1DF4A

Interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
57
Chain Sequence
b'IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAGGWMEWDREINNYTSLIHSLIEESQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 24
structure length 57
sequence length 62
ec nomenclature
pdb deposition date 1999-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1df4A00
3B8NA 3K9AA 4FIPC 4FJCC 1MOFA 3WFVA 4E2LA 5H9CA 4N23A 1I5YA 1ENVA 1QR8A 1I5XA 1JPXA 1MG1A 1DF4A 3P30A 4JGSA 3GWOA 5KA5A 2MK3A 1K33A 4JPRA 4G2KA 1JQ0A 1QR9A 1K34A 1Y4MA 3CYOA 4JF3A 1EBOA 5KA6A 2EZPA 5CMUA 2P6JA 1Y66A 2M7WA 5HFLA 3B8MA 1SZTA 1DF5A 3M99B 2LP7A 1QBZA 2EBOA 3B77A 3H01A 4FK5C 4N21A 3MHHC 5CN0A 5HFMA 2X7RB 3CP1A 1F23A 2EZOA 1DLBA 2OT5A 3MHSC 1QCEA
chains in the Genus database with same CATH superfamily
5KMGA 1YSCA 5EBWC 4OPAA 4B3MO 2A79B 2R70A 4UV8A 3G4SV 2UXBO 4RUFA 2DYRB 3K59A 2W0FC 4RAIA 2V1DA 1AVMA 1H38A 4E2LA 1I94B 2UUAB 1MZEA 3CCRV 1CXZB 4DUZB 2CGNA 2AZ0A 3CC4V 4WBNA 1XMOB 3CCMV 1KP3A 2GHYA 3BA9A 3UQ8A 3SPIA 2VQEB 2CUGA 2EIKB 1N32B 1OHHG 2XAJA 5KHHA 3LDDA 2RCVA 3K3WA 3N27A 1N36B 4BAYA 3SJAC 4I50A 4DR2O 1PV0A 1W0JG 1YTFD 4YJ2A 5EBMC 3OUFA 4U7NA 3TXSA 1ZX3A 2UUBB 4WFAV 3QTCA 4AQYO 3FB7C 4JI2B 3F5TA 3OW2U 4CS4A 2YXLA 4W4KA 1VF6A 2QJ1A 1FXKB 1JJ2U 4QNHB 4OX9B 5LXTB 1XNQO 1IXBA 2H3OA 1QCEA 3G6EV 1V54B 5IJ9A 4LFCO 4UV9A 1K92A 2YXYA 3JASB 3OEEG 3K03A 4PDVA 4R6ZA 1I7FA 4B3TO 4K3AA 3CJHA 5C8YA 4CH3A 4LP8A 1QBZA 3ZMSA 4LF6B 2QM4A 3HKBA 1S76D 1XBLA 1GH6A 1XNRB 3IAYA 1Q8IA 2EJRA 1KD1W 2IU0A 4WFGA 5CB4B 4DR6B 4JF3A 3CRQA 3KCXA 1P49A 1VQ4V 2OYQA 3CHXA 4PDRA 4LF4B 1G6UA 4I7ZB 4JTDB 4QJFB 2UXCO 1VQKV 2ARHA 3QNEA 2ZKOA 3CD6V 2P4KA 2JGUA 1SA0A 1Y76B 2DN9A 1BMFG 4IIJA 4QE7A 4GLXA 3SYQA 3TK1A 3IFXA 3OM3B 4LF9B 2HHHB 1WA8B 5B1BC 3PJSK 4CBCA 3K0GA 3SPJA 2E76B 5D5PA 4DR7B 4NTWA 1URFA 3C3TA 5B1BB 1MOFA 1DTOA 1XMQO 4NXMB 2IW5A 5BR8O 2JDIG 1Q6UA 2BE3A 1Q90D 4GT1A 3UCSC 4BIOA 4WF9V 3ETEA 1JQ0A 1R3KC 2YIBA 4MW3A 3NXSA 4O2AB 4X20A 2UXCB 1RPRA 1RSOA 5E79Z 3FYEB 3D3IA 2WLKA 5IDJA 3I56V 3FKSG 4O4JA 4CH4A 2QSAA 3KKYA 2ZM6O 1K4DC 4X1IB 3E8GA 2AHYA 3E86A 1PNMA 4FLXA 3RYHB 3A0RA 3BVOA 4KFMA 2DWDC 1VF7A 4X62B 3H1JH 3W7SA 1XMQB 5J2UA 2GBOA 5KHKA 1YZBA 2UUCB 2LGWA 1HNXB 2RNBA 2D3OW 4IHJB 1M56C 2JK5C 4LC1A 3A8TA 4N21A 4DXWA 1M93A 4U3JA 3UM7A 1F51A 3ZN1A 3E8FA 3ZRXA 3E8BA 1M56B 5FPRA 5H9CA 1YDXA 4X64O 5B3SC 3AG4B 4JI1O 4DR1B 4TQDA 2N04A 1V55C 2R9AA 4XBFA 5GTIZ 3TGUH 5IYBO 4UCRA 2DMXA 1VQPV 5B3SB 4BIUA 2F66C 3RYIA 2ITCC 1EN4A 5CN0A 1Y67A 4LH7A 2X6BA 3ZIAG 1DLBA 2GTSA 4GCZA 3CCSV 4YJ2B 2HR3A 4YHHO 4MT8A 5GONA 4LFBB 1VF6C 3P3NA 1G1XB 4NXNB 2GSMB 4GKJO 3SDLA 5JH7B 2R72A 3F5WC 4KHPO 3APQA 2OCCB 1AI5A 3CS5A 2O57A 3SJBC 4PHZA 2UXDO 4JI8O 4B7EA 3BABA 3RWRD 3S3WA 3OMNB 4PI2A 4JI3O 5IJ9B 5ITZB 4UCTA 2Z3YA 2KKWA 4K8ZA 3CCQV 3A2FA 2WA3A 3B09A 3HKBB 2RDCA 2ZIOA 1GRJA 1AB3A 4YY3O 1BS3A 5DECA 3ABLC 2C2AA 5EC1C 4QE9A 3L73H 3U11A 5IY5C 2YS8A 5AG2A 2WLIA 1AP6A 1KQSU 4B3SO 3AG1C 3ABLB 1HNWB 3K5NA 2EILC 5L3GA 5IY5B 3ZHRA 3CMAV 4X88A 3AG1B 1Z2GA 4BW9A 4JAAA 4WFEA 1WPBA 1GTOA 5EK0A 3B2EE 3BRCA 3K0DA 2UU9O 1H2KA 1KC8W 5L3FA 1KU9A 1KB9F 4DR3B 4JI3B 3CCJV 4HAMA 1K4CC 4LH6A 1E1RG 3K06A 3P30A 3ZMTA 1IVSA 4UFZA 1Q82W 1FXVA 2YSUB 1R3JC 4HYOA 1M9NA 4OXSA 2RN9A 1N4CA 1N0NA 3OFNG 2JJ2G 1AILA 3HKDA 4FZ0A 3TXQA 1LR1A 1NH2B 3L9DA 4X1YA 3AG2C 2FB5A 4NYKA 2YIBD 1NVPD 2VQFB 4X20B 5KUKA 4DV6O 2N05A 4ZOLB 2ZCEA 3RFRA 1E1QG 4BR6A 4K8XA 4P30A 3AG2B 3ETDA 4DK1A 2QKSA 1Q5OA 1Z5WA 3JD0A 2HP8A 4PJ0Z 1IBLO 4H13B 3WG7C 3K5OA 3CSXA 5EZYB 3OAAG 3BA8A 2DJVA 1OCOC 4Z1VA 3E83A 5CA3A 1AR5A 3N2GB 3WG7B 4FZ1A 2R9RB 4EB6A 4UVCA 3T1HB 2OWOA 3JALA 2PY5A 3BCCH 3H1KH 4LCUC 4KL1A 2BOCC 4BIZA 4FM2A 4YJ3B 5J2UB 1YCIA 4TT3G 4DK0A 1FXKA 2L35A 1CPYA 2VWKA 1SQQH 1QR8A 4JI7O 3JAKB 1K9MW 2ZR2A 1YF2A 4LF5O 4FLTA 2CDYA 1HNZO 4QGPA 2B1GA 2MW2B 4DV6B 3ZS8C 3JASA 1YXBA 2LP7A 1AR1B 4H33A 1IX9A 3TCUA 1JOYA 1P7BA 3L74H 2CTQA 4H44B 3JSNA 4CS3A 1THZA 2IJHA 1N0JA 3RBZA 4XDKA 4J7KA 2YIDA 3D3QA 1D5NA 3TJTA 2EINC 4I5SA 5CBFA 3SPHA 4Q20A 4NVPA 2E74B 1VQ7V 3LDCA 1BL8A 2EINB 3APOA 3J7AU 1TVKA 2E5LO 1K97A 4JI7B 5B1OA 2YEVB 1DGSA 1HNZB 2Y0PA 1Y76A 1M90W 3K57A 2E3CA 2WLNA 2Q9LA 4F6RB 3SR2C 2JVDA 2OIGA 1VQ8V 4U3FH 2P67A 1WA8A 3CMEV 3GVMA 1ZL8A 2Y0IA 1WP8A 3T1YO 4QPKA 2EJ7A 3AEIA 2NN4A 1Q86W 1E79G 3OR6C 5H6RA 4PELA 3M8AA 5KAFZ 2DW4A 1G8MA 5LMNB 4IGGA 4WCEV 2QA4V 2EX3A 3JATA 1PNLA 2AGAA 3VQVA 1OCRC 2H8PC 3G71V 3E2EA 1MSWD 4RO2A 1GM7A 1AI7A 1RM1B 3WB0A 3CWBH 2DQ0A 2QKAA 2NLJC 5KHIA 4DUZO 5LMUB 1S3JA 1XMOO 3JYCA 3QG5A 1SZTA 1I08A 2QTOA 3JCUZ 1N32O 1AI6A 4X1IA 3QF7A 2A06H 4X1KB 4A5UB 3H1LH 3OGCC 1N36O 1AJNA 1XDCA 4J42A 4DUYO 3RYHA 5KX5B 2DYRC 3TETA 3OEHG 2FL4A 2UUBO 4JI2O 3B8MA 5K1XA 3ZJZA 1JJOA 4FK5C 3HKDB 2Q8VA 4J41A 2FKXA 4IHJA 3DTUB 4OX9O 2KG7B 4X1YB 2E75B 1XILA 4JYAB 3LDEA 3ML0A 2LW1A 4NKGB 1Q6IA 2QR4A 1NKDA 2ZE7A 2IH3C 1NI8A 5LBQA 4Z2WA 1JFFB 3BEHA 3SYCA 1SERA 4I4TB 3E22A 2EIKC 4DV4B 1TA8A 3U0ZA 1TUEB 2YUAA 4Z1MG 3CRMA 4LF6O 1AROP 5IE9A 1XNRO 4NTXA 5L3DA 3KZIZ 1ENVA 4EB6B 1S5HC 2WLJA 3ZHTA 1GN6A 2PGGA 3FYIB 5B1AB 3SYOA 3IC7A 4DUYB 1MG1A 2K1EA 2ZE8A 4DV0O 1L8DA 1XOUA 3JALB 4DR6O 2RQ6A 4G28B 4I9QA 1YEWA 1P7GA 1N33B 1FXKC 3R65A 4LF4O 4P2ZA 1M4UA 4PA9A 2WSSG 4H0LB 5JH7A 5TISZ 3BAAA 1GN2A 2X7RB 1A32A 4RUEA 4B3RB 4DV5B 4EKWA 1YTFB 4TUYB 1V54C 4IL6Z 1PKXA 2JRIA 1FKAO 1VQMV 1TUBA 2OTJV 4GZRB 3FB8C 3T2MA 3ZEDA 2AW9A 3C90A 5BY1A 3ICXA 5ITZA 1NQTA 3F7YC 3N2KB 2AXTZ 3DSQA 4LF9O 2HHHO 4NTYA 3RGBA 5EC2C 3ASOB 2GUZA 1NU1H 4E4EA 2ZXWC 4DR7O 3X2QC 1X4TA 4LNUA 4NXMO 2GV9A 2UXXA 2ZXWB 2EULA 4JI0B 3X2QB 4DV0B 2Q67A 2HVKC 1PL0A 1BGYH 2YC0A 4GKKO 1YITV 4J10A 2X6AA 4DV3O 4QIWF 1T5EA 1TVKB 2ZQMA 4UB6Z 4X8AA 4FJCC 2VWJA 1K3EA 4MVMA 4D7TA 3VQWA 1VP7A 4D7SA 4AHCA 3L72H 3UO3A 4ZHQA 5GW7A 3AK3A 1HP8A 5HFLA 5K1PA 1ZL8B 1YJWV 2YI9A 2OIEA 1QQCA 5LHHA 1GAXA 2BTOA 1X59A 2F43G 4GX1A 4X62O 1ZUQA 5LGUA 3HPLC 1EM1A 3FB5C 3WB1A 2UUCO 3ABTA 3JATB 2A3QA 5LOVA 1HNXO 5F2VO 2Y69B 4LR3A 1GKFA 3CRCA 4GKKB 5BZBA 5LA6A 3OD4A 5KAIZ 2W6IG 1N8RW 4ZOLA 4R7CA 2PI5A 1S5LZ 4DV3B 1BHBA 2DYSC 1CP9A 4UVAA 1SF9A 5CA0A 2DYSB 5EZYA 3F7VC 4G27B 5L3BA 4DR1O 4UCUA 1MZFA 1SQXH 3N2GA 3OMAB 1XI1A 1UFIA 3G6BA 1OV9A 2W6JG 1MSDA 2CTWA 4PA4A 1Y6XA 3Q4HA 2LQTA 2OT5A 3CRRA 1HDJA 1EN6A 1SESA 4LFBO 4YJ3A 3QO7A 1JX9A 2P06A 3FB6C 1TGOA 4JTAB 4NXNO 1FFXB 1SS3A 2ETNA 4CH5A 1SC5B 3JAKA 4GX5A 3K79A 3K5MA 4GX0A 5CA1B 2Z5UA 1VQ9V 3E8HA 2ODMA 1F23A 5DM6V 4JAVA 3SJCC 5CBGA 4L8JA 2HJDA 3A0HZ 4HBNA 1R73A 3AG4C 5LYJA 2XAFA 3IC9A 1PM9A 5KA5A 3E22B 1R1BA 4JYYA 3H1IH 1QU7A 2WAMA 1PD3A 1K5SA 2K9PA 3FAVA 4RQFA 3AG7A 1M1KW 4FLUA 2PTMA 1GM9A 1FXHA 3ZBHA 5A2QN 1SQGA 2WPDG 1KP2A 2LO1A 4B7KA 1HNWO 3JD1A 4WFHA 2OCCC 3H1HH 2ZINA 3EFFK 1YVWA 4MVZA 1RFYA 4K35A 2Q69A 5IYZA 2YEVA 2V4DA 4R8CA 1TUBB 3G80A 1PNKA 1WB8A 2BSKA 4DR3O 4F6RA 4JV5B 4IYHA 1M57B 2M6YA 3ABMB 5IYCO 2QM7A 2P5OA 2VRZA 3JAMN 2QWQB 2QWOB 2GUZB 4QPJA 4XDJA 3OTOB 2Q73A 2FMLA 3M99B 4LNUB 1IBMB 1MNGA 2QE7G 1O9HA 2P7TC 2HEPA 3JD4A 1W0KG 3IJ4A 1FPOA 1EZJA 2XASA 4F4LA 4X66B 4OGQB 1J5EB 1KECA 2ZE6A 1WAZA 1JR9A 1QR9A 1XHXA 2VQFO 4ZKIA 3HR0A 4EFBA 1UJWB 2B5UA 2XT9A 1VQ6V 3IGAC 2CAZC 3UT5B 4PA6A 4CC5A 1WP7A 4UCVA 2CH7B 1NTZH 3DC5A 2ZR3A 1FYJA 4GUNA 4J11A 5FNVB 2YIAA 1K7DA 5B66Z 4XDLA 4JI4B 3JARB 2ZD9A 4ICGA 4ZHQB 4X1KA 2FYUH 3MDSA 1IBKO 1H8HG 2JIZG 2LFSA 2QWPB 5KA6A 5KX5A 2EIMC 3T1HO 2P4VA 4LF8B 1PP9H 5KLVH 1P4RA 3B4SA 3THOA 1FS0G 3JAWB 2EIMB 1VQLV 4UCSA 4TV9B 5LOVB 2KG7A 3WU2Z 3QO5A 2PYJA 1NH2D 1YJ9V 5L3CA 5LA6B 3OGIB 3O9OA 3ASNB 1DF5A 2XTAA 1JFFA 1JCHA 1NJIW 1YIJV 1GN4A 4I4TA 4JASA 5CA0B 4CH6A 4I9WA 3L75H 5EBLC 1OZ0A 1Y74B 1BHAA 1SZXA 2L6LA 1SETA 1H2SB 1IBKB 1FAFA 5EIBC 2EZPA 3AG3C 3Q4HB 3CE2A 1ZLZA 3RYFB 4PV1B 2KQXA 2Q5ZA 3AG3B 4PI0A 3SPGA 1B6QA 3K5LA 5EIBD 1KUQA 1WJZA 2ZNJA 1IZ3A 4TUYA 2JS5A 1FD9A 4UVBA 3OE7G 1L0NH 1NS1A 2IH1C 4IYIA 1ORQC 1R3IC 2P22C 3N2KA 4KUMA 1DK1A 4NB5A 2UXNA 2QM8A 5LYJB 3T4ZA 1Q6HA 3LSSA 4JI6B 5B1NA 4JI5B 4DV7O 3ZHUA 1LNQA 1SQBH 3FAVB 2V7QG 1W2BU 5EYPB 4ASUG 1LUWA 2RMKB 5LMNO 5H5NA 2HLDG 1WLEA 2YXHA 1FJGO 1AR4A 1VMGA 2HJFC 2KB1A 4F6EA 2ZE5A 4N23A 4LF7B 4YIOA 2MK3A 5IYZB 2JEXA 3VOUA 4FLVA 4MVUA 5LMUO 4LFAB 5CMUA 1MA1A 2D2CB 3DGEA 2JGDA 4J9YB 3L70H 1F7YA 2BSKB 4O4HB 2Q0OC 1XL4A 2EZOA 1R6KA 4WFFA 3BPZA 3WB2A 2WLMA 2ZNIA 4DV7B 4H37A 3ZRVA 4X89A 3KG2A 4O2BA 3W7WA 2ZIMA 4DR5B 5JJNB 2XHBA 2P6JA 5LP6A 2Q7GA 3LNNA 1FJGB 5IYDO 3ETQA 1RM1C 4CZZA 5HFMA 3UKMA 1N34B 1HR0B 2CK3G 1GO3F 2LW7A 3RN4A 2Y4TA 3LNMB 1K5QA 4DYLA 1SQFA 4JYAO 2F23A 2N74A 2PI4A 4JGSA 3T4DA 1H2MA 1BSMA 5J2TA 2H94A 4DV4O 4B08A 1B04A 3DXRA 5KUMA 3UO2A 4DW0A 1JA8A 4TOIA 2Q0AA 3HKEA 5BMVB 4DR4B 2HG5C 4AILC 4FM0A 1N33O 2IJJA 2YI8A 3RT3C 2ZT9B 3VQYA 4JTCB 1FFXA 1Q81W 3SGIA 1H2GA 3W7UA 4B3RO 4DV5O 4MTGA 4DV1B 4FFBA 5CA1A 4FLYA 4O4IB 3B40A 1XUQA 4CS2A 3QVNA 5JQGB 5JVDA 1R3LC 2B1IA 1XL6A 4DV2B 1L0LH 4ZI7A 4O4LB 1VIBA 2EBOA 2QWRB 3CP1A 1U97A 5B1AC 3T1CA 4KXRA 3J80N 1D2DA 1Q7YW 3HKCB 1H2NA 4JI0O 3ABUA 1Y4MA 5LGTA 1D5AA 3LSUA 1JMKC 4NR1A 2B9ZA 4C7UA 1NT2B 2HKOA 1ZWIC 1H8EG 4FIPC 3ZRSA 1EN5A 4B3MB 1WPXA 3ZX6A 4MW8A 1Q43A 2HVJC 1ZTEA 3ASOC 2OCHA 4JZGA 2UXBB 3CEIA 3VQXA 3E35A 2FTKA 4BW5A 2LJ2A 4J9ZB 2AZ2A 1GM8A 2CTPA 3OTFA 2PF4E 2JEUA 4GX2A 1K73W 1H2LA 2BTQB 2XAGA 3ZMUA 5GTHZ 1Z5VA 1KKDA 2WLLA 3D8CA 3QO8A 1V9PA 4K0KO 4DO2A 2DQ3A 2LGQA 2EIJC 3C3SA 3ETGA 1BQ0A 1OCCC 1NBMG 2VS0A 3UT5A 2KSDA 2EIJB 2F4VO 2CH7A 1OCCB 4DR2B 1MABG 1JVMA 5FNVA 2A9HA 4JPRA 4G2KA 2JGDB 3CCLV 3JARA 4AQYB 5IT9N 3AK1A 3RVZA 4HZ3A 4TV8B 3RYCB 1NZ6A 3OR7C 1CEZA 3H9VA 1XNQB 3MHSC 5LP6C 2DOSA 3BFRA 4O2BB 3JAWA 1JPXA 1S5JA 1SQPH 4LFCB 4CC6A 3MD0A 1QHTA 1UPGA 1WN7A 2Y69C 4IT5A 5LP6B 4TV9A 1R6TA 4B3TB 1BE3H 3AK2A 2PYLA 4K0KB 3SYAA 2Q6AA 4TQFA 5A9GA 1AI4A 3STZC 3D36A 2ILMA 1QLNA 1XQ8A 4D6TH 4J7ZA 2F4VB 1I0HA 2X6CA 4DW1A 5IJ0A 1S77D 1ZSPA 3U10A 5J2TB 1B3QA 2LFRA 1EFRG 4PD4F 1J95A 1DF4A 4LWSB 1QNMA 1K33A 3VBBA 3DXRB 1Y74A 1KYOF 2QGNA 1IURA 1RPOA 1QVGU 3G67A 2ITDC 2RJZA 3HKEB 4ABMA 4JZ2A 3JSLA 1GMGA 5JJJB 5DN6G 5FL7G 3K9AA 3WFVA 1YHQV 1K8AW 3RYFA 4TSFG 1QVFU 5JJEB 1B06A 5IWAO 3P32A 4P9OA 3J81N 4MTXA 5KMGB 4FFBB 4JAUA 5JVDB 3I55V 4I0XA 2IM9A 5B5EZ 1IDSA 5BR8B 1VQ5V 4JYCA 1VARA 4JV5O 4ZI7B 5JCOA 4MVSA 4R50A 3JD3A 3OTOO 2NR5A 1YI2V 5EYPA 1IBMO 3OUSA 2Y48A 3ABKC 4X66O 2G38A 4WBNB 1J5EO 1S0VA 1SKVA 3ZHQA 3ABKB 2IBZH 3K58A 5IWAB 4GYCB 2ZM6B 4ZBMA 1EZVH 3GWKC 3RW0A 1V55B 1M57C 4I50B 2XAHA 4U7OA 3ABMC 1BT8A 1MMMA 4O4HA 2P90A 4JI4O 2CTRA 4MTFA 3ZCCA 1XREA 4P9PA 2Z0AA 3CB2A 4OPHA 1GN3A 2F93B 5FPOA 1BZKA 4W4LA 2M7WA 3BHPA 4LF8O 3P3PA 1U96A 3H01A 1VQOV 4MTOA 3CPWU 4RWUA 1G4YB 3RVYA 2QEXV 3W7TA 2WLLB 1BQZA 2X0LA 4I55A 1VF5B 2JS3A 4X64B 3CJHB 4DRXA 5C8YB 3L71H 1M5IA 3CYOA 4JI1B 2Y4UA 3CRAA 2GTAA 3HB3B 3ZRWA 1QLEC 1RP3B 1FFTB 4FLZA 1SRYA 4YHHB 1QLEB 4J80A 1NTKH 2CGOA 2A0LA 1NR1A 3ZMZA 3FD9A 5BMVA 4GKJB 5E1AC 2XNDG 3CXCU 1TAEA 4KHPB 1HWYA 2EILB 1BCCH 3STLC 3PN1A 4PDLA 1SQVH 4HNAA 3CX5F 5D5QA 4JI8B 2UXDB 3EHBB 1SA0B 5LHGA 4IIJB 3DC6A 2WA4A 4MS2A 3CCVV 3GB7C 3D36C 1ZAUA 1IXMA 4O4IA 3FX7A 4L87A 4FLWA 3ASNC 5JQGA 4BWAA 2W0XA 5KHGA 1US6A 2ZDIA 4FPPA 3LSQA 2Q4PA 3ZHVA 2CE4A 5L3EA 3B77A 4O4LA 1KKCA 4MVRA 4YY3B 3CCEV 4RQEA 4AI8A 5IJ0B 2QKCA 4UXNA 4JI6O 4MVQA 3FFQA 4B3SB 4LBEC 1YJNV 1NVPB 4JI5O 2XOKG 4MVOA 2F1MA 3JCZA 3CC2V 2IU3A 1WB7A 2DWEC 3HKCA 4X65O 3KCYA 1R6NA 1P84F 3OMIB 2JJ1G 2PUSA 1RSOB 3CXHF 3MHHC 2Q68A 2YDEA 2UU9B 4PA3A 3I5DA 3CC7V 3CCUV 5KHJA 4O4JB 3JD2A 4LF7O 1L1FA 1O9GA 1OJHA 1KMIZ 3ZHSA 5LL6Y 1OCOB 1EBOA 4LFAO 1F4MA 5JCOC 2ADQB 4I0XB 2QTSA 5LHIA 5LGNA 1Q3EA 4WFBV 3MAQA 5LXTA 4UCOA 3K9SA 2BTQA 4DR5O 4U3JB 1AJPA 4FM1A 4X65B 4JYBA 1W59A 2QWNB 3EVKA 1HW7A 4FVMA 4EEQA 3M7MX 3S3XA 1IBLB 1F4NA 1N34O 1HR0O 4PA7A 5C93A 1ROPA 1XEQA 2NNUA 4X9QA 2ADPA 1VEWA 5H6QA 5BXZA 5J9PC 1KBHA 2WLHA 1COWG 2Q7EA 3RYIB 2YICA 5CB4A 1Y66A 4MSWC 3ZN0A 1VQNV 3SJQC 1AP5A 5GONB 5FLXN 4TV8A 3RYCA 1PPJH 3EXAA 3B8NA 2GDSA 1GK9A 3NR7A 4DR4O 4Q6GA 2Q7HA 3BY6A 4YIPA 4LF5B 1AJQA 1NR7A 3GWOA 2QDOA 4UUJC 3A0BZ 3SPCA 3W7XA 2OTLV 3SYPA 3K08A 4I55B 1XHZA 3K04A 2PZSA 3OT7A 4DV1O 4DRXB 3E89A 4EFEA 5H2FZ 4DV2O 2IJKA 1LUVA 3ZRWB 1WNSA 2AHZA 2BOBC 4LWSA 2IJIA 1NTMH 2XAQA 3O65A 2ATKC 2WLIB 1S72V 4PDMA 3ZMVA 4FMTA 4O2AA 4ZIBA 4J7JA 4TWKA 1I94O 2UUAO 4UB8Z 2HFEC 1I5YA 2A7WA 1OCRB 2XUMA 1I5XA 2BCCH 5JWPA 2E5LB 4YXWG 1K34A 1OCZC 2DE0X 4HNAB 2F95B 1PL4A 3R66A 5DEDA 4KP4A 2VQEO 2WWWA 1OCZB 3LUTB 2R9IA 5CBHA 4FFKA 3T1YB 2ZDIC
chains in the Genus database with same CATH topology
4TT3G 1FXKA 1M57B 1YSCA 1CPYA 5EBWC 1QR8A 3ABMB 1JPXA 2A79B 5IYCO 1K9MW 2ZR2A 2QM7A 3MD0A 2Y69C 4UV8A 3G4SV 4QPJA 2B1GA 4XDJA 4RUFA 2DYRB 3SYAA 2Q6AA 3M99B 2LP7A 2W0FC 1AR1B 4H33A 1AI4A 3STZC 4RAIA 2V1DA 2QE7G 3TCUA 3D36A 1JOYA 1P7BA 1H38A 1QLNA 2P7TC 3JD4A 1W0KG 4E2LA 1EZJA 2X6CA 2XASA 4F4LA 1S77D 3CCRV 1THZA 2IJHA 1KECA 1EFRG 2LFRA 1J95A 1DF4A 1K33A 3VBBA 1QR9A 3RBZA 4XDKA 4ZKIA 3CC4V 3CCMV 1RPOA 1KP3A 1UJWB 2GHYA 2B5UA 1QVGU 1VQ6V 3IGAC 2ITDC 3SPIA 4PA6A 1GMGA 2EINC 4I5SA 5CBFA 2EIKB 2ZR3A 5DN6G 3SPHA 1OHHG 2XAJA 5FL7G 4Q20A 3LDDA 3K9AA 1K7DA 3K3WA 3WFVA 1VQ7V 3LDCA 1BL8A 4XDLA 1YHQV 1K8AW 2EINB 4BAYA 4TSFG 2ZD9A 1W0JG 1YTFD 1K97A 1QVFU 5EBMC 5B1OA 3OUFA 4U7NA 2YEVB 4WFAV 1H8HG 2JIZG 2LFSA 3P32A 4P9OA 5KA6A 3FB7C 4MTXA 1M90W 2EIMC 2WLNA 3OW2U 1P4RA 1VQ8V 1FXKB 2P67A 1FS0G 1JJ2U 3CMEV 2EIMB 4QNHB 4JAUA 3I55V 1VQLV 1QCEA 1VQ5V 4JYCA 3G6EV 4QPKA 1V54B 3AEIA 4MVSA 4R50A 4UV9A 1K92A 1Q86W 1E79G 3OR6C 3QO5A 5H6RA 3OEEG 3K03A 4PELA 4PDVA 1YJ9V 4R6ZA 1NH2D 5L3CA 2DW4A 1G8MA 3JD3A 4WCEV 4LP8A 2QA4V 1YI2V 3ASNB 1DF5A 1QBZA 3ZMSA 1PNLA 1S76D 1JCHA 1NJIW 1YIJV 1OCRC 2H8PC 2EJRA 3G71V 3E2EA 1MSWD 3OUSA 4RO2A 1KD1W 2IU0A 1GM7A 4JASA 4WFGA 1AI7A 1RM1B 4I9WA 2Y48A 3ABKC 5EBLC 1OZ0A 2DQ0A 1S0VA 1BHAA 2NLJC 1SETA 3ABKB 4JF3A 1VQ4V 4PDRA 2EZPA 1S3JA 3AG3C 4ZBMA 3JYCA 1SZTA 4JTDB 4QJFB 2QTOA 3RW0A 1V55B 1M57C 1AI6A 2XAHA 4U7OA 1VQKV 3QNEA 3ABMC 3AG3B 3SPGA 1B6QA 2P90A 3CD6V 3OGCC 1AJNA 4MTFA 3ZCCA 1BMFG 4P9PA 2DYRC 3TETA 4QE7A 3OEHG 4UVBA 3SYQA 3TK1A 3IFXA 3OE7G 3OM3B 2IH1C 1ORQC 1R3IC 2M7WA 3B8MA 5B1BC 3PJSK 4CBCA 4KUMA 3H01A 3ZJZA 1VQOV 4MTOA 4FK5C 3CPWU 3K0GA 3SPJA 2UXNA 3DTUB 1G4YB 2QM8A 3T4ZA 3RVYA 5B1BB 3LSSA 1MOFA 1DTOA 2QEXV 2IW5A 3W7TA 2JDIG 2WLLB 5B1NA 3LDEA 2X0LA 3ML0A 1LNQA 4GT1A 4WF9V 1NKDA 3ETEA 2IH3C 2V7QG 1JQ0A 1R3KC 3CYOA 1W2BU 5LBQA 4ASUG 3BEHA 4MW3A 3SYCA 1SERA 2EIKC 3NXSA 3HB3B 2HLDG 1WLEA 3ZRWA 1TUEB 2HJFC 2KB1A 1QLEC 4Z1MG 1FFTB 1AROP 1RPRA 5L3DA 1SRYA 1QLEB 3FYEB 4N23A 1ENVA 1S5HC 2WLJA 3D3IA 3FYIB 5B1AB 3SYOA 3IC7A 2A0LA 2WLKA 1MG1A 1NR1A 2K1EA 3ZMZA 2MK3A 5E1AC 5IDJA 3FKSG 3I56V 2XNDG 3CXCU 4G28B 2JEXA 3VOUA 4MVUA 1HWYA 1FXKC 2EILB 3R65A 4P2ZA 5CMUA 4PA9A 3STLC 1K4DC 2WSSG 3DGEA 4J9YB 4PDLA 3E8GA 2AHYA 2X7RB 3E86A 1PNMA 1XL4A 4RUEA 2EZOA 1R6KA 3EHBB 4EKWA 1YTFB 5LHGA 3A0RA 1V54C 4KFMA 1PKXA 2DWDC 4WFFA 3W7SA 1VQMV 2OTJV 2WLMA 3FB8C 3T2MA 4MS2A 3CCVV 3GB7C 4H37A 3ZRVA 4X89A 3KG2A 1IXMA 1NQTA 3F7YC 4L87A 3W7WA 3ASNC 2D3OW 2ZDIA 2P6JA 4FPPA 1M56C 2JK5C 5EC2C 3ASOB 3LSQA 4LC1A 5IYDO 4N21A 4DXWA 3B77A 4CZZA 5L3EA 3UM7A 5HFMA 3CCEV 4MVRA 3UKMA 1F51A 3ZN1A 4RQEA 2ZXWC 3E8FA 3ZRXA 3X2QC 3E8BA 1M56B 2CK3G 1GO3F 5H9CA 3LNMB 4UXNA 4MVQA 1K5QA 2UXXA 2ZXWB 4LBEC 1YJNV 3X2QB 1NVPB 2XOKG 4MVOA 2PI4A 3JCZA 4JGSA 3T4DA 2IU3A 5B3SC 3CC2V 2DWEC 2Q67A 2HVKC 3AG4B 1PL0A 2H94A 1V55C 4XBFA 1R6NA 5IYBO 1VQPV 5KUMA 5B3SB 4BIUA 3OMIB 2JJ1G 1YITV 2ITCC 3MHHC 5CN0A 2X6BA 3ZIAG 2Q68A 2X6AA 1DLBA 4QIWF 4PA3A 4GCZA 3CCSV 2ZQMA 2HR3A 3CC7V 4X8AA 3CCUV 4FJCC 4MT8A 3JD2A 1K3EA 2HG5C 4MVMA 1L1FA 2GSMB 2IJJA 1OCOB 1EBOA 3F5WC 5GW7A 1F4MA 2OCCB 4JTCB 5HFLA 1Q81W 1YJWV 1AI5A 1H2GA 5LHIA 3W7UA 5LHHA 5LGNA 4MTGA 3OMNB 2F43G 4GX1A 1RM1C 2Z3YA 4WFBV 3CCQV 1R3LC 5LGUA 2B1IA 1XL6A 3HPLC 3FB5C 3ABTA 1AJPA 4JYBA 2Y69B 1GKFA 5BZBA 2EBOA 2W6IG 1N8RW 3CP1A 3ABLC 4R7CA 2C2AA 1F4NA 2PI5A 5EC1C 4QE9A 4PA7A 5B1AC 1ROPA 3T1CA 5C93A 1BHBA 5IY5C 2DYSC 2NNUA 1CP9A 1Q7YW 2WLIA 1KQSU 4UVAA 3AG1C 3ABLB 2EILC 5H6QA 5J9PC 3ABUA 5L3GA 5IY5B 2DYSB 1Y4MA 2WLHA 1COWG 3F7VC 4G27B 5L3BA 3CMAV 4X88A 3AG1B 3OMAB 5LGTA 1Y66A 4WFEA 2W6JG 4MSWC 3ZN0A 1GTOA 5EK0A 4PA4A 2HKOA 1VQNV 3SJQC 3K0DA 1ZWIC 2OT5A 1KC8W 5L3FA 1H8EG 3B8NA 4FIPC 1GK9A 3ZRSA 3CCJV 4HAMA 1SESA 1WPXA 3QO7A 1JX9A 3BY6A 1K4CC 4MW8A 1AJQA 1NR7A 1E1RG 3FB6C 3K06A 3P30A 3GWOA 4JTAB 3ZMTA 2HVJC 1Q82W 3ASOC 1FXVA 4UUJC 2YSUB 1R3JC 4HYOA 3SPCA 4GX5A 1M9NA 3E35A 2FTKA 4OXSA 4BW5A 4J9ZB 1GM8A 3K79A 3W7XA 4GX0A 2Z5UA 2JEUA 1VQ9V 2OTLV 3E8HA 3SYPA 1F23A 3OFNG 3K08A 2JJ2G 5DM6V 4JAVA 3K04A 5CBGA 4GX2A 1R73A 3E89A 3AG4C 1K73W 1NH2B 2XAGA 3ZMUA 2XAFA 5KA5A 1KKDA 2IJKA 2WLLA 3QO8A 3AG2C 3ZRWB 2WAMA 1NVPD 2AHZA 1PD3A 1K5SA 5KUKA 4RQFA 2BOBC 1M1KW 4DO2A 2DQ3A 1E1QG 1GM9A 2IJIA 2XAQA 3AG2B 1FXHA 2EIJC 3ETDA 4P30A 3ETGA 2QKSA 1OCCC 1NBMG 2ATKC 2WLIB 1S72V 4PDMA 3JD0A 3ZMVA 4FMTA 3WG7C 4TWKA 2WPDG 1KP2A 2EIJB 2HFEC 3OAAG 1I5YA 1OCCB 1OCRB 1MABG 1OCOC 3E83A 1I5XA 1JVMA 5CA3A 3JD1A 3WG7B 4YXWG 2A9HA 4WFHA 2R9RB 4JPRA 2OCCC 4G2KA 4UVCA 1K34A 3CCLV 3EFFK 1OCZC 4MVZA 2Q69A 3RVZA 4HZ3A 2YEVA 4KP4A 2WWWA 3OR7C 4LCUC 1CEZA 1OCZB 4R8CA 3LUTB 2R9IA 2BOCC 4BIZA 5CBHA 1PNKA 3MHSC 2ZDIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8N A;  3K9A A;  4FIP C;  4FJC C;  1MOF A;  3WFV A;  4E2L A;  5H9C A;  4N23 A;  1I5Y A;  1ENV A;  1QR8 A;  1I5X A;  1JPX A;  1MG1 A;  1DF4 A;  3P30 A;  4JGS A;  3GWO A;  5KA5 A;  2MK3 A;  1K33 A;  4JPR A;  4G2K A;  1JQ0 A;  1QR9 A;  1K34 A;  1Y4M A;  3CYO A;  4JF3 A;  1EBO A;  5KA6 A;  2EZP A;  5CMU A;  2P6J A;  1Y66 A;  2M7W A;  5HFL A;  3B8M A;  1SZT A;  1DF5 A;  3M99 B;  2LP7 A;  1QBZ A;  2EBO A;  3B77 A;  3H01 A;  4FK5 C;  4N21 A;  3MHH C;  5CN0 A;  5HFM A;  2X7R B;  3CP1 A;  1F23 A;  2EZO A;  1DLB A;  2OT5 A;  3MHS C;  1QCE A; 
#chains in the Genus database with same CATH topology
 5KMG A;  1YSC A;  5EBW C;  4OPA A;  4B3M O;  2A79 B;  2R70 A;  4UV8 A;  3G4S V;  2UXB O;  4RUF A;  2DYR B;  3K59 A;  2W0F C;  4RAI A;  2V1D A;  1AVM A;  1H38 A;  4E2L A;  1I94 B;  2UUA B;  1MZE A;  3CCR V;  1CXZ B;  4DUZ B;  2CGN A;  2AZ0 A;  3CC4 V;  4WBN A;  1XMO B;  3CCM V;  1KP3 A;  2GHY A;  3BA9 A;  3UQ8 A;  3SPI A;  2VQE B;  2CUG A;  2EIK B;  1N32 B;  1OHH G;  2XAJ A;  5KHH A;  3LDD A;  2RCV A;  3K3W A;  3N27 A;  1N36 B;  4BAY A;  3SJA C;  4I50 A;  4DR2 O;  1PV0 A;  1W0J G;  1YTF D;  4YJ2 A;  5EBM C;  3OUF A;  4U7N A;  3TXS A;  1ZX3 A;  2UUB B;  4WFA V;  3QTC A;  4AQY O;  3FB7 C;  4JI2 B;  3F5T A;  3OW2 U;  4CS4 A;  2YXL A;  4W4K A;  1VF6 A;  2QJ1 A;  1FXK B;  1JJ2 U;  4QNH B;  4OX9 B;  5LXT B;  1XNQ O;  1IXB A;  2H3O A;  1QCE A;  3G6E V;  1V54 B;  5IJ9 A;  4LFC O;  4UV9 A;  1K92 A;  2YXY A;  3JAS B;  3OEE G;  3K03 A;  4PDV A;  4R6Z A;  1I7F A;  4B3T O;  4K3A A;  3CJH A;  5C8Y A;  4CH3 A;  4LP8 A;  1QBZ A;  3ZMS A;  4LF6 B;  2QM4 A;  3HKB A;  1S76 D;  1XBL A;  1GH6 A;  1XNR B;  3IAY A;  1Q8I A;  2EJR A;  1KD1 W;  2IU0 A;  4WFG A;  5CB4 B;  4DR6 B;  4JF3 A;  3CRQ A;  3KCX A;  1P49 A;  1VQ4 V;  2OYQ A;  3CHX A;  4PDR A;  4LF4 B;  1G6U A;  4I7Z B;  4JTD B;  4QJF B;  2UXC O;  1VQK V;  2ARH A;  3QNE A;  2ZKO A;  3CD6 V;  2P4K A;  2JGU A;  1SA0 A;  1Y76 B;  2DN9 A;  1BMF G;  4IIJ A;  4QE7 A;  4GLX A;  3SYQ A;  3TK1 A;  3IFX A;  3OM3 B;  4LF9 B;  2HHH B;  1WA8 B;  5B1B C;  3PJS K;  4CBC A;  3K0G A;  3SPJ A;  2E76 B;  5D5P A;  4DR7 B;  4NTW A;  1URF A;  3C3T A;  5B1B B;  1MOF A;  1DTO A;  1XMQ O;  4NXM B;  2IW5 A;  5BR8 O;  2JDI G;  1Q6U A;  2BE3 A;  1Q90 D;  4GT1 A;  3UCS C;  4BIO A;  4WF9 V;  3ETE A;  1JQ0 A;  1R3K C;  2YIB A;  4MW3 A;  3NXS A;  4O2A B;  4X20 A;  2UXC B;  1RPR A;  1RSO A;  5E79 Z;  3FYE B;  3D3I A;  2WLK A;  5IDJ A;  3I56 V;  3FKS G;  4O4J A;  4CH4 A;  2QSA A;  3KKY A;  2ZM6 O;  1K4D C;  4X1I B;  3E8G A;  2AHY A;  3E86 A;  1PNM A;  4FLX A;  3RYH B;  3A0R A;  3BVO A;  4KFM A;  2DWD C;  1VF7 A;  4X62 B;  3H1J H;  3W7S A;  1XMQ B;  5J2U A;  2GBO A;  5KHK A;  1YZB A;  2UUC B;  2LGW A;  1HNX B;  2RNB A;  2D3O W;  4IHJ B;  1M56 C;  2JK5 C;  4LC1 A;  3A8T A;  4N21 A;  4DXW A;  1M93 A;  4U3J A;  3UM7 A;  1F51 A;  3ZN1 A;  3E8F A;  3ZRX A;  3E8B A;  1M56 B;  5FPR A;  5H9C A;  1YDX A;  4X64 O;  5B3S C;  3AG4 B;  4JI1 O;  4DR1 B;  4TQD A;  2N04 A;  1V55 C;  2R9A A;  4XBF A;  5GTI Z;  3TGU H;  5IYB O;  4UCR A;  2DMX A;  1VQP V;  5B3S B;  4BIU A;  2F66 C;  3RYI A;  2ITC C;  1EN4 A;  5CN0 A;  1Y67 A;  4LH7 A;  2X6B A;  3ZIA G;  1DLB A;  2GTS A;  4GCZ A;  3CCS V;  4YJ2 B;  2HR3 A;  4YHH O;  4MT8 A;  5GON A;  4LFB B;  1VF6 C;  3P3N A;  1G1X B;  4NXN B;  2GSM B;  4GKJ O;  3SDL A;  5JH7 B;  2R72 A;  3F5W C;  4KHP O;  3APQ A;  2OCC B;  1AI5 A;  3CS5 A;  2O57 A;  3SJB C;  4PHZ A;  2UXD O;  4JI8 O;  4B7E A;  3BAB A;  3RWR D;  3S3W A;  3OMN B;  4PI2 A;  4JI3 O;  5IJ9 B;  5ITZ B;  4UCT A;  2Z3Y A;  2KKW A;  4K8Z A;  3CCQ V;  3A2F A;  2WA3 A;  3B09 A;  3HKB B;  2RDC A;  2ZIO A;  1GRJ A;  1AB3 A;  4YY3 O;  1BS3 A;  5DEC A;  3ABL C;  2C2A A;  5EC1 C;  4QE9 A;  3L73 H;  3U11 A;  5IY5 C;  2YS8 A;  5AG2 A;  2WLI A;  1AP6 A;  1KQS U;  4B3S O;  3AG1 C;  3ABL B;  1HNW B;  3K5N A;  2EIL C;  5L3G A;  5IY5 B;  3ZHR A;  3CMA V;  4X88 A;  3AG1 B;  1Z2G A;  4BW9 A;  4JAA A;  4WFE A;  1WPB A;  1GTO A;  5EK0 A;  3B2E E;  3BRC A;  3K0D A;  2UU9 O;  1H2K A;  1KC8 W;  5L3F A;  1KU9 A;  1KB9 F;  4DR3 B;  4JI3 B;  3CCJ V;  4HAM A;  1K4C C;  4LH6 A;  1E1R G;  3K06 A;  3P30 A;  3ZMT A;  1IVS A;  4UFZ A;  1Q82 W;  1FXV A;  2YSU B;  1R3J C;  4HYO A;  1M9N A;  4OXS A;  2RN9 A;  1N4C A;  1N0N A;  3OFN G;  2JJ2 G;  1AIL A;  3HKD A;  4FZ0 A;  3TXQ A;  1LR1 A;  1NH2 B;  3L9D A;  4X1Y A;  3AG2 C;  2FB5 A;  4NYK A;  2YIB D;  1NVP D;  2VQF B;  4X20 B;  5KUK A;  4DV6 O;  2N05 A;  4ZOL B;  2ZCE A;  3RFR A;  1E1Q G;  4BR6 A;  4K8X A;  4P30 A;  3AG2 B;  3ETD A;  4DK1 A;  2QKS A;  1Q5O A;  1Z5W A;  3JD0 A;  2HP8 A;  4PJ0 Z;  1IBL O;  4H13 B;  3WG7 C;  3K5O A;  3CSX A;  5EZY B;  3OAA G;  3BA8 A;  2DJV A;  1OCO C;  4Z1V A;  3E83 A;  5CA3 A;  1AR5 A;  3N2G B;  3WG7 B;  4FZ1 A;  2R9R B;  4EB6 A;  4UVC A;  3T1H B;  2OWO A;  3JAL A;  2PY5 A;  3BCC H;  3H1K H;  4LCU C;  4KL1 A;  2BOC C;  4BIZ A;  4FM2 A;  4YJ3 B;  5J2U B;  1YCI A;  4TT3 G;  4DK0 A;  1FXK A;  2L35 A;  1CPY A;  2VWK A;  1SQQ H;  1QR8 A;  4JI7 O;  3JAK B;  1K9M W;  2ZR2 A;  1YF2 A;  4LF5 O;  4FLT A;  2CDY A;  1HNZ O;  4QGP A;  2B1G A;  2MW2 B;  4DV6 B;  3ZS8 C;  3JAS A;  1YXB A;  2LP7 A;  1AR1 B;  4H33 A;  1IX9 A;  3TCU A;  1JOY A;  1P7B A;  3L74 H;  2CTQ A;  4H44 B;  3JSN A;  4CS3 A;  1THZ A;  2IJH A;  1N0J A;  3RBZ A;  4XDK A;  4J7K A;  2YID A;  3D3Q A;  1D5N A;  3TJT A;  2EIN C;  4I5S A;  5CBF A;  3SPH A;  4Q20 A;  4NVP A;  2E74 B;  1VQ7 V;  3LDC A;  1BL8 A;  2EIN B;  3APO A;  3J7A U;  1TVK A;  2E5L O;  1K97 A;  4JI7 B;  5B1O A;  2YEV B;  1DGS A;  1HNZ B;  2Y0P A;  1Y76 A;  1M90 W;  3K57 A;  2E3C A;  2WLN A;  2Q9L A;  4F6R B;  3SR2 C;  2JVD A;  2OIG A;  1VQ8 V;  4U3F H;  2P67 A;  1WA8 A;  3CME V;  3GVM A;  1ZL8 A;  2Y0I A;  1WP8 A;  3T1Y O;  4QPK A;  2EJ7 A;  3AEI A;  2NN4 A;  1Q86 W;  1E79 G;  3OR6 C;  5H6R A;  4PEL A;  3M8A A;  5KAF Z;  2DW4 A;  1G8M A;  5LMN B;  4IGG A;  4WCE V;  2QA4 V;  2EX3 A;  3JAT A;  1PNL A;  2AGA A;  3VQV A;  1OCR C;  2H8P C;  3G71 V;  3E2E A;  1MSW D;  4RO2 A;  1GM7 A;  1AI7 A;  1RM1 B;  3WB0 A;  3CWB H;  2DQ0 A;  2QKA A;  2NLJ C;  5KHI A;  4DUZ O;  5LMU B;  1S3J A;  1XMO O;  3JYC A;  3QG5 A;  1SZT A;  1I08 A;  2QTO A;  3JCU Z;  1N32 O;  1AI6 A;  4X1I A;  3QF7 A;  2A06 H;  4X1K B;  4A5U B;  3H1L H;  3OGC C;  1N36 O;  1AJN A;  1XDC A;  4J42 A;  4DUY O;  3RYH A;  5KX5 B;  2DYR C;  3TET A;  3OEH G;  2FL4 A;  2UUB O;  4JI2 O;  3B8M A;  5K1X A;  3ZJZ A;  1JJO A;  4FK5 C;  3HKD B;  2Q8V A;  4J41 A;  2FKX A;  4IHJ A;  3DTU B;  4OX9 O;  2KG7 B;  4X1Y B;  2E75 B;  1XIL A;  4JYA B;  3LDE A;  3ML0 A;  2LW1 A;  4NKG B;  1Q6I A;  2QR4 A;  1NKD A;  2ZE7 A;  2IH3 C;  1NI8 A;  5LBQ A;  4Z2W A;  1JFF B;  3BEH A;  3SYC A;  1SER A;  4I4T B;  3E22 A;  2EIK C;  4DV4 B;  1TA8 A;  3U0Z A;  1TUE B;  2YUA A;  4Z1M G;  3CRM A;  4LF6 O;  1ARO P;  5IE9 A;  1XNR O;  4NTX A;  5L3D A;  3KZI Z;  1ENV A;  4EB6 B;  1S5H C;  2WLJ A;  3ZHT A;  1GN6 A;  2PGG A;  3FYI B;  5B1A B;  3SYO A;  3IC7 A;  4DUY B;  1MG1 A;  2K1E A;  2ZE8 A;  4DV0 O;  1L8D A;  1XOU A;  3JAL B;  4DR6 O;  2RQ6 A;  4G28 B;  4I9Q A;  1YEW A;  1P7G A;  1N33 B;  1FXK C;  3R65 A;  4LF4 O;  4P2Z A;  1M4U A;  4PA9 A;  2WSS G;  4H0L B;  5JH7 A;  5TIS Z;  3BAA A;  1GN2 A;  2X7R B;  1A32 A;  4RUE A;  4B3R B;  4DV5 B;  4EKW A;  1YTF B;  4TUY B;  1V54 C;  4IL6 Z;  1PKX A;  2JRI A;  1FKA O;  1VQM V;  1TUB A;  2OTJ V;  4GZR B;  3FB8 C;  3T2M A;  3ZED A;  2AW9 A;  3C90 A;  5BY1 A;  3ICX A;  5ITZ A;  1NQT A;  3F7Y C;  3N2K B;  2AXT Z;  3DSQ A;  4LF9 O;  2HHH O;  4NTY A;  3RGB A;  5EC2 C;  3ASO B;  2GUZ A;  1NU1 H;  4E4E A;  2ZXW C;  4DR7 O;  3X2Q C;  1X4T A;  4LNU A;  4NXM O;  2GV9 A;  2UXX A;  2ZXW B;  2EUL A;  4JI0 B;  3X2Q B;  4DV0 B;  2Q67 A;  2HVK C;  1PL0 A;  1BGY H;  2YC0 A;  4GKK O;  1YIT V;  4J10 A;  2X6A A;  4DV3 O;  4QIW F;  1T5E A;  1TVK B;  2ZQM A;  4UB6 Z;  4X8A A;  4FJC C;  2VWJ A;  1K3E A;  4MVM A;  4D7T A;  3VQW A;  1VP7 A;  4D7S A;  4AHC A;  3L72 H;  3UO3 A;  4ZHQ A;  5GW7 A;  3AK3 A;  1HP8 A;  5HFL A;  5K1P A;  1ZL8 B;  1YJW V;  2YI9 A;  2OIE A;  1QQC A;  5LHH A;  1GAX A;  2BTO A;  1X59 A;  2F43 G;  4GX1 A;  4X62 O;  1ZUQ A;  5LGU A;  3HPL C;  1EM1 A;  3FB5 C;  3WB1 A;  2UUC O;  3ABT A;  3JAT B;  2A3Q A;  5LOV A;  1HNX O;  5F2V O;  2Y69 B;  4LR3 A;  1GKF A;  3CRC A;  4GKK B;  5BZB A;  5LA6 A;  3OD4 A;  5KAI Z;  2W6I G;  1N8R W;  4ZOL A;  4R7C A;  2PI5 A;  1S5L Z;  4DV3 B;  1BHB A;  2DYS C;  1CP9 A;  4UVA A;  1SF9 A;  5CA0 A;  2DYS B;  5EZY A;  3F7V C;  4G27 B;  5L3B A;  4DR1 O;  4UCU A;  1MZF A;  1SQX H;  3N2G A;  3OMA B;  1XI1 A;  1UFI A;  3G6B A;  1OV9 A;  2W6J G;  1MSD A;  2CTW A;  4PA4 A;  1Y6X A;  3Q4H A;  2LQT A;  2OT5 A;  3CRR A;  1HDJ A;  1EN6 A;  1SES A;  4LFB O;  4YJ3 A;  3QO7 A;  1JX9 A;  2P06 A;  3FB6 C;  1TGO A;  4JTA B;  4NXN O;  1FFX B;  1SS3 A;  2ETN A;  4CH5 A;  1SC5 B;  3JAK A;  4GX5 A;  3K79 A;  3K5M A;  4GX0 A;  5CA1 B;  2Z5U A;  1VQ9 V;  3E8H A;  2ODM A;  1F23 A;  5DM6 V;  4JAV A;  3SJC C;  5CBG A;  4L8J A;  2HJD A;  3A0H Z;  4HBN A;  1R73 A;  3AG4 C;  5LYJ A;  2XAF A;  3IC9 A;  1PM9 A;  5KA5 A;  3E22 B;  1R1B A;  4JYY A;  3H1I H;  1QU7 A;  2WAM A;  1PD3 A;  1K5S A;  2K9P A;  3FAV A;  4RQF A;  3AG7 A;  1M1K W;  4FLU A;  2PTM A;  1GM9 A;  1FXH A;  3ZBH A;  5A2Q N;  1SQG A;  2WPD G;  1KP2 A;  2LO1 A;  4B7K A;  1HNW O;  3JD1 A;  4WFH A;  2OCC C;  3H1H H;  2ZIN A;  3EFF K;  1YVW A;  4MVZ A;  1RFY A;  4K35 A;  2Q69 A;  5IYZ A;  2YEV A;  2V4D A;  4R8C A;  1TUB B;  3G80 A;  1PNK A;  1WB8 A;  2BSK A;  4DR3 O;  4F6R A;  4JV5 B;  4IYH A;  1M57 B;  2M6Y A;  3ABM B;  5IYC O;  2QM7 A;  2P5O A;  2VRZ A;  3JAM N;  2QWQ B;  2QWO B;  2GUZ B;  4QPJ A;  4XDJ A;  3OTO B;  2Q73 A;  2FML A;  3M99 B;  4LNU B;  1IBM B;  1MNG A;  2QE7 G;  1O9H A;  2P7T C;  2HEP A;  3JD4 A;  1W0K G;  3IJ4 A;  1FPO A;  1EZJ A;  2XAS A;  4F4L A;  4X66 B;  4OGQ B;  1J5E B;  1KEC A;  2ZE6 A;  1WAZ A;  1JR9 A;  1QR9 A;  1XHX A;  2VQF O;  4ZKI A;  3HR0 A;  4EFB A;  1UJW B;  2B5U A;  2XT9 A;  1VQ6 V;  3IGA C;  2CAZ C;  3UT5 B;  4PA6 A;  4CC5 A;  1WP7 A;  4UCV A;  2CH7 B;  1NTZ H;  3DC5 A;  2ZR3 A;  1FYJ A;  4GUN A;  4J11 A;  5FNV B;  2YIA A;  1K7D A;  5B66 Z;  4XDL A;  4JI4 B;  3JAR B;  2ZD9 A;  4ICG A;  4ZHQ B;  4X1K A;  2FYU H;  3MDS A;  1IBK O;  1H8H G;  2JIZ G;  2LFS A;  2QWP B;  5KA6 A;  5KX5 A;  2EIM C;  3T1H O;  2P4V A;  4LF8 B;  1PP9 H;  5KLV H;  1P4R A;  3B4S A;  3THO A;  1FS0 G;  3JAW B;  2EIM B;  1VQL V;  4UCS A;  4TV9 B;  5LOV B;  2KG7 A;  3WU2 Z;  3QO5 A;  2PYJ A;  1NH2 D;  1YJ9 V;  5L3C A;  5LA6 B;  3OGI B;  3O9O A;  3ASN B;  1DF5 A;  2XTA A;  1JFF A;  1JCH A;  1NJI W;  1YIJ V;  1GN4 A;  4I4T A;  4JAS A;  5CA0 B;  4CH6 A;  4I9W A;  3L75 H;  5EBL C;  1OZ0 A;  1Y74 B;  1BHA A;  1SZX A;  2L6L A;  1SET A;  1H2S B;  1IBK B;  1FAF A;  5EIB C;  2EZP A;  3AG3 C;  3Q4H B;  3CE2 A;  1ZLZ A;  3RYF B;  4PV1 B;  2KQX A;  2Q5Z A;  3AG3 B;  4PI0 A;  3SPG A;  1B6Q A;  3K5L A;  5EIB D;  1KUQ A;  1WJZ A;  2ZNJ A;  1IZ3 A;  4TUY A;  2JS5 A;  1FD9 A;  4UVB A;  3OE7 G;  1L0N H;  1NS1 A;  2IH1 C;  4IYI A;  1ORQ C;  1R3I C;  2P22 C;  3N2K A;  4KUM A;  1DK1 A;  4NB5 A;  2UXN A;  2QM8 A;  5LYJ B;  3T4Z A;  1Q6H A;  3LSS A;  4JI6 B;  5B1N A;  4JI5 B;  4DV7 O;  3ZHU A;  1LNQ A;  1SQB H;  3FAV B;  2V7Q G;  1W2B U;  5EYP B;  4ASU G;  1LUW A;  2RMK B;  5LMN O;  5H5N A;  2HLD G;  1WLE A;  2YXH A;  1FJG O;  1AR4 A;  1VMG A;  2HJF C;  2KB1 A;  4F6E A;  2ZE5 A;  4N23 A;  4LF7 B;  4YIO A;  2MK3 A;  5IYZ B;  2JEX A;  3VOU A;  4FLV A;  4MVU A;  5LMU O;  4LFA B;  5CMU A;  1MA1 A;  2D2C B;  3DGE A;  2JGD A;  4J9Y B;  3L70 H;  1F7Y A;  2BSK B;  4O4H B;  2Q0O C;  1XL4 A;  2EZO A;  1R6K A;  4WFF A;  3BPZ A;  3WB2 A;  2WLM A;  2ZNI A;  4DV7 B;  4H37 A;  3ZRV A;  4X89 A;  3KG2 A;  4O2B A;  3W7W A;  2ZIM A;  4DR5 B;  5JJN B;  2XHB A;  2P6J A;  5LP6 A;  2Q7G A;  3LNN A;  1FJG B;  5IYD O;  3ETQ A;  1RM1 C;  4CZZ A;  5HFM A;  3UKM A;  1N34 B;  1HR0 B;  2CK3 G;  1GO3 F;  2LW7 A;  3RN4 A;  2Y4T A;  3LNM B;  1K5Q A;  4DYL A;  1SQF A;  4JYA O;  2F23 A;  2N74 A;  2PI4 A;  4JGS A;  3T4D A;  1H2M A;  1BSM A;  5J2T A;  2H94 A;  4DV4 O;  4B08 A;  1B04 A;  3DXR A;  5KUM A;  3UO2 A;  4DW0 A;  1JA8 A;  4TOI A;  2Q0A A;  3HKE A;  5BMV B;  4DR4 B;  2HG5 C;  4AIL C;  4FM0 A;  1N33 O;  2IJJ A;  2YI8 A;  3RT3 C;  2ZT9 B;  3VQY A;  4JTC B;  1FFX A;  1Q81 W;  3SGI A;  1H2G A;  3W7U A;  4B3R O;  4DV5 O;  4MTG A;  4DV1 B;  4FFB A;  5CA1 A;  4FLY A;  4O4I B;  3B40 A;  1XUQ A;  4CS2 A;  3QVN A;  5JQG B;  5JVD A;  1R3L C;  2B1I A;  1XL6 A;  4DV2 B;  1L0L H;  4ZI7 A;  4O4L B;  1VIB A;  2EBO A;  2QWR B;  3CP1 A;  1U97 A;  5B1A C;  3T1C A;  4KXR A;  3J80 N;  1D2D A;  1Q7Y W;  3HKC B;  1H2N A;  4JI0 O;  3ABU A;  1Y4M A;  5LGT A;  1D5A A;  3LSU A;  1JMK C;  4NR1 A;  2B9Z A;  4C7U A;  1NT2 B;  2HKO A;  1ZWI C;  1H8E G;  4FIP C;  3ZRS A;  1EN5 A;  4B3M B;  1WPX A;  3ZX6 A;  4MW8 A;  1Q43 A;  2HVJ C;  1ZTE A;  3ASO C;  2OCH A;  4JZG A;  2UXB B;  3CEI A;  3VQX A;  3E35 A;  2FTK A;  4BW5 A;  2LJ2 A;  4J9Z B;  2AZ2 A;  1GM8 A;  2CTP A;  3OTF A;  2PF4 E;  2JEU A;  4GX2 A;  1K73 W;  1H2L A;  2BTQ B;  2XAG A;  3ZMU A;  5GTH Z;  1Z5V A;  1KKD A;  2WLL A;  3D8C A;  3QO8 A;  1V9P A;  4K0K O;  4DO2 A;  2DQ3 A;  2LGQ A;  2EIJ C;  3C3S A;  3ETG A;  1BQ0 A;  1OCC C;  1NBM G;  2VS0 A;  3UT5 A;  2KSD A;  2EIJ B;  2F4V O;  2CH7 A;  1OCC B;  4DR2 B;  1MAB G;  1JVM A;  5FNV A;  2A9H A;  4JPR A;  4G2K A;  2JGD B;  3CCL V;  3JAR A;  4AQY B;  5IT9 N;  3AK1 A;  3RVZ A;  4HZ3 A;  4TV8 B;  3RYC B;  1NZ6 A;  3OR7 C;  1CEZ A;  3H9V A;  1XNQ B;  3MHS C;  5LP6 C;  2DOS A;  3BFR A;  4O2B B;  3JAW A;  1JPX A;  1S5J A;  1SQP H;  4LFC B;  4CC6 A;  3MD0 A;  1QHT A;  1UPG A;  1WN7 A;  2Y69 C;  4IT5 A;  5LP6 B;  4TV9 A;  1R6T A;  4B3T B;  1BE3 H;  3AK2 A;  2PYL A;  4K0K B;  3SYA A;  2Q6A A;  4TQF A;  5A9G A;  1AI4 A;  3STZ C;  3D36 A;  2ILM A;  1QLN A;  1XQ8 A;  4D6T H;  4J7Z A;  2F4V B;  1I0H A;  2X6C A;  4DW1 A;  5IJ0 A;  1S77 D;  1ZSP A;  3U10 A;  5J2T B;  1B3Q A;  2LFR A;  1EFR G;  4PD4 F;  1J95 A;  1DF4 A;  4LWS B;  1QNM A;  1K33 A;  3VBB A;  3DXR B;  1Y74 A;  1KYO F;  2QGN A;  1IUR A;  1RPO A;  1QVG U;  3G67 A;  2ITD C;  2RJZ A;  3HKE B;  4ABM A;  4JZ2 A;  3JSL A;  1GMG A;  5JJJ B;  5DN6 G;  5FL7 G;  3K9A A;  3WFV A;  1YHQ V;  1K8A W;  3RYF A;  4TSF G;  1QVF U;  5JJE B;  1B06 A;  5IWA O;  3P32 A;  4P9O A;  3J81 N;  4MTX A;  5KMG B;  4FFB B;  4JAU A;  5JVD B;  3I55 V;  4I0X A;  2IM9 A;  5B5E Z;  1IDS A;  5BR8 B;  1VQ5 V;  4JYC A;  1VAR A;  4JV5 O;  4ZI7 B;  5JCO A;  4MVS A;  4R50 A;  3JD3 A;  3OTO O;  2NR5 A;  1YI2 V;  5EYP A;  1IBM O;  3OUS A;  2Y48 A;  3ABK C;  4X66 O;  2G38 A;  4WBN B;  1J5E O;  1S0V A;  1SKV A;  3ZHQ A;  3ABK B;  2IBZ H;  3K58 A;  5IWA B;  4GYC B;  2ZM6 B;  4ZBM A;  1EZV H;  3GWK C;  3RW0 A;  1V55 B;  1M57 C;  4I50 B;  2XAH A;  4U7O A;  3ABM C;  1BT8 A;  1MMM A;  4O4H A;  2P90 A;  4JI4 O;  2CTR A;  4MTF A;  3ZCC A;  1XRE A;  4P9P A;  2Z0A A;  3CB2 A;  4OPH A;  1GN3 A;  2F93 B;  5FPO A;  1BZK A;  4W4L A;  2M7W A;  3BHP A;  4LF8 O;  3P3P A;  1U96 A;  3H01 A;  1VQO V;  4MTO A;  3CPW U;  4RWU A;  1G4Y B;  3RVY A;  2QEX V;  3W7T A;  2WLL B;  1BQZ A;  2X0L A;  4I55 A;  1VF5 B;  2JS3 A;  4X64 B;  3CJH B;  4DRX A;  5C8Y B;  3L71 H;  1M5I A;  3CYO A;  4JI1 B;  2Y4U A;  3CRA A;  2GTA A;  3HB3 B;  3ZRW A;  1QLE C;  1RP3 B;  1FFT B;  4FLZ A;  1SRY A;  4YHH B;  1QLE B;  4J80 A;  1NTK H;  2CGO A;  2A0L A;  1NR1 A;  3ZMZ A;  3FD9 A;  5BMV A;  4GKJ B;  5E1A C;  2XND G;  3CXC U;  1TAE A;  4KHP B;  1HWY A;  2EIL B;  1BCC H;  3STL C;  3PN1 A;  4PDL A;  1SQV H;  4HNA A;  3CX5 F;  5D5Q A;  4JI8 B;  2UXD B;  3EHB B;  1SA0 B;  5LHG A;  4IIJ B;  3DC6 A;  2WA4 A;  4MS2 A;  3CCV V;  3GB7 C;  3D36 C;  1ZAU A;  1IXM A;  4O4I A;  3FX7 A;  4L87 A;  4FLW A;  3ASN C;  5JQG A;  4BWA A;  2W0X A;  5KHG A;  1US6 A;  2ZDI A;  4FPP A;  3LSQ A;  2Q4P A;  3ZHV A;  2CE4 A;  5L3E A;  3B77 A;  4O4L A;  1KKC A;  4MVR A;  4YY3 B;  3CCE V;  4RQE A;  4AI8 A;  5IJ0 B;  2QKC A;  4UXN A;  4JI6 O;  4MVQ A;  3FFQ A;  4B3S B;  4LBE C;  1YJN V;  1NVP B;  4JI5 O;  2XOK G;  4MVO A;  2F1M A;  3JCZ A;  3CC2 V;  2IU3 A;  1WB7 A;  2DWE C;  3HKC A;  4X65 O;  3KCY A;  1R6N A;  1P84 F;  3OMI B;  2JJ1 G;  2PUS A;  1RSO B;  3CXH F;  3MHH C;  2Q68 A;  2YDE A;  2UU9 B;  4PA3 A;  3I5D A;  3CC7 V;  3CCU V;  5KHJ A;  4O4J B;  3JD2 A;  4LF7 O;  1L1F A;  1O9G A;  1OJH A;  1KMI Z;  3ZHS A;  5LL6 Y;  1OCO B;  1EBO A;  4LFA O;  1F4M A;  5JCO C;  2ADQ B;  4I0X B;  2QTS A;  5LHI A;  5LGN A;  1Q3E A;  4WFB V;  3MAQ A;  5LXT A;  4UCO A;  3K9S A;  2BTQ A;  4DR5 O;  4U3J B;  1AJP A;  4FM1 A;  4X65 B;  4JYB A;  1W59 A;  2QWN B;  3EVK A;  1HW7 A;  4FVM A;  4EEQ A;  3M7M X;  3S3X A;  1IBL B;  1F4N A;  1N34 O;  1HR0 O;  4PA7 A;  5C93 A;  1ROP A;  1XEQ A;  2NNU A;  4X9Q A;  2ADP A;  1VEW A;  5H6Q A;  5BXZ A;  5J9P C;  1KBH A;  2WLH A;  1COW G;  2Q7E A;  3RYI B;  2YIC A;  5CB4 A;  1Y66 A;  4MSW C;  3ZN0 A;  1VQN V;  3SJQ C;  1AP5 A;  5GON B;  5FLX N;  4TV8 A;  3RYC A;  1PPJ H;  3EXA A;  3B8N A;  2GDS A;  1GK9 A;  3NR7 A;  4DR4 O;  4Q6G A;  2Q7H A;  3BY6 A;  4YIP A;  4LF5 B;  1AJQ A;  1NR7 A;  3GWO A;  2QDO A;  4UUJ C;  3A0B Z;  3SPC A;  3W7X A;  2OTL V;  3SYP A;  3K08 A;  4I55 B;  1XHZ A;  3K04 A;  2PZS A;  3OT7 A;  4DV1 O;  4DRX B;  3E89 A;  4EFE A;  5H2F Z;  4DV2 O;  2IJK A;  1LUV A;  3ZRW B;  1WNS A;  2AHZ A;  2BOB C;  4LWS A;  2IJI A;  1NTM H;  2XAQ A;  3O65 A;  2ATK C;  2WLI B;  1S72 V;  4PDM A;  3ZMV A;  4FMT A;  4O2A A;  4ZIB A;  4J7J A;  4TWK A;  1I94 O;  2UUA O;  4UB8 Z;  2HFE C;  1I5Y A;  2A7W A;  1OCR B;  2XUM A;  1I5X A;  2BCC H;  5JWP A;  2E5L B;  4YXW G;  1K34 A;  1OCZ C;  2DE0 X;  4HNA B;  2F95 B;  1PL4 A;  3R66 A;  5DED A;  4KP4 A;  2VQE O;  2WWW A;  1OCZ B;  3LUT B;  2R9I A;  5CBH A;  4FFK A;  3T1Y B;  2ZDI C; 
#chains in the Genus database with same CATH homology
 4TT3 G;  1FXK A;  1M57 B;  1YSC A;  1CPY A;  5EBW C;  1QR8 A;  3ABM B;  1JPX A;  2A79 B;  5IYC O;  1K9M W;  2ZR2 A;  2QM7 A;  3MD0 A;  2Y69 C;  4UV8 A;  3G4S V;  4QPJ A;  2B1G A;  4XDJ A;  4RUF A;  2DYR B;  3SYA A;  2Q6A A;  3M99 B;  2LP7 A;  2W0F C;  1AR1 B;  4H33 A;  1AI4 A;  3STZ C;  4RAI A;  2V1D A;  2QE7 G;  3TCU A;  3D36 A;  1JOY A;  1P7B A;  1H38 A;  1QLN A;  2P7T C;  3JD4 A;  1W0K G;  4E2L A;  1EZJ A;  2X6C A;  2XAS A;  4F4L A;  1S77 D;  3CCR V;  1THZ A;  2IJH A;  1KEC A;  1EFR G;  2LFR A;  1J95 A;  1DF4 A;  1K33 A;  3VBB A;  1QR9 A;  3RBZ A;  4XDK A;  4ZKI A;  3CC4 V;  3CCM V;  1RPO A;  1KP3 A;  1UJW B;  2GHY A;  2B5U A;  1QVG U;  1VQ6 V;  3IGA C;  2ITD C;  3SPI A;  4PA6 A;  1GMG A;  2EIN C;  4I5S A;  5CBF A;  2EIK B;  2ZR3 A;  5DN6 G;  3SPH A;  1OHH G;  2XAJ A;  5FL7 G;  4Q20 A;  3LDD A;  3K9A A;  1K7D A;  3K3W A;  3WFV A;  1VQ7 V;  3LDC A;  1BL8 A;  4XDL A;  1YHQ V;  1K8A W;  2EIN B;  4BAY A;  4TSF G;  2ZD9 A;  1W0J G;  1YTF D;  1K97 A;  1QVF U;  5EBM C;  5B1O A;  3OUF A;  4U7N A;  2YEV B;  4WFA V;  1H8H G;  2JIZ G;  2LFS A;  3P32 A;  4P9O A;  5KA6 A;  3FB7 C;  4MTX A;  1M90 W;  2EIM C;  2WLN A;  3OW2 U;  1P4R A;  1VQ8 V;  1FXK B;  2P67 A;  1FS0 G;  1JJ2 U;  3CME V;  2EIM B;  4QNH B;  4JAU A;  3I55 V;  1VQL V;  1QCE A;  1VQ5 V;  4JYC A;  3G6E V;  4QPK A;  1V54 B;  3AEI A;  4MVS A;  4R50 A;  4UV9 A;  1K92 A;  1Q86 W;  1E79 G;  3OR6 C;  3QO5 A;  5H6R A;  3OEE G;  3K03 A;  4PEL A;  4PDV A;  1YJ9 V;  4R6Z A;  1NH2 D;  5L3C A;  2DW4 A;  1G8M A;  3JD3 A;  4WCE V;  4LP8 A;  2QA4 V;  1YI2 V;  3ASN B;  1DF5 A;  1QBZ A;  3ZMS A;  1PNL A;  1S76 D;  1JCH A;  1NJI W;  1YIJ V;  1OCR C;  2H8P C;  2EJR A;  3G71 V;  3E2E A;  1MSW D;  3OUS A;  4RO2 A;  1KD1 W;  2IU0 A;  1GM7 A;  4JAS A;  4WFG A;  1AI7 A;  1RM1 B;  4I9W A;  2Y48 A;  3ABK C;  5EBL C;  1OZ0 A;  2DQ0 A;  1S0V A;  1BHA A;  2NLJ C;  1SET A;  3ABK B;  4JF3 A;  1VQ4 V;  4PDR A;  2EZP A;  1S3J A;  3AG3 C;  4ZBM A;  3JYC A;  1SZT A;  4JTD B;  4QJF B;  2QTO A;  3RW0 A;  1V55 B;  1M57 C;  1AI6 A;  2XAH A;  4U7O A;  1VQK V;  3QNE A;  3ABM C;  3AG3 B;  3SPG A;  1B6Q A;  2P90 A;  3CD6 V;  3OGC C;  1AJN A;  4MTF A;  3ZCC A;  1BMF G;  4P9P A;  2DYR C;  3TET A;  4QE7 A;  3OEH G;  4UVB A;  3SYQ A;  3TK1 A;  3IFX A;  3OE7 G;  3OM3 B;  2IH1 C;  1ORQ C;  1R3I C;  2M7W A;  3B8M A;  5B1B C;  3PJS K;  4CBC A;  4KUM A;  3H01 A;  3ZJZ A;  1VQO V;  4MTO A;  4FK5 C;  3CPW U;  3K0G A;  3SPJ A;  2UXN A;  3DTU B;  1G4Y B;  2QM8 A;  3T4Z A;  3RVY A;  5B1B B;  3LSS A;  1MOF A;  1DTO A;  2QEX V;  2IW5 A;  3W7T A;  2JDI G;  2WLL B;  5B1N A;  3LDE A;  2X0L A;  3ML0 A;  1LNQ A;  4GT1 A;  4WF9 V;  1NKD A;  3ETE A;  2IH3 C;  2V7Q G;  1JQ0 A;  1R3K C;  3CYO A;  1W2B U;  5LBQ A;  4ASU G;  3BEH A;  4MW3 A;  3SYC A;  1SER A;  2EIK C;  3NXS A;  3HB3 B;  2HLD G;  1WLE A;  3ZRW A;  1TUE B;  2HJF C;  2KB1 A;  1QLE C;  4Z1M G;  1FFT B;  1ARO P;  1RPR A;  5L3D A;  1SRY A;  1QLE B;  3FYE B;  4N23 A;  1ENV A;  1S5H C;  2WLJ A;  3D3I A;  3FYI B;  5B1A B;  3SYO A;  3IC7 A;  2A0L A;  2WLK A;  1MG1 A;  1NR1 A;  2K1E A;  3ZMZ A;  2MK3 A;  5E1A C;  5IDJ A;  3FKS G;  3I56 V;  2XND G;  3CXC U;  4G28 B;  2JEX A;  3VOU A;  4MVU A;  1HWY A;  1FXK C;  2EIL B;  3R65 A;  4P2Z A;  5CMU A;  4PA9 A;  3STL C;  1K4D C;  2WSS G;  3DGE A;  4J9Y B;  4PDL A;  3E8G A;  2AHY A;  2X7R B;  3E86 A;  1PNM A;  1XL4 A;  4RUE A;  2EZO A;  1R6K A;  3EHB B;  4EKW A;  1YTF B;  5LHG A;  3A0R A;  1V54 C;  4KFM A;  1PKX A;  2DWD C;  4WFF A;  3W7S A;  1VQM V;  2OTJ V;  2WLM A;  3FB8 C;  3T2M A;  4MS2 A;  3CCV V;  3GB7 C;  4H37 A;  3ZRV A;  4X89 A;  3KG2 A;  1IXM A;  1NQT A;  3F7Y C;  4L87 A;  3W7W A;  3ASN C;  2D3O W;  2ZDI A;  2P6J A;  4FPP A;  1M56 C;  2JK5 C;  5EC2 C;  3ASO B;  3LSQ A;  4LC1 A;  5IYD O;  4N21 A;  4DXW A;  3B77 A;  4CZZ A;  5L3E A;  3UM7 A;  5HFM A;  3CCE V;  4MVR A;  3UKM A;  1F51 A;  3ZN1 A;  4RQE A;  2ZXW C;  3E8F A;  3ZRX A;  3X2Q C;  3E8B A;  1M56 B;  2CK3 G;  1GO3 F;  5H9C A;  3LNM B;  4UXN A;  4MVQ A;  1K5Q A;  2UXX A;  2ZXW B;  4LBE C;  1YJN V;  3X2Q B;  1NVP B;  2XOK G;  4MVO A;  2PI4 A;  3JCZ A;  4JGS A;  3T4D A;  2IU3 A;  5B3S C;  3CC2 V;  2DWE C;  2Q67 A;  2HVK C;  3AG4 B;  1PL0 A;  2H94 A;  1V55 C;  4XBF A;  1R6N A;  5IYB O;  1VQP V;  5KUM A;  5B3S B;  4BIU A;  3OMI B;  2JJ1 G;  1YIT V;  2ITC C;  3MHH C;  5CN0 A;  2X6B A;  3ZIA G;  2Q68 A;  2X6A A;  1DLB A;  4QIW F;  4PA3 A;  4GCZ A;  3CCS V;  2ZQM A;  2HR3 A;  3CC7 V;  4X8A A;  3CCU V;  4FJC C;  4MT8 A;  3JD2 A;  1K3E A;  2HG5 C;  4MVM A;  1L1F A;  2GSM B;  2IJJ A;  1OCO B;  1EBO A;  3F5W C;  5GW7 A;  1F4M A;  2OCC B;  4JTC B;  5HFL A;  1Q81 W;  1YJW V;  1AI5 A;  1H2G A;  5LHI A;  3W7U A;  5LHH A;  5LGN A;  4MTG A;  3OMN B;  2F43 G;  4GX1 A;  1RM1 C;  2Z3Y A;  4WFB V;  3CCQ V;  1R3L C;  5LGU A;  2B1I A;  1XL6 A;  3HPL C;  3FB5 C;  3ABT A;  1AJP A;  4JYB A;  2Y69 B;  1GKF A;  5BZB A;  2EBO A;  2W6I G;  1N8R W;  3CP1 A;  3ABL C;  4R7C A;  2C2A A;  1F4N A;  2PI5 A;  5EC1 C;  4QE9 A;  4PA7 A;  5B1A C;  1ROP A;  3T1C A;  5C93 A;  1BHB A;  5IY5 C;  2DYS C;  2NNU A;  1CP9 A;  1Q7Y W;  2WLI A;  1KQS U;  4UVA A;  3AG1 C;  3ABL B;  2EIL C;  5H6Q A;  5J9P C;  3ABU A;  5L3G A;  5IY5 B;  2DYS B;  1Y4M A;  2WLH A;  1COW G;  3F7V C;  4G27 B;  5L3B A;  3CMA V;  4X88 A;  3AG1 B;  3OMA B;  5LGT A;  1Y66 A;  4WFE A;  2W6J G;  4MSW C;  3ZN0 A;  1GTO A;  5EK0 A;  4PA4 A;  2HKO A;  1VQN V;  3SJQ C;  3K0D A;  1ZWI C;  2OT5 A;  1KC8 W;  5L3F A;  1H8E G;  3B8N A;  4FIP C;  1GK9 A;  3ZRS A;  3CCJ V;  4HAM A;  1SES A;  1WPX A;  3QO7 A;  1JX9 A;  3BY6 A;  1K4C C;  4MW8 A;  1AJQ A;  1NR7 A;  1E1R G;  3FB6 C;  3K06 A;  3P30 A;  3GWO A;  4JTA B;  3ZMT A;  2HVJ C;  1Q82 W;  3ASO C;  1FXV A;  4UUJ C;  2YSU B;  1R3J C;  4HYO A;  3SPC A;  4GX5 A;  1M9N A;  3E35 A;  2FTK A;  4OXS A;  4BW5 A;  4J9Z B;  1GM8 A;  3K79 A;  3W7X A;  4GX0 A;  2Z5U A;  2JEU A;  1VQ9 V;  2OTL V;  3E8H A;  3SYP A;  1F23 A;  3OFN G;  3K08 A;  2JJ2 G;  5DM6 V;  4JAV A;  3K04 A;  5CBG A;  4GX2 A;  1R73 A;  3E89 A;  3AG4 C;  1K73 W;  1NH2 B;  2XAG A;  3ZMU A;  2XAF A;  5KA5 A;  1KKD A;  2IJK A;  2WLL A;  3QO8 A;  3AG2 C;  3ZRW B;  2WAM A;  1NVP D;  2AHZ A;  1PD3 A;  1K5S A;  5KUK A;  4RQF A;  2BOB C;  1M1K W;  4DO2 A;  2DQ3 A;  1E1Q G;  1GM9 A;  2IJI A;  2XAQ A;  3AG2 B;  1FXH A;  2EIJ C;  3ETD A;  4P30 A;  3ETG A;  2QKS A;  1OCC C;  1NBM G;  2ATK C;  2WLI B;  1S72 V;  4PDM A;  3JD0 A;  3ZMV A;  4FMT A;  3WG7 C;  4TWK A;  2WPD G;  1KP2 A;  2EIJ B;  2HFE C;  3OAA G;  1I5Y A;  1OCC B;  1OCR B;  1MAB G;  1OCO C;  3E83 A;  1I5X A;  1JVM A;  5CA3 A;  3JD1 A;  3WG7 B;  4YXW G;  2A9H A;  4WFH A;  2R9R B;  4JPR A;  2OCC C;  4G2K A;  4UVC A;  1K34 A;  3CCL V;  3EFF K;  1OCZ C;  4MVZ A;  2Q69 A;  3RVZ A;  4HZ3 A;  2YEV A;  4KP4 A;  2WWW A;  3OR7 C;  4LCU C;  1CEZ A;  1OCZ B;  4R8C A;  3LUT B;  2R9I A;  2BOC C;  4BIZ A;  5CBH A;  1PNK A;  3MHS C;  2ZDI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...