1DF4A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
57
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAGGWMEWDREINNYTSLIHSLIEESQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 24
structure length 57
sequence length 62
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df4A00
2EBOA 2X7RB 2EZPA 3WFVA 1F23A 4JF3A 1I5YA 1K34A 3CYOA 3MHHC 5H9CA 4JPRA 1Y4MA 5HFMA 1ENVA 1MG1A 4JGSA 5CN0A 1QR9A 1DF4A 3P30A 1K33A 4FIPC 3GWOA 2M7WA 5HFLA 3H01A 1QCEA 1JPXA 5CMUA 1Y66A 1MOFA 3B8NA 2P6JA 3MHSC 2MK3A 1EBOA 3K9AA 3M99B 4N23A 4FJCC 4G2KA 5KA6A 1JQ0A 1DF5A 3B8MA 3B77A 4E2LA 1SZTA 3CP1A 5KA5A 2EZOA 2LP7A 2OT5A 1QR8A 4N21A 4FK5C 1DLBA 1I5XA 1QBZA
chains in the Genus database with same CATH superfamily
3JALB 3LSUA 5HFMA 1Y4MA 4NR1A 4TUYB 1K97A 4X1IA 4W4LA 4NKGB 4BWAA 4DV4B 5DEDA 1I94O 4PI0A 2UXDO 3A0BZ 2F23A 4KHPO 4MVMA 2R9AA 1IDSA 2W6JG 1IXMA 3NR7A 4J41A 1XHXA 5D5PA 4CH6A 4DV2B 3K04A 1D5AA 1RM1C 1QLEC 2YXHA 4O4IA 1AILA 2EBOA 4K0KB 1XUQA 1TVKB 1XOUA 5J2TA 1M56C 3OD4A 4DV6O 1UFIA 1GK9A 4X66B 5KAFZ 2LQTA 3JALA 3LDCA 3JYCA 4HAMA 1ZL8B 4TUYA 4LH7A 1RP3B 1E1RG 4EB6A 1N36O 1P4RA 3L75H 1Z5WA 1E1QG 3JSLA 5CBHA 3RFRA 2Q7GA 4FLVA 5KHJA 1VQMV 4GT1A 5KHIA 2AW9A 1WPXA 2YXYA 1WP7A 2FTKA 4LF9O 3GVMA 1TVKA 3FFQA 4DRXA 2Q68A 3HKEB 4MTFA 3JATA 2PF4E 2CK3G 2PTMA 2OIEA 1OCZC 1BSMA 4FVMA 3LDDA 1ZL8A 3ZHQA 4LF4B 1I7FA 5TISZ 1S76D 5J2UB 4C7UA 2IJJA 2KG7B 5BR8B 3OM3B 3CCSV 1I0HA 4I55B 1B04A 2DYRC 4LCUC 5KA5A 3HKEA 4DV0O 2V7QG 4PD4F 2ADQB 1GKFA 4FLYA 3AG2B 5H5NA 4I50B 1VQKV 4X65O 3OE7G 3T4ZA 2MK3A 4MVSA 1YCIA 3BFRA 2NLJC 1VMGA 4BIUA 5J2UA 4K3AA 4B08A 4ZHQB 1WB8A 3UKMA 4JAAA 4I55A 4O2AA 1Q7YW 5L3DA 4JGSA 3EHBB 2ZR3A 3OTOO 1IBLB 1IXBA 1J5EB 2CTRA 4WFGA 1Q6IA 1BQZA 3RYIA 5KHGA 5LGNA 4I50A 1HWYA 4XDKA 2IJIA 2DQ3A 2PI4A 2EULA 1K73W 4DR4O 4JYCA 1AI7A 1V54C 4KL1A 4ZHQA 2IM9A 4JTDB 1M9NA 1KYOF 4LH6A 3RWRD 5B5EZ 3AK2A 2M7WA 3G6EV 1AJNA 2NN4A 2WA3A 1Y76B 2YIAA 2VQFO 2BTOA 4DR3O 3LDEA 4DV1O 1RSOB 1ORQC 1XBLA 4LF5O 1FJGB 2R70A 5FPOA 1AI4A 3FYEB 1FXKA 3N27A 3W7XA 4GLXA 1AB3A 2A3QA 2IH3C 4HBNA 3ETQA 1IBKO 1AR4A 2ZM6B 4X1YA 4DK0A 2LGQA 4JI3O 1W59A 3ZBHA 1K92A 3TGUH 1OV9A 2XUMA 3JD0A 3X2QB 4FPPA 4EFBA 3EVKA 2BTQB 1Y76A 3R66A 3ZHRA 3G80A 3WFVA 2VQEO 1RSOA 4QE9A 1GN4A 3CCQV 2RMKB 4DV5B 1Y67A 4DR7O 5B1AC 2ZKOA 2VWKA 1JCHA 3SJQC 1K5QA 4X9QA 2Q7EA 4JI7O 2WWWA 4BIZA 4LP8A 2P06A 3QO5A 1SQPH 2F66C 2IW5A 3P3NA 4Q6GA 2XAQA 4UVBA 3C3SA 2PI5A 1NQTA 5IWAO 3L73H 4MVRA 4JI4O 2W6IG 1XNQO 1L8DA 2CGOA 4AI8A 2YS8A 2BTQA 4FZ0A 3K5NA 1JOYA 4UB8Z 3ABTA 1JPXA 2Q0OC 1H38A 3WB1A 3K3WA 4B7KA 2OCCB 1VQPV 5IYZB 1YITV 4GX5A 1NVPD 1L1FA 3OGIB 4NXNO 3IC7A 5KUMA 3ICXA 3SYCA 3F7VC 1MSDA 3I55V 1XMQB 4H44B 2QKAA 1VEWA 4G27B 1Y74B 3T1YB 2IJHA 2ITCC 4LF7B 1XDCA 2Q0AA 2DQ0A 3STLC 1Q86W 2F93B 4LF6B 4HZ3A 1EZVH 2BOCC 1LR1A 1RM1B 1QLEB 4FM2A 4J9ZB 1NR1A 1XL6A 4QNHB 1XNRB 5IYZA 4R6ZA 5H9CA 4I0XA 3W7SA 3ABLC 3VBBA 1M56B 2ARHA 1MG1A 3APOA 1B6QA 5LA6B 1PNMA 1JMKC 4QIWF 3OW2U 1EBOA 4GUNA 1F4MA 4AQYB 3CSXA 2PYJA 1DF5A 1Y74A 1TA8A 2Y48A 1AP5A 4NXMB 3SPGA 5EYPB 4JI0B 2UXXA 3JD2A 1JA8A 4DV4O 3AK1A 5KMGB 1QVFU 2IU3A 1K33A 3IFXA 4QGPA 1QCEA 4JI1B 3RVZA 4DV2O 5JVDB 5LA6A 1K5SA 2XASA 3OT7A 2ZXWC 1OCZB 4K0KO 4JI5O 1YF2A 2LFSA 4DYLA 5FLXN 2AHZA 1ZX3A 4B3TB 4UB6Z 3W7WA 3UM7A 5L3FA 1N4CA 4X66O 4PJ0Z 1WB7A 2VS0A 1Q8IA 4BAYA 3P3PA 5CMUA 4B3SB 3AG4C 1M57B 5EYPA 5BZBA 4UV9A 4IYHA 5KMGA 1OHHG 4OX9B 1URFA 4NVPA 2HEPA 5JVDA 2E74B 1FD9A 1GM8A 1TUBB 2Y4TA 1MZFA 1GN3A 2CTQA 2DW4A 4I4TB 2X6BA 2DE0X 4GX1A 1S72V 1NT2B 4X8AA 2HVJC 2JJ1G 5B1NA 2BSKA 5A2QN 4LF4O 2QKCA 4DR1B 4BR6A 4O4HB 5IY5B 1US6A 3QO7A 2QEXV 5EBWC 2D3OW 1XILA 5BR8O 5IYBO 3P30A 3ZRVA 3ZRXA 2Z3YA 3RYCB 1SRYA 4FLXA 1NBMG 1TUBA 4EKWA 2ITDC 5KA6A 4PA3A 4I4TA 2JIZG 1AP6A 1YI2V 3CCMV 5FPRA 2XT9A 3K0GA 1V54B 2B9ZA 2HKOA 5KX5B 4JF3A 2ODMA 1PPJH 2CTWA 4QJFB 1PKXA 4O4HA 3SJCC 1Q5OA 1FFXB 3CRRA 4J42A 3OEEG 4XDJA 2ZE8A 2ZQMA 3RYCA 4B3MB 4J9YB 2C2AA 3CRQA 3N2KB 4WF9V 1NR7A 4DV7B 3QG5A 2RDCA 1IBLO 2RCVA 1J5EO 3U10A 4JZ2A 5KX5A 2CDYA 4DUZB 4JTCB 3ZS8C 1L0NH 4CZZA 1KECA 3CCVV 3BA9A 1FFXA 2QA4V 1AR1B 1VF6C 2M6YA 2GDSA 2KQXA 2GUZB 1DLBA 1R3LC 1F23A 2JVDA 3N2KA 1MMMA 2EJRA 3B8NA 1YDXA 1BS3A 1FJGO 1COWG 3RW0A 1YJWV 3QNEA 5KAIZ 3KKYA 1F7YA 4RAIA 3ZHVA 2L35A 4H0LB 4JASA 2YC0A 4TV9A 3AG3C 4F6EA 2GUZA 3SPJA 1S77D 2BCCH 1GAXA 2BE3A 3TCUA 2ZD9A 4J11A 1RFYA 1BCCH 1GRJA 5EC2C 1N33B 4CS2A 4UCTA 4DV5O 4MTGA 2KKWA 4UCSA 2P67A 2DJVA 5B66Z 4Z1VA 4DR6B 1AJQA 2QDOA 1P84F 3OMIB 5GTIZ 3CRAA 3PN1A 2QWQB 2UU9O 3E22A 2A7WA 3ZMUA 4BIOA 3JCUZ 2EINB 3ABLB 4I9WA 5K1XA 3CC7V 1JR9A 4PA9A 4DXWA 5B1BC 4EB6B 3ETGA 1VARA 4MVZA 1SQVH 3NXSA 3LSQA 3SJAC 5KHHA 1PL0A 2R72A 1H2NA 3H1IH 1MA1A 1UPGA 3CMEV 4DRXB 3T1YO 4LWSB 3JATB 3T1CA 4ZOLB 1NI8A 3CHXA 4PV1B 3E83A 3CCRV 1B3QA 3UO3A 2HHHB 1XNRO 3UT5B 5LMNO 3E8FA 3ZMSA 3VOUA 4L87A 2EZPA 1QNMA 4WFHA 3SPIA 1OCRB 4EEQA 4MTOA 1WAZA 3SPCA 1FXHA 3ZRSA 4OPAA 5DN6G 4PA7A 4YY3B 2OCHA 1YIJV 1OJHA 2Q6AA 3K9AA 2P90A 4QPKA 4QPJA 4LWSA 1I08A 3LUTB 1WP8A 5FNVB 4ZOLA 4JI0O 1XI1A 2EIMC 4JI2O 1VQLV 3QVNA 2YEVB 2JGDB 5CBFA 2DYSC 1KP3A 1DGSA 3UT5A 1R6NA 3JAMN 4JI1O 3AG7A 2OIGA 2VWJA 4UCUA 1R6TA 2XAGA 2XTAA 4MSWC 4MW3A 3CCUV 1O9GA 1OCOC 2FYUH 3BCCH 2YI9A 3TJTA 4NTWA 1AI6A 3DXRB 4O2AB 2UXNA 3E35A 4Z1MG 4R8CA 5CA1B 3OUFA 3MHHC 4O4LB 2B1IA 5FNVA 4B3SO 3BPZA 3RYIB 3TXQA 2YUAA 2YEVA 2JGDA 4OX9O 3VQYA 1XEQA 1YZBA 2YSUB 3S3WA 1HR0B 2H8PC 5JCOC 3CJHB 3ZRWB 4X64B 1Q81W 3ASNB 4O2BB 3DXRA 4D7TA 2H3OA 3RYHB 3DSQA 4JYYA 5CA1A 1BL8A 1DTOA 1N0JA 4YXWG 1WA8B 4O4LA 4JTAB 2ZE7A 4P9PA 2X0LA 3D3QA 4DR1O 1FXKB 1KMIZ 3K5LA 2CGNA 3ABMB 5D5QA 2Z0AA 4X1YB 3CEIA 1K34A 1HP8A 4UCRA 4X62B 3ETDA 3CJHA 3ZRWA 2PUSA 4PDVA 3FB7C 3ZEDA 4O2BA 4TSFG 1NU1H 4MVOA 1XMOB 3RYHA 4LFCB 1SETA 1B06A 4IGGA 2YXLA 1WA8A 1Z2GA 3FX7A 3HKCB 2RJZA 2XHBA 2WLIA 4J80A 4MS2A 2P4KA 1HNXB 1BQ0A 3ZIAG 3HKBB 4D6TH 4WCEV 4LNUB 4B3MO 4UFZA 1PV0A 2UUAB 2UUCB 1BZKA 4LFBO 1NTZH 2DWEC 1PD3A 4ICGA 2F95B 4J10A 3ZCCA 1AR5A 2IBZH 2ZDIC 3EFFK 3RT3C 3AG3B 1CEZA 2QWNB 2PZSA 3HKCA 4DUZO 4FLWA 3K5MA 3C3TA 1MZEA 3SJBC 1SKVA 1U97A 4JYBA 1YTFB 4FLUA 3HKBA 2LW7A 3SYQA 4GKJO 4LNUA 5EIBD 1P7BA 4D7SA 2EILB 1MABG 3P32A 3H1JH 2Y69B 1EFRG 3ZHTA 2YICA 5H6QA 5EZYB 4TWKA 2FKXA 3RYFB 3BY6A 3QF7A 1KKDA 3CMAV 1W0KG 3MAQA 3ABKC 3M7MX 2F43G 2ZNIA 1S5JA 3F5WC 2QSAA 3G67A 4RQEA 4I0XB 1QLNA 3K79A 1CP9A 3ASOC 4G28B 1IBMB 3SPHA 4FM0A 3T1HB 2OTLV 2JRIA 3CX5F 3GB7C 2DWDC 4Z2WA 4XBFA 1H2KA 1ZUQA 1KBHA 2ZNJA 3LNMB 1H2LA 4FIPC 3LSSA 5B1BB 3W7UA 3B09A 4F6RB 4N23A 1WJZA 3JSNA 3KCXA 4NB5A 5EZYA 3MD0A 3RYFA 1N33O 2UXDB 1SQGA 2AGAA 2A9HA 1R1BA 4RUEA 3LNNA 1QBZA 1J95A 1HNWO 3TK1A 1ROPA 1N34O 1SQQH 1EN6A 3CWBH 4YJ2A 1F4NA 3JAKB 1FPOA 4DV6B 3STZC 3BABA 1PL4A 1YTFD 1FXVA 3B77A 4UVCA 2UUBB 4F6RA 5IYCO 5KLVH 1VP7A 3SYOA 2F4VB 4U3FH 4J7JA 1SZXA 5GW7A 4R7CA 1SQBH 3JCZA 3OR7C 1EZJA 5DECA 1XQ8A 2F1MA 3FKSG 1TGOA 2YIBA 3K0DA 4PA4A 2AHYA 3AG1C 2LO1A 3JAKA 2LJ2A 3OR6C 4GKKB 3HR0A 1EM1A 2QR4A 1WNSA 2DYSB 3A0RA 4ABMA 3ZX6A 4JYAB 4PDMA 4MT8A 2BSKB 2WLMA 2LW1A 1M5IA 4PHZA 3CCEV 1OCOB 2QKSA 3SR2C 1PNLA 2DYRB 2EIJC 3ML0A 3CP1A 2ZE5A 3KCYA 2UXBB 4FFBB 4DO2A 4DW0A 4A5UB 2IH1C 5CN0A 3RVYA 3UQ8A 4NYKA 1W2BU 5LHGA 1VQ6V 2CAZC 4UCOA 1Y66A 3G6BA 1V55C 3MHSC 5BMVB 5EC1C 4DR2B 4KXRA 1HW7A 3FYIB 4JV5B 2CH7B 4X20A 1H8HG 1BHAA 1JQ0A 1M93A 3DGEA 2JEUA 2NR5A 1YVWA 4FFKA 2YI8A 4TQDA 3U0ZA 3APQA 2YIDA 1O9HA 3RGBA 4DV3B 5L3CA 1G1XB 2XAHA 5B1OA 4Q20A 2Q69A 2FMLA 4FFBA 3WU2Z 5E79Z 1ZWIC 2H94A 4LR3A 3CPWU 3WG7C 1VQ9V 2HFEC 5L3BA 5H2FZ 5BMVA 3IC9A 2PY5A 2CH7A 2QE7G 5EK0A 4LF8B 4DR4B 4IT5A 4JPRA 3AG2C 1NZ6A 1YXBA 3PJSK 1NTKH 3GWOA 5LL6Y 3CXHF 4TT3G 2NNUA 4IYIA 5IJ0B 2D2CB 4AHCA 4H37A 1GN2A 1NJIW 3H1KH 4IHJB 4UXNA 3HB3B 2VQFB 4FLZA 1THZA 4YHHB 4DR3B 2HG5C 4DV1B 2W0XA 1SQFA 4LF5B 1LNQA 4U7OA 2V4DA 2IJKA 5LYJB 2JEXA 5LBQA 2X6AA 2WLKA 2Q9LA 1IBKB 3D3IA 5EBLC 4B3RB 3GWKC 3D36C 2E5LB 4FJCC 4TV9B 1TUEB 2QJ1A 1BMFG 4RO2A 5IJ0A 4UV8A 5LMUB 2B5UA 4IHJA 3SYPA 1GO3F 1Q43A 5IE9A 3OFNG 3ABUA 1XMOO 2GBOA 5AG2A 3VQWA 5B1AB 1SC5B 4LFCO 2Q67A 2P6JA 3RN4A 5LYJA 4DR7B 5J9PC 1D5NA 3U11A 5GONB 3L9DA 4JI7B 3RBZA 1R3IC 3JASB 2PGGA 1H2SB 3ZMTA 3CC4V 3KG2A 3OTFA 2WLNA 3OUSA 2XAJA 1HNXO 4CC5A 2LGWA 4JI4B 2ZM6O 4UVAA 4ZKIA 1XNQB 2Y0PA 2ZDIA 5JJEB 5L3GA 2UUAO 2Q7HA 3A2FA 3E22B 3R65A 1VQNV 2DN9A 3ABKB 1QU7A 3L71H 4HYOA 2P5OA 4X89A 1NTMH 4EFEA 1KUQA 4RUFA 5GONA 3MDSA 5DM6V 2QGNA 3JASA 4GX0A 1PM9A 1IVSA 3H01A 4MVUA 3CRCA 5LOVB 3H9VA 2JGUA 3B2EE 3CC2V 4JI6B 1M1KW 1Y6XA 1BT8A 4LC1A 1N0NA 2EZOA 2OT5A 4LFAB 3K58A 2QWOB 4UUJC 2XNDG 1CXZB 4CH4A 1FFTB 2ETNA 3K06A 1KD1W 1AROP 4CC6A 2OYQA 3K57A 3K03A 2V1DA 2XOKG 5C93A 1IBMO 4E4EA 3E89A 3T1HO 3ZMZA 3K5OA 5LOVA 1XMQO 5CB4B 1QHTA 1EN4A 1N32B 1XREA 4WBNB 3M8AA 1A32A 5LHIA 2OTJV 4LF7O 1K7DA 2EIKC 3QTCA 1MOFA 4FM1A 1R3KC 5L3EA 3BAAA 4PI2A 5LGTA 4LF6O 3AG1B 2HR3A 2ZXWB 2G38A 2E75B 2QM7A 1VQ4V 4RWUA 3E8HA 4KFMA 4JI5B 3H1HH 3UCSC 5LP6C 2WAMA 3D8CA 2Y4UA 3UO2A 1JFFB 5CB4A 1VQOV 2ZIOA 4IIJB 3AG4B 1X4TA 4WBNA 2XAFA 3CE2A 1KKCA 4LBEC 4AQYO 2UUBO 4NTXA 5JWPA 3L72H 4FLTA 1FAFA 2K1EA 2EIJB 4I9QA 4P9OA 1SA0B 4NXMO 2WLJA 1YEWA 1E79G 4K35A 2QTSA 1QVGU 2F4VO 4RQFA 4YIOA 5B3SC 1YHQV 3E2EA 1KC8W 2RN9A 4ZI7B 1V55B 1Q82W 1IX9A 4WFFA 2CUGA 4GKKO 4JI8B 1JFFA 3T4DA 1VQ8V 2UXCB 4CS4A 4IIJA 1P7GA 1LUVA 1OCCC 5LXTB 4B3TO 5CBGA 4J7KA 4JYAO 1I5YA 1K4DC 2ILMA 1SA0A 1D2DA 1LUWA 2DMXA 3BHPA 1M57C 1Q3EA 1AVMA 4UCVA 3ZMVA 2KB1A 2FB5A 4ZBMA 3WG7B 4ZI7A 3JAWB 4MW8A 1ZSPA 1Z5VA 2UXBO 3EXAA 2LP7A 1IZ3A 4N21A 2JJ2G 3L70H 1TAEA 2BOBC 4JZGA 4DR2O 2N05A 5LXTA 2N74A 4JV5O 2GHYA 1K9MW 1BHBA 4DUYB 4O4JB 2RQ6A 2KG7A 5JJJB 1XHZA 2WLIB 2LFRA 1WPBA 2WLHA 4DV3O 1AI5A 5IY5C 1MSWD 2O57A 4U3JB 2X7RB 3JAWA 2DOSA 3K59A 4AILC 4WFEA 2HJDA 1RPOA 4F4LA 3CS5A 2WA4A 1CPYA 2P4VA 3FB6C 3IGAC 1X59A 4LF8O 1U96A 4X1KB 3DTUB 1PP9H 4FK5C 4O4JA 4OXSA 3HPLC 1JJOA 1SF9A 5LHHA 1QR9A 5JQGB 4U3JA 5GTHZ 5IDJA 1VQ7V 3BEHA 2WSSG 1N8RW 1RPRA 1BE3H 4YHHO 3Q4HB 1R6KA 3M99B 4JAVA 1GMGA 3OEHG 3IAYA 2ATKC 1NVPB 1G8MA 3D36A 4DV7O 5CA0B 3HKDB 1H2MA 1JX9A 2GTSA 2CE4A 1S0VA 1R3JC 4X1KA 1VF6A 3F7YC 1HNZB 4B3RO 4GCZA 4MTXA 2E5LO 5JH7B 4CBCA 1NH2B 2QM4A 3AK3A 1V9PA 5JQGA 2CTPA 5LMUO 1PNKA 1SS3A 4E2LA 2N04A 3SYAA 2RNBA 1GM7A 3Q4HA 2P22C 2IU0A 2WPDG 1H8EG 1BGYH 2YDEA 2JS3A 3OMAB 5CA0A 3HKDA 1F51A 4OPHA 2KSDA 3TETA 2AZ0A 2W0FC 3QO8A 2ZINA 2UU9B 4HNAB 3L74H 5JH7A 1Q6UA 4J7ZA 3ZN0A 1FYJA 5F2VO 4YJ2B 3J7AU 5BXZA 2JDIG 1S3JA 3CYOA 3H1LH 2FL4A 4DR5B 1GTOA 3K9SA 4TOIA 2ZR2A 1I94B 1G6UA 2ZT9B 4H33A 4KHPB 1XL4A 1NKDA 2QWRB 3O9OA 3ZJZA 1I5XA 1ZLZA 4WFBV 3OMNB 4DR6O 4HNAA 4W4KA 5C8YB 1JJ2U 2VRZA 4CH5A 2EIKB 1WN7A 4DW1A 4YJ3B 4JI6O 1NH2D 4MVQA 3JARB 3VQVA 3VQXA 2HLDG 1M90W 4LFAO 1S5LZ 3ZHSA 3TXSA 2E76B 1GM9A 1SZTA 1QR8A 4JAUA 1YJ9V 1KQSU 2EINC 1N36B 5LP6B 5LMNB 1Q90D 1KU9A 2JK5C 4BW5A 1DF4A 2Y0IA 3B4SA 3E8GA 1OZ0A 1KB9F 5C8YA 5IYDO 4LF9B 1SESA 1SQXH 2L6LA 4YJ3A 5H6RA 4GX2A 1N32O 5LGUA 3JARA 4WFAV 2EIMB 2Q8VA 5B3SB 1AJPA 2QTOA 4JI2B 5ITZB 2X6CA 4X20B 5LP6A 3O65A 1R73A 3B40A 1SERA 1YJNV 2HHHO 1YSCA 2Q73A 4I5SA 3THOA 3FB5C 4K8ZA 5K1PA 1OCCB 4PELA 3SDLA 1JVMA 1OCRC 3CD6V 2B1GA 2HP8A 4DV0B 2YIBD 3CCLV 2Z5UA 1M4UA 1K3EA 4YY3O 1UJWB 1MNGA 3F5TA 3I5DA 2HVKC 3K08A 4X65B 5ITZA 4XDLA 3B8MA 1KP2A 1VIBA 3CRMA 1T5EA 4PA6A 5IT9N 1EN5A 5IJ9B 2EJ7A 3FAVB 1QQCA 4K8XA 3ETEA 4R50A 3JD4A 3FD9A 2A0LA 2ADPA 2JS5A 3ZHUA 4IL6Z 4JI8O 3OAAG 2R9RB 1GN6A 2UXCO 3OTOB 4L8JA 3KZIZ 3C90A 2ZE6A 5E1AC 2OWOA 5BY1A 2QM8A 2HJFC 2Q4PA 3BRCA 3J80N 1K4CC 5IJ9A 5JCOA 3FAVA 4TV8B 3E8BA 3G4SV 4U7NA 3WB2A 3ZN1A 4GYCB 4OGQB 1HR0O 3N2GB 2GV9A 3I56V 2GSMB 4X64O 4CS3A 1VF7A 1G4YB 3AEIA 2A06H 3ASNC 4GZRB 5FL7G 5EBMC 1H2GA 3S3XA 4DUYO 4X88A 2AZ2A 2MW2B 1P49A 4JI3B 4G2KA 1FXKC 4TV8A 1ZAUA 3ABMC 4LFBB 1NS1A 3IJ4A 3SGIA 5EIBC 4DK1A 2Q5ZA 4X62O 3N2GA 4FZ1A 4PDLA 1ENVA 4PDRA 5KHKA 1IURA 2VQEB 3JD3A 5HFLA 1FS0G 1VF5B 3G71V 3T2MA 4I7ZB 3DC6A 4CH3A 4KP4A 2EX3A 3WB0A 3JD1A 3J81N 4BW9A 1FKAO 3CCJV 4KUMA 4GKJB 2QWPB 5IWAB 3CB2A 4NTYA 1Q6HA 4TQFA 4ZIBA 2WLLB 2UUCO 1L0LH 3BVOA 3A8TA 4B7EA 5JJNB 5KUKA 3X2QC 3FB8C 3BA8A 3ASOB 3E86A 1HNZO 1WLEA 4NXNB 3CXCU 1GH6A 1HDJA 4FMTA 4P2ZA 3W7TA 2A79B 2R9IA 4H13B 2AXTZ 1W0JG 1VQ5V 2WLLA 4QE7A 4X1IB 4P30A 1K8AW 4ASUG 2P7TC 2EILC 1DK1A 2Y69C 1HNWB 1S5HC 2E3CA 1N34B 2K9PA 2PYLA 5CA3A 4O4IB 2OCCC 4YIPA 3OGCC 5A9GA 3DC5A 2ZIMA 3A0HZ 2GTAA 5J2TB 1ZTEA 4DR5O 2ZCEA
chains in the Genus database with same CATH topology
3K0GA 2X7RB 1V54B 2HKOA 1J95A 4JF3A 3TK1A 1ROPA 1Y4MA 5HFMA 4QJFB 1K97A 1PKXA 4WFEA 1F4NA 1RPOA 3OEEG 4XDJA 4F4LA 3STZC 1CPYA 3FB6C 1YTFD 3IGAC 4MVMA 2ZQMA 2W6JG 1FXVA 3B77A 4J9YB 1IXMA 2C2AA 4UVCA 3DTUB 5IYCO 4WF9V 3K04A 1NR7A 1RM1C 1QLEC 4FK5C 4OXSA 2EBOA 3HPLC 3SYOA 5LHHA 1M56C 1QR9A 5IDJA 5GW7A 1VQ7V 4R7CA 3BEHA 1GK9A 3JCZA 3OR7C 2WSSG 1N8RW 1EZJA 1RPRA 3LDCA 4JTCB 3JYCA 3FKSG 4HAMA 4CZZA 1R6KA 3K0DA 1KECA 3M99B 4JAVA 4PA4A 1GMGA 3CCVV 2AHYA 3AG1C 3OEHG 2ATKC 2QA4V 1NVPB 1G8MA 1E1RG 3D36A 3OR6C 1AR1B 1P4RA 1DLBA 1E1QG 1R3LC 5CBHA 2DYSB 3A0RA 1F23A 1JX9A 1S0VA 1R3JC 3F7YC 1VQMV 4GT1A 1WPXA 4GCZA 4PDMA 4MT8A 4MTXA 2WLMA 2EJRA 2FTKA 3B8NA 4CBCA 3CCEV 2Q68A 1NH2B 1COWG 3RW0A 1OCOB 4MTFA 1YJWV 2QKSA 3QNEA 2CK3G 1PNLA 1PNKA 2DYRB 2EIJC 3ML0A 4E2LA 3SYAA 1OCZC 3CP1A 1GM7A 3LDDA 4RAIA 2IU0A 2WPDG 4JASA 1H8EG 4DO2A 3AG3C 2IH1C 5CN0A 3RVYA 1W2BU 3OMAB 5LHGA 1S76D 1VQ6V 3SPJA 1S77D 2IJJA 1F51A 1Y66A 1V55C 3MHSC 5EC1C 3FYIB 3TETA 3OM3B 3CCSV 2W0FC 3TCUA 2ZD9A 1H8HG 1BHAA 1JQ0A 3QO8A 3DGEA 2JEUA 2DYRC 4LCUC 5KA5A 5EC2C 3ZN0A 4MTGA 2JDIG 5L3CA 1S3JA 3CYOA 2V7QG 2P67A 1GKFA 3AG2B 2XAHA 5B1OA 1VQKV 3OE7G 1GTOA 3T4ZA 4Q20A 1AJQA 2Q69A 2MK3A 4MVSA 3OMIB 1ZWIC 2H94A 3CPWU 2NLJC 2ZR2A 4BIUA 3WG7C 1VQ9V 4H33A 2HFEC 5L3BA 3UKMA 3ZMUA 1XL4A 1NKDA 2QE7G 5EK0A 3ZJZA 1I5XA 2EINB 4WFBV 1Q7YW 3ABLB 4I9WA 3OMNB 5L3DA 4JPRA 4JGSA 3AG2C 1JJ2U 3EHBB 2ZR3A 3CC7V 3PJSK 3GWOA 4PA9A 2EIKB 4DXWA 5B1BC 4TT3G 2NNUA 1NH2D 3ETGA 4MVQA 4WFGA 4MVZA 1NJIW 4H37A 2HLDG 5LGNA 1M90W 4UXNA 1HWYA 3HB3B 3NXSA 4XDKA 1THZA 2IJIA 2DQ3A 3LSQA 2HG5C 2PI4A 1GM9A 1SZTA 1K73W 1QR8A 4JAUA 1LNQA 1PL0A 4U7OA 4JYCA 1YJ9V 1KQSU 2EINC 1AI7A 1V54C 2IJKA 2JEXA 2JK5C 1M9NA 4JTDB 4BW5A 5LBQA 3CMEV 1DF4A 2X6AA 2WLKA 2M7WA 3D3IA 3T1CA 5EBLC 3G6EV 3E8GA 1AJNA 1OZ0A 3E83A 5IYDO 3LDEA 4FJCC 1SESA 3CCRV 1ORQC 1AI4A 5H6RA 1TUEB 4GX2A 3FYEB 3E8FA 5LGUA 1BMFG 4RO2A 3ZMSA 4UV8A 4WFAV 1FXKA 2EIMB 3VOUA 3W7XA 4L87A 2B5UA 2EZPA 3SYPA 4WFHA 1GO3F 5B3SB 1AJPA 2QTOA 3SPIA 2IH3C 1OCRB 4MTOA 2X6CA 3SPCA 1FXHA 3ZRSA 3OFNG 3ABUA 5DN6G 5B1AB 4PA7A 2Q67A 2P6JA 1YIJV 1R73A 2Q6AA 5J9PC 1SERA 1K92A 3K9AA 1YJNV 3JD0A 1YSCA 2P90A 4I5SA 4QPKA 4QPJA 3FB5C 3X2QB 3RBZA 1R3IC 4FPPA 3LUTB 1OCCB 4PELA 3ZMTA 3CC4V 3KG2A 2EIMC 2WLNA 3OUSA 1VQLV 2XAJA 2YEVB 3WFVA 5CBFA 4QE9A 1JVMA 2DYSC 1OCRC 1KP3A 3CD6V 2B1GA 3CCQV 4UVAA 1R6NA 4ZKIA 3CCLV 2Z5UA 1K3EA 2ZDIA 5L3GA 1UJWB 5B1AC 3R65A 1JCHA 1VQNV 2HVKC 3ABKB 2XAGA 3K08A 1K5QA 3SJQC 4MSWC 4MW3A 3CCUV 4XDLA 1OCOC 2WWWA 4LP8A 4BIZA 4HYOA 3QO5A 1AI6A 3B8MA 1KP2A 4X89A 2UXNA 2IW5A 3E35A 4PA6A 2XAQA 4UVBA 2PI5A 1NQTA 4RUFA 4MVRA 4Z1MG 2W6IG 3ETEA 4R8CA 4R50A 3JD4A 3OUFA 3MHHC 5DM6V 4GX0A 2A0LA 2B1IA 1JOYA 3ABTA 3H01A 1JPXA 4MVUA 1H38A 2YEVA 3OAAG 2R9RB 3K3WA 2YSUB 2OCCB 1VQPV 3CC2V 1YITV 1M1KW 4LC1A 4GX5A 1NVPD 1L1FA 2EZOA 5E1AC 2OT5A 2H8PC 3IC7A 5KUMA 4UUJC 3SYCA 3ZRWB 2XNDG 3F7VC 3I55V 1Q81W 3ASNB 2QM8A 2HJFC 1FFTB 1K4CC 4G27B 3K06A 1KD1W 1AROP 1BL8A 1DTOA 4YXWG 2IJHA 2ITCC 3E8BA 3G4SV 4U7NA 3ZN1A 4JTAB 2DQ0A 4P9PA 3STLC 2X0LA 1Q86W 1FXKB 3K03A 2V1DA 2XOKG 5C93A 3E89A 3I56V 3ABMB 4HZ3A 3ZMZA 2GSMB 2BOCC 1RM1B 1QLEB 4J9ZB 1G4YB 1NR1A 1XL6A 4QNHB 3AEIA 3ASNC 4R6ZA 5H9CA 5FL7G 3W7SA 1K34A 3ABLC 5EBMC 1H2GA 3VBBA 1M56B 1MG1A 4X88A 1B6QA 5LHIA 2OTJV 3ETDA 3ZRWA 1PNMA 4PDVA 1K7DA 2EIKC 3FB7C 1MOFA 4QIWF 1R3KC 4TSFG 5L3EA 4MVOA 3OW2U 1EBOA 5LGTA 1F4MA 3AG1B 2HR3A 1FXKC 1SETA 4G2KA 1DF5A 2ZXWB 3ABMC 2QM7A 2Y48A 1VQ4V 3E8HA 4KFMA 2WLIA 3SPGA 2WAMA 4PDLA 2UXXA 1ENVA 3JD2A 4PDRA 4MS2A 1QVFU 2IU3A 3JD3A 1K33A 3IFXA 5HFLA 1VQOV 1QCEA 3ZIAG 1FS0G 3AG4B 2XAFA 3G71V 4LBEC 4WCEV 3RVZA 3T2MA 2K1EA 1K5SA 2DWEC 2XASA 2EIJB 1PD3A 2ZXWC 1OCZB 4KP4A 4P9OA 3JD1A 2WLJA 3ZCCA 1E79G 3CCJV 4KUMA 2LFSA 2ZDIC 2AHZA 1QVGU 3EFFK 4RQFA 3W7WA 3AG3B 3UM7A 5B3SC 5L3FA 1YHQV 1CEZA 3E2EA 1KC8W 4BAYA 1V55B 5CMUA 3AG4C 1M57B 2WLLB 1Q82W 5BZBA 4UV9A 4WFFA 4JYBA 1OHHG 3T4DA 1YTFB 5KUKA 1VQ8V 3X2QC 3FB8C 1OCCC 3SYQA 3ASOB 5CBGA 3E86A 1P7BA 1WLEA 2EILB 1GM8A 1I5YA 1MABG 3CXCU 1K4DC 3P32A 2Y69B 1EFRG 4FMTA 5H6QA 4TWKA 4P2ZA 3BY6A 2DW4A 1KKDA 1M57C 3W7TA 2X6BA 3CMAV 1W0KG 4GX1A 2A79B 2R9IA 3ABKC 1S72V 4X8AA 2F43G 2HVJC 2JJ1G 3ZMVA 5B1NA 3F5WC 1W0JG 2KB1A 4ZBMA 3WG7B 1VQ5V 4MW8A 4RQEA 2WLLA 4QE7A 1QLNA 2LP7A 4P30A 1K8AW 3K79A 1CP9A 5IY5B 3ASOC 4G28B 4N21A 3SPHA 2JJ2G 2P7TC 4ASUG 2OTLV 3QO7A 3GB7C 5EBWC 2EILC 2D3OW 2QEXV 2DWDC 4XBFA 2Y69C 3LNMB 2BOBC 5IYBO 3P30A 1S5HC 4FIPC 2GHYA 3ZRVA 3ZRXA 2Z3YA 1K9MW 1BHBA 3LSSA 5B1BB 3W7UA 1SRYA 5CA3A 1NBMG 4N23A 2OCCC 4EKWA 2ITDC 3OGCC 5KA6A 3MD0A 4PA3A 2WLIB 2JIZG 1YI2V 2A9HA 2LFRA 2WLHA 3CCMV 1AI5A 5IY5C 1MSWD 4RUEA 1QBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBO A;  2X7R B;  2EZP A;  3WFV A;  1F23 A;  4JF3 A;  1I5Y A;  1K34 A;  3CYO A;  3MHH C;  5H9C A;  4JPR A;  1Y4M A;  5HFM A;  1ENV A;  1MG1 A;  4JGS A;  5CN0 A;  1QR9 A;  1DF4 A;  3P30 A;  1K33 A;  4FIP C;  3GWO A;  2M7W A;  5HFL A;  3H01 A;  1QCE A;  1JPX A;  5CMU A;  1Y66 A;  1MOF A;  3B8N A;  2P6J A;  3MHS C;  2MK3 A;  1EBO A;  3K9A A;  3M99 B;  4N23 A;  4FJC C;  4G2K A;  5KA6 A;  1JQ0 A;  1DF5 A;  3B8M A;  3B77 A;  4E2L A;  1SZT A;  3CP1 A;  5KA5 A;  2EZO A;  2LP7 A;  2OT5 A;  1QR8 A;  4N21 A;  4FK5 C;  1DLB A;  1I5X A;  1QBZ A; 
#chains in the Genus database with same CATH topology
 3JAL B;  3LSU A;  5HFM A;  1Y4M A;  4NR1 A;  4TUY B;  1K97 A;  4X1I A;  4W4L A;  4NKG B;  4BWA A;  4DV4 B;  5DED A;  1I94 O;  4PI0 A;  2UXD O;  3A0B Z;  2F23 A;  4KHP O;  4MVM A;  2R9A A;  1IDS A;  2W6J G;  1IXM A;  3NR7 A;  4J41 A;  1XHX A;  5D5P A;  4CH6 A;  4DV2 B;  3K04 A;  1D5A A;  1RM1 C;  1QLE C;  2YXH A;  4O4I A;  1AIL A;  2EBO A;  4K0K B;  1XUQ A;  1TVK B;  1XOU A;  5J2T A;  1M56 C;  3OD4 A;  4DV6 O;  1UFI A;  1GK9 A;  4X66 B;  5KAF Z;  2LQT A;  3JAL A;  3LDC A;  3JYC A;  4HAM A;  1ZL8 B;  4TUY A;  4LH7 A;  1RP3 B;  1E1R G;  4EB6 A;  1N36 O;  1P4R A;  3L75 H;  1Z5W A;  1E1Q G;  3JSL A;  5CBH A;  3RFR A;  2Q7G A;  4FLV A;  5KHJ A;  1VQM V;  4GT1 A;  5KHI A;  2AW9 A;  1WPX A;  2YXY A;  1WP7 A;  2FTK A;  4LF9 O;  3GVM A;  1TVK A;  3FFQ A;  4DRX A;  2Q68 A;  3HKE B;  4MTF A;  3JAT A;  2PF4 E;  2CK3 G;  2PTM A;  2OIE A;  1OCZ C;  1BSM A;  4FVM A;  3LDD A;  1ZL8 A;  3ZHQ A;  4LF4 B;  1I7F A;  5TIS Z;  1S76 D;  5J2U B;  4C7U A;  2IJJ A;  2KG7 B;  5BR8 B;  3OM3 B;  3CCS V;  1I0H A;  4I55 B;  1B04 A;  2DYR C;  4LCU C;  5KA5 A;  3HKE A;  4DV0 O;  2V7Q G;  4PD4 F;  2ADQ B;  1GKF A;  4FLY A;  3AG2 B;  5H5N A;  4I50 B;  1VQK V;  4X65 O;  3OE7 G;  3T4Z A;  2MK3 A;  4MVS A;  1YCI A;  3BFR A;  2NLJ C;  1VMG A;  4BIU A;  5J2U A;  4K3A A;  4B08 A;  4ZHQ B;  1WB8 A;  3UKM A;  4JAA A;  4I55 A;  4O2A A;  1Q7Y W;  5L3D A;  4JGS A;  3EHB B;  2ZR3 A;  3OTO O;  1IBL B;  1IXB A;  1J5E B;  2CTR A;  4WFG A;  1Q6I A;  1BQZ A;  3RYI A;  5KHG A;  5LGN A;  4I50 A;  1HWY A;  4XDK A;  2IJI A;  2DQ3 A;  2PI4 A;  2EUL A;  1K73 W;  4DR4 O;  4JYC A;  1AI7 A;  1V54 C;  4KL1 A;  4ZHQ A;  2IM9 A;  4JTD B;  1M9N A;  1KYO F;  4LH6 A;  3RWR D;  5B5E Z;  3AK2 A;  2M7W A;  3G6E V;  1AJN A;  2NN4 A;  2WA3 A;  1Y76 B;  2YIA A;  2VQF O;  2BTO A;  4DR3 O;  3LDE A;  4DV1 O;  1RSO B;  1ORQ C;  1XBL A;  4LF5 O;  1FJG B;  2R70 A;  5FPO A;  1AI4 A;  3FYE B;  1FXK A;  3N27 A;  3W7X A;  4GLX A;  1AB3 A;  2A3Q A;  2IH3 C;  4HBN A;  3ETQ A;  1IBK O;  1AR4 A;  2ZM6 B;  4X1Y A;  4DK0 A;  2LGQ A;  4JI3 O;  1W59 A;  3ZBH A;  1K92 A;  3TGU H;  1OV9 A;  2XUM A;  3JD0 A;  3X2Q B;  4FPP A;  4EFB A;  3EVK A;  2BTQ B;  1Y76 A;  3R66 A;  3ZHR A;  3G80 A;  3WFV A;  2VQE O;  1RSO A;  4QE9 A;  1GN4 A;  3CCQ V;  2RMK B;  4DV5 B;  1Y67 A;  4DR7 O;  5B1A C;  2ZKO A;  2VWK A;  1JCH A;  3SJQ C;  1K5Q A;  4X9Q A;  2Q7E A;  4JI7 O;  2WWW A;  4BIZ A;  4LP8 A;  2P06 A;  3QO5 A;  1SQP H;  2F66 C;  2IW5 A;  3P3N A;  4Q6G A;  2XAQ A;  4UVB A;  3C3S A;  2PI5 A;  1NQT A;  5IWA O;  3L73 H;  4MVR A;  4JI4 O;  2W6I G;  1XNQ O;  1L8D A;  2CGO A;  4AI8 A;  2YS8 A;  2BTQ A;  4FZ0 A;  3K5N A;  1JOY A;  4UB8 Z;  3ABT A;  1JPX A;  2Q0O C;  1H38 A;  3WB1 A;  3K3W A;  4B7K A;  2OCC B;  1VQP V;  5IYZ B;  1YIT V;  4GX5 A;  1NVP D;  1L1F A;  3OGI B;  4NXN O;  3IC7 A;  5KUM A;  3ICX A;  3SYC A;  3F7V C;  1MSD A;  3I55 V;  1XMQ B;  4H44 B;  2QKA A;  1VEW A;  4G27 B;  1Y74 B;  3T1Y B;  2IJH A;  2ITC C;  4LF7 B;  1XDC A;  2Q0A A;  2DQ0 A;  3STL C;  1Q86 W;  2F93 B;  4LF6 B;  4HZ3 A;  1EZV H;  2BOC C;  1LR1 A;  1RM1 B;  1QLE B;  4FM2 A;  4J9Z B;  1NR1 A;  1XL6 A;  4QNH B;  1XNR B;  5IYZ A;  4R6Z A;  5H9C A;  4I0X A;  3W7S A;  3ABL C;  3VBB A;  1M56 B;  2ARH A;  1MG1 A;  3APO A;  1B6Q A;  5LA6 B;  1PNM A;  1JMK C;  4QIW F;  3OW2 U;  1EBO A;  4GUN A;  1F4M A;  4AQY B;  3CSX A;  2PYJ A;  1DF5 A;  1Y74 A;  1TA8 A;  2Y48 A;  1AP5 A;  4NXM B;  3SPG A;  5EYP B;  4JI0 B;  2UXX A;  3JD2 A;  1JA8 A;  4DV4 O;  3AK1 A;  5KMG B;  1QVF U;  2IU3 A;  1K33 A;  3IFX A;  4QGP A;  1QCE A;  4JI1 B;  3RVZ A;  4DV2 O;  5JVD B;  5LA6 A;  1K5S A;  2XAS A;  3OT7 A;  2ZXW C;  1OCZ B;  4K0K O;  4JI5 O;  1YF2 A;  2LFS A;  4DYL A;  5FLX N;  2AHZ A;  1ZX3 A;  4B3T B;  4UB6 Z;  3W7W A;  3UM7 A;  5L3F A;  1N4C A;  4X66 O;  4PJ0 Z;  1WB7 A;  2VS0 A;  1Q8I A;  4BAY A;  3P3P A;  5CMU A;  4B3S B;  3AG4 C;  1M57 B;  5EYP A;  5BZB A;  4UV9 A;  4IYH A;  5KMG A;  1OHH G;  4OX9 B;  1URF A;  4NVP A;  2HEP A;  5JVD A;  2E74 B;  1FD9 A;  1GM8 A;  1TUB B;  2Y4T A;  1MZF A;  1GN3 A;  2CTQ A;  2DW4 A;  4I4T B;  2X6B A;  2DE0 X;  4GX1 A;  1S72 V;  1NT2 B;  4X8A A;  2HVJ C;  2JJ1 G;  5B1N A;  2BSK A;  5A2Q N;  4LF4 O;  2QKC A;  4DR1 B;  4BR6 A;  4O4H B;  5IY5 B;  1US6 A;  3QO7 A;  2QEX V;  5EBW C;  2D3O W;  1XIL A;  5BR8 O;  5IYB O;  3P30 A;  3ZRV A;  3ZRX A;  2Z3Y A;  3RYC B;  1SRY A;  4FLX A;  1NBM G;  1TUB A;  4EKW A;  2ITD C;  5KA6 A;  4PA3 A;  4I4T A;  2JIZ G;  1AP6 A;  1YI2 V;  3CCM V;  5FPR A;  2XT9 A;  3K0G A;  1V54 B;  2B9Z A;  2HKO A;  5KX5 B;  4JF3 A;  2ODM A;  1PPJ H;  2CTW A;  4QJF B;  1PKX A;  4O4H A;  3SJC C;  1Q5O A;  1FFX B;  3CRR A;  4J42 A;  3OEE G;  4XDJ A;  2ZE8 A;  2ZQM A;  3RYC A;  4B3M B;  4J9Y B;  2C2A A;  3CRQ A;  3N2K B;  4WF9 V;  1NR7 A;  4DV7 B;  3QG5 A;  2RDC A;  1IBL O;  2RCV A;  1J5E O;  3U10 A;  4JZ2 A;  5KX5 A;  2CDY A;  4DUZ B;  4JTC B;  3ZS8 C;  1L0N H;  4CZZ A;  1KEC A;  3CCV V;  3BA9 A;  1FFX A;  2QA4 V;  1AR1 B;  1VF6 C;  2M6Y A;  2GDS A;  2KQX A;  2GUZ B;  1DLB A;  1R3L C;  1F23 A;  2JVD A;  3N2K A;  1MMM A;  2EJR A;  3B8N A;  1YDX A;  1BS3 A;  1FJG O;  1COW G;  3RW0 A;  1YJW V;  3QNE A;  5KAI Z;  3KKY A;  1F7Y A;  4RAI A;  3ZHV A;  2L35 A;  4H0L B;  4JAS A;  2YC0 A;  4TV9 A;  3AG3 C;  4F6E A;  2GUZ A;  3SPJ A;  1S77 D;  2BCC H;  1GAX A;  2BE3 A;  3TCU A;  2ZD9 A;  4J11 A;  1RFY A;  1BCC H;  1GRJ A;  5EC2 C;  1N33 B;  4CS2 A;  4UCT A;  4DV5 O;  4MTG A;  2KKW A;  4UCS A;  2P67 A;  2DJV A;  5B66 Z;  4Z1V A;  4DR6 B;  1AJQ A;  2QDO A;  1P84 F;  3OMI B;  5GTI Z;  3CRA A;  3PN1 A;  2QWQ B;  2UU9 O;  3E22 A;  2A7W A;  3ZMU A;  4BIO A;  3JCU Z;  2EIN B;  3ABL B;  4I9W A;  5K1X A;  3CC7 V;  1JR9 A;  4PA9 A;  4DXW A;  5B1B C;  4EB6 B;  3ETG A;  1VAR A;  4MVZ A;  1SQV H;  3NXS A;  3LSQ A;  3SJA C;  5KHH A;  1PL0 A;  2R72 A;  1H2N A;  3H1I H;  1MA1 A;  1UPG A;  3CME V;  4DRX B;  3T1Y O;  4LWS B;  3JAT B;  3T1C A;  4ZOL B;  1NI8 A;  3CHX A;  4PV1 B;  3E83 A;  3CCR V;  1B3Q A;  3UO3 A;  2HHH B;  1XNR O;  3UT5 B;  5LMN O;  3E8F A;  3ZMS A;  3VOU A;  4L87 A;  2EZP A;  1QNM A;  4WFH A;  3SPI A;  1OCR B;  4EEQ A;  4MTO A;  1WAZ A;  3SPC A;  1FXH A;  3ZRS A;  4OPA A;  5DN6 G;  4PA7 A;  4YY3 B;  2OCH A;  1YIJ V;  1OJH A;  2Q6A A;  3K9A A;  2P90 A;  4QPK A;  4QPJ A;  4LWS A;  1I08 A;  3LUT B;  1WP8 A;  5FNV B;  4ZOL A;  4JI0 O;  1XI1 A;  2EIM C;  4JI2 O;  1VQL V;  3QVN A;  2YEV B;  2JGD B;  5CBF A;  2DYS C;  1KP3 A;  1DGS A;  3UT5 A;  1R6N A;  3JAM N;  4JI1 O;  3AG7 A;  2OIG A;  2VWJ A;  4UCU A;  1R6T A;  2XAG A;  2XTA A;  4MSW C;  4MW3 A;  3CCU V;  1O9G A;  1OCO C;  2FYU H;  3BCC H;  2YI9 A;  3TJT A;  4NTW A;  1AI6 A;  3DXR B;  4O2A B;  2UXN A;  3E35 A;  4Z1M G;  4R8C A;  5CA1 B;  3OUF A;  3MHH C;  4O4L B;  2B1I A;  5FNV A;  4B3S O;  3BPZ A;  3RYI B;  3TXQ A;  2YUA A;  2YEV A;  2JGD A;  4OX9 O;  3VQY A;  1XEQ A;  1YZB A;  2YSU B;  3S3W A;  1HR0 B;  2H8P C;  5JCO C;  3CJH B;  3ZRW B;  4X64 B;  1Q81 W;  3ASN B;  4O2B B;  3DXR A;  4D7T A;  2H3O A;  3RYH B;  3DSQ A;  4JYY A;  5CA1 A;  1BL8 A;  1DTO A;  1N0J A;  4YXW G;  1WA8 B;  4O4L A;  4JTA B;  2ZE7 A;  4P9P A;  2X0L A;  3D3Q A;  4DR1 O;  1FXK B;  1KMI Z;  3K5L A;  2CGN A;  3ABM B;  5D5Q A;  2Z0A A;  4X1Y B;  3CEI A;  1K34 A;  1HP8 A;  4UCR A;  4X62 B;  3ETD A;  3CJH A;  3ZRW A;  2PUS A;  4PDV A;  3FB7 C;  3ZED A;  4O2B A;  4TSF G;  1NU1 H;  4MVO A;  1XMO B;  3RYH A;  4LFC B;  1SET A;  1B06 A;  4IGG A;  2YXL A;  1WA8 A;  1Z2G A;  3FX7 A;  3HKC B;  2RJZ A;  2XHB A;  2WLI A;  4J80 A;  4MS2 A;  2P4K A;  1HNX B;  1BQ0 A;  3ZIA G;  3HKB B;  4D6T H;  4WCE V;  4LNU B;  4B3M O;  4UFZ A;  1PV0 A;  2UUA B;  2UUC B;  1BZK A;  4LFB O;  1NTZ H;  2DWE C;  1PD3 A;  4ICG A;  2F95 B;  4J10 A;  3ZCC A;  1AR5 A;  2IBZ H;  2ZDI C;  3EFF K;  3RT3 C;  3AG3 B;  1CEZ A;  2QWN B;  2PZS A;  3HKC A;  4DUZ O;  4FLW A;  3K5M A;  3C3T A;  1MZE A;  3SJB C;  1SKV A;  1U97 A;  4JYB A;  1YTF B;  4FLU A;  3HKB A;  2LW7 A;  3SYQ A;  4GKJ O;  4LNU A;  5EIB D;  1P7B A;  4D7S A;  2EIL B;  1MAB G;  3P32 A;  3H1J H;  2Y69 B;  1EFR G;  3ZHT A;  2YIC A;  5H6Q A;  5EZY B;  4TWK A;  2FKX A;  3RYF B;  3BY6 A;  3QF7 A;  1KKD A;  3CMA V;  1W0K G;  3MAQ A;  3ABK C;  3M7M X;  2F43 G;  2ZNI A;  1S5J A;  3F5W C;  2QSA A;  3G67 A;  4RQE A;  4I0X B;  1QLN A;  3K79 A;  1CP9 A;  3ASO C;  4G28 B;  1IBM B;  3SPH A;  4FM0 A;  3T1H B;  2OTL V;  2JRI A;  3CX5 F;  3GB7 C;  2DWD C;  4Z2W A;  4XBF A;  1H2K A;  1ZUQ A;  1KBH A;  2ZNJ A;  3LNM B;  1H2L A;  4FIP C;  3LSS A;  5B1B B;  3W7U A;  3B09 A;  4F6R B;  4N23 A;  1WJZ A;  3JSN A;  3KCX A;  4NB5 A;  5EZY A;  3MD0 A;  3RYF A;  1N33 O;  2UXD B;  1SQG A;  2AGA A;  2A9H A;  1R1B A;  4RUE A;  3LNN A;  1QBZ A;  1J95 A;  1HNW O;  3TK1 A;  1ROP A;  1N34 O;  1SQQ H;  1EN6 A;  3CWB H;  4YJ2 A;  1F4N A;  3JAK B;  1FPO A;  4DV6 B;  3STZ C;  3BAB A;  1PL4 A;  1YTF D;  1FXV A;  3B77 A;  4UVC A;  2UUB B;  4F6R A;  5IYC O;  5KLV H;  1VP7 A;  3SYO A;  2F4V B;  4U3F H;  4J7J A;  1SZX A;  5GW7 A;  4R7C A;  1SQB H;  3JCZ A;  3OR7 C;  1EZJ A;  5DEC A;  1XQ8 A;  2F1M A;  3FKS G;  1TGO A;  2YIB A;  3K0D A;  4PA4 A;  2AHY A;  3AG1 C;  2LO1 A;  3JAK A;  2LJ2 A;  3OR6 C;  4GKK B;  3HR0 A;  1EM1 A;  2QR4 A;  1WNS A;  2DYS B;  3A0R A;  4ABM A;  3ZX6 A;  4JYA B;  4PDM A;  4MT8 A;  2BSK B;  2WLM A;  2LW1 A;  1M5I A;  4PHZ A;  3CCE V;  1OCO B;  2QKS A;  3SR2 C;  1PNL A;  2DYR B;  2EIJ C;  3ML0 A;  3CP1 A;  2ZE5 A;  3KCY A;  2UXB B;  4FFB B;  4DO2 A;  4DW0 A;  4A5U B;  2IH1 C;  5CN0 A;  3RVY A;  3UQ8 A;  4NYK A;  1W2B U;  5LHG A;  1VQ6 V;  2CAZ C;  4UCO A;  1Y66 A;  3G6B A;  1V55 C;  3MHS C;  5BMV B;  5EC1 C;  4DR2 B;  4KXR A;  1HW7 A;  3FYI B;  4JV5 B;  2CH7 B;  4X20 A;  1H8H G;  1BHA A;  1JQ0 A;  1M93 A;  3DGE A;  2JEU A;  2NR5 A;  1YVW A;  4FFK A;  2YI8 A;  4TQD A;  3U0Z A;  3APQ A;  2YID A;  1O9H A;  3RGB A;  4DV3 B;  5L3C A;  1G1X B;  2XAH A;  5B1O A;  4Q20 A;  2Q69 A;  2FML A;  4FFB A;  3WU2 Z;  5E79 Z;  1ZWI C;  2H94 A;  4LR3 A;  3CPW U;  3WG7 C;  1VQ9 V;  2HFE C;  5L3B A;  5H2F Z;  5BMV A;  3IC9 A;  2PY5 A;  2CH7 A;  2QE7 G;  5EK0 A;  4LF8 B;  4DR4 B;  4IT5 A;  4JPR A;  3AG2 C;  1NZ6 A;  1YXB A;  3PJS K;  1NTK H;  3GWO A;  5LL6 Y;  3CXH F;  4TT3 G;  2NNU A;  4IYI A;  5IJ0 B;  2D2C B;  4AHC A;  4H37 A;  1GN2 A;  1NJI W;  3H1K H;  4IHJ B;  4UXN A;  3HB3 B;  2VQF B;  4FLZ A;  1THZ A;  4YHH B;  4DR3 B;  2HG5 C;  4DV1 B;  2W0X A;  1SQF A;  4LF5 B;  1LNQ A;  4U7O A;  2V4D A;  2IJK A;  5LYJ B;  2JEX A;  5LBQ A;  2X6A A;  2WLK A;  2Q9L A;  1IBK B;  3D3I A;  5EBL C;  4B3R B;  3GWK C;  3D36 C;  2E5L B;  4FJC C;  4TV9 B;  1TUE B;  2QJ1 A;  1BMF G;  4RO2 A;  5IJ0 A;  4UV8 A;  5LMU B;  2B5U A;  4IHJ A;  3SYP A;  1GO3 F;  1Q43 A;  5IE9 A;  3OFN G;  3ABU A;  1XMO O;  2GBO A;  5AG2 A;  3VQW A;  5B1A B;  1SC5 B;  4LFC O;  2Q67 A;  2P6J A;  3RN4 A;  5LYJ A;  4DR7 B;  5J9P C;  1D5N A;  3U11 A;  5GON B;  3L9D A;  4JI7 B;  3RBZ A;  1R3I C;  3JAS B;  2PGG A;  1H2S B;  3ZMT A;  3CC4 V;  3KG2 A;  3OTF A;  2WLN A;  3OUS A;  2XAJ A;  1HNX O;  4CC5 A;  2LGW A;  4JI4 B;  2ZM6 O;  4UVA A;  4ZKI A;  1XNQ B;  2Y0P A;  2ZDI A;  5JJE B;  5L3G A;  2UUA O;  2Q7H A;  3A2F A;  3E22 B;  3R65 A;  1VQN V;  2DN9 A;  3ABK B;  1QU7 A;  3L71 H;  4HYO A;  2P5O A;  4X89 A;  1NTM H;  4EFE A;  1KUQ A;  4RUF A;  5GON A;  3MDS A;  5DM6 V;  2QGN A;  3JAS A;  4GX0 A;  1PM9 A;  1IVS A;  3H01 A;  4MVU A;  3CRC A;  5LOV B;  3H9V A;  2JGU A;  3B2E E;  3CC2 V;  4JI6 B;  1M1K W;  1Y6X A;  1BT8 A;  4LC1 A;  1N0N A;  2EZO A;  2OT5 A;  4LFA B;  3K58 A;  2QWO B;  4UUJ C;  2XND G;  1CXZ B;  4CH4 A;  1FFT B;  2ETN A;  3K06 A;  1KD1 W;  1ARO P;  4CC6 A;  2OYQ A;  3K57 A;  3K03 A;  2V1D A;  2XOK G;  5C93 A;  1IBM O;  4E4E A;  3E89 A;  3T1H O;  3ZMZ A;  3K5O A;  5LOV A;  1XMQ O;  5CB4 B;  1QHT A;  1EN4 A;  1N32 B;  1XRE A;  4WBN B;  3M8A A;  1A32 A;  5LHI A;  2OTJ V;  4LF7 O;  1K7D A;  2EIK C;  3QTC A;  1MOF A;  4FM1 A;  1R3K C;  5L3E A;  3BAA A;  4PI2 A;  5LGT A;  4LF6 O;  3AG1 B;  2HR3 A;  2ZXW B;  2G38 A;  2E75 B;  2QM7 A;  1VQ4 V;  4RWU A;  3E8H A;  4KFM A;  4JI5 B;  3H1H H;  3UCS C;  5LP6 C;  2WAM A;  3D8C A;  2Y4U A;  3UO2 A;  1JFF B;  5CB4 A;  1VQO V;  2ZIO A;  4IIJ B;  3AG4 B;  1X4T A;  4WBN A;  2XAF A;  3CE2 A;  1KKC A;  4LBE C;  4AQY O;  2UUB O;  4NTX A;  5JWP A;  3L72 H;  4FLT A;  1FAF A;  2K1E A;  2EIJ B;  4I9Q A;  4P9O A;  1SA0 B;  4NXM O;  2WLJ A;  1YEW A;  1E79 G;  4K35 A;  2QTS A;  1QVG U;  2F4V O;  4RQF A;  4YIO A;  5B3S C;  1YHQ V;  3E2E A;  1KC8 W;  2RN9 A;  4ZI7 B;  1V55 B;  1Q82 W;  1IX9 A;  4WFF A;  2CUG A;  4GKK O;  4JI8 B;  1JFF A;  3T4D A;  1VQ8 V;  2UXC B;  4CS4 A;  4IIJ A;  1P7G A;  1LUV A;  1OCC C;  5LXT B;  4B3T O;  5CBG A;  4J7K A;  4JYA O;  1I5Y A;  1K4D C;  2ILM A;  1SA0 A;  1D2D A;  1LUW A;  2DMX A;  3BHP A;  1M57 C;  1Q3E A;  1AVM A;  4UCV A;  3ZMV A;  2KB1 A;  2FB5 A;  4ZBM A;  3WG7 B;  4ZI7 A;  3JAW B;  4MW8 A;  1ZSP A;  1Z5V A;  2UXB O;  3EXA A;  2LP7 A;  1IZ3 A;  4N21 A;  2JJ2 G;  3L70 H;  1TAE A;  2BOB C;  4JZG A;  4DR2 O;  2N05 A;  5LXT A;  2N74 A;  4JV5 O;  2GHY A;  1K9M W;  1BHB A;  4DUY B;  4O4J B;  2RQ6 A;  2KG7 A;  5JJJ B;  1XHZ A;  2WLI B;  2LFR A;  1WPB A;  2WLH A;  4DV3 O;  1AI5 A;  5IY5 C;  1MSW D;  2O57 A;  4U3J B;  2X7R B;  3JAW A;  2DOS A;  3K59 A;  4AIL C;  4WFE A;  2HJD A;  1RPO A;  4F4L A;  3CS5 A;  2WA4 A;  1CPY A;  2P4V A;  3FB6 C;  3IGA C;  1X59 A;  4LF8 O;  1U96 A;  4X1K B;  3DTU B;  1PP9 H;  4FK5 C;  4O4J A;  4OXS A;  3HPL C;  1JJO A;  1SF9 A;  5LHH A;  1QR9 A;  5JQG B;  4U3J A;  5GTH Z;  5IDJ A;  1VQ7 V;  3BEH A;  2WSS G;  1N8R W;  1RPR A;  1BE3 H;  4YHH O;  3Q4H B;  1R6K A;  3M99 B;  4JAV A;  1GMG A;  3OEH G;  3IAY A;  2ATK C;  1NVP B;  1G8M A;  3D36 A;  4DV7 O;  5CA0 B;  3HKD B;  1H2M A;  1JX9 A;  2GTS A;  2CE4 A;  1S0V A;  1R3J C;  4X1K A;  1VF6 A;  3F7Y C;  1HNZ B;  4B3R O;  4GCZ A;  4MTX A;  2E5L O;  5JH7 B;  4CBC A;  1NH2 B;  2QM4 A;  3AK3 A;  1V9P A;  5JQG A;  2CTP A;  5LMU O;  1PNK A;  1SS3 A;  4E2L A;  2N04 A;  3SYA A;  2RNB A;  1GM7 A;  3Q4H A;  2P22 C;  2IU0 A;  2WPD G;  1H8E G;  1BGY H;  2YDE A;  2JS3 A;  3OMA B;  5CA0 A;  3HKD A;  1F51 A;  4OPH A;  2KSD A;  3TET A;  2AZ0 A;  2W0F C;  3QO8 A;  2ZIN A;  2UU9 B;  4HNA B;  3L74 H;  5JH7 A;  1Q6U A;  4J7Z A;  3ZN0 A;  1FYJ A;  5F2V O;  4YJ2 B;  3J7A U;  5BXZ A;  2JDI G;  1S3J A;  3CYO A;  3H1L H;  2FL4 A;  4DR5 B;  1GTO A;  3K9S A;  4TOI A;  2ZR2 A;  1I94 B;  1G6U A;  2ZT9 B;  4H33 A;  4KHP B;  1XL4 A;  1NKD A;  2QWR B;  3O9O A;  3ZJZ A;  1I5X A;  1ZLZ A;  4WFB V;  3OMN B;  4DR6 O;  4HNA A;  4W4K A;  5C8Y B;  1JJ2 U;  2VRZ A;  4CH5 A;  2EIK B;  1WN7 A;  4DW1 A;  4YJ3 B;  4JI6 O;  1NH2 D;  4MVQ A;  3JAR B;  3VQV A;  3VQX A;  2HLD G;  1M90 W;  4LFA O;  1S5L Z;  3ZHS A;  3TXS A;  2E76 B;  1GM9 A;  1SZT A;  1QR8 A;  4JAU A;  1YJ9 V;  1KQS U;  2EIN C;  1N36 B;  5LP6 B;  5LMN B;  1Q90 D;  1KU9 A;  2JK5 C;  4BW5 A;  1DF4 A;  2Y0I A;  3B4S A;  3E8G A;  1OZ0 A;  1KB9 F;  5C8Y A;  5IYD O;  4LF9 B;  1SES A;  1SQX H;  2L6L A;  4YJ3 A;  5H6R A;  4GX2 A;  1N32 O;  5LGU A;  3JAR A;  4WFA V;  2EIM B;  2Q8V A;  5B3S B;  1AJP A;  2QTO A;  4JI2 B;  5ITZ B;  2X6C A;  4X20 B;  5LP6 A;  3O65 A;  1R73 A;  3B40 A;  1SER A;  1YJN V;  2HHH O;  1YSC A;  2Q73 A;  4I5S A;  3THO A;  3FB5 C;  4K8Z A;  5K1P A;  1OCC B;  4PEL A;  3SDL A;  1JVM A;  1OCR C;  3CD6 V;  2B1G A;  2HP8 A;  4DV0 B;  2YIB D;  3CCL V;  2Z5U A;  1M4U A;  1K3E A;  4YY3 O;  1UJW B;  1MNG A;  3F5T A;  3I5D A;  2HVK C;  3K08 A;  4X65 B;  5ITZ A;  4XDL A;  3B8M A;  1KP2 A;  1VIB A;  3CRM A;  1T5E A;  4PA6 A;  5IT9 N;  1EN5 A;  5IJ9 B;  2EJ7 A;  3FAV B;  1QQC A;  4K8X A;  3ETE A;  4R50 A;  3JD4 A;  3FD9 A;  2A0L A;  2ADP A;  2JS5 A;  3ZHU A;  4IL6 Z;  4JI8 O;  3OAA G;  2R9R B;  1GN6 A;  2UXC O;  3OTO B;  4L8J A;  3KZI Z;  3C90 A;  2ZE6 A;  5E1A C;  2OWO A;  5BY1 A;  2QM8 A;  2HJF C;  2Q4P A;  3BRC A;  3J80 N;  1K4C C;  5IJ9 A;  5JCO A;  3FAV A;  4TV8 B;  3E8B A;  3G4S V;  4U7N A;  3WB2 A;  3ZN1 A;  4GYC B;  4OGQ B;  1HR0 O;  3N2G B;  2GV9 A;  3I56 V;  2GSM B;  4X64 O;  4CS3 A;  1VF7 A;  1G4Y B;  3AEI A;  2A06 H;  3ASN C;  4GZR B;  5FL7 G;  5EBM C;  1H2G A;  3S3X A;  4DUY O;  4X88 A;  2AZ2 A;  2MW2 B;  1P49 A;  4JI3 B;  4G2K A;  1FXK C;  4TV8 A;  1ZAU A;  3ABM C;  4LFB B;  1NS1 A;  3IJ4 A;  3SGI A;  5EIB C;  4DK1 A;  2Q5Z A;  4X62 O;  3N2G A;  4FZ1 A;  4PDL A;  1ENV A;  4PDR A;  5KHK A;  1IUR A;  2VQE B;  3JD3 A;  5HFL A;  1FS0 G;  1VF5 B;  3G71 V;  3T2M A;  4I7Z B;  3DC6 A;  4CH3 A;  4KP4 A;  2EX3 A;  3WB0 A;  3JD1 A;  3J81 N;  4BW9 A;  1FKA O;  3CCJ V;  4KUM A;  4GKJ B;  2QWP B;  5IWA B;  3CB2 A;  4NTY A;  1Q6H A;  4TQF A;  4ZIB A;  2WLL B;  2UUC O;  1L0L H;  3BVO A;  3A8T A;  4B7E A;  5JJN B;  5KUK A;  3X2Q C;  3FB8 C;  3BA8 A;  3ASO B;  3E86 A;  1HNZ O;  1WLE A;  4NXN B;  3CXC U;  1GH6 A;  1HDJ A;  4FMT A;  4P2Z A;  3W7T A;  2A79 B;  2R9I A;  4H13 B;  2AXT Z;  1W0J G;  1VQ5 V;  2WLL A;  4QE7 A;  4X1I B;  4P30 A;  1K8A W;  4ASU G;  2P7T C;  2EIL C;  1DK1 A;  2Y69 C;  1HNW B;  1S5H C;  2E3C A;  1N34 B;  2K9P A;  2PYL A;  5CA3 A;  4O4I B;  2OCC C;  4YIP A;  3OGC C;  5A9G A;  3DC5 A;  2ZIM A;  3A0H Z;  2GTA A;  5J2T B;  1ZTE A;  4DR5 O;  2ZCE A; 
#chains in the Genus database with same CATH homology
 3K0G A;  2X7R B;  1V54 B;  2HKO A;  1J95 A;  4JF3 A;  3TK1 A;  1ROP A;  1Y4M A;  5HFM A;  4QJF B;  1K97 A;  1PKX A;  4WFE A;  1F4N A;  1RPO A;  3OEE G;  4XDJ A;  4F4L A;  3STZ C;  1CPY A;  3FB6 C;  1YTF D;  3IGA C;  4MVM A;  2ZQM A;  2W6J G;  1FXV A;  3B77 A;  4J9Y B;  1IXM A;  2C2A A;  4UVC A;  3DTU B;  5IYC O;  4WF9 V;  3K04 A;  1NR7 A;  1RM1 C;  1QLE C;  4FK5 C;  4OXS A;  2EBO A;  3HPL C;  3SYO A;  5LHH A;  1M56 C;  1QR9 A;  5IDJ A;  5GW7 A;  1VQ7 V;  4R7C A;  3BEH A;  1GK9 A;  3JCZ A;  3OR7 C;  2WSS G;  1N8R W;  1EZJ A;  1RPR A;  3LDC A;  4JTC B;  3JYC A;  3FKS G;  4HAM A;  4CZZ A;  1R6K A;  3K0D A;  1KEC A;  3M99 B;  4JAV A;  4PA4 A;  1GMG A;  3CCV V;  2AHY A;  3AG1 C;  3OEH G;  2ATK C;  2QA4 V;  1NVP B;  1G8M A;  1E1R G;  3D36 A;  3OR6 C;  1AR1 B;  1P4R A;  1DLB A;  1E1Q G;  1R3L C;  5CBH A;  2DYS B;  3A0R A;  1F23 A;  1JX9 A;  1S0V A;  1R3J C;  3F7Y C;  1VQM V;  4GT1 A;  1WPX A;  4GCZ A;  4PDM A;  4MT8 A;  4MTX A;  2WLM A;  2EJR A;  2FTK A;  3B8N A;  4CBC A;  3CCE V;  2Q68 A;  1NH2 B;  1COW G;  3RW0 A;  1OCO B;  4MTF A;  1YJW V;  2QKS A;  3QNE A;  2CK3 G;  1PNL A;  1PNK A;  2DYR B;  2EIJ C;  3ML0 A;  4E2L A;  3SYA A;  1OCZ C;  3CP1 A;  1GM7 A;  3LDD A;  4RAI A;  2IU0 A;  2WPD G;  4JAS A;  1H8E G;  4DO2 A;  3AG3 C;  2IH1 C;  5CN0 A;  3RVY A;  1W2B U;  3OMA B;  5LHG A;  1S76 D;  1VQ6 V;  3SPJ A;  1S77 D;  2IJJ A;  1F51 A;  1Y66 A;  1V55 C;  3MHS C;  5EC1 C;  3FYI B;  3TET A;  3OM3 B;  3CCS V;  2W0F C;  3TCU A;  2ZD9 A;  1H8H G;  1BHA A;  1JQ0 A;  3QO8 A;  3DGE A;  2JEU A;  2DYR C;  4LCU C;  5KA5 A;  5EC2 C;  3ZN0 A;  4MTG A;  2JDI G;  5L3C A;  1S3J A;  3CYO A;  2V7Q G;  2P67 A;  1GKF A;  3AG2 B;  2XAH A;  5B1O A;  1VQK V;  3OE7 G;  1GTO A;  3T4Z A;  4Q20 A;  1AJQ A;  2Q69 A;  2MK3 A;  4MVS A;  3OMI B;  1ZWI C;  2H94 A;  3CPW U;  2NLJ C;  2ZR2 A;  4BIU A;  3WG7 C;  1VQ9 V;  4H33 A;  2HFE C;  5L3B A;  3UKM A;  3ZMU A;  1XL4 A;  1NKD A;  2QE7 G;  5EK0 A;  3ZJZ A;  1I5X A;  2EIN B;  4WFB V;  1Q7Y W;  3ABL B;  4I9W A;  3OMN B;  5L3D A;  4JPR A;  4JGS A;  3AG2 C;  1JJ2 U;  3EHB B;  2ZR3 A;  3CC7 V;  3PJS K;  3GWO A;  4PA9 A;  2EIK B;  4DXW A;  5B1B C;  4TT3 G;  2NNU A;  1NH2 D;  3ETG A;  4MVQ A;  4WFG A;  4MVZ A;  1NJI W;  4H37 A;  2HLD G;  5LGN A;  1M90 W;  4UXN A;  1HWY A;  3HB3 B;  3NXS A;  4XDK A;  1THZ A;  2IJI A;  2DQ3 A;  3LSQ A;  2HG5 C;  2PI4 A;  1GM9 A;  1SZT A;  1K73 W;  1QR8 A;  4JAU A;  1LNQ A;  1PL0 A;  4U7O A;  4JYC A;  1YJ9 V;  1KQS U;  2EIN C;  1AI7 A;  1V54 C;  2IJK A;  2JEX A;  2JK5 C;  1M9N A;  4JTD B;  4BW5 A;  5LBQ A;  3CME V;  1DF4 A;  2X6A A;  2WLK A;  2M7W A;  3D3I A;  3T1C A;  5EBL C;  3G6E V;  3E8G A;  1AJN A;  1OZ0 A;  3E83 A;  5IYD O;  3LDE A;  4FJC C;  1SES A;  3CCR V;  1ORQ C;  1AI4 A;  5H6R A;  1TUE B;  4GX2 A;  3FYE B;  3E8F A;  5LGU A;  1BMF G;  4RO2 A;  3ZMS A;  4UV8 A;  4WFA V;  1FXK A;  2EIM B;  3VOU A;  3W7X A;  4L87 A;  2B5U A;  2EZP A;  3SYP A;  4WFH A;  1GO3 F;  5B3S B;  1AJP A;  2QTO A;  3SPI A;  2IH3 C;  1OCR B;  4MTO A;  2X6C A;  3SPC A;  1FXH A;  3ZRS A;  3OFN G;  3ABU A;  5DN6 G;  5B1A B;  4PA7 A;  2Q67 A;  2P6J A;  1YIJ V;  1R73 A;  2Q6A A;  5J9P C;  1SER A;  1K92 A;  3K9A A;  1YJN V;  3JD0 A;  1YSC A;  2P90 A;  4I5S A;  4QPK A;  4QPJ A;  3FB5 C;  3X2Q B;  3RBZ A;  1R3I C;  4FPP A;  3LUT B;  1OCC B;  4PEL A;  3ZMT A;  3CC4 V;  3KG2 A;  2EIM C;  2WLN A;  3OUS A;  1VQL V;  2XAJ A;  2YEV B;  3WFV A;  5CBF A;  4QE9 A;  1JVM A;  2DYS C;  1OCR C;  1KP3 A;  3CD6 V;  2B1G A;  3CCQ V;  4UVA A;  1R6N A;  4ZKI A;  3CCL V;  2Z5U A;  1K3E A;  2ZDI A;  5L3G A;  1UJW B;  5B1A C;  3R65 A;  1JCH A;  1VQN V;  2HVK C;  3ABK B;  2XAG A;  3K08 A;  1K5Q A;  3SJQ C;  4MSW C;  4MW3 A;  3CCU V;  4XDL A;  1OCO C;  2WWW A;  4LP8 A;  4BIZ A;  4HYO A;  3QO5 A;  1AI6 A;  3B8M A;  1KP2 A;  4X89 A;  2UXN A;  2IW5 A;  3E35 A;  4PA6 A;  2XAQ A;  4UVB A;  2PI5 A;  1NQT A;  4RUF A;  4MVR A;  4Z1M G;  2W6I G;  3ETE A;  4R8C A;  4R50 A;  3JD4 A;  3OUF A;  3MHH C;  5DM6 V;  4GX0 A;  2A0L A;  2B1I A;  1JOY A;  3ABT A;  3H01 A;  1JPX A;  4MVU A;  1H38 A;  2YEV A;  3OAA G;  2R9R B;  3K3W A;  2YSU B;  2OCC B;  1VQP V;  3CC2 V;  1YIT V;  1M1K W;  4LC1 A;  4GX5 A;  1NVP D;  1L1F A;  2EZO A;  5E1A C;  2OT5 A;  2H8P C;  3IC7 A;  5KUM A;  4UUJ C;  3SYC A;  3ZRW B;  2XND G;  3F7V C;  3I55 V;  1Q81 W;  3ASN B;  2QM8 A;  2HJF C;  1FFT B;  1K4C C;  4G27 B;  3K06 A;  1KD1 W;  1ARO P;  1BL8 A;  1DTO A;  4YXW G;  2IJH A;  2ITC C;  3E8B A;  3G4S V;  4U7N A;  3ZN1 A;  4JTA B;  2DQ0 A;  4P9P A;  3STL C;  2X0L A;  1Q86 W;  1FXK B;  3K03 A;  2V1D A;  2XOK G;  5C93 A;  3E89 A;  3I56 V;  3ABM B;  4HZ3 A;  3ZMZ A;  2GSM B;  2BOC C;  1RM1 B;  1QLE B;  4J9Z B;  1G4Y B;  1NR1 A;  1XL6 A;  4QNH B;  3AEI A;  3ASN C;  4R6Z A;  5H9C A;  5FL7 G;  3W7S A;  1K34 A;  3ABL C;  5EBM C;  1H2G A;  3VBB A;  1M56 B;  1MG1 A;  4X88 A;  1B6Q A;  5LHI A;  2OTJ V;  3ETD A;  3ZRW A;  1PNM A;  4PDV A;  1K7D A;  2EIK C;  3FB7 C;  1MOF A;  4QIW F;  1R3K C;  4TSF G;  5L3E A;  4MVO A;  3OW2 U;  1EBO A;  5LGT A;  1F4M A;  3AG1 B;  2HR3 A;  1FXK C;  1SET A;  4G2K A;  1DF5 A;  2ZXW B;  3ABM C;  2QM7 A;  2Y48 A;  1VQ4 V;  3E8H A;  4KFM A;  2WLI A;  3SPG A;  2WAM A;  4PDL A;  2UXX A;  1ENV A;  3JD2 A;  4PDR A;  4MS2 A;  1QVF U;  2IU3 A;  3JD3 A;  1K33 A;  3IFX A;  5HFL A;  1VQO V;  1QCE A;  3ZIA G;  1FS0 G;  3AG4 B;  2XAF A;  3G71 V;  4LBE C;  4WCE V;  3RVZ A;  3T2M A;  2K1E A;  1K5S A;  2DWE C;  2XAS A;  2EIJ B;  1PD3 A;  2ZXW C;  1OCZ B;  4KP4 A;  4P9O A;  3JD1 A;  2WLJ A;  3ZCC A;  1E79 G;  3CCJ V;  4KUM A;  2LFS A;  2ZDI C;  2AHZ A;  1QVG U;  3EFF K;  4RQF A;  3W7W A;  3AG3 B;  3UM7 A;  5B3S C;  5L3F A;  1YHQ V;  1CEZ A;  3E2E A;  1KC8 W;  4BAY A;  1V55 B;  5CMU A;  3AG4 C;  1M57 B;  2WLL B;  1Q82 W;  5BZB A;  4UV9 A;  4WFF A;  4JYB A;  1OHH G;  3T4D A;  1YTF B;  5KUK A;  1VQ8 V;  3X2Q C;  3FB8 C;  1OCC C;  3SYQ A;  3ASO B;  5CBG A;  3E86 A;  1P7B A;  1WLE A;  2EIL B;  1GM8 A;  1I5Y A;  1MAB G;  3CXC U;  1K4D C;  3P32 A;  2Y69 B;  1EFR G;  4FMT A;  5H6Q A;  4TWK A;  4P2Z A;  3BY6 A;  2DW4 A;  1KKD A;  1M57 C;  3W7T A;  2X6B A;  3CMA V;  1W0K G;  4GX1 A;  2A79 B;  2R9I A;  3ABK C;  1S72 V;  4X8A A;  2F43 G;  2HVJ C;  2JJ1 G;  3ZMV A;  5B1N A;  3F5W C;  1W0J G;  2KB1 A;  4ZBM A;  3WG7 B;  1VQ5 V;  4MW8 A;  4RQE A;  2WLL A;  4QE7 A;  1QLN A;  2LP7 A;  4P30 A;  1K8A W;  3K79 A;  1CP9 A;  5IY5 B;  3ASO C;  4G28 B;  4N21 A;  3SPH A;  2JJ2 G;  2P7T C;  4ASU G;  2OTL V;  3QO7 A;  3GB7 C;  5EBW C;  2EIL C;  2D3O W;  2QEX V;  2DWD C;  4XBF A;  2Y69 C;  3LNM B;  2BOB C;  5IYB O;  3P30 A;  1S5H C;  4FIP C;  2GHY A;  3ZRV A;  3ZRX A;  2Z3Y A;  1K9M W;  1BHB A;  3LSS A;  5B1B B;  3W7U A;  1SRY A;  5CA3 A;  1NBM G;  4N23 A;  2OCC C;  4EKW A;  2ITD C;  3OGC C;  5KA6 A;  3MD0 A;  4PA3 A;  2WLI B;  2JIZ G;  1YI2 V;  2A9H A;  2LFR A;  2WLH A;  3CCM V;  1AI5 A;  5IY5 C;  1MSW D;  4RUE A;  1QBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...