 A;  3VB2 A;  4B44 A;  2R93 J;  1I5Z A;  2K4J A;  3Q0V A;  1XDS A;  1IXR C;  3S2W A;  4KIS A;  4M9S A;  4QLC U;  1WGX A;  2R7F A;  2EA4 A;  3S3M A;  1N75 A;  3H3V K;  4M3G A;  3OYH A;  1OQY A;  1Q1V A;  2IGM A;  2I10 A;  1X3U A;  3CCJ I;  2EIM H;  2MW8 A;  3DTE A;  1FOY A;  2DTR A;  2DJI A;  3F8C A;  1BJZ A;  3I4M J;  4I7H A;  3EET A;  2KHM A;  2O0Y A;  1B4A A;  2XUB A;  5HDN A;  1JJ6 C;  5HVQ C;  1BC8 C;  2P6S A;  2F4I A;  1HC8 A;  3BG5 A;  2EV0 A;  3H92 A;  3H3U A;  4PJJ A;  2R5Y B;  3EUK L;  3WTZ A;  3CCU I;  1H8A C;  1U9N A;  4II3 A;  2PLY A;  1H0M A;  1ETK A;  3JRB A;  4P55 A;  3TQN A;  5B66 C;  3BT9 A;  2VIX A;  5LRS A;  1JTX A;  3ERM A;  4LK1 F;  4MEY F;  2ID6 A;  1FIA A;  1G6N A;  2HNH A;  1SD5 A;  2VXZ A;  2GOX B;  3SDB A;  3RIR A;  1WJB A;  2ZXI A;  3GZN B;  1RPW A;  3HRT A;  3S93 A;  2QZ8 A;  4XLN F;  4B48 A;  2UXN A;  4G94 A;  3N05 A;  2W25 A;  4JOM A;  1HXD A;  1MW7 A;  2DI3 A;  2F4M B;  4B47 A;  4UVC A;  1UAA A;  3A01 B;  1EJ9 A;  3MD2 A;  4LOC A;  1IUF A;  4I98 B;  2O8K A;  1XN7 A;  4XM3 A;  1JGS A;  1V5F A;  1T56 A;  1ORK A;  4I0B A;  1HF0 A;  4CCK A;  9ANT A;  1YJW I;  1MMA A;  3L2C A;  1Z77 A;  3VYT B;  3P9C A;  2GAU A;  4C30 A;  1JUM A;  3NEU A;  5CKT A;  2M8E A;  2JZY A;  1B72 B;  2A61 A;  3KZY A;  1G59 A;  3BR2 A;  2O61 A;  3T8T A;  3CLQ A;  5H20 A;  1VND A;  3FXR A;  2XC7 A;  2V6C A;  4GGG A;  4XQF A;  3PJR A;  2VL8 A;  1R4M B;  4ZDP A;  3K4L A;  1V5E A;  1WZ2 A;  1FT9 A;  5HDK A;  2LRD A;  4R1H A;  4M3B A;  1ZYR F;  4D7N A;  3VPR A;  4RLF A;  1V4R A;  4RM3 A;  2KZG A;  2WV1 A;  1SFU A;  2F2E A;  3LOC A;  1NH3 A;  2E2I J;  1YIO A;  1KU9 A;  3E6C C;  4DGW B;  1WVR A;  3F72 A;  2XSD C;  3OV8 A;  3ECH A;  4JYK A;  3MAJ A;  2Y0S A;  3QYB A;  3JAM K;  3B73 A;  3Q0U A;  3QYF A;  4CYC B;  2BHY A;  3HSE A;  3P9I A;  4V2F A;  2ZNZ A;  1O7L A;  2L9V A;  2CJJ A;  2EA2 A;  3V7R A;  2DA7 A;  3HZJ A;  4BNC A;  4KNY A;  2P7V B;  4HYE A;  1X2M A;  1GV2 A;  2FNA A;  3WGI A;  2ZCW A;  3KP3 A;  3QRF F;  5EZG A;  4Z6Y A;  1EV7 A;  3VOD A;  4HF1 A;  3K2A A;  5E8I A;  3LAP A;  1FJL A;  3H9G A;  1R9T J;  1FYM A;  1DU6 A;  2M35 A;  4I76 A;  1K7A A;  2YX4 A;  1OR7 A;  2NNY A;  1AKH B;  5DV5 A;  2VJ4 A;  3J7Y J;  2V1U A;  3S1M J;  4D7M A;  2DK8 A;  4OAY A;  1U5T A;  3FXK A;  6PAX A;  4UXN A;  5FLX K;  2JWT A;  2PJP A;  2QKL B;  1N77 A;  3OIQ A;  3VYR B;  1VQ9 I;  4LIU A;  2GZW A;  1I39 A;  1Y56 A;  1FBS A;  1ENH A;  2QKM B;  1YRN B;  3CUQ C;  1FPQ A;  2OAZ A;  1USS A;  3S1N J;  3OYL A;  2PJR B;  4RB0 A;  1OYY A;  2VI6 A;  5C4X J;  1IV8 A;  1JT6 A;  4OIP F;  4HNT A;  3OYA A;  2QBY B;  4II2 A;  3PNV A;  2OV7 A;  2F5C A;  3FIS A;  1B8I A;  2R0Q C;  5FRM A;  3N97 A;  5LFA A;  1K61 A;  3ZMV A;  3BQZ A;  4OMY A;  3OS2 A;  3JR9 A;  1IXC A;  3ZQG A;  2D5V A;  2CMP A;  2F48 A;  2JUC A;  3G2B A;  1Y8Q B;  3IH4 A;  2NVX J;  3J7A Y;  4RB2 C;  3HBL A;  1U78 A;  2K40 A;  3DBR B;  1QZZ A;  2FQ3 A;  1CGP A;  1JHF A;  2VKV A;  1BI3 A;  3IP4 B;  1B6A A;  1OKR A;  1BI0 A;  5KNL A;  5KAF C;  3QP6 A;  4J19 A;  2E19 A;  2DT6 A;  1W5S A;  3FBI B;  2BHZ A;  3ABL H;  4KIF A;  1POG A;  4MTD A;  1UFM A;  5GTI C;  3OSF A;  3GTP J;  2XB0 X;  4ENJ A;  3H35 A;  2KZV A;  4W97 A;  2MFZ A;  4E6K G;  1UHS A;  3W6K B;  2XGE A;  3EQL F;  4XLF A;  4HNU A;  3OYM A;  1YQA A;  1S7O A;  2RQQ A;  3LFU A;  5IPA A;  3FXQ A;  3MVP A;  3RYR A;  4AIK A;  4HA8 A;  5HOD A;  3LQQ A;  1YS6 A;  4HX7 A;  4N9H A;  3IKT A;  2C6Y A;  4ZYE A;  3T5X A;  1MNE A;  2QCO A;  1FZP B;  2M2E A;  5E3L A;  4Y17 A;  2BW3 B;  1P4X A;  2WA0 A;  1R1U A;  3VYU B;  3W2V A;  2QQ8 A;  4YIR X;  2RNJ A;  2WAQ A;  3HOV J;  4EGY A;  4IXA A;  1VF9 A;  4XSX F;  3T0Y A;  4CGZ A;  1OCZ H;  2QGU A;  1SFE A;  1ON1 A;  5CVU A;  1D5Y A;  1KYZ A;  3A4C A;  3TW6 A;  2XIG A;  5EG0 B;  3FHZ A;  5FLX R;  1DDN A;  4UUS A;  3CF2 A;  3GTJ J;  3WTY C;  1G4D A;  3GFM A;  3DXJ F;  3K10 A;  2LKS A;  3U9G A;  3JRD A;  5B5E C;  2D45 A;  4IKF A;  1S8N A;  5JVG F;  3G1O A;  1NG6 A;  2EZH A;  2HOS A;  2MLK A;  3ZMD A;  5JHF A;  1R7J A;  3EPZ A;  1WSU A;  3ZOB A;  3RKQ A;  4B1R A;  2CV1 A;  4UUS B;  1EH7 A;  3BZK A;  3CTA A;  2LYC A;  4FET A;  1K6O A;  2KQR A;  1FTT A;  4IOC F;  4LG3 A;  5E1Z B;  3CO6 C;  5CJ9 A;  2EBI A;  3BTC A;  3JAM R;  4DZP A;  4F3Q A;  1YE9 A;  1AWC A;  1MBE A;  5ICF A;  3H36 A;  4ANJ A;  2VPL A;  3H9Q A;  1B9N A;  1B1B A;  2DOA A;  2OCE A;  3HSF A;  3LMM A;  4LD5 A;  3W2A A;  4W1U A;  2XAH A;  5J4Y A;  4RDU A;  5BPD A;  1LE8 A;  4RGS A;  2BW3 A;  2NAZ A;  2M5W A;  2HPI A;  3V8J A;  4BEH B;  1HW1 A;  4RGU A;  4I99 C;  4XKW A;  2CQX A;  1PP8 F;  1TTY A;  2HPM A;  3BZC A;  2JA7 J;  4AM3 A;  5D6F A;  1ZLK A;  4EAT A;  3D5R C;  3KP2 A;  1LDD A;  5HS8 A;  3K1M A;  3I58 A;  4K2E A;  4AD9 A;  2L01 A;  3LA2 A;  4HRI A;  3KLO A;  5BQT A;  4A93 J;  2PI0 A;  3CLO A;  1SFX A;  1OYW A;  1JKO C;  3VDX A;  5E18 F;  1P4A A;  4B3X A;  2XGX A;  3F6V A;  4KDP A;  3C2H A;  3KYC B;  2VJ5 A;  3J7A O;  4CCM A;  3O2P E;  3GZ6 A;  1F9N A;  4IQ4 A;  1IDY A;  2X6W A;  5J6X A;  3ML6 A;  4XNF A;  3I4P A;  1ZG1 A;  2PMH A;  2V1X A;  4JK1 X;  2JK3 A;  1U8R A;  4AC0 A;  3UKG A;  3I3L A;  2R7S A;  1OCO H;  1X3Z B;  1ZAR A;  1Z3Y A;  2H6B A;  2QQB A;  3RI4 A;  1S72 I;  3C1D A;  5E1X A;  1SEU A;  1JGG A;  3CC7 I;  1IG7 A;  1BM9 A;  2F5F A;  2PFB A;  4HQM A;  1XSV A;  4JX4 A;  1XD7 A;  1MDM A;  3CC2 I;  4GXO A;  1VQ7 I;  3LL7 A;  4NQW B;  3ZMU A;  2VQL A;  2BXY A;  3TED A;  2GBY A;  1WJE A;  2TCT A;  4LGW A;  1IRF A;  3BR1 A;  3ZXS A;  2PJR A;  2HQA A;  4KYW A;  1D1A A;  3OSG A;  3DTK A;  3IUO A;  2IPQ X;  4M3F A;  4C2T A;  4LLG F;  3TMO A;  1U6G A;  1ZKG A;  3LSR A;  2K9L A;  2KIM A;  2NRA C;  4WXH A;  3HOZ J;  2HDD A;  2X85 A;  1VQM I;  4KIT B;  3HOX J;  4AVZ A;  3JRE A;  1ITY A;  1QZE A;  2BVL A;  3JRH A;  5LGT A;  2BYV E;  1XMX A;  3B6C A;  1MSE C;  1VTN C;  2HKX A;  2R7D A;  2OUM A;  2E2H J;  3V8L A;  4ZZD A;  2CUJ A;  5FRN A;  2VKE A;  4CCL A;  2HQN A;  4AIH A;  2X0L A;  2F5E A;  3MKZ A;  1AU7 A;  2NVU B;  3TL4 X;  1TWH J;  2LY2 A;  4HSR A;  3HOW J;  2EFP A;  3E3V A;  5HNF A;  1YJN I;  2NVT J;  1STZ A;  3BJ6 A;  5IT3 A;  4DYC A;  2RV8 A;  1XMA A;  3S3O A;  2GLO A;  2ECC A;  2X6O A;  5KCM A;  5EEH A;  5HNH A;  3BR5 A;  3BJO A;  3PNT A;  2R5Z B;  5J40 A;  5B3S H;  1SD4 A;  2A3S A;  1MSF C;  2NS8 A;  2BZT A;  1FSE A;  4BYY A;  2Z33 A;  4PJN A;  1P4W A;  3FKJ A;  4DBR A;  1R23 A;  2FBH A;  5DS9 A;  1PP7 U;  1SC7 A;  1VQ4 I;  1IDZ A;  3KYD B;  3BPV A;  1QA6 A;  5GAH J;  3Q9V A;  3IC7 A;  2VJJ A;  2K7L A;  4F92 B;  5BOX A;  5J4V A;  1MJ9 A;  2L4A A;  1I1S A;  2E71 A;  2R7U A;  3PFI A;  4ZTJ A;  1NTC A;  3TBI A;  1KZH A;  4B8X A;  4QTR A;  4H0E A;  3WG7 H;  1H89 C;  4JX5 A;  1MNM C;  5JI6 A;  2K4B A;  3Q9S A;  1RZ4 A;  1ZHF A;  4A3E J;  2UWM A;  4YRV A;  1UHW A;  3F9K A;  4IHX A;  4CUG A;  1RKW A;  2LY9 A;  1BW6 A;  4G8X A;  2IEK A;  1MIJ A;  1XGM A;  2VC1 A;  2LH9 A;  2ZJ2 A;  3GXO A;  2H94 A;  4BDZ A;  3ZQQ A;  2VPR A;  2HU9 A;  3DLA A;  1MGT A;  3CUO A;  5ICE A;  2L9S A;  4HDV A;  3CMM A;  1W5C C;  3BCB A;  4XRM A;  3MKW B;  5HLT A;  2BGC A;  2VOO A;  2WV0 A;  4U0V A;  3DBH B;  1WJD A;  3BPX A;  2LOO A;  3WGH A;  3C7J A;  2R7V A;  1M1E B;  3I9V 2;  1YHQ I;  1MDM B;  4BE0 A;  2BBY A;  3K4K A;  3J80 Z;  3RTR A;  3IRR A;  2VUM J;  2H1L A;  1P6R A;  3QPT A;  4IHW A;  2DYS H;  2LC2 A;  3ZMS A;  3OOU A;  4U7D A;  2PEX A;  4O5V A;  1KQ9 A;  1DU0 A;  2Q0O A;  1KU3 A;  4LJZ F;  5KHD A;  2VT3 A;  1ZR4 A;  4IHY A;  2VAS A;  1YG2 A;  4M72 A;  3KP7 A;  3DBL B;  2I8D A;  5A2Q K;  3GYH X;  3ZQC A;  3S14 J;  2DOD A;  3TO7 A;  4L9V A;  1MZB A;  4XN3 A;  4BDY A;  1BL0 A;  1UZC A;  5K7Z A;  2ZO4 A;  4EM1 A;  3CJR B;  1R49 A;  2FE3 A;  1HLV A;  1Z1D A;  3HG9 A;  5FLM J;  3A02 A;  4RAG A;  2F5V A;  1G3Y A;  2Q2E B;  1X19 A;  3CCE I;  1N78 A;  3I54 A;  2Z5U A;  2IRF G;  3NQO A;  1QHG A;  3F0C A;  2CQQ A;  3M8F A;  2B7E A;  2IS6 A;  3H0G J;  4XR6 A;  1OFC X;  1T38 A;  3ULQ B;  3ELK A;  1U8B A;  2OA4 A;  3LSI A;  4ZC3 A;  1X4P A;  2M0M A;  2P5K A;  2CUF A;  5FJ8 J;  2E60 A;  1E3H A;  1Y0U A;  4BE1 A;  2MBF A;  3K4J A;  4YFN F;  3ASO H;  2E7W A;  1HQC A;  2QSF X;  2DDA A;  1LEA A;  3WG9 A;  4P9U A;  2YX7 A;  2M4K A;  3D1N I;  3OIO A;  3OOP A;  4IL6 C;  2EWN A;  4MFD A;  3CUQ B;  2P6T A;  1UB9 A;  2P4W A;  2ZSH B;  2CUE A;  4C3I J;  3FM3 A;  3DLL F;  1R71 A;  2HR3 A;  3PQK A;  4EM0 B;  5J8C A;  1W36 D;  2M1B A;  3C2G A;  4G7Z F;  4FCY A;  3ZR8 X;  3P5J A;  2ELJ A;  3GFJ A;  5IYC J;  1U5T B;  4YEJ A;  4KIC A;  5DEQ A;  1IN5 A;  3NWS A;  4ZYG A;  4WK8 F;  4DQ2 A;  2EZI A;  4CSW A;  2HQR A;  1WPK A;  1LJ9 A;  4UVB A;  3CME I;  2CSO A;  4BUP A;  1X3W B;  4PGH A;  2FUG 2;  4RGR A;  1MBH A;  4XOP A;  3BC8 A;  4A3G J;  1IJW C;  2CFO A;  2KRH A;  1R6R A;  4RS8 A;  4A3K J;  1IXS B;  5EDN A;  4A6E A;  1OLT A;  4YII A;  4MEX F;  2EPF A;  3LWF A;  3JRG A;  4HDU A;  2K27 A;  1FIP A;  2VQH A;  5DTD A;  4S05 A;  4ITV A;  2CQ7 A;  5FKK A;  3S2H J;  2ZME C;  1Z7U A;  1IRZ A;  2AS5 F;  3F3X A;  5F64 A;  3FXJ A;  1J7K A;  1S5L C;  2Q1Z B;  3ONQ A;  1J5Y A;  2VOP A;  4Y15 A;  2R7R A;  5IYD J;  1SVM A;  1IN6 A;  4HZF A;  2M34 A;  2Y9Z A;  1YW7 A;  3BZ6 A;  3LSH A;  3BG7 A;  4Y33 A;  5EZH A;  2IS2 A;  1FMV A;  3SXY A;  4P5O A;  3FMS A;  2XAQ A;  2WC2 A;  4KN4 X;  4D1Q A;  1TP4 A;  2ME0 A;  2X98 A;  3MMY B;  4C3H J;  4LK0 F;  2A5W A;  3GVA A;  2RGV A;  3F21 A;  1ZH5 A;  1YX5 A;  2D2W A;  3PIO F;  1WRJ A;  2WY8 Q;  3RQI A;  1UJ8 A;  2JA8 J;  3FWE A;  4EM2 A;  5E8G A;  2KRF A;  3LSM A;  5F04 A;  2DMP A;  3A2K A;  2OPT A;  4IEJ A;  1TW3 A;  1K79 A;  3ZMT A;  1ETV A;  1FEX A;  2HVR A;  1BC7 C;  2UXX A;  2IA0 A;  4XOT A;  4DNC A;  2OQG A;  2VXD A;  3D5S C;  3DV8 A;  1R5I D;  2AO9 A;  3K70 C;  1X1P A;  4E7H A;  3HJE A;  1IN8 A;  5DUI A;  1TWG J;  3CMY A;  1O7F A;  3LAJ A;  2FEZ A;  3G71 I;  4MHG A;  3OYC A;  3X2Q H;  3S1Q J;  1HSJ A;  1FX7 A;  2YUS A;  3DPL C;  4C2M J;  4BE2 A;  2CRG A;  1H88 C;  4LIT A;  5ICG A;  2ELK A;  3L2R A;  5D8K B;  1OJL A;  2ZXJ A;  5CQE A;  4BQA A;  1LDK B;  2W48 A;  2LMD A;  2MC4 A;  2FML A;  2BXZ A;  2ESH A;  2RAE A;  1X1D A;  4EJV A;  1T6S A;  2Y30 A;  2M7B A;  5HLH A;  1DPU A;  3EUH C;  3A52 A;  1FWZ A;  2P8T A;  3AG3 H;  5GP9 A;  3RCO A;  5C44 J;  5ICC A;  1B9M A;  4E7Z A;  2J5P A;  3FBN B;  4XN0 A;  4N9I A;  4E4H A;  5E79 C;  1E2X A;  2KIS A;  3I4N J;  3MZH A;  1TLH B;  1AKH A;  3PL8 A;  2CH0 A;  2K5C A;  1TW2 A;  1YW9 A;  3MEX A;  3WTS C;  2L54 A;  3DU6 A;  3QOP A;  1YW8 A;  4XLP F;  1BR1 A;  1O3Q A;  3SFZ A;  4IVN A;  3QPL A;  4Y7N J;  2HXI A;  4Z2Y A;  1K4S A;  2LD5 A;  3RDI A;  3LFK A;  1MKM A;  1TL8 A;  5LGU A;  1YFH A;  2MG4 A;  2H27 A;  4CYC A;  4ZDO A;  2XV4 S;  2IT0 A;  2LBF A;  2W82 A;  4PGG A;  1A36 A;  4BHC A;  1PYV A;  1R4N B;  3WGG A;  3RYP A;  3I56 I;  4IRI A;  2FF4 A;  1PUF B;  2BY0 A;  4QIW N;  4BQN A;  2ETH A;  2M7A A;  4P9F A;  4BEH A;  5LEK A;  4FX4 A;  5GPC A;  1VQK I;  4IJA A;  2Y0M A;  2LVS A;  4ABZ A;  3ERE D;  3WU1 B;  2FX0 A;  5LLQ A;  3IH3 A;  4NC8 A;  4FTH A;  2ZXW H;  4P96 A;  4ZYH A;  1DGR M;  3CJN A;  1HOM A;  2K9S A;  4UHT A;  1SFK A;  1PUF A;  4BBR J;  3OYB A;  3BWG A;  3ZGK A;  1BOA A;  2M8G X;  4HST A;  2HDW A;  2UV1 A;  1GXP A;  3COA C;  3W6V A;  4J00 A;  2GWR A;  3RKW A;  4XKB A;  4IO9 F;  3KP5 A;  1MH3 A;  4PZJ A;  1JT0 A;  4A0Z A;  1APL C;  4S0H B;  3MKL A;  2PQ8 A;  4EQQ A;  3KCC A;  2LTP A;  1IN7 A;  1T0F C;  5M5W J;  3BRO A;  5K7F A;  1G2H A;  2ELH A;  2JPB A;  3GME A;  1D0Y A;  3FKI J;  4IPA A;  2H6C A;  4V2G A;  5D4S A;  5F0H A;  3RQ4 A;  5JR3 A;  3KYL A;  5EG0 A;  5K5R A;  2F5D A;  4ON0 A;  5TIS C;  1VQ5 I;  3MN2 A;  3JRA A;  3LST A;  2IW5 A;  2LSO A;  3JTG A;  2JVG A;  2XAS A;  2CW0 F;  2V9K A;  1MMD A;  4A3B J;  3A0B C;  4EJU A;  2V4J C;  4RB1 A;  3JSP A;  1D0Z A;  4FAS D;  5E3N A;  3QAH A;  4XRS A;  3CJT B;  5BPI A;  3K1N A;  5HLI A;  1WCM J;  1EH6 A;  1H9G A;  1NG7 A;  3EUH A;  1WH7 A;  2MA3 A;  2JMW A;  4NQW A;  1GV5 A;  3G4S I;  5LD2 C;  4YFX F;  4Q4Z F;  2H1K A;  3WTT C;  2HGC A;  2HKO A;  3SEQ A;  2VKH A;  4L9N A;  3K70 D;  2X9D A;  2L02 A;  4ENM A;  4M3D A;  2JJ7 A;  4ZJZ A;  4I2O A;  2PBI A;  4LLN A;  1R5H A;  2DA1 A;  2O9L A;  4PJL A;  5M5Y J;  4V19 K;  1XSX A;  2PG4 A;  4UNO A;  1MND A;  5HS7 A;  5D5V B;  1IW7 F;  3VFZ A;  4OOI A;  4XBF A;  2YU9 J;  4L5J A;  1Z67 A;  1W7P A;  1LNW A;  3VEP A;  3QP5 A;  4RGX A;  1BI2 A;  4WX9 A;  2ZJQ F;  2DAO A;  2Z1D A;  3AL0 B;  2DO7 A;  4BY1 J;  3S16 J;  1ULY A;  4HPQ A;  4IF4 A;  2ZB9 A;  2IGO A;  1Y1V J;  4OWR B;  2TRT A;  4XKV A;  3FZV A;  1VQN I;  2FQ4 A;  4XKC A;  5E17 F;  2VBW A;  2XF5 A;  4BXX J;  3MQ0 A;  1FBQ A;  3FIW A;  3CO7 C;  2VON A;  3DU5 A;  2GXA A;  1RR8 C;  1WFX A;  3M07 A;  3KEY A;  2EQR A;  1OR7 C;  1RES A;  1AA7 A;  2EB7 A;  1T2K A;  1OMI A;  3A03 A;  3CES A;  2XAF A;  2WAQ N;  4S04 A;  2GIV A;  3QU3 A;  4F91 B;  5EEG A;  2JTV A;  5H6R A;  2HOT A;  1T95 A;  1ZAO A;  3S17 J;  2M4G A;  4MIM A;  3LA3 A;  1YRN A;  1JXS A;  1QVU A;  3SEZ A;  4X1E A;  4BJT A;  1YI2 I;  2CO5 A;  5DCF A;  3RKX A;  1Z3X A;  5K1Y A;  5D6E A;  1WWX A;  2XAG A;  4BAC A;  2E7X A;  3TGN A;  4BXU A;  1P7I A;  5M3F J;  4U88 A;  2XF7 A;  2DA4 A;  4ESF A;  3RPU D;  5IY5 H;  2DLL A;  3H1C A;  3RKY A;  1O3T A;  2HDC A;  1BIB A;  3RZD J;  3HTU A;  2VQC A;  1HDP A;  4NB5 A;  3VSK A;  4DYR A;  2JA6 J;  3DPT A;  3GF2 A;  4A3F J;  3ZQL A;  3K4M A;  1ZRD A;  5J8F A;  1IRX A;  1A5J A;  4CCJ A;  5GAE J;  3CCQ I;  1QVT A;  1L3L A;  2E5N A;  2DXI A;  2JN6 A;  3IRQ A;  2MGQ A;  3QU6 A;  4ESJ A;  5TGT A;  4A12 A;  3PUB A;  3HOU J;  4BGD A;  5FLV A;  2ICW G;  4EMS A;  4HNV A;  2BY3 A;  2OD5 A;  1SAU A;  1DP7 P;  4KFC A;  3HRU A;  1G3S A;  1YS7 A;  4KT6 A;  3NAU A;  2EIK H;  4M73 A;  2KJC A;  2M3A A;  2V26 A;  2ISY A;  3M1E A;  2ZJR F;  2IA1 A;  3QOD A;  1S6L A;  5F0C A;  1K4T A;  5E3M A;  1HDD C;  3F8M A;  1X1A A;  1I6H J;  1MMG A;  2DYR H;  3E7L A;  5L3F A;  3S8P A;  1HBX G;  1OIS A;  2MLG A;  1XGO A;  4G9Y A;  2RN7 A;  1LDJ A;  2CUZ A;  2IVM A;  3SJM A;  2AHQ A;  3HSR A;  2IS1 A;  3R0J A;  4CYD A;  3MWM A;  3HYI A;  4ENK A;  2H8R A;  5LBQ A;  1J09 A;  4Y3O A;  4LB5 A;  3EUA A;  5F0F A;  1OCP A;  1I6X A;  2HXO A;  5LHI A;  3D0S A;  2RDP A;  2P5L C;  1J59 A;  1NK2 P;  2AXT C;  1QPI A;  4A3I J;  3OL4 A;  4G12 A;  3BP8 A;  4GYI A;  2PMU A;  2W7N A;  3ZRG A;  2ZBK A;  4GCV A;  3K7A J;  1NK3 P;  4EEF G;  3BTI A;  1JHH A;  3HHH A;  4XID A;  1ETX A;  2DT7 B;  3CJQ B;  4E7S A;  3M1C A;  3ABT A;  3QPH A;  5FFX A;  4NNJ A;  4TV7 A;  3KZZ A;  1DQU A;  4ASN A;  3GTG J;  4WWC A;  1BW5 A;  3R0A A;  2EK5 A;  3HKZ N;  2STT A;  1Y1W J;  1JKP C;  2V1D A;  3EDP A;  4IQJ A;  2CQK A;  4H4K C;  1J9I A;  2OCC H;  4XRF A;  5CLS A;  2Y0S N;  4GO1 A;  1ETY A;  4UV8 A;  1LE8 B;  5F6F A;  3IHU A;  3LNQ A;  2DA5 A;  2L4M A;  2UUZ A;  4JP0 A;  4B09 A;  2QVO A;  4UB6 C;  2B9S A;  2DFE A;  5D4R A;  2IXS A;  4R8H A;  2DA3 A;  5GTH C;  1UMQ A;  2DTZ A;  2IP2 A;  2LG4 A;  4UUV A;  3BY6 A;  3I59 B;  1D1C A;  2ZKZ A;  3FXU A;  2OBP A;  4D9J A;  4YEL A;  4XL9 A;  1QO0 D;  1S3J A;  5GAD J;  2HFH A;  1S7A A;  3FX3 A;  2EIL H;  3OWT A;  4DYQ A;  1F4K A;  1JJ8 C;  2KDO A;  4AVP A;  4YIF A;  1E17 A;  5KAI C;  3KIO A;  4AU7 A;  1LVA A;  1KQ0 A;  1KU7 A;  3BTJ A;  1R1V A;  2P5V A;  4CZC A;  1E0E A;  5IT9 Z;  1YLF A;  3AL0 C;  2K3F A;  5DM7 F;  4KT5 C;  4LLL A;  2NNN A;  1A35 A;  3MZY A;  1SVO A;  4GRI A;  4HLY A;  5FGM A;  1WI3 A;  2VBZ A;  3B02 A;  3CP8 A;  4AYB N;  1WJF A;  2QEX I;  5F27 A;  1I3A A;  3E5Q A;  1JE8 A;  1HW2 A;  4B43 A;  5L3C A;  2ID3 A;  2A07 F;  4RBO A;  3V4G A;  2Z2S B;  1WJ5 A;  5ERI A;  4D0P A;  4EV0 A;  1BN5 A;  3OYJ A;  1VQL I;  3K0L A;  1OCR H;  1FNN A;  2E1M B;  5DD4 A;  4E70 A;  2V9P A;  5J1Y A;  2HI3 A;  4YG2 F;  1TZL A;  3ROU A;  1R58 A;  2ZJP F;  3ZMZ A;  5CVJ A;  1O3R A;  2FD5 A;  1KQ8 A;  1TQI A;  3HOS A;  4WF2 A;  4G6Q A;  1GUU A;  2HOE A;  1Z6R A;  2WB1 N;  2HZT A;  5J1R A;  1SMY F;  4B4C A;  2QQ9 A;  2OC6 A;  2E35 A;  2L5Q A;  3WE3 A;  3DPU A;  2GXG A;  2DFF A;  1TBX A;  3OS1 A;  5K5O A;  4PFP A;  5KK1 A;  3RZO J;  2DA2 A;  2RRE A;  1RKT A;  2WWY A;  2HOA A;  2GXB A;  1RC9 A;  1MH4 A;  2LY1 A;  4EJO A;  3LSJ A;  2XAJ A;  1MBK A;  1RQ6 A;  2DQL A;  3R60 A;  2IBD A;  5EJC A;  3CDL A;  5LRR A;  3J81 R;  2FOK A;  2E5Z A;  3L2U A;  1QZY A;  1W1W E;  2QWW A;  2X4H A;  5CVV A;  4M71 A;  2OQR A;  2Q8K A;  4WXC A;  1LVK A;  2HVQ A;  4MNU A;  1T98 A;  3DTI A;  2HZD A;  5IT9 K;  2X6X A;  2ACJ A;  1LUJ B;  2IAI A;  3LA7 A;  3F22 A;  2KFD A;  1RR7 A;  2QM3 A;  4L9J A;  1I50 J;  2ESN A;  4CZZ A;  2G0E A;  3HUG A;  2GQQ A;  3DWL E;  2YU3 A;  4RA2 A;  2R5Y A;  4ETS A;  1T08 B;  4OIR F;  2ECB A;  2E1N A;  3G73 A;  1D1B A;  5DUK A;  5HLG A;  2OTJ I;  2XPW A;  3HIF A;  3O3K A;  2FA5 A;  1ZGW A;  2VJI A;  2MSY A;  3ABM H;  3CZ6 A;  3H5R A;  3JAM Z;  3RPU A;  4HX4 A;  2KIQ A;  2A6H F;  3O6B B;  4MO7 A;  4PCQ A;  4XLH A;  1U9O A;  4A3D J;  4L5I A;  2G7H A;  3FDY A;  2XPU A;  4A5N A;  5IP7 J;  2DPD A;  3CCV I;  2OJE D;  1XX5 A;  3PO2 J;  1RI7 A;  1QHH D;  4MFE A;  5JVT A;  1BOB A;  1FOK A;  2B0L A;  2L9N A;  2W84 A;  2R3S A;  1XC5 A;  3WU0 A;  5ILS A;  2YPR A;  1QGP A;  2G7U A;  2L2O A;  2VE8 A;  1O57 A;  2BEO A;  3L1P A;  2XF6 A;  2JSP A;  1XCB A;  4HF0 A;  3T1B A;  1QPM A;  4BU2 A;  3CUQ A;  1ZQ3 P;  3L7W A;  4BS9 A;  4KIB A;  2LF8 A;  1MJB A;  3ECO A;  2CYY A;  1ZG3 A;  4OMZ A;  5D5U B;  4PUS A;  5L3G A;  2P7C B;  2CS3 A;  2MD0 A;  2JA2 A;  5AIQ A;  4IOA F;  4CCN A;  3I5U A;  2LDU A;  2X1C A;  3K4N A;  2PN6 A;  2K3P A;  4FT8 A;  4M6V A;  3E6M A;  3TW7 A;  1XPX A;  1B72 A;  4NUB A;  1P9Q C;  4HAM A;  1TWA J;  3SDG A;  4Q47 A;  3G1M A;  3M7G A;  2DMT A;  5DYM A;  5EYR A;  2Y9Y A;  3JRC A;  2MD5 A;  5L3B A;  1FP2 A;  1O4X A;  1HA8 A;  5KVR A;  4Y13 A;  3L2V A;  2VBY A;  5FD6 A;  1FOX A;  5D5X B;  4F52 A;  3A01 A;  2OZ6 A;  2MC3 A;  3DCF A;  1DPR A;  4FIS A;  4XIC A;  1Z7L A;  1ZGJ A;  4M9Z A;  3F6O A;  4UVA A;  5FD5 A;  3DFG A;  4A3M J;  4ZTF A;  2DBB A;  2A05 A;  5FKN A;  5M5X J;  1QBJ A;  4RB3 C;  3IWF A;  1YIJ I;  1A31 A;  2FBK A;  2AXL A;  3IAM 2;  4U87 A;  1ONV A;  3MZ8 A;  4AUX A;  3K4B A;  4XON A;  2D1H A;  1IUY A;  2DQR A;  3HXL A;  2X1D A;  5GPA A;  3HGG A;  3CF5 F;  2NVQ J;  4N0B A;  2M87 A;  1FOW A;  3I0T A;  3F8N A;  5FFZ A;  1YTY A;  3CDH A;  3R4K A;  4MQV A;  5F08 A;  2AQF A;  2DMN A;  5M3M J;  1W0U A;  2H09 A;  2VLA A;  1JTY A;  4KIG A;  3BG3 A;  1ETQ A;  1I27 A;  3OIP A;  1JKR C;  3M4O J;  2MUN A;  5F1J A;  2Q2E A;  2UZK A;  1W5T A;  2KDZ A;  3J81 Z;  2CU7 A;  2PMZ N;  2HEO A;  4AWX B;  2MZ4 A;  4HV6 A;  3GO5 A;  1IO2 A;  2WAE A;  4B3A A;  5ED4 A;  3JTH A;  4Y4R A;  1ACI A;  1HST A;  3FM5 A;  1V55 H;  5FLX Z;  3JSO A;  3DEU A;  2XGC A;  1W36 C;  2IGN A;  3I55 I;  2KPM A;  1BIA A;  2R7X A;  2BVM A;  2FMY A;  1ZEL A;  3VSL A;  3ZQ7 A;  4PJ0 C;  5E3O A;  2Y31 A;  1F5T A;  5LGN A;  3DKW A;  4AIJ A;  3E5X A;  4RM2 A;  1IF1 A;  2X51 A;  3WU2 C;  3BR3 A;  4NC7 A;  2VB6 A;  3GCM A;  5K5Q A;  1ZRF A;  1V5G A;  2DMU A;  5LEJ A;  1PVE A;  2Z16 A;  4IHT A;  1A04 A;  3OL3 A;  4P1W A;  1UEL B;  2CG4 A;  4XSZ F;  5J47 A;  1LFU P;  2R7O A;  2F6C A;  4QPO A;  2KLO A;  5FKO A;  3G1L A;  5FRO A;  2KMU A;  3M9A A;  4BL0 B;  2GA1 A;  5DDG A;  4I6Z A;  1FP1 D;  5L3E A;  3KP6 A;  3I53 A;  1KA8 A;  4GDF A;  4EVI A;  2EFQ A;  2L7Z A;  5ILV A;  1QU3 A;  4XLC A;  1F43 A;  2XSJ C;  1SAX A;  1OCT C;  2KP6 A;  4BAY A;  2VT2 A;  1T0F A;  4QPQ A;  2JVH A;  5D8L B;  2RC4 A;  1V3F A;  3KEO A;  4NDL A;  3F23 A;  4HF2 A;  3O8H A;  2OF7 A;  1U0J A;  2Y75 A;  1F36 A;  3REO A;  2QSH X;  2EFO A;  2RNG A;  3WOD F;  4N4N B;  2N8G A;  3OYK A;  2J5O A;  3MKY B;  3R6S A;  2RKH A;  1R5G A;  5AIP A;  1QNT A;  3CC4 I;  3E97 A;  3CCR I;  3SZT A;  4BXF A;  2NVY J;  4D5C A;  4FQG A;  1FLI A;  1ZTR A;  3WTV C;  3E1S A;  2D1V A;  2V7F A;  5EGO A;  4MQ9 F;  3LSP A;  5HOO A;  5FB2 A;  2W24 A;  3QOE A;  4IX7 A;  1P2F A;  3UNG C;  2WAF A;  1BA5 A;  1IGN A;  1TC3 C;  2HVS A;  4RAZ A;  4R79 A;  3U1K A;  3CQZ J;  3GTL J;  1E3O C;  2M30 A;  4OIO F;  3DQV C;  3CCM I;  4G7O F;  3PSF A;  5DCM B;  3DEW A;  4U0W A;  1R00 A;  4EGZ A;  2L7F P;  3K1P A;  1U5T C;  4G7H F;  3QYE A;  2R4G A;  2LFB A;  1ZRE A;  2V1N A;  2DFH A;  3AG4 H;  3DKY A;  3HTS B;  2WBM A;  2KIU A;  5DM6 F;  4ENN A;  2VOD A;  2XRL A;  1ERD A;  3SHF A;  2FXA A;  5LHH A;  4HEA 2;  3KZI C;  5E1W A;  2EH3 A;  4HX8 A;  2DT5 A;  4OIQ F;  4KUM A;  4AID A;  3H9J A;  5JHU A;  1V54 H;  2AQE A;  3LSK A;  2JA5 J;  3BTL A;  5EGO B;  4O3M A;  4DIQ A;  2O6G E;  2ZC2 A;  5IP6 A;  2QBY A;  4RMN A;  1HKS A;  3N4M A;  5HS9 A;  3SFI A;  4LMY A;  3ESW B;  3KEQ A;  2CW8 A;  5IYB J;  1C0W A;  1REP C;  1MJA A;  3TP0 A;  4NC6 A;  4PDK A;  2W1O A;  4QSH A;  4CIC A;  2CW7 A;  1T8I A;  1LQ1 A;  2O03 A;  3WTX C;  5H6Q A;  3BLY A;  5IP9 J;  2XHK A;  5ILU A;  3C18 A;  3L9F A;  1Y8R B;  2EV5 A;  2FRH A;  2BE5 F;  3HRM A;  3CCL I;  1QRY A;  2LKP A;  4RLQ A;  3KX2 A;  2NXN B;  3HHG A;  3S2D J;  2BY2 A;  1DGW Y;  4KN7 X;  4Q48 A;  2O3F A;  2JT1 A;  3RJP A;  2QA4 I;  3TO9 A;  3U2R A;  4IRG A;  5J3L A;  2HQ5 A;  2HS5 A;  2MYS A;  2MH2 A;  5GAG J;  3FK6 A;  3I59 A;  1WKM A;  2DCE A;  2EIN H;  2TDX A;  1Z91 A;  4M6X A;  2E1C A;  3BQY A;  4OIN F;  5HDG A;  3S32 A;  3OYG A;  4PJM A;  3HKZ A;  2CQN A;  3IL2 A;  2ZXH A;  2GM4 A;  3UR3 C;  1GLN A;  2W00 A;  3PNY A;  2FOW A;  3OYE A;  1EA3 A;  2VC0 A;  1Z6T A;  3GUD A;  4KJZ A;  1XS9 A;  3WHC A;  4JQF A;  1VQ8 I;  3SZP A;  2PX9 A;  2A69 F;  3PSI A;  3DKX A;  4X6A J;  1JI8 A;  5CPR B;  3KLN A;  1YJ9 I;  3TOA A;  1K83 J;  3WHB A;  3J7A W;  1TWC J;  5IOY A;  3VWB A;  4C9Y A;  5CVI A;  4YFK F;  1XGS A;  1ZG5 A;  2DJN A;  5JLW A;  2KL4 A;  3Q0W A;  4GFB A;  2LRE A;  3D5L A;  4ESB A;  2RVC A;  3CD6 I;  4KMF A;  1MMN A;  2Y69 H;  3K69 A;  3KPH A;  4XMY A;  1DP3 A;  2FBI A;  1W7P B;  3NRV A;  1P92 A;  2P0T A;  4DOZ A;  4C2U A;  3HRS A;  2M0C A;  5H2F C;  4GYG A;  5C4J J;  3Q5F A;  2ZNY A;  2WTE A;  1LFB A;  1KGS A;  1YX3 A;  3M8E A;  3HPG A;  3HGY A;  2K9N A;  1K78 B;  3J80 R;  4ZDL A;  3E0J B;  5K7H A;  3JRF A;  4IHS A;  1I3Q J;  3AAF A;  1VQP I;  2Z99 A;  3ZQF A;  1TNT A;  1VZ0 A;  2YSR A;  4L18 B;  2KKO A;  2H8W A;  2WB1 A;  3IH2 A;  1MBF A;  1BI1 A;  1UCR A;  2JPC A;  2LK2 A;  2MH9 A;  2OZU A;  4BQO A;  4IZZ A;  3OYI A;  5A2Q R;  2E1M C;  5FKL A;  3QPS A;  4HBL A;  3ZN0 A;  1S7E A;  2K86 A;  3CCY A;  1GDT A;  4M9X A;  2YS9 A;  5B1A H;  2STW A;  2EFN A;  1A6I A;  2FU4 A;  2R7T A;  4LB6 B;  4X0G A;  3RSN A;  2VN2 A;  3E6D A;  4BJ6 C;  5C3E J;  3OYD A;  1VI0 A;  1IN4 A;  2DOE A;  2R7Z J;  3OMY A;  3V42 A;  2E1O A;  4A6D A;  4XK4 A;  1U2W A;  3GWZ A;  1Z05 A;  1IV6 A;  1XGN A;  1KYW A;  4M74 A;  4IHV A;  1D8K A;  3C2B A;  1FYL A;  2DMQ A;  2NYX A;  5E20 A;  2A6T A;  1WI9 A;  3DF8 A;  3AFH A;  1FY7 A;  4JBA A;  1HW5 A;  1FC3 A;  4ZZL A;  4XRS G;  3CP2 A;  3SQN A;  4CCO A;  2ME6 A;  2M45 A;  1LKX A;  2B63 J;  3A0H C;  3F8B A;  3G3Z A;  1GXQ A;  4A3L J;  1D5V A;  4UB8 C;  3BR6 A;  2L3D A;  3H0D A;  2KIF A;  3FXO A;  2L7M P;  4L9T A;  4UUT A;  1R1T A;  5TJJ A;  1R36 A;  2LKX A;  5L3D A;  1PDN C;  3WE2 A;  4OU0 A;  1TT0 A;  2IS4 A;  1IC8 A;  2ZME A;  3ISP A;  2EV6 A;  3W2W A;  3PM1 A;  2O7O A;  3S1R J;  3BR0 A;  3NWT A;  4DJA A;  2OU2 A;  1OCC H;  2VKD A;  4FE7 A;  2JQ7 A;  1WHU A;  2BV6 A;  3MCZ A;  2XRN A;  2DPU A;  1ETW A;  2IA2 A;  1GVD A;  2HYG D;  2XKP A;  4XLE A;  4DBQ A;  3L2Q A;  4JX6 A;  3EYI A;  1AOY A;  3FMR A;  2WY7 Q;  4CHU A;  2PMZ A;  3R61 A;  3CDI A;  3C3W A;  2ZME B;  3TP3 A;  3TDU C;  2QQA A;  1ZK8 A;  3FMQ A;  1EF4 A;  4KA4 A;  1BBY A;  1DUX C;  5BS6 A;  1SD6 A;  2KJB A;  4RAY A;  5D5W B;  4BBS J;  2NS0 A;  3P7N A;  1TT5 B;  2GIZ A;  1ZR2 A;  3SZG A;  1JKQ C;  5F1R A;  3GTM J;  5FO5 A;  5JFR A;  3K9T A;  1BR4 A;  1XB4 A;  3L00 A;  2EIJ H;  2MAB A;  3G6E I;  4E7K A;  4A3J J;  1IAW A;  1SFO J;  3OYF A;  3L09 A;  4MTE A;  1W0T A;  2A68 F;  4ZYA A;  2JRM A;  2DK5 A;  3FXL A;  2EFW A;  1WJC A;  1YO5 C;  1LPQ A;  1H9T A;  2LR8 A;  3TO6 A;  1G3T A;  1BJA A;  3CMA I;  3NAR A;  4BH9 A;  2QSG X;  2DU9 A;  3U1D A;  3OS0 A;  1L0O C;  2BOL A;  4J01 A;  2P81 A;  2FNP A;  3PIP F;  3HB9 A;  4HV5 A;  3HL2 A;  1J75 A;  4WXD A;  4BHP A;  3ZP5 A;  1WH5 A;  1J2X A;  4I0A A;  2E2J J;  4BHB A;  2CWE A;  4N4O B;  1QQI A;  1JUS A;  4QWQ A;  3GFI A;  2R7W A;  4ZYD A;  3ZPL A;  2L0K A;  3RPQ A;  3DP7 A;  1BR2 A;  4NHJ A;  1FBU A;  3PQJ A;  2FJ1 A;  2EZK A;  2DW4 A;  3AKZ A;  4FHT A;  4A2U A;  1J0R A;  3KP4 A;  4I02 A;  4XLA A;  1RUO A;  1Z21 A;  3B6A A;  5EF6 A;  2V9V A;  3GTO J;  1EKE A;  3KET A;  1YOV B;  1Y0N A;  2W4S A;  2CV0 A;  3M8J A;  1E3P A;  2R7Q A;  2DA6 A;  1PUE E;  2QLZ A;  5DCM A;  4FX0 A;  2NOJ B;  4M6Y A;  3VYS B;  1RET A;  1X1B A;  3E5U A;  2GA2 A;  3JCU C;  1R22 A;  3J7Z I;  1IRG A;  1G3W A;  3A1Y A;  2XPV A;  3SYT A;  2ZSI B;  4E7I A;  4WCG A;  1UHM A;  3GLX A;  3LQR A;  3CCS I;  1VQ6 I;  4C3J J;  1A6Q A;  3I71 A;  2CV2 A;  3M3Y J;  1HKQ A;  2JSC A;  2QUF A;  4L0Y B;  2LLK A;  3TDZ C;  2RQP A;  4M3E A;  4LFU A;  2JRT A;  5CYV A;  3U21 A;  4UY8 I;  2EZL A;  2X6Y A;  4FE4 A;  1Z0X A;  3ASN H;  1TQP A;  1B8I B;  2Y2Z A;  4A0Y A;  1T33 A;  3GBG A;  1RRJ A;  2K85 A;  4LG0 A;  3E6B A;  3F8F A;  1O3S A;  4DW6 A;  1K6Y A;  4KMU X;  1AHD P;  3K2Z A;  3GTK J;  5B1B H;  3Q3S A;  3GTQ J;  1D0X A;  3KFW X;  2G9W A;  3HPH A;  1MD0 A;  1ZRC A;  2R92 J;  2XKO A;  1WQ2 A;  2L9R A;  2ZFU A;  3FXM A;  3OR1 C;  3PUF A;  2XAU A;  2F4O B;  4LIV A;  3L2W A;  3QWL A;  1XG1 A;  1TQM A;  2XVC A;  3VOE A;  2QYO A;  4OAZ A;  1FTZ A;  2K02 A;  2NOG A;  5IT9 R;  4PFO A;  1SVL A;  2IJL A;  1CF7 B;  3ZQI A;  1HKT A;  1Z9C A;  1PJR A;  3K6G A;  4F55 A;  4PK4 A;  4MGR A;  3V7C A;  3P9K A;  2HTJ A;  2ZFW A;  2DFI A;  4LG0 B;  3BOQ A;  2FSW A;  3J81 K;  3MFK A;  3EYY A;  4U7B A;  2OTL I;  3HDD A;  3J80 K;  1Y39 A;  1WJA A;  2KRC A;  4L5E A;  4UV9 A;  1YIT I;  2O5R A;  3ABK H;  3V7S A;  4Y52 J;  4PSX A;  4F7Z A;  1FSH A;  1B59 A;  1LFP A;  2V6E A;  2DN0 A;  1X58 A;  1TNS A;  2W57 A;  2R5Z A;  3V8K A;  2YR2 A;  3OR2 C;  2K9Q A;  3H5A A;  4ZH4 F;  3BG9 A;  5IOZ A;  2X1E A;  2W85 A;  1VFC A;  2LBF B;  4EJW A;  1ETO A;  2HTS A;  1I1G A;  1XSD A;  3JRI A;  5AON A;  3GX4 X;  1JUP A;  1W7P D;  4G6D A;  5JLX A;  2BY1 A;  4D5F A;  2HWV A;  1YYV A;  4L0Z B;  1UG2 A;  4CDG A;  1GT0 C;  2K9M A;  3KE2 A;  1P7J A;  2COM A;  2HYJ A;  4A3C J;  3BJA A;  2HYF A;  3QQA A;  2LNB A;  4NBQ A;  2VE9 A;  2X48 A;  4E7J A;  1FYK A;  4E7L A;  3GLL A;  3AG2 H;  4MLO A;  3IV5 A;  1X1C A;  1XCV A;  3FK7 A;  4G6T B;  1UG0 A;  5BMZ A;  1MBG A;  1D8J A;  1W4M A;  2LF7 A;  5CVR A;  2WAD A;  1RNL A;  4I01 A;  4CO8 A;  2Z9O A;  3AG1 H;  4IRH A;  5A2Q Z;  5DD8 A;  1RIO H;  3BG6 A;  1XDU A;  3DEE A;  3FHN A;  1GHC A;  1X2N A;  2M9H A;  1Y6I A;  5FKM A;  3HUG B;  2P0W A;  3JW4 A;  3W3C A;  3PFY A;  3IAS 2;  1CQT A;  3WTU C;  4BQQ A;  2NS7 A;  3LSG A;  3K4C A;  5EEA A;  3T8R A;  4CXF A; 
#chains in the Genus database with same CATH homology
 2VBX A;  3ABU A;  4U0Y A;  1F1Z A;  1U3E M;  1XMK A;  2ADU A;  3BDD A;  1SMT A;  3H3Z A;  1NHA A;  2Y48 A;  5TRD A;  1ZGA A;  1SD7 A;  4HOB A;  1UST A;  1K78 A;  3HOT A;  1ON2 A;  2EJR A;  2Z3Y A;  2XRO A;  2CFX A;  1LB2 A;  3GZ5 A;  2A5Y B;  1T39 A;  2CGP A;  4A0X A;  1ODD A;  4O6J A;  3GFL A;  2V79 A;  1EH8 A;  4Q5S F;  4HW0 A;  4HLX A;  1D3Y A;  3IWZ A;  4EJT A;  1S29 A;  3TOB A;  2O8X A;  3WTW C;  4I09 A;  1Q1H A;  1RUN A;  4HQE A;  1IZ1 A;  3W6J B;  1ZLJ A;  3TKY A;  2ISZ A;  3ZN1 A;  1LEB A;  2A6E F;  3I64 A;  3GW2 A;  3IKV A;  5LHG A;  1GVJ A;  3GEZ A;  2QEN A;  1ZN2 A;  4A5M A;  3FF5 A;  1OYI A;  1KU2 A;  1CF7 A;  1OPC A;  3VB2 A;  1I5Z A;  2K4J A;  3S2W A;  1XDS A;  1IXR C;  4M9S A;  4QLC U;  2R7F A;  2EA4 A;  1X3U A;  2DTR A;  3F8C A;  4I7H A;  3EET A;  2O0Y A;  5HDN A;  1B4A A;  2XUB A;  5HVQ C;  1BC8 C;  2P6S A;  2EV0 A;  3H92 A;  3H3U A;  3WTZ A;  2PLY A;  1H0M A;  4P55 A;  3TQN A;  5LRS A;  4LK1 F;  4MEY F;  2VXZ A;  1G6N A;  1SD5 A;  3RIR A;  3HRT A;  2QZ8 A;  4XLN F;  2UXN A;  4G94 A;  2W25 A;  1HXD A;  2DI3 A;  4UVC A;  4I98 B;  1XN7 A;  1JGS A;  4I0B A;  3L2C A;  3P9C A;  2GAU A;  3NEU A;  2M8E A;  2JZY A;  2A61 A;  3KZY A;  2O61 A;  3T8T A;  5H20 A;  3FXR A;  2V6C A;  4GGG A;  1FT9 A;  5HDK A;  4R1H A;  1ZYR F;  1V4R A;  1SFU A;  2F2E A;  1YIO A;  1KU9 A;  3E6C C;  3F72 A;  3OV8 A;  3ECH A;  3MAJ A;  3JAM K;  3B73 A;  3HSE A;  3P9I A;  1O7L A;  2ZNZ A;  2EA2 A;  3V7R A;  4BNC A;  4KNY A;  2P7V B;  4HYE A;  2FNA A;  3WGI A;  3QRF F;  2ZCW A;  3KP3 A;  4HF1 A;  1EV7 A;  3VOD A;  5E8I A;  3LAP A;  1FYM A;  1K7A A;  2YX4 A;  1OR7 A;  2NNY A;  5DV5 A;  2V1U A;  2DK8 A;  1U5T A;  6PAX A;  5FLX K;  4UXN A;  2PJP A;  2GZW A;  1FBS A;  3CUQ C;  1FPQ A;  2OAZ A;  1USS A;  4RB0 A;  1OYY A;  4OIP F;  2QBY B;  2F5C A;  3N97 A;  3ZMV A;  4OMY A;  1IXC A;  4RB2 C;  1U78 A;  1QZZ A;  2FQ3 A;  1CGP A;  1JHF A;  1BI3 A;  1B6A A;  1OKR A;  1BI0 A;  3QP6 A;  1W5S A;  4KIF A;  4MTD A;  1UFM A;  4ENJ A;  3W6K B;  3EQL F;  1YQA A;  1S7O A;  3FXQ A;  3RYR A;  4AIK A;  4HA8 A;  3LQQ A;  1YS6 A;  4HX7 A;  4N9H A;  3IKT A;  2C6Y A;  4ZYE A;  3T5X A;  1FZP B;  4Y17 A;  1P4X A;  1R1U A;  2RNJ A;  4EGY A;  4IXA A;  4XSX F;  3T0Y A;  4CGZ A;  1SFE A;  1ON1 A;  5CVU A;  1KYZ A;  2XIG A;  3FHZ A;  1DDN A;  3WTY C;  1G4D A;  3DXJ F;  3GFM A;  3U9G A;  2D45 A;  1S8N A;  2MLK A;  3ZMD A;  1R7J A;  1WSU A;  1EH7 A;  3CTA A;  1K6O A;  5E1Z B;  3CO6 C;  5CJ9 A;  1AWC A;  5ICF A;  1B9N A;  1B1B A;  3HSF A;  4LD5 A;  5BPD A;  2XAH A;  4RGS A;  2NAZ A;  2M5W A;  3V8J A;  1HW1 A;  4RGU A;  1PP8 F;  1TTY A;  5D6F A;  1ZLK A;  3KP2 A;  1LDD A;  5HS8 A;  3K1M A;  3I58 A;  4K2E A;  4AD9 A;  2L01 A;  3LA2 A;  3KLO A;  5BQT A;  2PI0 A;  3CLO A;  1SFX A;  1OYW A;  5E18 F;  1P4A A;  2XGX A;  3F6V A;  4KDP A;  3J7A O;  3O2P E;  3GZ6 A;  1F9N A;  5J6X A;  3ML6 A;  3I4P A;  1ZG1 A;  2PMH A;  2V1X A;  4JK1 X;  1U8R A;  1ZAR A;  2H6B A;  2QQB A;  3RI4 A;  3C1D A;  5E1X A;  1BM9 A;  2F5F A;  2PFB A;  4HQM A;  1XSV A;  1XD7 A;  1MDM A;  4GXO A;  3ZMU A;  4LGW A;  1IRF A;  4KYW A;  2IPQ X;  4LLG F;  1U6G A;  2KIM A;  2NRA C;  4WXH A;  5LGT A;  2BYV E;  1VTN C;  2HKX A;  2R7D A;  3V8L A;  4ZZD A;  2HQN A;  4AIH A;  2X0L A;  2F5E A;  2EFP A;  3E3V A;  1STZ A;  3BJ6 A;  5IT3 A;  2RV8 A;  1XMA A;  5EEH A;  3BJO A;  1SD4 A;  2A3S A;  1FSE A;  4BYY A;  2Z33 A;  1P4W A;  1R23 A;  2FBH A;  1PP7 U;  3BPV A;  3Q9V A;  3IC7 A;  2K7L A;  5BOX A;  1MJ9 A;  2L4A A;  1I1S A;  3PFI A;  4B8X A;  4H0E A;  5JI6 A;  2K4B A;  3Q9S A;  1RZ4 A;  1ZHF A;  2UWM A;  1UHW A;  4G8X A;  1XGM A;  2VC1 A;  2ZJ2 A;  3GXO A;  2H94 A;  1MGT A;  3CUO A;  5ICE A;  4HDV A;  2BGC A;  2VOO A;  2WV0 A;  4U0V A;  3BPX A;  3WGH A;  3C7J A;  1MDM B;  2BBY A;  3J80 Z;  3RTR A;  3IRR A;  3QPT A;  1P6R A;  3ZMS A;  4U7D A;  2PEX A;  4O5V A;  1KQ9 A;  2Q0O A;  1KU3 A;  4LJZ F;  2VT3 A;  1YG2 A;  4M72 A;  3KP7 A;  5A2Q K;  3GYH X;  3TO7 A;  4L9V A;  1MZB A;  2ZO4 A;  4EM1 A;  2FE3 A;  1Z1D A;  1G3Y A;  3I54 A;  2Z5U A;  2IRF G;  3NQO A;  3M8F A;  1T38 A;  3ULQ B;  3ELK A;  2OA4 A;  2P5K A;  1Y0U A;  2MBF A;  4YFN F;  2E7W A;  1HQC A;  1LEA A;  3WG9 A;  4P9U A;  2YX7 A;  3OOP A;  2EWN A;  3CUQ B;  2P6T A;  1UB9 A;  2P4W A;  3FM3 A;  2HR3 A;  3PQK A;  4EM0 B;  5J8C A;  2M1B A;  4G7Z F;  3GFJ A;  1U5T B;  4KIC A;  5DEQ A;  1IN5 A;  4ZYG A;  4WK8 F;  4DQ2 A;  2HQR A;  1LJ9 A;  4UVB A;  2CSO A;  4PGH A;  4RGR A;  4RS8 A;  1IXS B;  4A6E A;  4YII A;  4MEX F;  3LWF A;  4HDU A;  2K27 A;  4S05 A;  1Z7U A;  2AS5 F;  3F3X A;  5F64 A;  1J7K A;  1J5Y A;  2VOP A;  4Y15 A;  1IN6 A;  4HZF A;  1YW7 A;  3BZ6 A;  3SXY A;  4P5O A;  2XAQ A;  3FMS A;  2WC2 A;  4KN4 X;  4LK0 F;  3GVA A;  2RGV A;  3F21 A;  1ZH5 A;  2D2W A;  1WRJ A;  3FWE A;  4EM2 A;  5E8G A;  2KRF A;  1TW3 A;  1K79 A;  3ZMT A;  1BC7 C;  2UXX A;  2IA0 A;  4DNC A;  2OQG A;  3DV8 A;  1IN8 A;  5DUI A;  1O7F A;  3LAJ A;  2FEZ A;  4MHG A;  1HSJ A;  1FX7 A;  3DPL C;  5ICG A;  5D8K B;  2ZXJ A;  4BQA A;  1LDK B;  4EJV A;  2FML A;  2ESH A;  1T6S A;  5HLH A;  1DPU A;  1FWZ A;  2P8T A;  5ICC A;  1B9M A;  2J5P A;  4N9I A;  1E2X A;  3MZH A;  1TLH B;  1TW2 A;  1YW9 A;  3MEX A;  3WTS C;  2L54 A;  3QOP A;  1YW8 A;  4XLP F;  1O3Q A;  3SFZ A;  4IVN A;  4Z2Y A;  3RDI A;  3LFK A;  1MKM A;  5LGU A;  1YFH A;  2H27 A;  2XV4 S;  2IT0 A;  4PGG A;  4BHC A;  3WGG A;  3RYP A;  4IRI A;  2FF4 A;  2ETH A;  4P9F A;  5LEK A;  4FX4 A;  4IJA A;  2Y0M A;  3ERE D;  3WU1 B;  5LLQ A;  4P96 A;  4ZYH A;  3CJN A;  4UHT A;  3BWG A;  1BOA A;  1GXP A;  3COA C;  2GWR A;  3RKW A;  3KP5 A;  4PZJ A;  4A0Z A;  2PQ8 A;  4EQQ A;  3KCC A;  1IN7 A;  3BRO A;  2ELH A;  2JPB A;  4IPA A;  2H6C A;  5D4S A;  5JR3 A;  5K5R A;  2F5D A;  4ON0 A;  3LST A;  2IW5 A;  2LSO A;  3JTG A;  2XAS A;  2CW0 F;  4EJU A;  4RB1 A;  3JSP A;  3QAH A;  5BPI A;  3K1N A;  5HLI A;  1EH6 A;  1H9G A;  3EUH A;  2MA3 A;  4NQW A;  4YFX F;  4Q4Z F;  3WTT C;  2HGC A;  2HKO A;  4L9N A;  2L02 A;  4ENM A;  4I2O A;  2PBI A;  4LLN A;  1R5H A;  1XSX A;  2PG4 A;  4UNO A;  5HS7 A;  5D5V B;  1IW7 F;  3VFZ A;  4OOI A;  4XBF A;  4L5J A;  1W7P A;  1LNW A;  3VEP A;  3QP5 A;  4RGX A;  1BI2 A;  4WX9 A;  2DAO A;  2DO7 A;  1ULY A;  4IF4 A;  3FZV A;  5E17 F;  2VBW A;  3MQ0 A;  1FBQ A;  3CO7 C;  2VON A;  2EB7 A;  1T2K A;  1OMI A;  2XAF A;  4S04 A;  2GIV A;  3QU3 A;  5EEG A;  2JTV A;  5H6R A;  1ZAO A;  3LA3 A;  1JXS A;  2CO5 A;  5DCF A;  3RKX A;  5K1Y A;  5D6E A;  1WWX A;  2XAG A;  2E7X A;  3TGN A;  4BXU A;  4U88 A;  4ESF A;  2DLL A;  3RKY A;  1O3T A;  2HDC A;  1BIB A;  3HTU A;  4NB5 A;  3DPT A;  3GF2 A;  1ZRD A;  5J8F A;  1L3L A;  3IRQ A;  3QU6 A;  4ESJ A;  4A12 A;  4EMS A;  2OD5 A;  1DP7 P;  4KFC A;  3HRU A;  1G3S A;  1YS7 A;  4M73 A;  2KJC A;  2ISY A;  3M1E A;  2IA1 A;  1S6L A;  3F8M A;  5L3F A;  1HBX G;  2MLG A;  1XGO A;  4G9Y A;  2RN7 A;  1LDJ A;  2IVM A;  3HSR A;  3R0J A;  4CYD A;  3MWM A;  3HYI A;  4ENK A;  5LBQ A;  4LB5 A;  1I6X A;  5LHI A;  3D0S A;  2RDP A;  2P5L C;  1J59 A;  3BP8 A;  4GYI A;  2PMU A;  2ZBK A;  4GCV A;  1JHH A;  3HHH A;  3ABT A;  3QPH A;  5FFX A;  4TV7 A;  3KZZ A;  4ASN A;  4WWC A;  3R0A A;  2EK5 A;  2STT A;  2V1D A;  3EDP A;  2CQK A;  1J9I A;  4XRF A;  5CLS A;  4GO1 A;  4UV8 A;  5F6F A;  3IHU A;  2L4M A;  4B09 A;  2QVO A;  5D4R A;  4R8H A;  4UUV A;  2IP2 A;  3BY6 A;  3I59 B;  2ZKZ A;  3FXU A;  2OBP A;  1QO0 D;  1S3J A;  2HFH A;  1S7A A;  3FX3 A;  1F4K A;  4YIF A;  4AVP A;  1E17 A;  1LVA A;  1KQ0 A;  1KU7 A;  1R1V A;  2P5V A;  5IT9 Z;  1YLF A;  4KT5 C;  4LLL A;  2NNN A;  3MZY A;  4HLY A;  5FGM A;  2VBZ A;  3B02 A;  3E5Q A;  1JE8 A;  1HW2 A;  5L3C A;  2A07 F;  3V4G A;  5ERI A;  4D0P A;  4EV0 A;  1BN5 A;  3K0L A;  1FNN A;  5DD4 A;  4E70 A;  4YG2 F;  3ROU A;  1R58 A;  3ZMZ A;  5CVJ A;  1O3R A;  1KQ8 A;  1TQI A;  3HOS A;  4WF2 A;  4G6Q A;  2HOE A;  1Z6R A;  2HZT A;  1SMY F;  2QQ9 A;  3WE3 A;  2GXG A;  1TBX A;  5K5O A;  5KK1 A;  2WWY A;  2GXB A;  4EJO A;  2XAJ A;  2DQL A;  3R60 A;  5LRR A;  2FOK A;  1QZY A;  2QWW A;  2X4H A;  5CVV A;  4M71 A;  2OQR A;  2Q8K A;  4WXC A;  4MNU A;  1T98 A;  5IT9 K;  2ACJ A;  3LA7 A;  3F22 A;  2QM3 A;  4L9J A;  2ESN A;  4CZZ A;  3HUG A;  2GQQ A;  2YU3 A;  4ETS A;  4OIR F;  2E1N A;  3G73 A;  5DUK A;  5HLG A;  3O3K A;  3HIF A;  2FA5 A;  3JAM Z;  3RPU A;  4HX4 A;  2A6H F;  3O6B B;  4PCQ A;  4L5I A;  2G7H A;  4A5N A;  2DPD A;  1RI7 A;  5JVT A;  1FOK A;  2B0L A;  2W84 A;  2R3S A;  3WU0 A;  5ILS A;  2YPR A;  1QGP A;  2G7U A;  2VE8 A;  1O57 A;  2BEO A;  1XCB A;  4HF0 A;  3T1B A;  1QPM A;  3CUQ A;  3L7W A;  4KIB A;  2LF8 A;  1MJB A;  3ECO A;  2CYY A;  1ZG3 A;  4OMZ A;  5D5U B;  2P7C B;  5L3G A;  5AIQ A;  3I5U A;  2LDU A;  2PN6 A;  4FT8 A;  3E6M A;  4HAM A;  4Q47 A;  3M7G A;  5DYM A;  2MD5 A;  5L3B A;  1FP2 A;  5KVR A;  4Y13 A;  2VBY A;  5FD6 A;  5D5X B;  2OZ6 A;  2MC3 A;  1DPR A;  1ZGJ A;  4M9Z A;  3F6O A;  4UVA A;  5FD5 A;  3DFG A;  2DBB A;  1QBJ A;  4RB3 C;  3IWF A;  2FBK A;  2AXL A;  1ONV A;  2D1H A;  1IUY A;  2DQR A;  4N0B A;  2M87 A;  5FFZ A;  3I0T A;  3F8N A;  1YTY A;  3CDH A;  3R4K A;  4MQV A;  2H09 A;  4KIG A;  1I27 A;  2Q2E A;  2UZK A;  1W5T A;  3J81 Z;  2HEO A;  4AWX B;  4HV6 A;  3GO5 A;  5ED4 A;  3JTH A;  1HST A;  3FM5 A;  5FLX Z;  3JSO A;  3DEU A;  1BIA A;  2FMY A;  3ZQ7 A;  1F5T A;  5LGN A;  3DKW A;  4AIJ A;  3E5X A;  1IF1 A;  5K5Q A;  1ZRF A;  5LEJ A;  4IHT A;  1A04 A;  2CG4 A;  4XSZ F;  3M9A A;  2GA1 A;  5DDG A;  1FP1 D;  5L3E A;  3KP6 A;  3I53 A;  1KA8 A;  4EVI A;  2EFQ A;  5ILV A;  1SAX A;  4BAY A;  2VT2 A;  1T0F A;  5D8L B;  2RC4 A;  1V3F A;  3KEO A;  3F23 A;  4HF2 A;  2Y75 A;  3REO A;  2EFO A;  3WOD F;  2J5O A;  3R6S A;  2RKH A;  1R5G A;  5AIP A;  1QNT A;  3E97 A;  3SZT A;  1FLI A;  3WTV C;  2D1V A;  4MQ9 F;  5HOO A;  5FB2 A;  2W24 A;  1P2F A;  4RAZ A;  4R79 A;  2M30 A;  4OIO F;  3DQV C;  4G7O F;  5DCM B;  4U0W A;  1R00 A;  4EGZ A;  3K1P A;  1U5T C;  4G7H F;  1ZRE A;  3HTS B;  2KIU A;  4ENN A;  2VOD A;  3SHF A;  2FXA A;  5LHH A;  5E1W A;  4HX8 A;  2DT5 A;  4OIQ F;  4KUM A;  5JHU A;  4O3M A;  2O6G E;  2QBY A;  1HKS A;  3N4M A;  5HS9 A;  4LMY A;  3KEQ A;  1C0W A;  1REP C;  1MJA A;  4PDK A;  4CIC A;  1LQ1 A;  2O03 A;  3WTX C;  5H6Q A;  2XHK A;  5ILU A;  3C18 A;  3L9F A;  2EV5 A;  2FRH A;  2BE5 F;  3HRM A;  2LKP A;  3HHG A;  4KN7 X;  4Q48 A;  2O3F A;  2JT1 A;  3RJP A;  3TO9 A;  3U2R A;  4IRG A;  2HS5 A;  2MH2 A;  3I59 A;  1WKM A;  2TDX A;  1Z91 A;  4M6X A;  2E1C A;  4OIN F;  5HDG A;  3IL2 A;  2VC0 A;  1Z6T A;  3GUD A;  4JQF A;  3SZP A;  2A69 F;  3KLN A;  3TOA A;  5CVI A;  4YFK F;  1XGS A;  1ZG5 A;  3D5L A;  4ESB A;  2RVC A;  4KMF A;  3K69 A;  2FBI A;  1W7P B;  3NRV A;  1P92 A;  3HRS A;  4GYG A;  3Q5F A;  2ZNY A;  2WTE A;  1KGS A;  1K78 B;  3M8E A;  4IHS A;  3AAF A;  2Z99 A;  1TNT A;  2YSR A;  4L18 B;  2KKO A;  1BI1 A;  1UCR A;  2JPC A;  2MH9 A;  2OZU A;  3ZN0 A;  4HBL A;  2K86 A;  4M9X A;  2STW A;  2EFN A;  2FU4 A;  4LB6 B;  2VN2 A;  3E6D A;  1IN4 A;  4A6D A;  1U2W A;  3GWZ A;  1Z05 A;  1XGN A;  1KYW A;  4M74 A;  1D8K A;  1FYL A;  2NYX A;  5E20 A;  1WI9 A;  3DF8 A;  1FY7 A;  4JBA A;  1HW5 A;  1FC3 A;  4ZZL A;  3SQN A;  2M45 A;  3F8B A;  3G3Z A;  1GXQ A;  1D5V A;  2L3D A;  2KIF A;  4L9T A;  5TJJ A;  1R1T A;  1R36 A;  1PDN C;  5L3D A;  3WE2 A;  4OU0 A;  2ZME A;  3ISP A;  2EV6 A;  2OU2 A;  2BV6 A;  3MCZ A;  2XRN A;  2DPU A;  2XKP A;  2IA2 A;  2HYG D;  3EYI A;  1AOY A;  3FMR A;  4CHU A;  3R61 A;  3C3W A;  2ZME B;  3TDU C;  2QQA A;  3FMQ A;  4KA4 A;  1BBY A;  1DUX C;  5BS6 A;  1SD6 A;  2KJB A;  4RAY A;  5D5W B;  2NS0 A;  3P7N A;  5F1R A;  5FO5 A;  5JFR A;  3K9T A;  1XB4 A;  3L00 A;  1IAW A;  3L09 A;  4MTE A;  2A68 F;  2DK5 A;  2EFW A;  1YO5 C;  1H9T A;  3TO6 A;  1G3T A;  1BJA A;  4BH9 A;  2DU9 A;  3U1D A;  1L0O C;  2FNP A;  4HV5 A;  1J75 A;  4WXD A;  4BHP A;  3ZP5 A;  1J2X A;  4I0A A;  4BHB A;  2CWE A;  1QQI A;  3GFI A;  4QWQ A;  4ZYD A;  3ZPL A;  3RPQ A;  3DP7 A;  4NHJ A;  1FBU A;  3PQJ A;  2DW4 A;  4FHT A;  4A2U A;  1J0R A;  3KP4 A;  4I02 A;  1RUO A;  2V9V A;  3KET A;  1PUE E;  2QLZ A;  5DCM A;  4FX0 A;  4M6Y A;  3E5U A;  2GA2 A;  1IRG A;  1R22 A;  1G3W A;  4WCG A;  1UHM A;  3GLX A;  3LQR A;  3I71 A;  1HKQ A;  2JSC A;  2QUF A;  4L0Y B;  3TDZ C;  2RQP A;  4LFU A;  2JRT A;  5CYV A;  1TQP A;  4A0Y A;  4LG0 A;  3E6B A;  3F8F A;  1O3S A;  4KMU X;  3K2Z A;  3KFW X;  2G9W A;  1MD0 A;  1ZRC A;  2XKO A;  1WQ2 A;  1TQM A;  2XVC A;  3VOE A;  2QYO A;  2K02 A;  2IJL A;  1CF7 B;  1HKT A;  1Z9C A;  4MGR A;  3V7C A;  3P9K A;  2HTJ A;  2ZFW A;  2DFI A;  4LG0 B;  3BOQ A;  2FSW A;  3J81 K;  3MFK A;  3EYY A;  4U7B A;  3J80 K;  4UV9 A;  3V7S A;  4F7Z A;  1FSH A;  1B59 A;  1TNS A;  2W57 A;  3V8K A;  2YR2 A;  4ZH4 F;  2W85 A;  4EJW A;  2HTS A;  1I1G A;  1XSD A;  5AON A;  3GX4 X;  1W7P D;  4G6D A;  2HWV A;  1YYV A;  4L0Z B;  4CDG A;  3KE2 A;  2COM A;  3BJA A;  2HYF A;  2LNB A;  2VE9 A;  1FYK A;  1XCV A;  5BMZ A;  1D8J A;  1W4M A;  2LF7 A;  5CVR A;  1RNL A;  4I01 A;  4CO8 A;  2Z9O A;  4IRH A;  5A2Q Z;  5DD8 A;  1RIO H;  1XDU A;  1GHC A;  3JW4 A;  3WTU C;  3T8R A;  4CXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...