1DF4A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
57
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAGGWMEWDREINNYTSLIHSLIEESQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
total genus 24
structure length 57
sequence length 62
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df4A00
1Y66A 1Y4MA 4N23A 4JGSA 1F23A 5KA6A 1QR9A 3MHHC 1JPXA 3H01A 1MG1A 2M7WA 3B77A 1K34A 5H9CA 1QR8A 2EZOA 3B8NA 2OT5A 4N21A 3CP1A 1MOFA 5CMUA 4G2KA 2MK3A 1DF5A 2X7RB 4FJCC 4FIPC 1QBZA 1K33A 3M99B 1ENVA 1QCEA 2EZPA 1I5XA 1EBOA 4JF3A 1DLBA 5CN0A 5KA5A 1I5YA 3MHSC 2LP7A 3K9AA 3B8MA 2P6JA 3WFVA 4E2LA 5HFMA 5HFLA 1JQ0A 2EBOA 1SZTA 3CYOA 4JPRA 3P30A 1DF4A 4FK5C 3GWOA
chains in the Genus database with same CATH superfamily
4J7JA 1Y67A 3JARB 2ETNA 4DR5O 2PY5A 1KBHA 4O4LB 4CH3A 4GKKO 1YZBA 3AG4B 2IU3A 3OEHG 5GONB 2OWOA 2JS5A 5JH7B 2ZR2A 1VQ8V 3ZHTA 3ZHSA 1VQ9V 2OCCC 2JRIA 2RCVA 1PNMA 3E89A 3J7AU 3A2FA 3T4DA 1TVKB 4AILC 3HKEA 3FYIB 3CCVV 2EZOA 2ZM6O 2QEXV 1K9MW 3RYFA 2DYSB 3FYEB 3FFQA 3CS5A 1NTKH 1EZJA 3QO8A 1AI7A 5IY5B 3WFVA 5KHHA 3N2GB 2UUAB 4DR6B 1M1KW 4WFHA 5IY5C 3OR6C 4DV1O 3T1CA 2UXBB 2WSSG 1JFFA 1P4RA 1D5NA 4DUZB 2GV9A 1N34B 2LW1A 3CCJV 2F4VO 4WFBV 2EJ7A 2GUZA 2DYRC 4GX0A 4GCZA 1VQMV 3B4SA 2HHHO 2CH7B 3JSNA 4DR7B 3JAWB 3G4SV 2ZR3A 1Q5OA 4CH5A 4GKKB 1AR4A 2GTAA 2ZXWC 3WB1A 4JI8O 4JI1B 1N34O 3SYAA 2N05A 5C8YB 3UO3A 1V9PA 3MD0A 2L35A 2E5LO 4JI5O 4NXNB 4PD4F 2QSAA 1BSMA 3DGEA 4I4TA 4FPPA 4ZI7A 4OGQB 2BE3A 4E4EA 3ABUA 3E22B 1VF6A 3N2KB 2UU9B 2IJHA 1OV9A 2F43G 2H94A 2H8PC 2CK3G 3RVZA 3OT7A 3CMAV 4CH4A 3BHPA 2Y4UA 4DV5O 4JI4B 1UPGA 1TVKA 5CBHA 1TAEA 2K9PA 2IBZH 1MMMA 1KC8W 5LP6C 1GK9A 4HNAB 3BCCH 1Y74A 3X2QC 1L0LH 5IJ9A 2QM8A 4IIJA 2CDYA 2DJVA 3H1LH 2B5UA 2CE4A 3K06A 5LYJB 4UCSA 1HW7A 4OX9O 4J7KA 4I50B 1JJ2U 3OMNB 3AK1A 1XDCA 3H1IH 4WBNB 3UM7A 4H13B 1R3IC 2RNBA 4LF9B 2B9ZA 4DR2B 1KUQA 5JH7A 4TUYB 3E8BA 2O57A 2ZXWB 1MZEA 1Q7YW 4YHHO 3LUTB 1F51A 4X1KB 3SJAC 1HP8A 3F7VC 3H1KH 3K59A 4GLXA 1GN3A 4UVBA 3FAVB 2IH1C 4JI7O 4JI4O 1Y4MA 3OGIB 4AI8A 1NR7A 3CC4V 1XEQA 4LF6O 2R70A 1ZL8A 2DYRB 2EULA 2HEPA 3VOUA 3H1HH 1H2GA 4UCOA 4LF7B 1IBKB 2ZM6B 2P6JA 2ADPA 3SYCA 4I5SA 3RYFB 3GWKC 2EINB 4JYAB 2OCHA 3TCUA 2IW5A 1GO3F 2YDEA 4LFCO 1MOFA 1SETA 5JQGA 1K33A 1YDXA 1B3QA 3BEHA 5KHKA 1GMGA 5EBMC 2CGOA 2QGNA 4WFEA 3ZHVA 1BGYH 3ZMZA 4FM2A 1IBMB 4K8ZA 4TV9B 2OTLV 1VQPV 4YY3B 4O4IA 5L3CA 1MG1A 1LNQA 3IC7A 4AHCA 1S3JA 4FIPC 5BMVA 3EXAA 1K4DC 3G71V 1RFYA 2D3OW 3G6BA 5KA5A 1NVPD 1OCRC 2DOSA 1URFA 1NVPB 2FB5A 4ZI7B 1H38A 3E86A 4CS2A 1V55B 1SERA 2ARHA 1DTOA 3CXCU 3W7UA 4LF6B 5B1OA 1BCCH 1OCRB 4MVOA 1E79G 4PI0A 4WBNA 2V7QG 4PHZA 2QWNB 4JZGA 2QKSA 4FFBA 4Q20A 2E5LB 5C8YA 4IHJB 1Z5VA 5H5NA 1M4UA 4WFGA 1GAXA 4MW3A 2VQFO 4HBNA 1O9GA 1OZ0A 3ZRWA 2BCCH 3ZHUA 1G6UA 4CZZA 4DV3O 2PYJA 1NT2B 2QWOB 1VQ7V 2LGQA 1SQGA 1J5EB 5GTIZ 1Y6XA 5LMNO 2ZCEA 5LA6B 1HNWO 4JPRA 3JASB 1AP6A 3HKDA 3E8FA 5IDJA 2CTRA 4PA4A 3BVOA 2K1EA 3LSQA 3WB2A 2LGWA 3CXHF 2XHBA 1S0VA 4FLXA 3ETQA 3RN4A 1EBOA 2CTWA 5KLVH 2EILC 3TXSA 3OW2U 2UXNA 4OXSA 1VQNV 3GWOA 2HVJC 4I55B 3HR0A 3ZJZA 1AR1B 1VQOV 3ETDA 1K4CC 2DE0X 2Q69A 3AG3C 2P7TC 1YXBA 2KSDA 3HKBA 3JASA 2LFSA 2LW7A 2ZIOA 5D5PA 4JYAO 1HNZO 2H3OA 2JK5C 1GH6A 2QWQB 3OUFA 5LOVA 2Y69C 5IYDO 4X89A 5KAFZ 5TISZ 1FKAO 4XDLA 3SYPA 3E35A 4O2AB 1T5EA 5DEDA 1WA8B 5IYZB 3THOA 4JI5B 4NXNO 2WLIB 2WLLA 4A5UB 4FLWA 2QDOA 4UV8A 1SF9A 2PTMA 1XHXA 1Q90D 3DC5A 3OTOO 2A3QA 4YJ3A 5EBWC 3CRCA 4IGGA 5CMUA 2MK3A 2ZQMA 2UUBB 1TUBB 4FJCC 1CEZA 4C7UA 3LDCA 3RW0A 2ZDIC 4LH7A 4H37A 1H8EG 1QCEA 5IWAB 4K8XA 4NTYA 3ABLC 1JX9A 4B08A 3EVKA 4YJ2B 2RJZA 5BMVB 2EIMC 4O2BB 3LDEA 1F23A 1JA8A 1OCCB 4JASA 3UCSC 4MTGA 1VEWA 4MSWC 5F2VO 3FAVA 1FJGB 2YXHA 5ITZA 2ZE5A 4BIZA 5JJJB 4B3RO 4PDLA 4NVPA 2AW9A 2QKAA 4U3JA 4CS4A 2XUMA 1SRYA 3RYCB 4IYHA 1XUQA 2QM4A 1YSCA 5LMNB 2BSKA 2JVDA 3N27A 4X9QA 3T1HO 5J9PC 3LSUA 4UFZA 1P7BA 1I5YA 5A2QN 4PA6A 3KZIZ 2X0LA 1OCZB 5KMGA 1YTFB 2B1GA 4FM1A 4PDMA 3ABLB 2M6YA 4DV1B 5H2FZ 3WG7B 4JYBA 4JI2O 3GVMA 2M7WA 5CA1A 5EYPA 1QR8A 1NZ6A 3LNNA 1RPOA 1GN2A 2EIKC 2IH3C 3OUSA 4JV5B 4NB5A 3UKMA 5JWPA 4JZ2A 1BE3H 5FNVB 3OEEG 1SQBH 4JI1O 3CRAA 1M57B 1R3LC 4X1KA 4DR5B 1O9HA 1QR9A 4WFAV 3CCSV 4DR2O 5EZYA 5H9CA 1TA8A 1P7GA 1EZVH 3ABMB 2W0XA 4Z1MG 2PI4A 2KG7B 3L71H 4LF4B 1NTMH 4JI2B 2Y4TA 2IJIA 3L75H 2R9RB 4X1YA 3DTUB 3I56V 5E1AC 2F23A 5KA6A 3K9SA 2QR4A 3CRQA 2IJJA 2ZNJA 3ZHQA 2E76B 2HJDA 2JGUA 4FFBB 1AB3A 2R72A 3APOA 3RYIB 1ENVA 4KHPB 3DXRA 4JTCB 5LL6Y 4EKWA 2FYUH 3HKCA 4B3TO 3DC6A 3D3QA 2UUBO 3D36C 4FVMA 2DWEC 2L6LA 1EM1A 3CE2A 5LP6A 3SPHA 2Z5UA 3AG2B 5LHHA 3MDSA 4P30A 1SKVA 3H9VA 2HR3A 2Q68A 1K5QA 4IIJB 2C2AA 2ATKC 3VQWA 3NR7A 1NBMG 1SS3A 1G4YB 1BHAA 1FPOA 1BS3A 1R1BA 1YHQV 5EK0A 3WG7C 1IVSA 3A0RA 2BOBC 3STLC 1I94O 1XMOB 4X65B 3ZHRA 1WAZA 4LFAB 3TETA 1P49A 4R8CA 4LF5B 1BHBA 3E8GA 1R6KA 3ASNB 3FB8C 4MTXA 4TV8B 2X6AA 4LNUA 4DUZO 3SYOA 2Q8VA 1X59A 2HHHB 4FLYA 3CJHA 3K0DA 4U3FH 3CWBH 3HPLC 5K1XA 1XL4A 2VWKA 3W7TA 4FLVA 4PDVA 5BY1A 3KCXA 2YXLA 2R9AA 4NYKA 2XNDG 4B3MO 3JATB 1F7YA 3E8HA 2WLNA 5CB4A 2KKWA 1OHHG 4X62O 1AJQA 1FXVA 1WA8A 2UXDO 2KB1A 1ZAUA 3N2KA 1RP3B 1SA0A 5BXZA 1NU1H 1RPRA 3T1YB 2YC0A 4Q6GA 3K03A 1XI1A 2P67A 4HYOA 3SPCA 4FLUA 2IU0A 1N32O 3JD4A 4J9ZB 1MZFA 1VF7A 3ZRSA 4GKJO 1V54B 3M8AA 3AG7A 3BA9A 3RGBA 4B7KA 1N33B 5KHIA 1PNLA 2PF4E 4X65O 5CA0A 1WN7A 2BTQA 1KD1W 4OPHA 5JVDB 4QNHB 1I5XA 4TUYA 1J5EO 2JS3A 2UXXA 3RVYA 4LH6A 1AJPA 2A9HA 1RM1B 4ZBMA 1U97A 1H2SB 2WPDG 4B3SO 1XMQO 2A06H 1ZLZA 2NLJC 3K3WA 3TJTA 1A32A 1OJHA 1K8AW 2EX3A 4DV6O 3ZMSA 4FZ0A 4CC6A 3B09A 3QO5A 3QNEA 4X66O 3CCEV 1MABG 1SQVH 1D5AA 1EFRG 4U7OA 4CBCA 3SYQA 4DR6O 3ZEDA 1WP8A 1PD3A 1X4TA 2CTPA 5IYCO 4K0KB 1E1QG 3FX7A 3K04A 2ZD9A 4TV8A 4F6RB 3ASOC 3IJ4A 3JAMN 1I94B 4X64O 4KL1A 1FYJA 4DV0O 4GT1A 2EBOA 1XNQO 4DR4B 2JJ2G 1PPJH 1ORQC 2LO1A 2CAZC 1WNSA 1TGOA 1L1FA 3BA8A 4O4JB 2EILB 3U10A 2ITCC 5KUMA 1CP9A 1H8HG 2HJFC 5L3DA 1W0JG 5IJ0B 4X20B 4PA9A 1QLEC 2UUCO 2JGDB 2E75B 5B66Z 1M5IA 2F93B 5LP6B 5JQGB 1SQFA 2Q5ZA 4DV7O 1R73A 2YIAA 3MHHC 2WLIA 3H01A 2VQFB 5DECA 5IYZA 4UCUA 4KFMA 5GW7A 4H0LB 4EFEA 2QTSA 3RT3C 4KXRA 4R7CA 3AG4C 3AG1B 4DXWA 4X66B 2ZIMA 2ODMA 3W7XA 1QQCA 2LFRA 3Q4HA 2Q7EA 1LR1A 4MW8A 4MVSA 4YHHB 1U96A 3JCUZ 1XOUA 5EC2C 1L0NH 3L74H 1YJNV 1YEWA 3TXQA 2WLHA 3OAAG 4MVZA 1R6NA 4O2BA 2PGGA 4KP4A 4JI0O 2JIZG 3ZS8C 4JF3A 3JD1A 2Z3YA 4MS2A 4YY3O 1N0NA 1F4NA 3JD0A 3VBBA 1XQ8A 3B77A 4FFKA 4TV9A 2FKXA 3QG5A 2HVKC 5L3EA 2W6IG 3AK2A 4J9YB 3HB3B 2QWPB 1WB7A 3UQ8A 2EIMB 4IT5A 4LF9O 4LWSB 4OX9B 3K9AA 4W4LA 3JD3A 5LGUA 3L72H 1JFFB 2D2CB 3JALB 1QLNA 1ZUQA 2HG5C 3CCUV 2GUZB 1XHZA 5FPOA 3ABTA 3VQYA 3OMIB 1J95A 5KMGB 1I08A 4WCEV 2HLDG 1SQQH 4IYIA 2VS0A 2YEVA 4NXMO 4I0XB 3L9DA 4RUFA 5CBGA 1DF4A 4DV5B 3JD2A 1ZSPA 4DR1O 4JI0B 1S5LZ 3JATA 4LWSA 4BW9A 2NN4A 2GBOA 3LSSA 2UXDB 4DR3O 4G2KA 2P22C 3SDLA 2DQ0A 3BY6A 4LF5O 5A9GA 4O4HB 3ASOB 4QJFB 1AI4A 3O65A 1K97A 5B3SC 3GB7C 4ASUG 1QNMA 3WB0A 1IURA 4YIOA 2AHYA 4ZOLB 4DRXB 2IJKA 1YI2V 1M56C 1HR0B 3HKDB 5GTHZ 1VMGA 1XREA 1BL8A 1WJZA 1GN4A 3CRMA 1JOYA 5FPRA 2HP8A 4X1IB 1TUBA 1VQ4V 2AZ2A 2YI8A 3E83A 3OTOB 4GUNA 2PZSA 2X6BA 4J10A 4O4HA 2VQEO 4K3AA 4JAUA 3JALA 4TT3G 4GYCB 1HNWB 1DF5A 2X7RB 4KHPO 3JCZA 2ADQB 3LDDA 4RQFA 4QPJA 3IFXA 4UUJC 5EIBC 1N8RW 4UB8Z 1K73W 3K5NA 4DV4O 2N04A 4MVRA 2AGAA 4JAAA 1WLEA 3X2QB 3DXRB 1ZTEA 4I0XA 1F4MA 2YXYA 4L87A 3K79A 4DR3B 1JVMA 3U0ZA 5J2TB 3M99B 3OGCC 2BTOA 3ZIAG 1DGSA 2ZNIA 1H2NA 2W0FC 1Y76A 3ZRWB 1ZX3A 5JCOC 1XILA 4DO2A 1QLEB 3K57A 3H1JH 5LGNA 4JI8B 1NQTA 1FXHA 2QWRB 1NJIW 2DW4A 3ZCCA 5B1AB 3Q4HB 2ZE8A 2UXCO 2EIJB 3RWRD 4DYLA 4FLTA 5CA1B 1OCCC 4FLZA 2XAGA 4ZHQA 1W0KG 2AZ0A 5HFMA 5IYBO 1AR5A 5IE9A 1HR0O 4UV9A 1PL0A 1TUEB 3W7SA 4X62B 3L70H 1FFXB 4X1IA 3IAYA 3ASNC 4PA7A 2RQ6A 1VQKV 4I7ZB 4I9WA 4W4KA 4QE7A 2WLLB 5D5QA 1VQLV 1D2DA 5LXTA 3RYHA 1VF5B 5EZYB 3P3PA 4YXWG 5LHIA 1Q86W 4PI2A 4RQEA 4JI3O 2HKOA 3SJCC 5LXTB 2KG7A 4UVAA 1Y66A 1MA1A 1ZL8B 1PNKA 3K08A 4LNUB 4N21A 1Q6IA 4YIPA 2F1MA 1NI8A 1FS0G 1Z5WA 4J7ZA 4LBEC 2EZPA 3MHSC 4FZ1A 2Q0AA 3RYCA 2V1DA 3HKEB 1SZTA 3BFRA 3R65A 5CA3A 1COWG 3CSXA 2XT9A 5IJ0A 2A0LA 4TSFG 2ITDC 1S72V 2JGDA 3E22A 2Y0PA 4H44B 4DW0A 1S5HC 3ZMVA 2PYLA 3AG3B 3CHXA 2W6JG 1GM8A 1VIBA 5J2UA 3E2EA 4YJ3B 3CCMV 2VQEB 4EB6A 2PI5A 3B8MA 3BRCA 1AROP 1Q3EA 3SPGA 4DV3B 3P30A 1P84F 1GTOA 2XAHA 4R50A 4EB6B 1H2KA 2GTSA 4K35A 4X20A 4GX1A 2FMLA 3SGIA 4PELA 3ML0A 1IBMO 2WLMA 3ETEA 2Q73A 4GX2A 4MVUA 2YSUB 4Z2WA 4I55A 4UCTA 1HDJA 3G67A 5FL7G 5KHGA 3G80A 1N0JA 2OIGA 1YJWV 2BTQB 1R3JC 1PV0A 1AI6A 2CTQA 1US6A 1IZ3A 3CX5F 1N33O 1M57C 3OTFA 1AVMA 2A7WA 3VQXA 2WA3A 4BIUA 4I50A 5IT9N 2LJ2A 4JAVA 1YTFD 2DWDC 4U3JB 4BIOA 3AG1C 4B3TB 1IXBA 5J2TA 1NKDA 4O4JA 1VQ6V 2UUAO 4ICGA 4LF8O 3FB5C 3T2MA 1FD9A 4LFAO 5CB4B 2JJ1G 3JAKB 4WFFA 3RFRA 5LMUB 2QA4V 5C93A 1B6QA 2FL4A 4GX5A 2XASA 2OTJV 3JSLA 4ZOLA 1AI5A 4LP8A 4LCUC 4U7NA 2YIBD 4BR6A 1Q8IA 3F5TA 2YIDA 3SR2C 5LBQA 4H33A 1MSWD 4DW1A 1NH2D 3AG2C 4JTAB 4L8JA 4BWAA 1YIJV 3AEIA 2KQXA 1N32B 1B04A 4E2LA 3ICXA 1S76D 3EHBB 4QGPA 5JJNB 2PUSA 2YS8A 3JAKA 1W2BU 2RMKB 1JCHA 3UT5B 3K58A 3FB6C 1XBLA 2DMXA 1QBZA 1XL6A 3PN1A 3CCLV 1QU7A 1IBKO 2EINC 4O4LA 4UCVA 5B5EZ 3A0HZ 2YUAA 3C3SA 4ABMA 4TQFA 3JYCA 1Q43A 3R66A 1B06A 4LF7O 2ZE6A 3CB2A 1Z2GA 4LF8B 1KKDA 3MAQA 1L8DA 3CP1A 1IX9A 3I5DA 4B3RB 3ABMC 4IL6Z 1SC5B 3O9OA 3ZX6A 4DV6B 3A0BZ 3QO7A 2ZINA 2YI9A 1WPBA 4NXMB 1GN6A 5B1AC 1K7DA 5J2UB 2Y0IA 1PM9A 4NKGB 4GKJB 1YVWA 1BMFG 1G8MA 1RM1C 2Y69B 4I9QA 3KKYA 3B8NA 1MNGA 4DK0A 4UB6Z 3EFFK 3N2GA 3ABKC 3PJSK 3SPJA 1SESA 3TGUH 2XOKG 1N36O 4YJ2A 1MSDA 4EFBA 4RUEA 3F5WC 2JEUA 4ZKIA 4DV0B 1Q81W 3WU2Z 4X64B 1W59A 2QJ1A 4DUYB 1IXMA 1QHTA 3CCRV 3ZN1A 4F6RA 1Q82W 4I4TB 2Y48A 2B1IA 4P2ZA 5L3GA 2XTAA 2VWJA 4D7SA 1OCOB 1RSOA 4HNAA 3ZN0A 1CPYA 1ROPA 3STZC 3CRRA 1EN4A 1R3KC 2ZDIA 2HFEC 1SA0B 5L3FA 4LFCB 1RSOB 3CD6V 1JQ0A 3OFNG 1NR1A 1WB8A 4FM0A 3OR7C 2ZT9B 5B1BB 2XAQA 4DV7B 4B7EA 2Q4PA 4ZHQB 1K34A 4BAYA 1M90W 2LQTA 2OT5A 5BR8B 1FXKA 2GSMB 3SPIA 5KX5B 1Y74B 4X8AA 1AP5A 2JEXA 3B40A 4HZ3A 1NTZH 5AG2A 4HAMA 1WP7A 1XMOO 2P5OA 1XMQB 3RBZA 4NTXA 2QM7A 3CYOA 5JVDA 4DV4B 4J80A 1VP7A 3RYHB 3D3IA 4JI7B 2N74A 1SQPH 5IWAO 4P9OA 3FKSG 2Q9LA 2P4VA 1XNRB 5LA6A 3BPZA 1I7FA 3K5LA 3K5OA 4D7TA 5B3SB 4O4IB 3C90A 1BQ0A 1G1XB 4DV2O 1BQZA 5HFLA 2JDIG 4NTWA 4DK1A 5CA0B 2QTOA 4LC1A 1FXKB 1CXZB 1KP2A 1KQSU 4JI6O 1THZA 1VQ5V 4IHJA 2BOCC 3U11A 4NR1A 2AXTZ 1I0HA 1Y76B 2OIEA 4PDRA 5KAIZ 3QF7A 2ILMA 2Z0AA 1GRJA 3ETGA 2DYSC 1JMKC 4QIWF 3FB7C 3D36A 3W7WA 1EN5A 5ITZB 1VF6C 3QVNA 3ZRXA 3CPWU 2DQ3A 1Q6UA 4J41A 3FD9A 1FFTB 1UFIA 2GHYA 4QPKA 3ZMTA 1YJ9V 4UXNA 2GDSA 2Q7GA 1PKXA 4XDJA 3S3WA 4LFBB 1HWYA 1FXKC 3OD4A 3CCQV 4DUYO 4MTOA 3UT5A 3SJQC 1IBLB 1HNXO 1K92A 2UU9O 1DLBA 4DV2B 4PA3A 1K3EA 1UJWB 1FFXA 4MVMA 2BSKB 2WAMA 1WPXA 5H6RA 5LYJA 2EIJC 5JJEB 4UCRA 2CUGA 3A8TA 2P90A 2P06A 2QKCA 3J80N 4O2AA 1PL4A 2AHZA 1BT8A 5KHJA 1SZXA 1Q6HA 3OMAB 4ZIBA 4FMTA 3QTCA 4D6TH 2F4VB 1V54C 3IC9A 5LMUO 1R6TA 3KCYA 3ZBHA 3AK3A 2EJRA 5EYPB 3JAWA 1LUWA 5LHGA 1YCIA 1IDSA 1H2MA 4GZRB 1YF2A 4JTDB 4WF9V 3I55V 2V4DA 3D8CA 2YICA 4XBFA 5B1NA 4AQYO 2OYQA 1KB9F 1OCZC 4DR7O 3L73H 5FNVA 1GM9A 3OE7G 3JARA 2UXCB 1SQXH 5JCOA 4B3SB 1S77D 3F7YC 4EEQA 1HNZB 1V55C 1JR9A 3T1HB 3P3NA 1LUVA 2Q6AA 2ZE7A 5B1BC 1FAFA 5EIBD 2UXBO 2ZKOA 3SJBC 4P9PA 4F4LA 2Q67A 2MW2B 1NH2B 1YITV 3CMEV 5K1PA 1KYOF 1KP3A 1OCOC 4F6EA 3ABKB 1VARA 1KMIZ 3RYIA 2R9IA 5KX5A 5FLXN 2WLKA 2YIBA 3NXSA 1M56B 3BABA 1E1RG 1GM7A 4Z1VA 3HKCB 2E74B 1XNQB 4DR4O 2X6CA 3APQA 1AILA 1PP9H 1XNRO 2LP7A 1NS1A 4JYYA 1JJOA 4R6ZA 1QVGU 5BZBA 4LR3A 4JI6B 4PJ0Z 4JGSA 3T4ZA 2FTKA 5LGTA 4X1YB 2XAFA 3IGAC 2Q0OC 5L3BA 2E3CA 1M93A 2A79B 4XDKA 3TK1A 1N4CA 3VQVA 4CH6A 5GONA 5EBLC 1FJGO 4N23A 3P32A 2F95B 1JPXA 4G27B 2DN9A 2IM9A 1KU9A 3C3TA 3OM3B 2RN9A 3M7MX 5DM6V 5IJ9B 3ZMUA 2OCCB 3CEIA 3CC7V 2G38A 3T1YO 3BAAA 1KECA 4RO2A 2RDCA 1BZKA 1H2LA 4J42A 2NR5A 2WLJA 4X88A 1GKFA 5DN6G 5LOVB 2UUCB 3UO2A 2WWWA 3J81N 4QE9A 4JI3B 3ZRVA 2XAJA 4UVCA 4CC5A 3B2EE 4RWUA 4CS3A 3KG2A 5KUKA 4BW5A 2QE7G 5E79Z 4FK5C 4G28B 4JV5O 4MVQA 1EN6A 4TQDA 3DSQA 2EIKB 2YEVB 4JYCA 1M9NA 2CH7A 5CBFA 2WA4A 2P4KA 2VRZA 1ZWIC 4MT8A 4J11A 4DRXA 4K0KO 1AJNA 2CGNA 3HKBB 3K5MA 4MTFA 2NNUA 1S5JA 4B3MB 4LFBO 4PV1B 5H6QA 5BR8O 2Q7HA 4OPAA 4TOIA 1QVFU 2F66C 1DK1A 1N36B 3G6EV 3K0GA 4DR1B 4RAIA 4LF4O 4TWKA 4AQYB 4KUMA 3CJHB 3S3XA 1HNXB 5CN0A 1IBLO 5EC1C 1K5SA 3LNMB 3CC2V 1KKCA
chains in the Genus database with same CATH topology
1BMFG 1G8MA 1RM1C 1F4NA 2Y69B 3JD0A 3VBBA 3B77A 5EBWC 5L3EA 2HVKC 3B8NA 5CMUA 2W6IG 4J9YB 2MK3A 2ZQMA 3EFFK 4FJCC 3HB3B 3ABKC 3PJSK 3SPJA 1CEZA 1SESA 2EIMB 2IU3A 3AG4B 2ZDIC 3LDCA 3OEHG 3RW0A 2XOKG 1H8EG 4H37A 1QCEA 2ZR2A 4RUEA 1VQ8V 3F5WC 2JEUA 3K9AA 3ABLC 4ZKIA 1Q81W 3JD3A 5LGUA 1JX9A 1VQ9V 2OCCC 1IXMA 1QLNA 1PNMA 3CCRV 3E89A 3ZN1A 2HG5C 3CCUV 2EIMC 3T4DA 1Q82W 3LDEA 1F23A 2Y48A 2B1IA 4P2ZA 5L3GA 1OCCB 4JASA 3ABTA 3FYIB 3CCVV 4MTGA 2EZOA 3OMIB 1J95A 2QEXV 1OCOB 1K9MW 2DYSB 3ZN0A 3FYEB 4MSWC 1CPYA 1ROPA 4WCEV 2HLDG 3STZC 1EZJA 2ZDIA 1R3KC 2HFEC 2YEVA 3QO8A 1AI7A 5IY5B 5L3FA 3WFVA 4BIZA 3CD6V 1JQ0A 3OFNG 4PDLA 1NR1A 4RUFA 5CBGA 1DF4A 3OR7C 3JD2A 1M1KW 5B1BB 2XAQA 4WFHA 5IY5C 3OR6C 1SRYA 3T1CA 1K34A 4BAYA 3LSSA 1M90W 2OT5A 2WSSG 1FXKA 1YSCA 1P4RA 4G2KA 2DQ0A 2GSMB 3BY6A 3SPIA 3CCJV 4WFBV 4X8AA 2JEXA 4HZ3A 5J9PC 3ASOB 4QJFB 2DYRC 1AI4A 4HAMA 1P7BA 1K97A 1I5YA 5B3SC 4PA6A 3GB7C 4GX0A 3RBZA 4GCZA 4ASUG 2QM7A 1VQMV 2X0LA 1OCZB 3CYOA 1YTFB 2B1GA 3D3IA 3ABLB 4PDMA 3WG7B 2AHYA 4JYBA 2M7WA 4P9OA 3FKSG 1QR8A 3G4SV 2ZR3A 2IJKA 1RPOA 1YI2V 1M56C 2EIKC 2IH3C 1BL8A 3OUSA 5B3SB 3UKMA 1JOYA 2ZXWC 3OEEG 5HFLA 2JDIG 2QTOA 4LC1A 1FXKB 1M57B 1VQ4V 1R3LC 3SYAA 1KP2A 1KQSU 3E83A 1THZA 2X6BA 1QR9A 4WFAV 3CCSV 5H9CA 1VQ5V 3MD0A 2BOCC 4JAUA 4TT3G 1DF5A 2X7RB 3ABMB 4Z1MG 3JCZA 3DGEA 2PI4A 3LDDA 4RQFA 4PDRA 4QPJA 4FPPA 3IFXA 4UUJC 1N8RW 1K73W 3ABUA 2IJIA 2IJHA 2F43G 2R9RB 3ETGA 2DYSC 3DTUB 2H94A 4MVRA 4QIWF 2H8PC 3FB7C 3I56V 5E1AC 1WLEA 3D36A 3W7WA 3X2QB 2CK3G 5KA6A 3ZRXA 3RVZA 2IJJA 1F4MA 3CMAV 3CPWU 2DQ3A 4L87A 3K79A 1JVMA 3M99B 1ENVA 1FFTB 3OGCC 4JTCB 3ZIAG 2GHYA 4QPKA 4EKWA 5CBHA 3ZMTA 1YJ9V 2W0FC 1KC8W 4UXNA 1GK9A 3ZRWB 1PKXA 3X2QC 4XDJA 4DO2A 1HWYA 1QLEB 5LGNA 2DWEC 1NQTA 2QM8A 1FXHA 1NJIW 1FXKC 2B5UA 2DW4A 3SPHA 2Z5UA 3ZCCA 5B1AB 3AG2B 5LHHA 3CCQV 4MTOA 2EIJB 4P30A 3K06A 2HR3A 2Q68A 1K5QA 2C2AA 3SJQC 1OCCC 1K92A 2ATKC 2XAGA 1DLBA 4PA3A 1NBMG 1W0KG 1G4YB 1K3EA 5HFMA 1BHAA 5IYBO 1UJWB 1JJ2U 3OMNB 4MVMA 2WAMA 1WPXA 5H6RA 4UV9A 1PL0A 2EIJC 1TUEB 3UM7A 3W7SA 1YHQV 1R3IC 5EK0A 2P90A 3WG7C 3A0RA 2BOBC 3STLC 2AHZA 3E8BA 2ZXWB 3ASNC 1Q7YW 4PA7A 3OMAB 3LUTB 1VQKV 4FMTA 4I9WA 1F51A 3TETA 4QE7A 2WLLB 4R8CA 1V54C 1BHBA 1VQLV 3E8GA 1R6KA 3F7VC 2EJRA 4YXWG 3ASNB 3FB8C 5LHIA 1Q86W 4RQEA 4MTXA 4UVBA 2HKOA 2X6AA 2IH1C 3SYOA 5LHGA 4UVAA 1Y66A 1Y4MA 1PNKA 3K0DA 4JTDB 4WF9V 3I55V 3K08A 4XBFA 5B1NA 3HPLC 1OCZC 1XL4A 3W7TA 4N21A 4PDVA 1NR7A 3CC4V 1GM9A 1FS0G 2DYRB 3OE7G 4LBEC 3VOUA 2XNDG 1S77D 1H2GA 2EZPA 3F7YC 3E8HA 1V55C 2WLNA 3MHSC 2P6JA 2V1DA 1SZTA 3R65A 5CA3A 1OHHG 3SYCA 4I5SA 1COWG 2Q6AA 5B1BC 2EINB 2A0LA 1AJQA 1FXVA 4TSFG 2KB1A 3TCUA 2ITDC 1S72V 2IW5A 1GO3F 1S5HC 4P9PA 1MOFA 1SETA 4F4LA 3ZMVA 1RPRA 2Q67A 3AG3B 1K33A 1NH2B 2W6JG 1GM8A 1YITV 3K03A 3CMEV 3BEHA 3E2EA 1GMGA 2P67A 4HYOA 3SPCA 5EBMC 3CCMV 1KP3A 2PI5A 2IU0A 1OCOC 3JD4A 3B8MA 4WFEA 3ZMZA 4J9ZB 2OTLV 1AROP 3ABKB 3SPGA 3P30A 1VQPV 1GTOA 3ZRSA 2XAHA 4R50A 1V54B 2R9IA 2WLKA 3NXSA 5L3CA 1M56B 1MG1A 1LNQA 1PNLA 4GX1A 1E1RG 1GM7A 3IC7A 4PELA 3ML0A 2WLMA 1S3JA 4FIPC 3ETEA 4GX2A 4MVUA 1KD1W 2YSUB 2X6CA 4QNHB 1K4DC 5FL7G 3G71V 2D3OW 1I5XA 5KA5A 1NVPD 1OCRC 2LP7A 1YJWV 2UXXA 3RVYA 1R3JC 4R6ZA 1NVPB 1QVGU 5BZBA 1H38A 1AJPA 3E86A 1AI6A 2A9HA 1RM1B 4ZBMA 4JGSA 1V55B 3T4ZA 1M57C 2FTKA 2WPDG 1SERA 5LGTA 2NLJC 3K3WA 4BIUA 2XAFA 1DTOA 3CXCU 3IGAC 3W7UA 5B1OA 1K8AW 5L3BA 1OCRB 4MVOA 4JAVA 1E79G 3ZMSA 1YTFD 2DWDC 3QNEA 2V7QG 3QO5A 3CCEV 2A79B 4XDKA 1MABG 3AG1C 3TK1A 2QKSA 4Q20A 1NKDA 1EFRG 4U7OA 4CBCA 1VQ6V 3SYQA 4WFGA 4MW3A 5EBLC 4N23A 3P32A 1JPXA 1PD3A 4G27B 1OZ0A 5IYCO 3FB5C 3ZRWA 3T2MA 1E1QG 3K04A 2ZD9A 3OM3B 4CZZA 3ASOC 2JJ1G 4WFFA 5DM6V 3ZMUA 2OCCB 2QA4V 1VQ7V 5C93A 1B6QA 3CC7V 4GX5A 2XASA 2OTJV 4GT1A 2EBOA 1AI5A 4JPRA 1KECA 4LP8A 4LCUC 2JJ2G 4RO2A 4U7NA 1ORQC 2WLJA 3E8FA 4X88A 5IDJA 4PA4A 1GKFA 5DN6G 1L1FA 5LBQA 2WWWA 4H33A 2K1EA 1MSWD 1NH2D 3LSQA 2EILB 3AG2C 4QE9A 4JTAB 2ITCC 3ZRVA 5KUMA 2XAJA 4UVCA 1CP9A 1H8HG 2HJFC 5L3DA 1YIJV 1S0VA 3AEIA 1W0JG 1EBOA 3KG2A 4PA9A 5KUKA 1QLEC 2EILC 4E2LA 4BW5A 1S76D 3OW2U 3EHBB 2QE7G 2UXNA 4OXSA 1VQNV 4FK5C 3GWOA 2HVJC 4G28B 1R73A 4MVQA 2EIKB 3MHHC 2YEVB 2WLIA 3H01A 3ZJZA 1W2BU 4JYCA 1AR1B 1JCHA 1VQOV 1M9NA 3ETDA 1K4CC 3FB6C 2Q69A 3AG3C 4KFMA 5GW7A 1QBZA 2P7TC 5CBFA 4DXWA 3AG4C 3AG1B 4R7CA 2LFSA 1ZWIC 1XL6A 4MT8A 3CCLV 3W7XA 2EINC 2JK5C 2LFRA 3OUFA 1AJNA 4MW8A 4MVSA 4MTFA 2Y69C 3JYCA 5IYDO 5EC2C 1YJNV 2NNUA 4X89A 5H6QA 1KKDA 3CP1A 2WLHA 4XDLA 3OAAG 4MVZA 3SYPA 1R6NA 3ABMC 1QVFU 4KP4A 3E35A 3G6EV 3K0GA 4RAIA 2JIZG 4TWKA 4KUMA 4JF3A 3JD1A 5CN0A 3QO7A 2Z3YA 2WLIB 2WLLA 5B1AC 4UV8A 1K5SA 3LNMB 1K7DA 4MS2A 5EC1C 3CC2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y66 A;  1Y4M A;  4N23 A;  4JGS A;  1F23 A;  5KA6 A;  1QR9 A;  3MHH C;  1JPX A;  3H01 A;  1MG1 A;  2M7W A;  3B77 A;  1K34 A;  5H9C A;  1QR8 A;  2EZO A;  3B8N A;  2OT5 A;  4N21 A;  3CP1 A;  1MOF A;  5CMU A;  4G2K A;  2MK3 A;  1DF5 A;  2X7R B;  4FJC C;  4FIP C;  1QBZ A;  1K33 A;  3M99 B;  1ENV A;  1QCE A;  2EZP A;  1I5X A;  1EBO A;  4JF3 A;  1DLB A;  5CN0 A;  5KA5 A;  1I5Y A;  3MHS C;  2LP7 A;  3K9A A;  3B8M A;  2P6J A;  3WFV A;  4E2L A;  5HFM A;  5HFL A;  1JQ0 A;  2EBO A;  1SZT A;  3CYO A;  4JPR A;  3P30 A;  1DF4 A;  4FK5 C;  3GWO A; 
#chains in the Genus database with same CATH topology
 4J7J A;  1Y67 A;  3JAR B;  2ETN A;  4DR5 O;  2PY5 A;  1KBH A;  4O4L B;  4CH3 A;  4GKK O;  1YZB A;  3AG4 B;  2IU3 A;  3OEH G;  5GON B;  2OWO A;  2JS5 A;  5JH7 B;  2ZR2 A;  1VQ8 V;  3ZHT A;  3ZHS A;  1VQ9 V;  2OCC C;  2JRI A;  2RCV A;  1PNM A;  3E89 A;  3J7A U;  3A2F A;  3T4D A;  1TVK B;  4AIL C;  3HKE A;  3FYI B;  3CCV V;  2EZO A;  2ZM6 O;  2QEX V;  1K9M W;  3RYF A;  2DYS B;  3FYE B;  3FFQ A;  3CS5 A;  1NTK H;  1EZJ A;  3QO8 A;  1AI7 A;  5IY5 B;  3WFV A;  5KHH A;  3N2G B;  2UUA B;  4DR6 B;  1M1K W;  4WFH A;  5IY5 C;  3OR6 C;  4DV1 O;  3T1C A;  2UXB B;  2WSS G;  1JFF A;  1P4R A;  1D5N A;  4DUZ B;  2GV9 A;  1N34 B;  2LW1 A;  3CCJ V;  2F4V O;  4WFB V;  2EJ7 A;  2GUZ A;  2DYR C;  4GX0 A;  4GCZ A;  1VQM V;  3B4S A;  2HHH O;  2CH7 B;  3JSN A;  4DR7 B;  3JAW B;  3G4S V;  2ZR3 A;  1Q5O A;  4CH5 A;  4GKK B;  1AR4 A;  2GTA A;  2ZXW C;  3WB1 A;  4JI8 O;  4JI1 B;  1N34 O;  3SYA A;  2N05 A;  5C8Y B;  3UO3 A;  1V9P A;  3MD0 A;  2L35 A;  2E5L O;  4JI5 O;  4NXN B;  4PD4 F;  2QSA A;  1BSM A;  3DGE A;  4I4T A;  4FPP A;  4ZI7 A;  4OGQ B;  2BE3 A;  4E4E A;  3ABU A;  3E22 B;  1VF6 A;  3N2K B;  2UU9 B;  2IJH A;  1OV9 A;  2F43 G;  2H94 A;  2H8P C;  2CK3 G;  3RVZ A;  3OT7 A;  3CMA V;  4CH4 A;  3BHP A;  2Y4U A;  4DV5 O;  4JI4 B;  1UPG A;  1TVK A;  5CBH A;  1TAE A;  2K9P A;  2IBZ H;  1MMM A;  1KC8 W;  5LP6 C;  1GK9 A;  4HNA B;  3BCC H;  1Y74 A;  3X2Q C;  1L0L H;  5IJ9 A;  2QM8 A;  4IIJ A;  2CDY A;  2DJV A;  3H1L H;  2B5U A;  2CE4 A;  3K06 A;  5LYJ B;  4UCS A;  1HW7 A;  4OX9 O;  4J7K A;  4I50 B;  1JJ2 U;  3OMN B;  3AK1 A;  1XDC A;  3H1I H;  4WBN B;  3UM7 A;  4H13 B;  1R3I C;  2RNB A;  4LF9 B;  2B9Z A;  4DR2 B;  1KUQ A;  5JH7 A;  4TUY B;  3E8B A;  2O57 A;  2ZXW B;  1MZE A;  1Q7Y W;  4YHH O;  3LUT B;  1F51 A;  4X1K B;  3SJA C;  1HP8 A;  3F7V C;  3H1K H;  3K59 A;  4GLX A;  1GN3 A;  4UVB A;  3FAV B;  2IH1 C;  4JI7 O;  4JI4 O;  1Y4M A;  3OGI B;  4AI8 A;  1NR7 A;  3CC4 V;  1XEQ A;  4LF6 O;  2R70 A;  1ZL8 A;  2DYR B;  2EUL A;  2HEP A;  3VOU A;  3H1H H;  1H2G A;  4UCO A;  4LF7 B;  1IBK B;  2ZM6 B;  2P6J A;  2ADP A;  3SYC A;  4I5S A;  3RYF B;  3GWK C;  2EIN B;  4JYA B;  2OCH A;  3TCU A;  2IW5 A;  1GO3 F;  2YDE A;  4LFC O;  1MOF A;  1SET A;  5JQG A;  1K33 A;  1YDX A;  1B3Q A;  3BEH A;  5KHK A;  1GMG A;  5EBM C;  2CGO A;  2QGN A;  4WFE A;  3ZHV A;  1BGY H;  3ZMZ A;  4FM2 A;  1IBM B;  4K8Z A;  4TV9 B;  2OTL V;  1VQP V;  4YY3 B;  4O4I A;  5L3C A;  1MG1 A;  1LNQ A;  3IC7 A;  4AHC A;  1S3J A;  4FIP C;  5BMV A;  3EXA A;  1K4D C;  3G71 V;  1RFY A;  2D3O W;  3G6B A;  5KA5 A;  1NVP D;  1OCR C;  2DOS A;  1URF A;  1NVP B;  2FB5 A;  4ZI7 B;  1H38 A;  3E86 A;  4CS2 A;  1V55 B;  1SER A;  2ARH A;  1DTO A;  3CXC U;  3W7U A;  4LF6 B;  5B1O A;  1BCC H;  1OCR B;  4MVO A;  1E79 G;  4PI0 A;  4WBN A;  2V7Q G;  4PHZ A;  2QWN B;  4JZG A;  2QKS A;  4FFB A;  4Q20 A;  2E5L B;  5C8Y A;  4IHJ B;  1Z5V A;  5H5N A;  1M4U A;  4WFG A;  1GAX A;  4MW3 A;  2VQF O;  4HBN A;  1O9G A;  1OZ0 A;  3ZRW A;  2BCC H;  3ZHU A;  1G6U A;  4CZZ A;  4DV3 O;  2PYJ A;  1NT2 B;  2QWO B;  1VQ7 V;  2LGQ A;  1SQG A;  1J5E B;  5GTI Z;  1Y6X A;  5LMN O;  2ZCE A;  5LA6 B;  1HNW O;  4JPR A;  3JAS B;  1AP6 A;  3HKD A;  3E8F A;  5IDJ A;  2CTR A;  4PA4 A;  3BVO A;  2K1E A;  3LSQ A;  3WB2 A;  2LGW A;  3CXH F;  2XHB A;  1S0V A;  4FLX A;  3ETQ A;  3RN4 A;  1EBO A;  2CTW A;  5KLV H;  2EIL C;  3TXS A;  3OW2 U;  2UXN A;  4OXS A;  1VQN V;  3GWO A;  2HVJ C;  4I55 B;  3HR0 A;  3ZJZ A;  1AR1 B;  1VQO V;  3ETD A;  1K4C C;  2DE0 X;  2Q69 A;  3AG3 C;  2P7T C;  1YXB A;  2KSD A;  3HKB A;  3JAS A;  2LFS A;  2LW7 A;  2ZIO A;  5D5P A;  4JYA O;  1HNZ O;  2H3O A;  2JK5 C;  1GH6 A;  2QWQ B;  3OUF A;  5LOV A;  2Y69 C;  5IYD O;  4X89 A;  5KAF Z;  5TIS Z;  1FKA O;  4XDL A;  3SYP A;  3E35 A;  4O2A B;  1T5E A;  5DED A;  1WA8 B;  5IYZ B;  3THO A;  4JI5 B;  4NXN O;  2WLI B;  2WLL A;  4A5U B;  4FLW A;  2QDO A;  4UV8 A;  1SF9 A;  2PTM A;  1XHX A;  1Q90 D;  3DC5 A;  3OTO O;  2A3Q A;  4YJ3 A;  5EBW C;  3CRC A;  4IGG A;  5CMU A;  2MK3 A;  2ZQM A;  2UUB B;  1TUB B;  4FJC C;  1CEZ A;  4C7U A;  3LDC A;  3RW0 A;  2ZDI C;  4LH7 A;  4H37 A;  1H8E G;  1QCE A;  5IWA B;  4K8X A;  4NTY A;  3ABL C;  1JX9 A;  4B08 A;  3EVK A;  4YJ2 B;  2RJZ A;  5BMV B;  2EIM C;  4O2B B;  3LDE A;  1F23 A;  1JA8 A;  1OCC B;  4JAS A;  3UCS C;  4MTG A;  1VEW A;  4MSW C;  5F2V O;  3FAV A;  1FJG B;  2YXH A;  5ITZ A;  2ZE5 A;  4BIZ A;  5JJJ B;  4B3R O;  4PDL A;  4NVP A;  2AW9 A;  2QKA A;  4U3J A;  4CS4 A;  2XUM A;  1SRY A;  3RYC B;  4IYH A;  1XUQ A;  2QM4 A;  1YSC A;  5LMN B;  2BSK A;  2JVD A;  3N27 A;  4X9Q A;  3T1H O;  5J9P C;  3LSU A;  4UFZ A;  1P7B A;  1I5Y A;  5A2Q N;  4PA6 A;  3KZI Z;  2X0L A;  1OCZ B;  5KMG A;  1YTF B;  2B1G A;  4FM1 A;  4PDM A;  3ABL B;  2M6Y A;  4DV1 B;  5H2F Z;  3WG7 B;  4JYB A;  4JI2 O;  3GVM A;  2M7W A;  5CA1 A;  5EYP A;  1QR8 A;  1NZ6 A;  3LNN A;  1RPO A;  1GN2 A;  2EIK C;  2IH3 C;  3OUS A;  4JV5 B;  4NB5 A;  3UKM A;  5JWP A;  4JZ2 A;  1BE3 H;  5FNV B;  3OEE G;  1SQB H;  4JI1 O;  3CRA A;  1M57 B;  1R3L C;  4X1K A;  4DR5 B;  1O9H A;  1QR9 A;  4WFA V;  3CCS V;  4DR2 O;  5EZY A;  5H9C A;  1TA8 A;  1P7G A;  1EZV H;  3ABM B;  2W0X A;  4Z1M G;  2PI4 A;  2KG7 B;  3L71 H;  4LF4 B;  1NTM H;  4JI2 B;  2Y4T A;  2IJI A;  3L75 H;  2R9R B;  4X1Y A;  3DTU B;  3I56 V;  5E1A C;  2F23 A;  5KA6 A;  3K9S A;  2QR4 A;  3CRQ A;  2IJJ A;  2ZNJ A;  3ZHQ A;  2E76 B;  2HJD A;  2JGU A;  4FFB B;  1AB3 A;  2R72 A;  3APO A;  3RYI B;  1ENV A;  4KHP B;  3DXR A;  4JTC B;  5LL6 Y;  4EKW A;  2FYU H;  3HKC A;  4B3T O;  3DC6 A;  3D3Q A;  2UUB O;  3D36 C;  4FVM A;  2DWE C;  2L6L A;  1EM1 A;  3CE2 A;  5LP6 A;  3SPH A;  2Z5U A;  3AG2 B;  5LHH A;  3MDS A;  4P30 A;  1SKV A;  3H9V A;  2HR3 A;  2Q68 A;  1K5Q A;  4IIJ B;  2C2A A;  2ATK C;  3VQW A;  3NR7 A;  1NBM G;  1SS3 A;  1G4Y B;  1BHA A;  1FPO A;  1BS3 A;  1R1B A;  1YHQ V;  5EK0 A;  3WG7 C;  1IVS A;  3A0R A;  2BOB C;  3STL C;  1I94 O;  1XMO B;  4X65 B;  3ZHR A;  1WAZ A;  4LFA B;  3TET A;  1P49 A;  4R8C A;  4LF5 B;  1BHB A;  3E8G A;  1R6K A;  3ASN B;  3FB8 C;  4MTX A;  4TV8 B;  2X6A A;  4LNU A;  4DUZ O;  3SYO A;  2Q8V A;  1X59 A;  2HHH B;  4FLY A;  3CJH A;  3K0D A;  4U3F H;  3CWB H;  3HPL C;  5K1X A;  1XL4 A;  2VWK A;  3W7T A;  4FLV A;  4PDV A;  5BY1 A;  3KCX A;  2YXL A;  2R9A A;  4NYK A;  2XND G;  4B3M O;  3JAT B;  1F7Y A;  3E8H A;  2WLN A;  5CB4 A;  2KKW A;  1OHH G;  4X62 O;  1AJQ A;  1FXV A;  1WA8 A;  2UXD O;  2KB1 A;  1ZAU A;  3N2K A;  1RP3 B;  1SA0 A;  5BXZ A;  1NU1 H;  1RPR A;  3T1Y B;  2YC0 A;  4Q6G A;  3K03 A;  1XI1 A;  2P67 A;  4HYO A;  3SPC A;  4FLU A;  2IU0 A;  1N32 O;  3JD4 A;  4J9Z B;  1MZF A;  1VF7 A;  3ZRS A;  4GKJ O;  1V54 B;  3M8A A;  3AG7 A;  3BA9 A;  3RGB A;  4B7K A;  1N33 B;  5KHI A;  1PNL A;  2PF4 E;  4X65 O;  5CA0 A;  1WN7 A;  2BTQ A;  1KD1 W;  4OPH A;  5JVD B;  4QNH B;  1I5X A;  4TUY A;  1J5E O;  2JS3 A;  2UXX A;  3RVY A;  4LH6 A;  1AJP A;  2A9H A;  1RM1 B;  4ZBM A;  1U97 A;  1H2S B;  2WPD G;  4B3S O;  1XMQ O;  2A06 H;  1ZLZ A;  2NLJ C;  3K3W A;  3TJT A;  1A32 A;  1OJH A;  1K8A W;  2EX3 A;  4DV6 O;  3ZMS A;  4FZ0 A;  4CC6 A;  3B09 A;  3QO5 A;  3QNE A;  4X66 O;  3CCE V;  1MAB G;  1SQV H;  1D5A A;  1EFR G;  4U7O A;  4CBC A;  3SYQ A;  4DR6 O;  3ZED A;  1WP8 A;  1PD3 A;  1X4T A;  2CTP A;  5IYC O;  4K0K B;  1E1Q G;  3FX7 A;  3K04 A;  2ZD9 A;  4TV8 A;  4F6R B;  3ASO C;  3IJ4 A;  3JAM N;  1I94 B;  4X64 O;  4KL1 A;  1FYJ A;  4DV0 O;  4GT1 A;  2EBO A;  1XNQ O;  4DR4 B;  2JJ2 G;  1PPJ H;  1ORQ C;  2LO1 A;  2CAZ C;  1WNS A;  1TGO A;  1L1F A;  3BA8 A;  4O4J B;  2EIL B;  3U10 A;  2ITC C;  5KUM A;  1CP9 A;  1H8H G;  2HJF C;  5L3D A;  1W0J G;  5IJ0 B;  4X20 B;  4PA9 A;  1QLE C;  2UUC O;  2JGD B;  2E75 B;  5B66 Z;  1M5I A;  2F93 B;  5LP6 B;  5JQG B;  1SQF A;  2Q5Z A;  4DV7 O;  1R73 A;  2YIA A;  3MHH C;  2WLI A;  3H01 A;  2VQF B;  5DEC A;  5IYZ A;  4UCU A;  4KFM A;  5GW7 A;  4H0L B;  4EFE A;  2QTS A;  3RT3 C;  4KXR A;  4R7C A;  3AG4 C;  3AG1 B;  4DXW A;  4X66 B;  2ZIM A;  2ODM A;  3W7X A;  1QQC A;  2LFR A;  3Q4H A;  2Q7E A;  1LR1 A;  4MW8 A;  4MVS A;  4YHH B;  1U96 A;  3JCU Z;  1XOU A;  5EC2 C;  1L0N H;  3L74 H;  1YJN V;  1YEW A;  3TXQ A;  2WLH A;  3OAA G;  4MVZ A;  1R6N A;  4O2B A;  2PGG A;  4KP4 A;  4JI0 O;  2JIZ G;  3ZS8 C;  4JF3 A;  3JD1 A;  2Z3Y A;  4MS2 A;  4YY3 O;  1N0N A;  1F4N A;  3JD0 A;  3VBB A;  1XQ8 A;  3B77 A;  4FFK A;  4TV9 A;  2FKX A;  3QG5 A;  2HVK C;  5L3E A;  2W6I G;  3AK2 A;  4J9Y B;  3HB3 B;  2QWP B;  1WB7 A;  3UQ8 A;  2EIM B;  4IT5 A;  4LF9 O;  4LWS B;  4OX9 B;  3K9A A;  4W4L A;  3JD3 A;  5LGU A;  3L72 H;  1JFF B;  2D2C B;  3JAL B;  1QLN A;  1ZUQ A;  2HG5 C;  3CCU V;  2GUZ B;  1XHZ A;  5FPO A;  3ABT A;  3VQY A;  3OMI B;  1J95 A;  5KMG B;  1I08 A;  4WCE V;  2HLD G;  1SQQ H;  4IYI A;  2VS0 A;  2YEV A;  4NXM O;  4I0X B;  3L9D A;  4RUF A;  5CBG A;  1DF4 A;  4DV5 B;  3JD2 A;  1ZSP A;  4DR1 O;  4JI0 B;  1S5L Z;  3JAT A;  4LWS A;  4BW9 A;  2NN4 A;  2GBO A;  3LSS A;  2UXD B;  4DR3 O;  4G2K A;  2P22 C;  3SDL A;  2DQ0 A;  3BY6 A;  4LF5 O;  5A9G A;  4O4H B;  3ASO B;  4QJF B;  1AI4 A;  3O65 A;  1K97 A;  5B3S C;  3GB7 C;  4ASU G;  1QNM A;  3WB0 A;  1IUR A;  4YIO A;  2AHY A;  4ZOL B;  4DRX B;  2IJK A;  1YI2 V;  1M56 C;  1HR0 B;  3HKD B;  5GTH Z;  1VMG A;  1XRE A;  1BL8 A;  1WJZ A;  1GN4 A;  3CRM A;  1JOY A;  5FPR A;  2HP8 A;  4X1I B;  1TUB A;  1VQ4 V;  2AZ2 A;  2YI8 A;  3E83 A;  3OTO B;  4GUN A;  2PZS A;  2X6B A;  4J10 A;  4O4H A;  2VQE O;  4K3A A;  4JAU A;  3JAL A;  4TT3 G;  4GYC B;  1HNW B;  1DF5 A;  2X7R B;  4KHP O;  3JCZ A;  2ADQ B;  3LDD A;  4RQF A;  4QPJ A;  3IFX A;  4UUJ C;  5EIB C;  1N8R W;  4UB8 Z;  1K73 W;  3K5N A;  4DV4 O;  2N04 A;  4MVR A;  2AGA A;  4JAA A;  1WLE A;  3X2Q B;  3DXR B;  1ZTE A;  4I0X A;  1F4M A;  2YXY A;  4L87 A;  3K79 A;  4DR3 B;  1JVM A;  3U0Z A;  5J2T B;  3M99 B;  3OGC C;  2BTO A;  3ZIA G;  1DGS A;  2ZNI A;  1H2N A;  2W0F C;  1Y76 A;  3ZRW B;  1ZX3 A;  5JCO C;  1XIL A;  4DO2 A;  1QLE B;  3K57 A;  3H1J H;  5LGN A;  4JI8 B;  1NQT A;  1FXH A;  2QWR B;  1NJI W;  2DW4 A;  3ZCC A;  5B1A B;  3Q4H B;  2ZE8 A;  2UXC O;  2EIJ B;  3RWR D;  4DYL A;  4FLT A;  5CA1 B;  1OCC C;  4FLZ A;  2XAG A;  4ZHQ A;  1W0K G;  2AZ0 A;  5HFM A;  5IYB O;  1AR5 A;  5IE9 A;  1HR0 O;  4UV9 A;  1PL0 A;  1TUE B;  3W7S A;  4X62 B;  3L70 H;  1FFX B;  4X1I A;  3IAY A;  3ASN C;  4PA7 A;  2RQ6 A;  1VQK V;  4I7Z B;  4I9W A;  4W4K A;  4QE7 A;  2WLL B;  5D5Q A;  1VQL V;  1D2D A;  5LXT A;  3RYH A;  1VF5 B;  5EZY B;  3P3P A;  4YXW G;  5LHI A;  1Q86 W;  4PI2 A;  4RQE A;  4JI3 O;  2HKO A;  3SJC C;  5LXT B;  2KG7 A;  4UVA A;  1Y66 A;  1MA1 A;  1ZL8 B;  1PNK A;  3K08 A;  4LNU B;  4N21 A;  1Q6I A;  4YIP A;  2F1M A;  1NI8 A;  1FS0 G;  1Z5W A;  4J7Z A;  4LBE C;  2EZP A;  3MHS C;  4FZ1 A;  2Q0A A;  3RYC A;  2V1D A;  3HKE B;  1SZT A;  3BFR A;  3R65 A;  5CA3 A;  1COW G;  3CSX A;  2XT9 A;  5IJ0 A;  2A0L A;  4TSF G;  2ITD C;  1S72 V;  2JGD A;  3E22 A;  2Y0P A;  4H44 B;  4DW0 A;  1S5H C;  3ZMV A;  2PYL A;  3AG3 B;  3CHX A;  2W6J G;  1GM8 A;  1VIB A;  5J2U A;  3E2E A;  4YJ3 B;  3CCM V;  2VQE B;  4EB6 A;  2PI5 A;  3B8M A;  3BRC A;  1ARO P;  1Q3E A;  3SPG A;  4DV3 B;  3P30 A;  1P84 F;  1GTO A;  2XAH A;  4R50 A;  4EB6 B;  1H2K A;  2GTS A;  4K35 A;  4X20 A;  4GX1 A;  2FML A;  3SGI A;  4PEL A;  3ML0 A;  1IBM O;  2WLM A;  3ETE A;  2Q73 A;  4GX2 A;  4MVU A;  2YSU B;  4Z2W A;  4I55 A;  4UCT A;  1HDJ A;  3G67 A;  5FL7 G;  5KHG A;  3G80 A;  1N0J A;  2OIG A;  1YJW V;  2BTQ B;  1R3J C;  1PV0 A;  1AI6 A;  2CTQ A;  1US6 A;  1IZ3 A;  3CX5 F;  1N33 O;  1M57 C;  3OTF A;  1AVM A;  2A7W A;  3VQX A;  2WA3 A;  4BIU A;  4I50 A;  5IT9 N;  2LJ2 A;  4JAV A;  1YTF D;  2DWD C;  4U3J B;  4BIO A;  3AG1 C;  4B3T B;  1IXB A;  5J2T A;  1NKD A;  4O4J A;  1VQ6 V;  2UUA O;  4ICG A;  4LF8 O;  3FB5 C;  3T2M A;  1FD9 A;  4LFA O;  5CB4 B;  2JJ1 G;  3JAK B;  4WFF A;  3RFR A;  5LMU B;  2QA4 V;  5C93 A;  1B6Q A;  2FL4 A;  4GX5 A;  2XAS A;  2OTJ V;  3JSL A;  4ZOL A;  1AI5 A;  4LP8 A;  4LCU C;  4U7N A;  2YIB D;  4BR6 A;  1Q8I A;  3F5T A;  2YID A;  3SR2 C;  5LBQ A;  4H33 A;  1MSW D;  4DW1 A;  1NH2 D;  3AG2 C;  4JTA B;  4L8J A;  4BWA A;  1YIJ V;  3AEI A;  2KQX A;  1N32 B;  1B04 A;  4E2L A;  3ICX A;  1S76 D;  3EHB B;  4QGP A;  5JJN B;  2PUS A;  2YS8 A;  3JAK A;  1W2B U;  2RMK B;  1JCH A;  3UT5 B;  3K58 A;  3FB6 C;  1XBL A;  2DMX A;  1QBZ A;  1XL6 A;  3PN1 A;  3CCL V;  1QU7 A;  1IBK O;  2EIN C;  4O4L A;  4UCV A;  5B5E Z;  3A0H Z;  2YUA A;  3C3S A;  4ABM A;  4TQF A;  3JYC A;  1Q43 A;  3R66 A;  1B06 A;  4LF7 O;  2ZE6 A;  3CB2 A;  1Z2G A;  4LF8 B;  1KKD A;  3MAQ A;  1L8D A;  3CP1 A;  1IX9 A;  3I5D A;  4B3R B;  3ABM C;  4IL6 Z;  1SC5 B;  3O9O A;  3ZX6 A;  4DV6 B;  3A0B Z;  3QO7 A;  2ZIN A;  2YI9 A;  1WPB A;  4NXM B;  1GN6 A;  5B1A C;  1K7D A;  5J2U B;  2Y0I A;  1PM9 A;  4NKG B;  4GKJ B;  1YVW A;  1BMF G;  1G8M A;  1RM1 C;  2Y69 B;  4I9Q A;  3KKY A;  3B8N A;  1MNG A;  4DK0 A;  4UB6 Z;  3EFF K;  3N2G A;  3ABK C;  3PJS K;  3SPJ A;  1SES A;  3TGU H;  2XOK G;  1N36 O;  4YJ2 A;  1MSD A;  4EFB A;  4RUE A;  3F5W C;  2JEU A;  4ZKI A;  4DV0 B;  1Q81 W;  3WU2 Z;  4X64 B;  1W59 A;  2QJ1 A;  4DUY B;  1IXM A;  1QHT A;  3CCR V;  3ZN1 A;  4F6R A;  1Q82 W;  4I4T B;  2Y48 A;  2B1I A;  4P2Z A;  5L3G A;  2XTA A;  2VWJ A;  4D7S A;  1OCO B;  1RSO A;  4HNA A;  3ZN0 A;  1CPY A;  1ROP A;  3STZ C;  3CRR A;  1EN4 A;  1R3K C;  2ZDI A;  2HFE C;  1SA0 B;  5L3F A;  4LFC B;  1RSO B;  3CD6 V;  1JQ0 A;  3OFN G;  1NR1 A;  1WB8 A;  4FM0 A;  3OR7 C;  2ZT9 B;  5B1B B;  2XAQ A;  4DV7 B;  4B7E A;  2Q4P A;  4ZHQ B;  1K34 A;  4BAY A;  1M90 W;  2LQT A;  2OT5 A;  5BR8 B;  1FXK A;  2GSM B;  3SPI A;  5KX5 B;  1Y74 B;  4X8A A;  1AP5 A;  2JEX A;  3B40 A;  4HZ3 A;  1NTZ H;  5AG2 A;  4HAM A;  1WP7 A;  1XMO O;  2P5O A;  1XMQ B;  3RBZ A;  4NTX A;  2QM7 A;  3CYO A;  5JVD A;  4DV4 B;  4J80 A;  1VP7 A;  3RYH B;  3D3I A;  4JI7 B;  2N74 A;  1SQP H;  5IWA O;  4P9O A;  3FKS G;  2Q9L A;  2P4V A;  1XNR B;  5LA6 A;  3BPZ A;  1I7F A;  3K5L A;  3K5O A;  4D7T A;  5B3S B;  4O4I B;  3C90 A;  1BQ0 A;  1G1X B;  4DV2 O;  1BQZ A;  5HFL A;  2JDI G;  4NTW A;  4DK1 A;  5CA0 B;  2QTO A;  4LC1 A;  1FXK B;  1CXZ B;  1KP2 A;  1KQS U;  4JI6 O;  1THZ A;  1VQ5 V;  4IHJ A;  2BOC C;  3U11 A;  4NR1 A;  2AXT Z;  1I0H A;  1Y76 B;  2OIE A;  4PDR A;  5KAI Z;  3QF7 A;  2ILM A;  2Z0A A;  1GRJ A;  3ETG A;  2DYS C;  1JMK C;  4QIW F;  3FB7 C;  3D36 A;  3W7W A;  1EN5 A;  5ITZ B;  1VF6 C;  3QVN A;  3ZRX A;  3CPW U;  2DQ3 A;  1Q6U A;  4J41 A;  3FD9 A;  1FFT B;  1UFI A;  2GHY A;  4QPK A;  3ZMT A;  1YJ9 V;  4UXN A;  2GDS A;  2Q7G A;  1PKX A;  4XDJ A;  3S3W A;  4LFB B;  1HWY A;  1FXK C;  3OD4 A;  3CCQ V;  4DUY O;  4MTO A;  3UT5 A;  3SJQ C;  1IBL B;  1HNX O;  1K92 A;  2UU9 O;  1DLB A;  4DV2 B;  4PA3 A;  1K3E A;  1UJW B;  1FFX A;  4MVM A;  2BSK B;  2WAM A;  1WPX A;  5H6R A;  5LYJ A;  2EIJ C;  5JJE B;  4UCR A;  2CUG A;  3A8T A;  2P90 A;  2P06 A;  2QKC A;  3J80 N;  4O2A A;  1PL4 A;  2AHZ A;  1BT8 A;  5KHJ A;  1SZX A;  1Q6H A;  3OMA B;  4ZIB A;  4FMT A;  3QTC A;  4D6T H;  2F4V B;  1V54 C;  3IC9 A;  5LMU O;  1R6T A;  3KCY A;  3ZBH A;  3AK3 A;  2EJR A;  5EYP B;  3JAW A;  1LUW A;  5LHG A;  1YCI A;  1IDS A;  1H2M A;  4GZR B;  1YF2 A;  4JTD B;  4WF9 V;  3I55 V;  2V4D A;  3D8C A;  2YIC A;  4XBF A;  5B1N A;  4AQY O;  2OYQ A;  1KB9 F;  1OCZ C;  4DR7 O;  3L73 H;  5FNV A;  1GM9 A;  3OE7 G;  3JAR A;  2UXC B;  1SQX H;  5JCO A;  4B3S B;  1S77 D;  3F7Y C;  4EEQ A;  1HNZ B;  1V55 C;  1JR9 A;  3T1H B;  3P3N A;  1LUV A;  2Q6A A;  2ZE7 A;  5B1B C;  1FAF A;  5EIB D;  2UXB O;  2ZKO A;  3SJB C;  4P9P A;  4F4L A;  2Q67 A;  2MW2 B;  1NH2 B;  1YIT V;  3CME V;  5K1P A;  1KYO F;  1KP3 A;  1OCO C;  4F6E A;  3ABK B;  1VAR A;  1KMI Z;  3RYI A;  2R9I A;  5KX5 A;  5FLX N;  2WLK A;  2YIB A;  3NXS A;  1M56 B;  3BAB A;  1E1R G;  1GM7 A;  4Z1V A;  3HKC B;  2E74 B;  1XNQ B;  4DR4 O;  2X6C A;  3APQ A;  1AIL A;  1PP9 H;  1XNR O;  2LP7 A;  1NS1 A;  4JYY A;  1JJO A;  4R6Z A;  1QVG U;  5BZB A;  4LR3 A;  4JI6 B;  4PJ0 Z;  4JGS A;  3T4Z A;  2FTK A;  5LGT A;  4X1Y B;  2XAF A;  3IGA C;  2Q0O C;  5L3B A;  2E3C A;  1M93 A;  2A79 B;  4XDK A;  3TK1 A;  1N4C A;  3VQV A;  4CH6 A;  5GON A;  5EBL C;  1FJG O;  4N23 A;  3P32 A;  2F95 B;  1JPX A;  4G27 B;  2DN9 A;  2IM9 A;  1KU9 A;  3C3T A;  3OM3 B;  2RN9 A;  3M7M X;  5DM6 V;  5IJ9 B;  3ZMU A;  2OCC B;  3CEI A;  3CC7 V;  2G38 A;  3T1Y O;  3BAA A;  1KEC A;  4RO2 A;  2RDC A;  1BZK A;  1H2L A;  4J42 A;  2NR5 A;  2WLJ A;  4X88 A;  1GKF A;  5DN6 G;  5LOV B;  2UUC B;  3UO2 A;  2WWW A;  3J81 N;  4QE9 A;  4JI3 B;  3ZRV A;  2XAJ A;  4UVC A;  4CC5 A;  3B2E E;  4RWU A;  4CS3 A;  3KG2 A;  5KUK A;  4BW5 A;  2QE7 G;  5E79 Z;  4FK5 C;  4G28 B;  4JV5 O;  4MVQ A;  1EN6 A;  4TQD A;  3DSQ A;  2EIK B;  2YEV B;  4JYC A;  1M9N A;  2CH7 A;  5CBF A;  2WA4 A;  2P4K A;  2VRZ A;  1ZWI C;  4MT8 A;  4J11 A;  4DRX A;  4K0K O;  1AJN A;  2CGN A;  3HKB B;  3K5M A;  4MTF A;  2NNU A;  1S5J A;  4B3M B;  4LFB O;  4PV1 B;  5H6Q A;  5BR8 O;  2Q7H A;  4OPA A;  4TOI A;  1QVF U;  2F66 C;  1DK1 A;  1N36 B;  3G6E V;  3K0G A;  4DR1 B;  4RAI A;  4LF4 O;  4TWK A;  4AQY B;  4KUM A;  3CJH B;  3S3X A;  1HNX B;  5CN0 A;  1IBL O;  5EC1 C;  1K5S A;  3LNM B;  3CC2 V;  1KKC A; 
#chains in the Genus database with same CATH homology
 1BMF G;  1G8M A;  1RM1 C;  1F4N A;  2Y69 B;  3JD0 A;  3VBB A;  3B77 A;  5EBW C;  5L3E A;  2HVK C;  3B8N A;  5CMU A;  2W6I G;  4J9Y B;  2MK3 A;  2ZQM A;  3EFF K;  4FJC C;  3HB3 B;  3ABK C;  3PJS K;  3SPJ A;  1CEZ A;  1SES A;  2EIM B;  2IU3 A;  3AG4 B;  2ZDI C;  3LDC A;  3OEH G;  3RW0 A;  2XOK G;  1H8E G;  4H37 A;  1QCE A;  2ZR2 A;  4RUE A;  1VQ8 V;  3F5W C;  2JEU A;  3K9A A;  3ABL C;  4ZKI A;  1Q81 W;  3JD3 A;  5LGU A;  1JX9 A;  1VQ9 V;  2OCC C;  1IXM A;  1QLN A;  1PNM A;  3CCR V;  3E89 A;  3ZN1 A;  2HG5 C;  3CCU V;  2EIM C;  3T4D A;  1Q82 W;  3LDE A;  1F23 A;  2Y48 A;  2B1I A;  4P2Z A;  5L3G A;  1OCC B;  4JAS A;  3ABT A;  3FYI B;  3CCV V;  4MTG A;  2EZO A;  3OMI B;  1J95 A;  2QEX V;  1OCO B;  1K9M W;  2DYS B;  3ZN0 A;  3FYE B;  4MSW C;  1CPY A;  1ROP A;  4WCE V;  2HLD G;  3STZ C;  1EZJ A;  2ZDI A;  1R3K C;  2HFE C;  2YEV A;  3QO8 A;  1AI7 A;  5IY5 B;  5L3F A;  3WFV A;  4BIZ A;  3CD6 V;  1JQ0 A;  3OFN G;  4PDL A;  1NR1 A;  4RUF A;  5CBG A;  1DF4 A;  3OR7 C;  3JD2 A;  1M1K W;  5B1B B;  2XAQ A;  4WFH A;  5IY5 C;  3OR6 C;  1SRY A;  3T1C A;  1K34 A;  4BAY A;  3LSS A;  1M90 W;  2OT5 A;  2WSS G;  1FXK A;  1YSC A;  1P4R A;  4G2K A;  2DQ0 A;  2GSM B;  3BY6 A;  3SPI A;  3CCJ V;  4WFB V;  4X8A A;  2JEX A;  4HZ3 A;  5J9P C;  3ASO B;  4QJF B;  2DYR C;  1AI4 A;  4HAM A;  1P7B A;  1K97 A;  1I5Y A;  5B3S C;  4PA6 A;  3GB7 C;  4GX0 A;  3RBZ A;  4GCZ A;  4ASU G;  2QM7 A;  1VQM V;  2X0L A;  1OCZ B;  3CYO A;  1YTF B;  2B1G A;  3D3I A;  3ABL B;  4PDM A;  3WG7 B;  2AHY A;  4JYB A;  2M7W A;  4P9O A;  3FKS G;  1QR8 A;  3G4S V;  2ZR3 A;  2IJK A;  1RPO A;  1YI2 V;  1M56 C;  2EIK C;  2IH3 C;  1BL8 A;  3OUS A;  5B3S B;  3UKM A;  1JOY A;  2ZXW C;  3OEE G;  5HFL A;  2JDI G;  2QTO A;  4LC1 A;  1FXK B;  1M57 B;  1VQ4 V;  1R3L C;  3SYA A;  1KP2 A;  1KQS U;  3E83 A;  1THZ A;  2X6B A;  1QR9 A;  4WFA V;  3CCS V;  5H9C A;  1VQ5 V;  3MD0 A;  2BOC C;  4JAU A;  4TT3 G;  1DF5 A;  2X7R B;  3ABM B;  4Z1M G;  3JCZ A;  3DGE A;  2PI4 A;  3LDD A;  4RQF A;  4PDR A;  4QPJ A;  4FPP A;  3IFX A;  4UUJ C;  1N8R W;  1K73 W;  3ABU A;  2IJI A;  2IJH A;  2F43 G;  2R9R B;  3ETG A;  2DYS C;  3DTU B;  2H94 A;  4MVR A;  4QIW F;  2H8P C;  3FB7 C;  3I56 V;  5E1A C;  1WLE A;  3D36 A;  3W7W A;  3X2Q B;  2CK3 G;  5KA6 A;  3ZRX A;  3RVZ A;  2IJJ A;  1F4M A;  3CMA V;  3CPW U;  2DQ3 A;  4L87 A;  3K79 A;  1JVM A;  3M99 B;  1ENV A;  1FFT B;  3OGC C;  4JTC B;  3ZIA G;  2GHY A;  4QPK A;  4EKW A;  5CBH A;  3ZMT A;  1YJ9 V;  2W0F C;  1KC8 W;  4UXN A;  1GK9 A;  3ZRW B;  1PKX A;  3X2Q C;  4XDJ A;  4DO2 A;  1HWY A;  1QLE B;  5LGN A;  2DWE C;  1NQT A;  2QM8 A;  1FXH A;  1NJI W;  1FXK C;  2B5U A;  2DW4 A;  3SPH A;  2Z5U A;  3ZCC A;  5B1A B;  3AG2 B;  5LHH A;  3CCQ V;  4MTO A;  2EIJ B;  4P30 A;  3K06 A;  2HR3 A;  2Q68 A;  1K5Q A;  2C2A A;  3SJQ C;  1OCC C;  1K92 A;  2ATK C;  2XAG A;  1DLB A;  4PA3 A;  1NBM G;  1W0K G;  1G4Y B;  1K3E A;  5HFM A;  1BHA A;  5IYB O;  1UJW B;  1JJ2 U;  3OMN B;  4MVM A;  2WAM A;  1WPX A;  5H6R A;  4UV9 A;  1PL0 A;  2EIJ C;  1TUE B;  3UM7 A;  3W7S A;  1YHQ V;  1R3I C;  5EK0 A;  2P90 A;  3WG7 C;  3A0R A;  2BOB C;  3STL C;  2AHZ A;  3E8B A;  2ZXW B;  3ASN C;  1Q7Y W;  4PA7 A;  3OMA B;  3LUT B;  1VQK V;  4FMT A;  4I9W A;  1F51 A;  3TET A;  4QE7 A;  2WLL B;  4R8C A;  1V54 C;  1BHB A;  1VQL V;  3E8G A;  1R6K A;  3F7V C;  2EJR A;  4YXW G;  3ASN B;  3FB8 C;  5LHI A;  1Q86 W;  4RQE A;  4MTX A;  4UVB A;  2HKO A;  2X6A A;  2IH1 C;  3SYO A;  5LHG A;  4UVA A;  1Y66 A;  1Y4M A;  1PNK A;  3K0D A;  4JTD B;  4WF9 V;  3I55 V;  3K08 A;  4XBF A;  5B1N A;  3HPL C;  1OCZ C;  1XL4 A;  3W7T A;  4N21 A;  4PDV A;  1NR7 A;  3CC4 V;  1GM9 A;  1FS0 G;  2DYR B;  3OE7 G;  4LBE C;  3VOU A;  2XND G;  1S77 D;  1H2G A;  2EZP A;  3F7Y C;  3E8H A;  1V55 C;  2WLN A;  3MHS C;  2P6J A;  2V1D A;  1SZT A;  3R65 A;  5CA3 A;  1OHH G;  3SYC A;  4I5S A;  1COW G;  2Q6A A;  5B1B C;  2EIN B;  2A0L A;  1AJQ A;  1FXV A;  4TSF G;  2KB1 A;  3TCU A;  2ITD C;  1S72 V;  2IW5 A;  1GO3 F;  1S5H C;  4P9P A;  1MOF A;  1SET A;  4F4L A;  3ZMV A;  1RPR A;  2Q67 A;  3AG3 B;  1K33 A;  1NH2 B;  2W6J G;  1GM8 A;  1YIT V;  3K03 A;  3CME V;  3BEH A;  3E2E A;  1GMG A;  2P67 A;  4HYO A;  3SPC A;  5EBM C;  3CCM V;  1KP3 A;  2PI5 A;  2IU0 A;  1OCO C;  3JD4 A;  3B8M A;  4WFE A;  3ZMZ A;  4J9Z B;  2OTL V;  1ARO P;  3ABK B;  3SPG A;  3P30 A;  1VQP V;  1GTO A;  3ZRS A;  2XAH A;  4R50 A;  1V54 B;  2R9I A;  2WLK A;  3NXS A;  5L3C A;  1M56 B;  1MG1 A;  1LNQ A;  1PNL A;  4GX1 A;  1E1R G;  1GM7 A;  3IC7 A;  4PEL A;  3ML0 A;  2WLM A;  1S3J A;  4FIP C;  3ETE A;  4GX2 A;  4MVU A;  1KD1 W;  2YSU B;  2X6C A;  4QNH B;  1K4D C;  5FL7 G;  3G71 V;  2D3O W;  1I5X A;  5KA5 A;  1NVP D;  1OCR C;  2LP7 A;  1YJW V;  2UXX A;  3RVY A;  1R3J C;  4R6Z A;  1NVP B;  1QVG U;  5BZB A;  1H38 A;  1AJP A;  3E86 A;  1AI6 A;  2A9H A;  1RM1 B;  4ZBM A;  4JGS A;  1V55 B;  3T4Z A;  1M57 C;  2FTK A;  2WPD G;  1SER A;  5LGT A;  2NLJ C;  3K3W A;  4BIU A;  2XAF A;  1DTO A;  3CXC U;  3IGA C;  3W7U A;  5B1O A;  1K8A W;  5L3B A;  1OCR B;  4MVO A;  4JAV A;  1E79 G;  3ZMS A;  1YTF D;  2DWD C;  3QNE A;  2V7Q G;  3QO5 A;  3CCE V;  2A79 B;  4XDK A;  1MAB G;  3AG1 C;  3TK1 A;  2QKS A;  4Q20 A;  1NKD A;  1EFR G;  4U7O A;  4CBC A;  1VQ6 V;  3SYQ A;  4WFG A;  4MW3 A;  5EBL C;  4N23 A;  3P32 A;  1JPX A;  1PD3 A;  4G27 B;  1OZ0 A;  5IYC O;  3FB5 C;  3ZRW A;  3T2M A;  1E1Q G;  3K04 A;  2ZD9 A;  3OM3 B;  4CZZ A;  3ASO C;  2JJ1 G;  4WFF A;  5DM6 V;  3ZMU A;  2OCC B;  2QA4 V;  1VQ7 V;  5C93 A;  1B6Q A;  3CC7 V;  4GX5 A;  2XAS A;  2OTJ V;  4GT1 A;  2EBO A;  1AI5 A;  4JPR A;  1KEC A;  4LP8 A;  4LCU C;  2JJ2 G;  4RO2 A;  4U7N A;  1ORQ C;  2WLJ A;  3E8F A;  4X88 A;  5IDJ A;  4PA4 A;  1GKF A;  5DN6 G;  1L1F A;  5LBQ A;  2WWW A;  4H33 A;  2K1E A;  1MSW D;  1NH2 D;  3LSQ A;  2EIL B;  3AG2 C;  4QE9 A;  4JTA B;  2ITC C;  3ZRV A;  5KUM A;  2XAJ A;  4UVC A;  1CP9 A;  1H8H G;  2HJF C;  5L3D A;  1YIJ V;  1S0V A;  3AEI A;  1W0J G;  1EBO A;  3KG2 A;  4PA9 A;  5KUK A;  1QLE C;  2EIL C;  4E2L A;  4BW5 A;  1S76 D;  3OW2 U;  3EHB B;  2QE7 G;  2UXN A;  4OXS A;  1VQN V;  4FK5 C;  3GWO A;  2HVJ C;  4G28 B;  1R73 A;  4MVQ A;  2EIK B;  3MHH C;  2YEV B;  2WLI A;  3H01 A;  3ZJZ A;  1W2B U;  4JYC A;  1AR1 B;  1JCH A;  1VQO V;  1M9N A;  3ETD A;  1K4C C;  3FB6 C;  2Q69 A;  3AG3 C;  4KFM A;  5GW7 A;  1QBZ A;  2P7T C;  5CBF A;  4DXW A;  3AG4 C;  3AG1 B;  4R7C A;  2LFS A;  1ZWI C;  1XL6 A;  4MT8 A;  3CCL V;  3W7X A;  2EIN C;  2JK5 C;  2LFR A;  3OUF A;  1AJN A;  4MW8 A;  4MVS A;  4MTF A;  2Y69 C;  3JYC A;  5IYD O;  5EC2 C;  1YJN V;  2NNU A;  4X89 A;  5H6Q A;  1KKD A;  3CP1 A;  2WLH A;  4XDL A;  3OAA G;  4MVZ A;  3SYP A;  1R6N A;  3ABM C;  1QVF U;  4KP4 A;  3E35 A;  3G6E V;  3K0G A;  4RAI A;  2JIZ G;  4TWK A;  4KUM A;  4JF3 A;  3JD1 A;  5CN0 A;  3QO7 A;  2Z3Y A;  2WLI B;  2WLL A;  5B1A C;  4UV8 A;  1K5S A;  3LNM B;  1K7D A;  4MS2 A;  5EC1 C;  3CC2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...