1DFGA

X-ray structure of escherichia coli enoyl reductase with bound nad and benzo-diazaborine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfgA00
3BTSA 4DL9A 1I2CA 2HUNA 1B2LA 3C1OA 1Y9EA 4UUNA 5FI5A 1C1DB 1NR7A 1D4FA 1E7MA 1T25A 3KB6A 4RPGA 4N5NA 4WGGA 4WECA 2PNFA 3ZWAA 1UP4A 1XR3A 5DBGA 4Z0TA 3G1UA 1CYDA 1PJBA 3UCXA 4ONEA 3WTCA 3G17A 3P19A 3ZGYA 1LSOA 1JKIA 2HAEA 3GH3A 4D3FA 4GGOA 2CDBA 4Z9YA 4FFMA 5A9RA 3E5RA 2O48X 3GVIA 2WYUA 4HX5A 1H2BA 2ZTVA 1U5AA 2ZYDA 4OAQA 1YRLA 5F5LA 2H5LA 2G5CA 2I3GA 5TX7A 1R15A 2AEJA 4WCFB 4CLRB 4MP6A 5TJHA 4R51A 2YV2A 3COSA 3IIEA 1P3DA 3Q9UA 1E1NA 3F3SA 1X1EA 3RBZA 2VNAA 1Y8RB 3TFQA 3JTMA 5LCXA 1X1TA 2W8ZA 1WNTA 4HFMA 4DXHA 2ZTLA 1ENZA 3MTGA 2WSBA 4AJJA 4J9VA 4OHUA 3HG7A 2P9GA 4DPMA 4IDFA 3AU8A 2JD0A 4RQUA 2O2SA 2OOSA 5I7VA 3KSZO 4IMRA 5BNTA 4L73A 5CDSA 1I2ZA 3SX2A 3WLEA 1NNUA 3MTJA 5T5QA 1LLDA 3Q9NA 4CMKA 1JAYA 3S2FA 4CMAA 1HDYA 1SC6A 2JL1A 3S2EA 4EGFA 2DUWA 4MPDA 3L0DA 3GMSA 4ITUA 3HN2A 3ROPA 4MVJP 2O2YA 1DHRA 4LVUA 4Y6PA 5IF3A 3ZWPA 4NFSA 1MLDA 4DRYA 3GA0A 3UOGA 1DJQA 5A05A 3DZHA 5U1PA 2CDCA 3UAGA 3UH1A 4WCFA 2C29D 5FFFA 3GG2A 4DQUA 1HRDA 3TPCA 5DCYA 1VPDA 1FJHA 1R6DA 5KTKA 4PLGA 1RM4A 4II2A 5G4LA 4MKXA 1LX6A 1G0OA 2X0RA 3ZHZA 5G0TA 3MJSA 4IDEA 5A06A 3NJ4A 4IDDA 2DLDA 4OH1A 2ET6A 5JAIA 3U49A 5FF9A 1WMBA 1V3VA 3PHIA 1HT0A 1DFGA 2VZ9A 4J1SA 3O8QA 5L7WA 4YQZA 1QP8A 2NADA 4FB5A 2X5OA 2PD6A 4A10A 3T7EA 3EYWA 4ZRNA 5I9LA 4FR5A 1NPTO 3F9IA 2B4RO 4BNFA 2AE2A 3K73O 4DC0A 1OFGA 1MV8A 4YRDA 5H81A 3VOSA 1XYGA 4N5LA 1GEEA 5HWSA 1O89A 1LA2A 1ARZA 2ZJ0A 4BB5A 3INRA 3WOHA 1XQ6A 1XCBA 3FNFA 2DTXA 3OICA 1GDHA 3ZU3A 1A71A 2JFFA 4E5YA 3DZBA 1EUDA 2G0TA 1Y1PA 2HK8A 3U4IA 4R3WA 2NU9A 3WWZA 3HN7A 3H9EO 4NU6A 3KM0A 4NK5A 2D5AA 3E03A 3KV3O 1G1AA 2EGHA 3RUEA 1TT5A 2FWMX 1M67A 4IXWA 4W6ZA 3QRWA 1XIVA 4RL6A 5I7EA 4RLHA 4TQGA 1GU7A 2D1YA 1E1MA 1YS4A 1P1JA 2HMVA 3PRJA 3VZQA 8ADHA 4FJ0A 4FC7A 4MVJG 1FDUA 1XLTA 3CMMA 2JFGA 1ULUA 3ADOA 1NFQA 1DLIA 1A72A 4E2YA 4EUHA 1DSSG 4DTIA 1GUZA 1MP0A 1HLDA 4HY3A 3PK0A 3V2GA 1UZLA 1IB6A 3WGQA 1PS8A 3BHJA 1LNQA 3GGOA 1E7SA 4LSWA 3HZZA 4WKGA 3VZSA 1GY8A 3JQ9A 4MOWA 4F46A 4BMNA 1MG0A 5HM8A 2HJRA 4FFLA 3WBFA 3K5PA 1V3TA 4LGVA 1H9AA 2DFVA 1PGPA 5TQVA 4ZICA 5CDYA 1HYEA 2FY8A 3H2SA 3NTOA 4NHEA 4AJPA 1HDZA 4M8SA 4OL9A 2QIOA 3EZYA 4N5MA 2WYVA 2C5AA 3LT0A 4TRRA 3I83A 2C2XA 3VVBA 3O38A 4L8VA 4NBVA 7ADHA 2XXJA 3ZZNA 4JBIA 3ZCXA 1B16A 4XB1A 5JBIA 3DBRB 3M6IA 1WWKA 4YAGA 2FPIA 4BNJA 3RWBA 3TFOA 3TN7A 1Q0LA 2G1UA 2YZ7A 2PY6A 3I1JA 1NPDA 4CR7A 1B26A 3RJ5A 1MGOA 4IUYA 2GUGA 4WLFA 1CIVA 3I3OA 1NQAO 3JD4A 1S7CA 4PLZA 2ZB3A 5AXBA 1PGQA 3BHIA 3H4VA 5CEJA 2QRJA 1T26A 2P4QA 2BD0A 2OP0A 2ZQZA 1VE9A 4EEZA 1DIBA 2HJSA 1SB8A 4E33A 5F5NA 1FK8A 4A2CA 4FW8A 3RU9A 4F6CA 2BMAA 1DBVO 3G0OA 4MVJH 4E5NA 1X13A 1YE3A 1E6EA 1H9BA 5EJ2A 2EV9A 4J4TA 2YW9A 1BVUA 1LU9A 4FSHA 4BNNA 4Z3KA 3QQPA 1I33A 4R9RA 1VRWA 4JROA 1GYPA 3TF5A 1ZSVA 3GN1A 4GWKA 3VDQA 1PS9A 1U5CA 3AOGA 3GR6A 4R41A 4AJEA 1PZEA 2GGSA 2IZZA 1QYCA 3TZ6A 2CMDA 3R1IA 1DIHA 3DBVO 4CQLB 3N74A 4BB6A 3T7CA 5JC1A 3AOEA 3BMNB 3NKLA 3F4LA 1X7HA 3PHHA 3D5QA 2OORA 2YY7A 2ZTUA 5F21A 5BSEA 1P1IA 3A1NA 2EKLA 3GOHA 4BOYA 5GY7A 2W2LA 3TZKA 1BGVA 3N58A 2GDZA 2HMUA 4L76A 4UVGA 5KVQA 1IZ9A 5EL0A 1J0XO 2IDZA 2ZIZA 4W7HA 5I9MA 5CEFA 1YGYA 2CDAA 4D79A 1C0KA 1E1KA 4GX2A 4LCEA 5JYEA 2Y1CA 3PTZA 1DRVA 1ISMA 1A27A 1I36A 1TLTA 2WEKA 2I3AA 3U09A 4AICA 4IIUA 1U9JA 4UVDA 4YWJA 3RCBA 1EQ2A 4PVDA 3ROQA 4R16A 4EUEA 3FHLA 2E48A 4LMRA 2VRBA 4XYBA 5MDHA 4CUZA 1ZIDA 1EVYA 3ONDA 3C85A 3PI7A 3BMCB 3BTOA 2B35A 3OIFA 2VHWA 1EK5A 2A92A 3KSUA 1GTMA 1Q1NA 2PGDA 4H16A 4Y67A 3QWAA 4AVYA 1ZJYA 1I10A 1ID1A 4OMUA 1PQWA 1PWXA 2PR2A 3QVTA 4CQLA 1HE2A 3I9MA 4CLOA 4HWKA 3VKUA 1MXFA 3VH3A 1NBOA 4RF2A 4XYGA 5JDIC 2B5VA 3DL2A 1P0FA 3W4KA 1YQDA 2J5QA 4URFA 4GMFA 2PZKA 1H6AA 1K6XA 1O94A 4NR0A 2GYYA 3WYBA 3GUYA 1XU7A 3AY6A 3PWSA 1WXDA 2VUTA 2IRWA 4AJ4A 4CLHA 3HUDA 3ZH2A 3NDIA 4A03A 1ZCJA 4D3SA 3HADA 1FMCA 4XRGA 2W98A 3VHRA 3DO5A 2C54A 1GV0A 1SOVA 3OJ0A 1PSDA 3DHYA 3HE3A 3Q11A 3TL2A 2CD9A 4E32A 5ENVA 3PLNA 1MG5A 2E4AA 1SNYA 3DTYA 3EVTA 4FJ2A 4KWIA 3RJ9A 5T8KA 3NYWA 3CSDA 4LRTB 3BMCA 4XYMA 1BXZA 1MFPA 3FR7A 5A9TA 9LDBA 4IY1A 1VJ1A 4JP3A 1K2WA 4OOFA 1HE3A 1WDKA 2D0IA 2I67A 2GR9A 1E3IA 2DFDA 2EW2A 3TL3A 3RD5A 1J6UA 5IDWA 4CMGA 4CMEA 3OJFA 3AK4A 5JAMA 1TT7A 1UP6A 3G79A 4YEDA 3HDYA 3E18A 1IPEA 1T2FA 3LC1O 3RVDA 5KWEA 1VL0A 1TI7A 3NGLA 4KZPA 4Z3DA 3WXBA 4DA9A 2QRLA 3CUKA 4Z9FA 4PLTA 1X7GA 4J2HA 1E6UA 3SVTA 2J3JA 2UDPA 4QTZA 1P74A 2Q4EA 2Q4BA 2VZ0A 1Z7BA 4MO2A 2DPHA 3LSYA 1E3LA 1Y7TA 7MDHA 3AW9A 3R0IA 2HO5A 4DYDA 1UXJA 3LZ6A 3SJ7A 4F3YA 2P4HX 4HBGA 2ZQYA 3T4EA 1NQ5A 2VWHA 2QW8A 4B3IA 1I24A 4ZN6A 3KYDA 4FOOA 1L7EA 3BZUA 4PLHA 2C07A 4XGNA 3GLQA 4BO4A 2Q2QA 3GDGA 2D59A 3ZNNA 1DC3A 4DLLA 4EBFA 2X8LA 2DVMA 2GERA 1Q7CA 2C59A 1GZ4A 4KMSA 4J2OA 5HS6A 4IQGA 2D2IA 3DDNA 3E82A 3QV1A 1NX6A 3JQGB 3D3WB 1ZBQA 1CETA 1HWYA 2O7SA 1KVRA 5G0VA 2GLXA 3V2UA 1DLJA 1H6DA 1ZZEA 1G6KA 3GK3A 4I1IA 4CM3A 4NJOA 3PGJA 3STHA 1E7YA 3ROMA 4J7UA 3RROA 4OKIA 1Z73A 3RASA 1ZXLA 1T4DA 3PP8A 1ENYA 4K6CA 5KVCA 1YJQA 5K6AA 1QRRA 3FBTA 1RKXA 3JD0A 1Q0QA 2Q1WA 2Y93A 4KDFA 5KJ1A 3CXRA 3UCFA 4GL4A 2HK9A 1CDOA 1NAIA 1VM6A 5KKCA 1JTVA 1X14A 2OZPA 4WCFC 4PN3A 4O63O 5AVOA 3QVXA 4EJ6A 1ORRA 2DTDA 1QORA 2B69A 1QXSA 4GSKA 1JVBA 4I5DA 3AUSA 3WWYA 4BNLA 3QHAA 1XEAA 1DO8A 2X86A 2E82A 1JN0A 3IC5A 3PYMA 3F5SA 3GGGA 5C37A 3DONA 4DVJA 1LLQA 3FNGA 4DQVA 2J8ZA 4PLFA 4R1TA 3MJEA 1LBEA 4KQWA 4CM1A 3JQGA 3D3WA 2P91A 4WEQA 1ONNA 2Y67A 3PLRA 4CMJA 3NRCA 1C3VA 2ZCUA 1AHIA 3L4SO 3QE3A 5ADHA 1P1RA 4FQ8A 2DT5A 1H6CA 3K96A 4OSOA 4QQRA 2GN4A 3U4DA 1N2SA 1PU2A 1V0JA 4Q3DA 1CWUA 2FR1A 2R2GA 3ZNOA 3DFZA 2TMDA 3KXDA 3JQ7B 4YAKA 1HXHA 4XR4A 5KVSA 1HE4A 4IJVA 4IS3A 4Z9XA 4J91A 1QV6A 4QSMA 4IIVA 3W8DA 4BGEA 1PJ4A 2WTBA 3KYCB 3LC2O 4LSMA 4FFRA 5DDIP 4UAGA 3GRPA 2BFAA 1NWCA 5JO9A 1Q7BA 1C1XA 5EQDA 5JW6A 3IP3A 1GZ6A 1PJQA 3KETA 3L6DA 2YQ5A 1RM5A 1VSUA 2Q1TA 4L0QA 3VPXA 4MIYA 4XYEA 4A7PA 2C20A 3GVPA 2H1SA 3L6EA 2QHXA 5KKAA 2EG9A 1PL7A 3OQ6A 4L74A 3VPHA 3I9KA 2AQIA 4TVOA 1J5PA 1EZ4A 5EIOA 3GVHA 4XGIA 3PJGA 3PIIA 4I5GA 4OYRA 4YT5A 5DCWA 5B37A 5THQA 4G2NA 1GD1O 3UF0A 4RDIA 4E5KA 4PG8A 1I2BA 2C82A 4U6SA 3SLGA 4BL5A 4BNGA 4RZHA 2CF6A 4P4LA 2Y99A 2Q49A 3CE6A 5IN4A 2P9EA 1E3SA 1WP4A 1YONA 3V1YA 1HLPA 3JQ9C 3GC6A 1UUFA 4UEKA 4WOJA 5L4LA 3E9QA 4QEDA 3WGYA 3ZHBA 3JQ7A 1W0CA 4J7XA 2H9IA 3O9ZA 4ZVVA 3EVNA 3JQ6A 3NV9A 5B4TA 1XGKA 4KUHA 3KYCA 4D7AA 2PK3A 4U5QA 4KWHA 2SCUA 1KC3A 1ZNQO 1U7TA 2YQ4A 3OETA 4W82A 4JBGA 1NWHA 4K9DA 4OM8A 5GZ1A 1HZJA 1E7QA 1IE3A 1GADO 4RVHA 3ANLA 2CFCA 2FP4A 2UUPA 1B8UA 3IP1A 4MKRA 1D7OA 5KCZA 3JQAB 4CM9A 5K9ZA 4O6VA 4GH5A 4KDEA 2VWGA 5G2OA 4YRBA 2EEZA 2IYPA 2ZYAA 3JD3A 3DBLB 2EXXA 4Q3AA 4XIJA 5ILGA 3T4XA 2CVZA 5A1TA 1KVTA 4OSPA 2V6GA 3EY4A 5DOVA 3RUFA 4M49A 1U3VA 3AI3A 3SC6A 4S3MA 5DCUA 1GUYA 3DZFA 1UXHA 3AFMA 3G1TA 3INGA 4GX0A 5C7OO 5BSFA 5T67A 2OUIA 1MC4A 2XAAA 5JMPA 2XPCA 2OP1A 1EDZA 2NM0A 4YAEA 3OSUA 1LDNA 3WQQA 5IDQA 3KZVA 3L6OO 3V1TC 4IINA 4R1NA 2X4GA 1DB3A 2NU6A 2HK7A 4YJDA 2CZCA 3ZU2A 1LDBA 4YRAA 3EGOA 3IMFA 1QV7A 3F6YA 3ICCA 5EPOA 5KVVA 1HEUA 5I7SA 2AMFA 5COAA 3Q6IA 3VPGA 4DLAA 4JQCA 3V2HA 4MVJD 3AOEC 1B0AA 4TRMA 4XQCA 3C7AA 3JQAA 2YV1A 4ID9A 3ZWYA 4DPKA 1EFLA 2RHCA 4FS3A 3OA0A 4EYEA 4ND4A 3DBLA 3RBVA 3RFTA 3VPFA 4CV3A 3JYPA 5L53A 2GD1O 2OMEA 3MJCA 1BHSA 1R4NB 4FBGA 4KTVE 4IDCA 3DZIA 1XSEA 5DOZA 3ZV5A 4NJMB 3NT2A 2OXIA 4BNHA 1U2GA 1Q0HA 2EKQA 5CG2A 4HKTA 3NEPX 1YBMA 3L9XA 4IGEA 1ONPA 2ZKLA 1NFFA 3PWZA 1GL3A 2W2KB 3R3JA 3ZV6A 5COBA 5BSHA 3JV7A 2YFHA 1O95A 5JAQA 3H6KA 3RC7A 2RCYA 3HDJA 3JQCA 1LQTA 5TIIA 4MP8A 3RFXA 5F3RA 2JCYA 3KYBA 1C1DA 4PZDA 1WZIA 1ZK2A 4RGBA 3W8FA 3UUWA 4E6PA 4RVGA 2JCVA 3IUPA 3K31A 3TQHA 3EC7A 4MP3A 1WPQA 5JFOA 5FYDA 1C14A 2J5RA 1Y9AA 1BDMA 1XDWA 3D5TA 1M75A 4FOSA 3SLKA 1XG5A 1ZMOA 3QSGA 1YWGO 4EITA 3VZPA 3ZNQA 3KHUA 4IBOA 3H9QA 3EZLA 4EJMA 1LTHR 1ZW1A 4Q9NA 1ISGA 2RAFA 3NJ8A 2Q45A 4CLRA 2BGLA 3EDMA 3ULKA 3KEOA 3RU7A 5KJFA 1JA9A 3HDHA 4A27A 1R4NA 3IKTA 2YV3A 3FPCA 5I8WA 2IEDA 2B4TO 2Y0EA 1Y8RA 1YVEI 4GQAA 4NJMA 4PRLA 2V7PA 4AFNA 3ZV4A 4BO8A 4IQ8A 3FF4A 5F1OA 1HTBA 3JYOA 1JDJA 1HSOA 4XWYA 4BKPA 1G0NA 3PWKA 4B7UA 3SEFA 1UR5A 4YR9A 2ZATA 3TOXA 2NSDA 3RUHA 4I5FA 3AU9A 4RF3A 5T8KC 2IYOA 1P45A 3E9NA 4W9NA 3IQDB 3WDSA 4EUFA 1BSVA 2B5WA 4WPGA 5IDYA 3WG9A 4BNWA 3JYNA 4RJTA 3LLSA 1JW9B 4IMPA 1PTJA 3RC9A 2DC1A 4LCJA 1MXHA 3DWFA 1CJCA 3I4CA 3OECA 1NVGA 3PQDA 1KEWA 4I8XA 3FD8A 1PS0A 4CM8B 3ETEA 4RPHA 3Q1LA 1NQOA 2NU8A 2EJVA 2NACA 3RUDA 3JQDA 4JCOA 4DQXA 1GUFA 1YQGA 2EIHA 4FC6A 1F0YA 3NT4A 3ZI0A 4PLWA 3W6UA 5BT9A 4P22A 2F1KA 3U4CA 1R0LA 4NBTA 1D8AA 2DKNA 4Q3EA 1IPFA 2AA3A 3D4PA 3Q2IA 1U8XX 3PZRA 1WMAA 3JYLA 1ZK3A 2YJZA 4CR8A 2NVWA 5JCJA 2I9PA 1T2AA 1UAYA 1IOLA 1B14A 1H93A 3R3SA 1O5IA 3LLVA 4CQMD 3FWZA 2Z1MA 1PL8A 1T1SA 2EW8A 4II3A 5TT0A 3IJPA 1PJ2A 1AE1A 1LRKA 3H9UA 3JQBA 2Y66A 1PJ3A 3WQSB 4J16A 1UXGA 2PKQO 3K92A 4P8RA 4DIOA 2NVBA 1ZSYA 5KJCA 1MA0A 2GSDA 5TT1A 4S1VA 3RC1A 1OC4A 1XWFA 2VHXA 4B79A 2WE7A 4E13A 2E49A 4MIOA 4CM8A 2Y1EA 1GQYA 4AJIA 3OJEA 3UHAA 2IE0A 5CFZA 2JD1A 1SEPA 4ZU3A 4BO5A 4YYZA 5JY6A 5EERA 3TWOA 4JIGA 3WNVA 2Y0CA 3DAPA 3EAGA 4HNHA 1PZFA 4KP7A 4RPKA 5L7TA 4EW6A 2C0CA 2Q46A 5DT9A 1CERA 1H0KA 5K6AC 3MCVA 3V5NA 2W2LD 5DP2A 2JHGA 3PJEA 1SZJG 4GVLA 1B8PA 4N7RA 4YJFB 4Q39A 3ITKA 5JLAA 1GCUA 3OIGA 3QWHA 1Z74A 4BVAA 2R00C 3ZHXA 3OJLA 3FTNA 1GZ3A 1TXGA 3I4FA 4GI2A 4WLOA 4E2ZA 1I3KA 5AXCA 4BS9A 2PH5A 4QUKA 2HDHA 1PGOA 1F8FA 3AI2A 4YA6A 4CUJA 2EP7A 1B7GO 3GF4A 4I5EA 4TROA 1NM5A 5AOVA 5F1PA 1PJLA 2FZWA 3C7CB 4BNVA 4YCAA 2NNLD 1P31A 4B4UA 1ZSNA 2DM6A 4D44A 2POQX 3JQFC 1KERA 3H8VA 1QMGA 3KOUA 3ZWOA 2PZJA 3QWFA 4AJNA 1KEUA 2PA3A 4GGPA 3QW2A 2HRZA 4RLSA 3OJOA 4DREA 2JAHA 1EBUA 3DHNA 1EE2A 4ND3A 2X23A 5IXYA 4I9UA 1KY5A 6ADHA 2IZ1A 2VNSA 3U62A 2Q50A 1GPJA 2AXQA 4B4OA 5ITVA 1DEHA 3MOGA 4PFJA 4CV2A 1XELA 3Q2KA 3DBRA 1T2EA 1X0VA 2HSDA 4YJFA 1CF2O 4LN1A 1P44A 2O3RA 2NQTA 4R9SA 5DULA 3DB2A 1R0SA 4Y98A 1VSVA 3RIHA 5C7IO 3MWDB 4UUMA 3C8MA 1RYDA 1SEVA 1UDBA 1GCOA 2D3TA 5JY1A 2LDBA 4JJFA 4DGSA 3JQ8B 1FDWA 3LT2A 4OXNA 4R1SA 1BXGB 5LDHA 4H7PA 2ZB7A 2J3HA 5H83A 4E2WA 2CUKA 3ASVA 1U3TA 1JQBA 5ILOA 4ND5A 2V6MA 1SMKA 3D3EA 5G0UA 1FDVA 3WSWA 3FN4A 4IDBA 1E5QA 3G49A 3O03A 1B8VA 5EESA 4J0FA 2HMWA 1UXKA 3GPDG 4RV9A 1R66A 2PTGA 3ZWXA 5HS4A 1QYXA 3B70A 5EN4A 3R6DA 5EMHA 4HXYA 3JD2A 2PD3A 1Y5MA 2Y0DA 1BWSA 3ON5A 3PFFA 2OL4A 3GFBA 4H3VA 4R54A 3WGHA 2C7VA 5CEEA 1Z45A 4D3DA 1NPYA 4AL4A 4RVDA 2HMSA 1HL3A 4E31A 3MZ0A 5G0SA 3JSAA 4K26A 1F14A 1V35A 3BMNA 3VH4A 5BQFA 3GY0A 4EEXA 3A28A 2TMGA 3GVCA 4BKUA 4EZBA 2WD7B 3ZW8A 3OIDA 4G5HA 3BMOB 3GFGA 2OFPA 1QSGA 3HB5X 4BNXA 4J90A 2VWPA 5ES3A 1P1FA 3JQ8A 4XQ9A 2Y68A 1BXGA 4TKMA 4F45A 4MKZA 4CMBA 2WD8A 1R12A 4MDHA 4CM4B 5L9AA 4GAEA 4YT2A 3SJUA 2H63A 3SXPA 5G0WA 1HDXA 3PHLA 1WAMA 1PQUA 4E3ZA 4IJKA 2WYWA 2G76A 2H6EA 4O5OA 1JLLA 4DPLA 5JAZA 3S8MA 4BKRA 4YQYA 3I9JA 5IZCA 2B4QA 3ZW9A 2VRCA 5A4DA 2IXBA 2Q1SA 4YPOA 1Y8QB 5I8ZA 3BA1A 5JS6A 3MJVA 1ZEJA 4JBHA 4M55A 3PHGA 2J6IA 1A4IA 5HA5A 1M6HA 2FOIA 2CY0A 1OAAA 3F4BA 1A9YA 4OXYA 1ZJZA 1WDLA 5TSDA 1J4AA 2IXAA 5FWNA 1T1RA 2WD7A 3RI3A 3ZV3A 3PYLA 3H9GA 3LF2A 3BMOA 1NHGA 3GAFA 4AJ2A 4MJLA 1NP3A 2PFGA 1H2HA 2C7GA 1U7HA 3QIVA 1NQTA 4DMLA 4W7IA 2NU7A 1YBAA 1LSJA 3GDOA 5T64A 5CAEA 2FHSA 3VPSA 1K6JA 5GZ6A 3NUGA 4CM4A 2X9VA 3RC2A 3OFSA 2BLLA 4OGWA 3WNQA 3K8ZA 4WASA 4XR9A 5IXSA 1YH3A 5ER9A 3F1LA 5CG1A 1X0XA 1EVJA 2VUUA 1ADFA 1ZFNA 4NI5A 3PJDA 4UULA 1PQPA 3NAQA 1E6WA 4UVIA 2UUOA 3WIDA 4HFJA 1IHXA 2FPPA 3E6AA 3IS3A 2A94A 1Y8QA 3G3EA 3RFVA 4E30A 3IJRA 1O0SA 3EW7A 4FPXA 3BYZA 3VDRA 2ZCVA 4AJLA 4YXFA 5J23A 3GPIA 1RWBA 1VL8A 5MGBA 3TSCA 4Y6RA 3S2IA 2NVUB 1K5HA 4XJSA 1DXYA 3DOOA 3U3XA 2X5KO 2PLAA 4PLPA 2Y1DA 3UVEA 4IDAA 4IJWA 4MVJM 1ZXBA 4RVSA 1N7HA 3ETDA 1SCUA 3LQFA 3PEFA 1BVRA 1Z75A 4RF4A 3FNEA 1HDCA 3ANMA 5L51A 2ZB4A 2BFPA 1LDMA 1PEDA 2WJPA 3TRIA 2OHXA 1QYWA 4Y8VA 5JE8A 4FFNA 5JDCA 3FNHA 2F00A 2HMTA 4AG3A 2J5KA 4ALJA 4BO3A 1KOLA 4BMVA 1RPNA 2B36A 4TWRA 2P2SA 1E7RA 3WBBA 4IZHA 3NT5A 4HV4A 3B1KA 4AJOA 2Z95A 4CL8A 1PX0A 3H5AA 1DC4A 2FR0A 1LDGA 1EUZA 3K2EA 4UREA 1NVTA 3D4OA 4EJ0A 1H94A 3BMQB 4GBJA 4XIYA 2FMUA 1E77A 1LLUA 3LDHA 3ZU4A 4CLXA 4BNMA 4TVBA 4DC1A 1F17A 4AJ1A 4U8GA 1LI4A 1M6WA 2CVQA 4XDYA 4WOKA 4BNIA 2ZJ1A 3E9MA 4J3FA 2DBQA 1ZK0A 3HFGA 1PR3A 4IM7A 4BGVA 3LU1A 2FN7A 4W9NC 5U9CA 3I6QA 3E8XA 5BSGA 4D43A 1DFIA 3L77A 2EJWA 3AWDA 1L1FA 3GT0A 4QO7A 3IDSA 1QYVA 3QJ5A 3V1UA 4DBZA 1AN9A 3EHEA 3WB9A 2X5JO 4BV8A 3F5QA 1A9ZA 1U3UA 4YT8A 4H15A 3C7DB 1TA4A 3CH6A 4I9NA 3DBHB 1KY4A 4IS2A 1T2DA 2QG4A 1T24A 1D3AA 1U4SA 4R1UA 4CM9D 1EFKA 4BGUA 3DMTA 1UXIA 3I9OA 3M1LA 4QO8A 1P0CA 3AM4A 4E21A 2FSVA 1J49A 1F8GA 3BMQA 3W1VA 3AUTA 5CDTA 4FIZA 1I3NA 2Q1UA 3FCOA 4YDRA 5CPBA 1R37A 1ADCA 2JCXA 3OEWA 4M87A 2I65A 3GZNB 5DBFA 4HFNA 4RF5A 4WNCA 3D7LA 9LDTA 5JC8A 4LVCA 5FEUA 5C7LO 5TJ9A 1LLCA 1KS9A 2DUUA 4LRSB 1ML3A 4YJGB 4D42A 1BTOA 4DLBA 1CEQA 4L4XA 5DZSA 4IQ0A 4A26A 1W4ZA 3VH2A 3C24A 2YUTA 3ST7A 1UZMA 3BIOA 5A5EA 2HQ1A 3GQVA 1MB4A 4L9RA 2FR8A 4M86A 1Y81A 4J9UE 3WYCA 4ZD6A 4GKVA 4ZQEA 2VQ3A 1KC1A 3H2ZA 1VLLA 3HSKA 4LISA 4J1QA 1Z7EA 4ZRMA 3VKVA 1CQIA 1K6IA 1A7AA 2ZB8A 3DBHA 4I08A 1PJTA 3I5MA 4Q3CA 3L07A 2Y1GA 1SOWA 1YQXA 3BHMA 3P2YA 3FPLA 2UAGA 4B8WA 3AUUA 2NTJA 5B4UA 5C3MA 3WTBA 3RUCA 1N1EA 1ADBA 1FF9A 5A3JA 2UVDA 4EI2A 2ZTMA 5BR7A 2VZ8A 4OXKA 5DN9A 2Y05A 3SC4A 3GZNA 1DHTA 1BXKA 1GYRA 4NIMA 4XD2A 4QFCA 4D0RA 4BO0A 3FI9A 3OH8A 2HRBA 4PZCA 4YJGA 3D0OA 2CF5A 2YHUA 2JD2A 4NH4A 1U28A 2GN6A 4BMSA 1KEPA 2QZ9A 4N18A 4KQXA 5A03A 4XZ3A 1FXSA 4GLOA 4O59O 4CV1A 1QLJA 1EVIA 1DJNA 1I8TA 2Q99A 4UUPA 1I32A 2OO5A 1DC5A 3AI1A 4B3HA 4J4BA 5JCXA 1Z82A 2WM3A 3MOIA 3WFIA 4E2XA 5B12A 2X1HA 2VHYA 1YOVB 3FSRA 2WE8A 3BTVA 4ZQFA 4LMPA 1O9BA 4YB8A 2GNAA 1LDYA 1XKQA 2AEFA 1C0PA 1EBFA 3ZDFA 4E5PA 3HJAA 1WVGA 4Y9DA 2GZ1A 4YAJA 5HRUA 2G17A 1OZAA 4QXMA 4BNYA 3WMXA 3VZRA 2VYVA 3WJAA 1I30A 4CLDA 3DZKA 3CTMA 5DNAA 1N5DA 4KUGA 3OBBA 1BMDA 5GMOA 4JP2A 3ZWMA 3MJ4A 4XJTA 1N1GA 3PVZA 4CJXA 1X15A 1MUUA 4J7CA 4YTEA 5TLSA 1PWZA 2E37A 4R5MA 4O0LA 1PJCA 4UUOA 1I01A 2FRDA 2O3QA 3PQEA 3PJFA 4NDNE 3C1TA 4ZHSA 3M2TA 3QVOA 2ZYGA 1DIGA 2PWZA 1YJ8A 4Y6SA 4Z0HO 3RKRA 2HU2A 4PVCA 5IAAA 4J49A 1A5ZA 2PD4A 2XOXA 5ICMA 3OA2A 3GNTA 1YXMA 2EERA 1YOVA 2VYNA 5C5IA 4HNGA 3KLPX 3KVOA 1UDCA 2DBRA 2GZ2A 4UEOA 2EGGA 4B7XA 3CMCO 2DBZA 4E5MA 1GV1A 1U4OA 4KUEA 1JKJA 3HNPA 1DDOA 1EQUA 2AQ8A 2VHZA 1U3WA 3OP4A 4BO7A 3W4IA 3GNSA 1LDEA 4NK4A 4WNIA 3KTDA 1K3TA 4HP8A 1ADGA 5JPIA 3E48A 1ZEMA 1HDGO 2BFMA 4J6FA 3M2PA 4XQGA 3ORFA 4BQPA 2X9NA 1BW9B 3GHHA 1OBFO 3O4RA 3QA9A 1DOHA 4MVJF 4R4JA 3S2GA 2PKQP 2RIRA 3GEDA 1JAXA 1LXCA 4XKJA 1PGNA 1IHYA 5JCJD 2VHVA 2QYTA 4UEJA 2CVOA 3O8QB 4ZJUA 2BGKA 2IZ0A 3E1KA 3GZ4A 4RDHA 4WCDA 3UICA 2GZ3A 2O50A 1V8BA 3MJTA 3D1LA 3S55A 2JHFA 5COQA 5CPFA 3VAZA 3U5TA 2VT3A 1AHHA 3X2FA 4D0SA 2YYYA 3KEQA 3Q0EA 4PRKA 4X54A 5CDUA 4IGFA 4IJUA 2GPTA 1JU9A 1KYQA 1YB5A 3FR8A 4PZEA 1EK6A 1PZGA 2W2KA 2X0NA 4EDFA 3UXYA 1NVMB 2UV8A 3GEGA 2BFOA 4B7CA 3OF2A 1R0KA 1LRLA 4OOEA 1E3JA 4XEHA 1WW8A 4AJHA 5IZCC 5IZ4A 5L45A 1ZKMA 3OM9A 2RBEA 3QWIA 2BRUA 4MVJA 5DBIA 1JVSA 5H82A 1Y6JA 1M76A 4BIIA 1TT5B 3GHYA 1EMDA 1P9LA 4MINA 1CRWG 3ZWBA 3RUAA 4QT0A 3UFXA 4CODB 3HHPA 4JGBA 2FZEA 1BW9A 4CMEC 2O4CA 3NGXA 3FRJA 4UVHA 4ILKA 1HETA 1T4BA 4NNJA 2XF8A 3ONFA 1A4UA 2JAPA 4WLVA 1GFSA 1LSSA 1ISIA 4DIBA 3U4HA 1AXGA 1W8DA 2Q2WA 1F12A 1IYZA 2PGLA 2X9GA 3GRKA 4E0BA 4O1MA 4RPJA 3Q3CA 4B8ZA 1GQ2A 2P9CA 4R3NA 1V9LA 2GASA 2I99A 4XQEA 2V6BA 2OBYA 3ADPA 4YBZA 4GKBA 1T2CA 3GNQA 3PYXA 3PXXA 4E4YA 1N7GA 2VOJA 4P4NA 1ZH8A 3CPSA 3TZHA 4ZQGA 1NFRA 4GLLA 1K89A 5L4SA 1YO6A 5IG2A 2NLOA 1JWAB 4PG4A 2QX7A 1N92A 5IDXA 4DUPA 2AHRA 1UAGA 1DIAA 2AEMA 3H65A 4GSLA 1GPDG 3GVXA 1DC6A 4NU5A 4TZTA 1TVEA 3ZN2A 4DYVA 1EVZA 5DP1A 2D5CA 3AY3A 5U4QA 4BO6A 1EDOA 1P1HA 5DF1A 4Q3BA 4INAA 5IFLA 1M66A 4BGIA 3HFSA 1ISFA 3NTQA 3ASUA 3PPIA 4PG6A 2CNBA 4RVUA 2IODA 1X7DA 1OI7A 3I9NA 3UW3A 3I6IA 4P4GA 3WQRA 3BAZA 4XCVA 4A0SA 3QY9A 4Z0PA 1U2DA 1I5RA 5JDCC 3WYEA 1VJ0A 2WWRA 4J4HA 3WIEA 4QECA 3U9LA 4D46A 2BI7A 1DFHA 4GMGA 4CQMB 4ND2A 1B15A 1DRWA 1AUPA 1KETA 2FPGA 1M2WA 4XA8A 3GMDA 2JJYA 3L4BA 4DBVO 3LVFO 4R5HA 3B1JA 1DPGA 3LF1A 4C7JA 2BKAA 1HKUA 4HUJA 2X58A 3WJ7A 3A14A 2VUSA 5TRTA 2I5PO 4D41A 4KTTE 4WLUA 4LW8A 4NMHA 1SB9A 1IL0A 5ENDA 5I9NA 3P7MA 3TZQA 1LJ8A 1XA0A 4OQYA 1LUAA 3I52A 3IKVA 3RAJA 2YHIB 4L75A 2NUAA 3QVSA 4C7KA 4A5OA 2VT2A 1BG6A 3JD1A 3TZCA 2X7HA 1BDBA 1LRJA 5AQ1A 1E3EA 1UJMA 2I66A 3H5NA 4CMHA 5B4VA 4ALMA 1PJSA 2DBVO 4K28A 2B83A 1O6ZA 3SBOA 2VTEA 5F1KA 3PIDA 5CHEA 2HKIA 3H3FA 5A9SB 3W6ZA 1GR0A 1B3RA 2AQHA 2Y1OA 2D8AA 2X6TA 4HADA 3D64A 4NG5A 4CMCA 3M1AA 1HYGA 4NFHA 2AG5A 4NPCA 4WEOA 3C3XA 1L7DA 4J0EA 4AJKA 4CQMA 1Q2XA 5JXWA 3ENKA 4CL3A 1FDTA 2HCTA 5BNIA 5KIAA 3IOYA 4PCVA 2BELA 2C5EA 3DMTC 2VOEA 4JN6B 1GYQA 3BTUA 4CPDA 1K0UA 1R16A 4ZGWA 3ETGA 2O7QA 3K30A 4ESOA 4Z6KA 2QRKA 1E0DA 2P68A 3F1KA 2G82A 4WLNA 1NHWA 2YHIA 3K9QO 4B3JA 1KVQA 1VI2A 4LK3A 4CLOB 4E12A 2VRCD 4R01A 1VJTA 4TKLA 2XXBA 2A4KA 3OHSX 2QZZA 2GN8A 1U1IA 2NQ8A 3ENNA 3JCZA 1HSZA 3AFNA 3A9WA 3PQFA 3ZWNA 4HFRA 3ROKA 1YKFA 4WJZA 4ALKA 1IULA 2P5UA 4WUVA 1KBZA 2RH8A 2X22A 4YAIA 5A9SA 4JJIA 1PGJA 2C2YA 5IN5A 3NTRA 2AQKA 1C0IA 1Q7GA 3PGXA 1HDRA 3CZMA 1S6YA 4ZA2A 2DU8A 2GF2A 3WLFA 3TJRA 2O3TA 4G81A 2O23A 4NFYA 3LT1A 2RH4A 3HB4X 4OQZA 4DMMA 3GEMA 1XQ1A 1ZVMA 3JQEA 5LDGA 3ZU5A 3HDQA 1HF3A 1I3MA 2AW5A 3GAZA 3DAFA 5K0ZA 1SAYA 1TEHA 3S1LA 3BXXA 3AUAA 4KOAA 1NXQA 5A02A 1E3WB 1WLYA 4IZIA 5EQFA 2EKPA 3UGKA 1E7WA 3L9WA 3B1FA 4GX1A 2VN8A 4YJHB 4BHTA 2BGMA 3D4NA 1OC2A 1IUKA 1XU9A 1SO8A 4OKNA 2GO1A 4YACA 1D1TA 5A04A 2BH9A 3QP9A 2B37A 5KJ6A 2DQ4A 1LC3A 4OIMA 1EEHA 3WGIA 3LT4A 1QYDA 1V6AA 3PDJA 2PGJA 5ER6A 5HTOA 4JLWA 5L4NA 3WGZA 2A35A 4RQTA 2O3UA 3AJRA 3VTZA 2DAPA 1I0ZA 4Q3NA 1SPXA 4L4RA 3WGOA 2PZLA 3ITDA 3E5MA 1ZK4A 1U8FO 2OGUA 3KSDO 4PG5A 4J1NA 3H5RA 3ZHYA 5CDGA 1MX3A 3KYDB 3WICA 4P38A 4PLCA 4RO0A 4XDZA 1XHLA 3RUIA 2NV6A 5KJEA 1E92A 3DEYX 4CM7A 2PKRA 5AXDA 4L4SA 5TNXA 1E3WA 2BF7A 3QWBA 4D45A 2Q3EA 4YT4A 3VTFA 4BV9A 3CZRA 3I23A 1HZZA 1UDAA 2NTNA 4GX5A 1ISJA 4PIVA 4YJHA 4DIFA 4BNKA 1I3LA 4PLYA 1VC2A 2AG8A 2WDZA 3KBOA 1KVUA 2YDXA 5IJZA 1PR9A 5LC1A 1UZNA 2EP5A 4F6LA 4CUKA 3U0BA 4RCVA 1EE9A 2J3IA 3DHEA 3OQ1A 2W90A 4RPLA 4BO2A 1GAEO 2UYYA 1CQJA 5B1YA 2GRAA 2QYSA 3W4JA 2O4UX 1RM3A 4JX8A 5THKA 3TNLA 2VTDA 5AYVA 4FCCA 3DR3A 2AE1A 3OQBA 2P5YA 4NZ9A 4J1TA 4BUCA 1E5LA 1YDWA 1DIRA 4GVXA 4IXTA 4TMFA 1TB4A 2ILTA 3IL2A 2EWMA 2FSSA 1C0LA 3O26A 3H9JA 4DWVA 2V6FA 3RBXA 1Y5RA 4JJGA 2PV7A 4GWGA 3CKYA 5JYDA 1N8KA 1D1SA 4YVFA 4ALNA 2Z5LA 3HWRA 3AY7A 3P2OA 2OBNA 1LC0A 2VWQA 1UP7A 3EK2A 3PHJA 4ZQBA 3FBGA 5G4KB 3RQSA 3V8BA 3CINA 1YB1A 3KLMX 5KNLA 1ONOA 4WLEA 2BI8A 5JO0A 4M54A 3DXFA 4OO3A 2VCYA 5JSFA 2CSUA 3F47A 2B0JA 1DAPA 1YB4A 3NX4A 4GPD1 2EF1A 3MEQA 1JWBB 3VVCA 3EUWA 4XGKA 2BHLA 4BNZA 1O8CA 3KUXA 2RHRA 4TRJA 2V65A 1EUCA 1DRUA 3CEAA 1NASA 2Y1FA 4MVJE 4TSKA 4PLVA 5L40A 4XX0A 5BNFA 1YL5A 4CR6A 4NBRA 2PZMA 1C1XB 5A5FA 3RKUA 3GG9A 2NVUA 5L3ZA 2R00A 3I9LA 8LDHA 3P5SA 2O3JA 4CMIB 4K6FA 3ZNPA 1NYTA 4BKQA 3AM3A 3AM5A 5GZ3A 3PDUA 1DAOA 3ONEA 5TGDA 4XYLA 4XRRA 1W73A 1LQUA 1WZEA 5I7FA 4NBUA 1AXEA 1UH5A 4RORA 3LC7O 3B6ZA 1MC5A 1ULSA 4W4TA 2R6JA 4TZKA 4WE3A 5G4KA 3EMKA 2JFHA 3ZWVA 4ALIA 1HDOA 3UCEA 1YDEA 3B20A 5L7YA 3H3JA 4WK6A 4BO1A 1YL6A 3JQFA 3KO8A 2IEBA 4U0JA 4UVEA 3IUSA 3X2EA 1P77A 4BO9A 4ND1A 3F46A 5T6BA 1GQQA 3A06A 5ICSA 1ZUD1 4FDAA 4MVJI 4W99A 4CV0A 1P33A 3PFWO 1PL6A 1VKNA 3DOJA 2D4AA 4FGSA 3GUCA 1KIFA 3FTPA 3VH1A 3WS7A 4JNKA 1PIWA 5TF4A 1ZMTA 1LEHA 1FDSA 3JYQA 4BNTA 4IDGA 5KOIA 2DPGA 3INTA 1YBVA 4R69A 4BKOA 3VC7A 4JXKA 4U6QA 3IAHA 3DFUA 5ITWA 3WGTA 4CM5A 3JQBC 1OMOA 1ENPA 2JKVA 3K2BA 4CMIA 2EHDA 1SBYA 3FWNA 3OMLA 1RM0A 3UN1A 4ROSA 3GN2A 1N9GB 1QR6A 2LDXA 4FFOA 2Z1NA 3ANNA 3DC2A 2X0JA 3TOZA 1KVSA 2VYVD 4K1LA 2A9FA 4NQZA 4ALLA 5A3VA 2WMDA 2HLPA 3H7AA 1LSUA 4ZQHA 2I76A 1HYHA 1VL6A 3ABIA 3HQ4O 5TC4A 4A73A 4OJNA 5CP8A 5EINA 3QLJA 3ICPA 5FI3A 4JK3A 3DOCA 3JQAD 4QX6A 4RVFA 1ZO8A 3QVWA 3DQPA 3NDJA 1KEVA 4FFPA 3W8EA 1VKOA 1W6UA 1HE5A 4XB2A 1ZK1A 3RSHA 3C1AA 1A7KA 3WGGA 5AXAA 3WR5A 4CLEA 1R4MB 1E1LA 4R68A 2E6UX 4U7WA 4CM6A 1NR1A 3WFJA 1IY8A 1OOEA 3L4BC 1RJWA 5T57A 5JNLA 2DTEA 3DMYA 3DTTA 4PGFA 1BRMA 1QLHA 3N7UA 2VYND 3WX0A 2J3KA 5JDIA 4PG7A 3DZJA 1Z6ZA 3MWEB 4N54A 3UKOA 1GEGA 1H6BA 2I6TA 3LYLA 4FJ1A 4FGWA 5HBRA 4TRNA 1NAHA 1N9GA 4QFDA 5JMWA 1P1KA 2W4QA 3DAGA 4M89A 3ZWWA 4C4OA 4BQRA 4I9HA 4J43A 3GDFA 4U0KA 4M1QA 1B3BA 1F06A 4FN4A 3OEYA 2GN9A 1IZ0A 1V3UA 3CIFA 1ENOA 3TDKA 3K6JA 1QG6A 3A4VA 3LK7A 4IPTA 5L95A 4B4WA 4NBWA 2QQ5A 4BNUA 1MFZA 3GGPA 3ZWCA 2GCGA 2PH3A 4RZIA 1NTOA 3WMWA 2Q2VA 1YL7A 3WSVA 1QKIA 4G65A 4B4VA 3PZBA 6LDHA 1PZHA 2ZK7A 1WDMA 5TS3A 2X0IA 1H5QA 4MIEA 2NWQA 1JKFA 2O3SA 3NDRA 1AGNA 2NTVA 1R4MA 2YDYA 2YFQA 1RYEA 1ISHA 3KRTA 3DZGA 4FD3A
chains in the Genus database with same CATH superfamily
3BTSA 5LYYA 3G1WA 5FI5A 2BHNA 3B5EA 3TE6A 4ETIA 3AEXA 4WGGA 1H4QA 2DBYA 2PNFA 1UP4A 3GGCA 1QHSA 2I4TA 3GU3A 4KAAA 1Q21A 1Z4KA 4K88A 4POOA 2Q9CA 2XTNA 1NJGA 2GM5A 3UCXA 4DUGA 4YUWA 5IFKA 2ZZMA 1CR1A 3FKSA 5GIOE 4Q00A 3JTEA 4BLQA 4OQEA 4RSRA 3W3ZB 4Z9AA 5KPDA 1ZWLA 3PQCA 4I55B 2XWQA 3INNA 1HQYE 4GNRA 4MK4A 2QE6A 2ZYDA 3C4JA 4MWEA 5DIZA 3BWDD 4CEJB 1T29A 1JA0A 4FMCF 2H5LA 4IEEA 4FGLA 1R0RE 5TX7A 4ZC1A 4AXXA 1X7XB 1OXSC 1R15A 2R84A 3INYA 3OZIA 1COWA 5D6NA 1DOAA 4R51A 2YV2A 3AJ8A 2JLUA 1II9A 2HBYA 2FFBA 5DHTA 1UBMS 2H7YA 4EVRA 2Z4SA 1J2RA 1L0BA 2FSUA 2R79A 5AOBA 1XAIA 3U80A 1YIAA 1BNCA 3BE8A 4Q34A 1G5FA 1DINA 3KUKA 1WNTA 3PRYA 5B2ZA 4TXMA 5HJ2A 5BO5A 5M2QA 4PAWA 3SE0A 4DXHA 1WMSA 1ENZA 2PX4A 3E8MA 3K53A 3HG7A 4N1AA 4OHUA 3Q3GE 1M0WA 3PA8A 2QVYX 2XA9A 1DAIA 3IT2A 4DPMA 1GCGA 2HSWA 2O5EA 3OCYA 4TLAA 5JCOA 3AU8A 1T2VA 4KMRA 2I2CA 5HZKA 2O2SA 1WETA 2QK4A 5J40A 1SQ6A 3D3NA 3MTBA 1I2ZA 3DD1A 4UNSA 3SX2A 2HY7A 3WLEA 3MTJA 3H6HA 3NHUA 1VDMA 1P2FA 2QUKA 4RZQA 4KQ1A 4CMAA 3KZXA 3RIXA 3AY0A 3LLUA 2WZQA 4EGFA 5EZ5A 3QX3A 2CUZA 4D0NA 3D7MA 2Y71A 3L0DA 4RZ2A 4F6RB 4UMVA 5LWQA 4MW6A 5LWHA 2O8BB 1JHRA 1WD5A 2VHEA 1DHRA 1Z2DA 2C2ZA 5B6IA 3DYIA 1R10A 1ZH0A 4I81A 4LVUA 3PQ4A 3AF3A 5IF3A 3ZWPA 3I62A 3MLBA 2Q9BA 4XW2A 1GNVA 4GOND 3I39X 1A9OA 2PJUA 4E7OA 4RELA 1MDBA 1L7BA 2GEJA 3GA0A 4KAXA 3KQMA 4OHMA 2I4NA 5A05A 5FEMA 3HSYA 1ECJA 3UH1A 4ISCA 1CP3A 3GL9A 4WCFA 5EIXA 3W5IA 1HRDA 4NCIA 1VGVA 1G59A 3QVUA 5YASA 3TPCA 2WKSA 4BMYA 1KEKA 1Q12A 3RQIA 3DDWA 4YJ2B 4IHAA 5A5VA 3DV0B 1R6DA 4ZEVA 4P92A 5EXPA 4HDNB 3HJHA 2H0RA 1RM4A 4II2A 4XJVA 3QBDA 1AJEA 2PUFA 4MKXA 1QCCA 4MJ7A 4YCLA 1RBMA 1QIDA 1C7ZA 2X0RA 1JMVA 5G0TA 4N03A 4CW7A 4CDRA 5A06A 3K0HA 2FWRA 3NJ4A 1FUYB 3SR0A 1GPAA 1LGYA 4D8VA 2I6QA 3AEUA 3DDOA 5A1JA 5IJ0B 2QF7A 2BWJA 2IYNA 1ATIA 5HCUA 3UAOA 2PUBA 4AWBA 1HT0A 4PSCA 3KXPA 3FWKA 2VZ9A 1IUPA 4J1SA 3VYTB 1DZIA 3QFTA 1KY2A 5KWIA 1OXMA 5KYYA 3OLQA 1IMJA 1YRBA 1KI2A 1HZZC 2X5OA 4OM7A 1XJCA 2I4MA 4TTVA 2ZVJA 3QFSA 4JQYA 5ALGA 3KQWA 4Z7QB 3EYWA 1ZKDA 2R1ZA 3A70A 1LTQA 3FB1A 2M9MA 3S4YA 3FHJA 3VOSA 2ZSUA 2O2GA 1RFGE 1GEEA 4JJKA 1ARZA 2LCIA 3IA7A 3INRA 4MNTA 3ZV7A 4BB5A 5LKRA 3TAXA 2WLTA 3REFA 1NP7A 2FLWA 4G26A 2ZIGA 4K8OA 3VKFA 3ZU3A 2QLBA 2IPOA 3KL4A 5AI9A 1EUDA 3OE7D 2G0TA 1U5BA 2WVHA 2I29A 3R76A 1Y1PA 3ZKWA 3I58A 2X3YA 3X2SA 1F0NA 1L5RA 1NN1A 2NU9A 3EHDA 1U0GA 3KM0A 5KNBA 1GTRA 2D5AA 3KV3O 3TRFA 4EKYA 4EEKA 2VDWB 1G1AA 2FZ5A 4J1TC 2XHEA 3P97A 4KX3A 3HYNA 1OWLA 4YS6A 4YGYA 1FYWA 2V96A 3W7AA 3VDNB 1XIVA 2CCGA 3AR7A 2XMPA 2XUDA 3CNHA 3BD7A 2UZIR 1AH2A 2PS0A 1E1MA 1CEXA 2GD2A 3PRJA 2HMVA 4ZCRA 2R68A 2AZ4A 8ADHA 3IUEA 1GNLA 4EFLA 4AF8A 1XLTA 1Y4UA 5E0KB 2JFGA 3M6MD 1NFQA 3JAWA 3SF0A 4BPRA 4H4CA 4GMKA 4HG2A 1BMQA 1YZNA 4E2YA 2ECKA 2WA2A 3BSFA 5A7HA 2JG3A 2OXTA 5LDDC 3I30X 4KLZA 3PGVA 3PK0A 1UZLA 2X8AA 4BJ3A 4D5GA 4PPGA 1JAZA 4S2UA 2PL3A 2OO3A 3BHJA 5K1ZA 3HDTA 1YR6A 2NVOA 4HEA6 3RAPR 3QLUA 3VZSA 3JQ9A 4MOWA 4OHOA 2GBPA 2PBFA 3V55A 2PYIA 3H9BA 3I61A 3A6JA 1FEZA 2DWPA 1H9AA 2DFVA 4DNPA 1G4UR 1TMGE 3VYSB 1HYEA 1IZ8A 2FY8A 1J1IA 4P84A 3H2SA 4NHEA 4YNBA 2IZ6A 2JCSA 3ZS8A 5EIWA 5DCLA 5FNVF 4HB4A 5DTIA 3EPKA 1D0VA 4GI1A 4NYJQ 3KZKA 3A6FA 3TD2A 3A2MA 1FNMA 3HVUA 4LDAA 1M6VA 3TLMA 2QUJA 2YJ5A 4D4MA 2D5LA 3I83A 4IXMA 1UBLS 4G07A 2FFJA 4X64B 2AR9A 3DW3X 5BUZA 4BVLA 3VDMA 2UZ3A 5LA6A 1N5LA 1KZ6A 2IV7A 3ZZNA 2BFCA 2R65A 4GE3A 4XB1A 4ZIRB 5JBIA 2R6FA 5IT0A 2WM8A 4AUEA 1WWKA 1SCIA 2FPIA 3NHBA 4P3KA 3TFOA 1Q0LA 5ICCA 5HUJA 2H08A 1NPDA 2G6TA 4OBWA 2RB4A 3RJ5A 4IUYA 3AEYA 3PB3A 3UH0A 4U39A 2BDUA 3DJFA 5DI9A 1GN9A 4KITB 3MMPA 2XE4A 4M0EA 3JD4A 4KW7A 3P2IA 3G8YA 4BVGA 2DECA 5JXJA 2ZB3A 3H1AA 2W2TA 3P9YA 2CNLA 4NE2A 1BEZA 2UU9B 1H3EA 3H4VA 5CEJA 1A1VA 5E38A 1T26A 4S1WA 4X90A 2OP0A 2ORWA 2ZQZA 1A4RA 1SB8A 1FK8A 2MSKA 1E2LA 3IESA 3QEBZ 3OCVA 3A7DA 3RHSA 3OUZA 3G0OA 1J39A 1QCZA 2PPVA 4PZ9A 5EYPA 4RTMA 2Q9UA 5JR3A 1YE3A 4Q9KA 5K0SA 3ORQA 2GPSA 2QT1A 2OFOA 2CBXA 1BKDR 3C5VA 4FSHA 4J4TA 5FOUA 1CYEA 4W1PA 5G53C 4Z3KA 1NNI1 2QVLA 3BH7A 3QQPA 3IDOA 4BZQA 1VRWA 1ZM3A 3GP5A 3ICVA 1BXRB 3OAAA 2XYRA 4GYJA 4JROA 2XE6A 3NMUF 3VDQA 3ZHQA 1CZLA 3GR6A 4R41A 2R8EA 3TGPA 3TZ6A 2CMDA 2GPAA 1QFSA 1ZGBA 2BAGA 2QM8A 2CEKA 3BQ9A 3F6BX 1ZM9A 2O2XA 1V8PA 3DBVO 1N2GA 4M1ZA 4TV8A 3N74A 4BB6A 2X0FA 1RC8A 1CKEA 1Q14A 2XT0A 4QEZA 1PJRA 1X7HA 1OA0A 3N5CA 3SNKA 5BSEA 1RAEA 4DLWA 5E6UB 2G5TA 1A5TA 1O96A 1AXRA 3CN9A 4LHYA 3T3OA 3TRKA 3C6BA 4FHCA 3HVHA 5LP6C 1AHPA 4L76A 2FR8C 3FUVA 2D7CA 3K2QA 1IJKA 4NE9A 5EL0A 5K0GA 2IDZA 3L7AA 4QQ8A 3QW4B 4W7HA 1Q0PA 2JIBA 2CDAA 3A25A 1C0KA 4LCEA 4C5CA 3IDQA 5JYEA 2OHIA 4LC1A 2I55A 1XD9A 1I36A 4IHJB 4EG7A 2XBLA 2APJA 4LDZA 2ZIFA 1KE1A 4B3TB 5AP9A 3RCBA 2FQ1A 2QL9A 4PVDA 3M6XA 4JB8A 3Q3HA 3ONWA 2IH2A 3RSLA 4XYBA 4E5VA 5MDHA 5BV0A 2XX3A 4CUZA 1EVYA 3FYSA 3CWZA 4DQKA 2EBUA 4ISBA 3BTOA 4Z4FA 1EK5A 2B3TA 1YI1A 4X20A 4H16A 3TR0A 2XNHA 5DHQA 1YRWA 4S1NA 1MTZA 4AVYA 1ZJYA 4JNCA 2P30A 1PQWA 1PWXA 4WTOA 4CQLA 4CZ2A 4TYQA 5AKEA 1T0UA 1EG2A 1TGYA 1E2UA 1K9SA 3VKUA 2CFSA 2I22A 3LWNA 4HPWA 5HTKA 2OGTA 4ZCPA 4RF2A 2PJZA 1L3IA 1KJWA 4EECA 5JDIC 2FWNA 5L3SA 4RDXA 1HFEL 2JGMA 4GMFA 3ZVLA 4BFSA 1MW8X 2PZKA 1PFQA 4LJ9A 4X6UA 4Y3UA 1EINA 4JSTA 1E2IA 2GYYA 3Q3VA 4URUR 3X1JA 3UPDA 1XU7A 2QBYB 5A5GA 3PWSA 1WXDA 4JOQA 2WF9A 5CYFA 4CLHA 3HUDA 3ZH2A 3V1NA 5ESDA 3WKAA 5L3RA 1WCYA 4FYKA 1O0CA 1SCQA 4IVPA 5HKLA 4E88A 1XC7A 3IQIX 1KDTA 5KINB 1GV0A 4WH0A 1RPTA 3IBSA 1SOVA 1ZCZA 2FMXA 3EZ6A 5EA2A 2K7FA 3TL2A 4IUDS 1PEKE 1GOTA 4JGGA 1D6MA 3G68A 2BM0A 2VVTA 1XTTA 3EVTA 2OCXA 4KWIA 4BZPA 3IQEA 3NYWA 4KJXA 2R2AA 3C14C 3BMCA 3MS4A 2FPPB 2R60A 4IIBA 2FPRA 1BVYF 3QIAA 4ENTA 5B7PA 3HK2A 2ZR8A 2OHVA 4HLNA 5DU2A 1XLUA 3PDCA 1KSJA 3VVMA 2MYUA 4OOFA 3L8GA 2D0IA 1Z0UA 4M0KA 4UMEA 4AZWA 2RHJA 4XB6B 3NHRA 4O1HA 1SY7A 1T1EA 1KL7A 3K0FB 3LA8A 4NOJA 1RI1A 4IFBA 5K0LA 2IH4A 2E4VA 1IPEA 1T2FA 4YECA 3LC1O 2WIGA 1PV4A 2O07A 3A9TA 1YAJA 3EOAI 4O5AA 4EG3A 5KWEA 2R7AA 5FUVA 4OI0A 1I6LA 3HHEA 2IYVA 2P2GA 3H18A 2AX4A 3P94A 3PR2B 4KIGA 2YJ6A 4J29A 3CUKA 3GIDA 3QEOA 1NKTA 4BAZA 1RBQA 4D8UA 1X7GA 1M7HA 1E6UA 4J2HA 1HFKA 4QTZA 4DLPA 5KOJA 3GP3A 2Q4BA 2HADA 3HM2A 1B0PA 4GOKA 4MO2A 4RABA 4X92A 3RTDA 5DYIA 1SHUX 4LDPA 3NHAA 3TW0A 4F11A 1GGEA 1RWVA 1Z83A 2HO5A 3H2KA 4O02B 1FTNA 3FOFC 5CXUA 3T99A 4HBGA 2ZQYA 3OF3A 2FJUA 4P58A 2C2OA 1RJ9A 2QW8A 2V4MA 1GNTA 4B3IA 1I24A 2B0CA 4ZN6A 4MHSA 1H22A 1QG2A 1L7EA 2PIAA 2WMOB 3BZUA 4UQLA 1Z15A 3EF3A 1AUVA 1VHTA 3WQHA 1FNDA 4BO4A 1Y1QA 2Q2QA 3GDGA 1O6GA 1BAPA 3ZY5A 3H4MA 2FVXA 1W59A 2Z5GA 4L27A 5HX7A 1DC3A 2NSYA 2BP7A 3LBIA 4EBFA 5CFLA 2XTAA 3EPLA 1N2BA 3PNPA 1LPNA 2C59A 4Z1MD 4UM9B 4HHEA 2CNOA 4J2OA 1U9IC 1N2HA 5FWXB 4P86A 1PRYA 4UPDA 2HIGA 4S05A 1PW7A 2ZKIA 2PVPA 1ECCA 3V42A 5BSKA 1IN1A 3V4OA 4AECA 3L3BA 3LFUA 5EJ7A 4KQKA 1N36B 3WYFA 4GR4A 1HM5A 4GW3A 1ZZEA 1VMAA 3CZ9A 1K8QA 1G6KA 3H5IA 5JAPA 3PNSA 2HA6A 4RHCA 2KM1A 2XCLA 1XTKA 2AHOA 4K9LA 2A2ZA 1NNEA 3RROA 1KO7A 2IYTA 4LQCA 5HKKD 1NI3A 3PF9A 1CB7A 1T4DA 2NO7A 1O8BA 2NZ2A 2GK4A 3R75A 4FWTA 2FJ0A 3KQUA 4MR7A 1Y6ZA 1C3OA 3AWIA 4K6MA 2WPDA 4DCPA 1Q1QA 1Q0QA 4QJIA 2D8MA 5UKDA 4KDFA 2LTAA 2C0PA 1IFXA 3IIIA 4GL4A 3SHFA 3UCFA 4C2BA 3R8FA 1V8OA 2HK9A 2ANBA 2OZEA 1KS2A 3QXHA 1X14A 2R6GA 2UZAA 2ZXFA 1BHQ1 3EIXA 1LZLA 2VNJA 4G1FA 1VOTA 4EJ6A 5C5EA 1EWYA 1MOQA 4YRSA 4ZDIA 3U1TA 4GSKA 2FSFA 4RENA 5JXHA 1VJGA 1JVBA 3L04A 1TZBA 4I5DA 4OUDB 4XPIB 2WB2A 3NKVA 3ZDZB 3QHAA 5C31A 2CCKA 1LK7A 1W19A 4F91B 2QN8A 1DO8A 2X86A 4L95C 4DDMA 1LI5A 1JN0A 2XUGA 4K2HA 4NMLA 3WLJA 4DVJA 1LLQA 3I76A 4M9RA 4G84A 2QB5A 2J8ZA 3MUFA 4R1TA 4KQWA 3JQGA 3D3WA 4WEQA 4BMOB 3PLRA 1X1BA 4UATA 1YZVA 4ENPA 5IABA 1C3VA 1AHIA 3L4SO 2QNIA 3NWBA 2V1XA 4KGZA 1OAOA 2FCRA 3GBPA 1V41E 4MXDA 4QQRA 4R9NA 5K0NA 2GN4A 1N2SA 2QN3A 2IX3A 1DQZA 1V0JA 3U44A 1AB5A 3G13A 2HTFA 3FMIA 2QAGA 1CWUA 2FR1A 2R2GA 4UMFA 4WCVA 4V0RA 3DFZA 2W0SA 5ED0A 2TMDA 1JEQB 1LX7A 3UK2A 2YWEA 3UPTA 1QE0A 3JQ7B 1HXHA 4YAKA 2FW6A 2VHJA 3KVNA 3MBOA 3E2PA 4IDNA 2ZI3A 2AZTA 3HWSA 4F38A 4UU8A 3BX1A 1AHNA 1MBZA 3Q7RA 5C1BA 4BVFA 3OE4A 4G1EB 1D2RA 4XSVA 5CX1B 1FUUA 2BOVA 2WTBA 3KYCB 4RA6A 4F6LA 3FYDA 1NWCA 3G2HA 3AJAA 1C1XA 4IWNA 3STYA 1ZM7A 1GZ6A 2A5FA 3KETA 3BB4A 2YQ5A 2F1OA 1VSUA 2P4UA 4D9NA 3RC3A 3QKRA 4IOLA 4A7PA 3GVPA 5JJIA 3LO5A 3NEYA 5KSZA 2V7BA 2ZJBA 1THTA 3CW9A 4DUYB 1QGOA 4D9CA 3TEJA 2NOAA 1HG0A 3FTCA 3WYNA 1MEJA 5M3BA 4FS8A 4CKEB 2MIIA 4OV6B 4NJEA 1EZ4A 2GEDA 5LFAA 5EIOA 2KBEA 4QUJA 4XGIA 4QU5A 3PIIA 2V74B 4RC9A 4Q1FA 5DN6A 4WKCA 1ZPDA 2ZJFA 4PYIA 2L17A 4G2NA 1COZA 3WGMA 4E5KA 3W3AA 3WAGA 2W8BA 4HGZA 4JC0A 4BBPA 1Q22A 4YHBA 4ZYYA 1ZIYA 4PEVA 1O6BA 4KAJA 5J2TA 1CU1A 4AQYB 2FETA 1PWEA 2BGRA 2R97A 4P4LA 5LQRA 4P4UA 2R7KA 4WZBA 1WP4A 2VKQA 2PAAA 3BORA 1HLPA 5K8UA 1PLKA 3HJBA 1C7EA 3NHFA 4UEKA 5F7JA 4DUGD 2REQB 3WGYA 1W4CA 1W0CA 1KPHA 3FKSD 2LXNA 3BSSA 2AEEA 4ZVVA 1MHPA 1L5ZA 1U1DA 1Y1SA 1Y3CE 3EA0A 3EVNA 3SK0A 2IIBA 3NV9A 1EFRD 5IVDA 2LR0A 1W44A 2DH5A 1J20A 2RJ3A 2XWSA 3HBJA 1S2MA 2NU6B 4KUHA 1Z5UA 2IU3A 4FEYA 1KC3A 1ZNQO 2Y1WA 3RS3A 4OAPA 1LI7A 2JZOA 4A0RA 1GG2A 2QMYA 3HUUA 3MGCA 3ZIUA 2EJTA 3K94A 4D82A 1HZJA 1DC7A 1Y8AA 2GHTA 2N42A 2OC9A 1COWD 3F7OA 4N6NA 3TTVA 1YS1X 4RJKA 3IGFA 5F7XA 1VSTA 1C30B 2FP4A 4JLNA 1KIMA 3LY8A 1ISSA 1VPWA 1VCMA 1D7OA 3HCOA 4M9XA 3JQAB 4B3CA 1IY1A 2G06A 2ZPAA 2RHWA 3OJWA 3WLAA 2P6NA 1N4AA 1ZN2A 2EEZA 1XRNA 3F78A 3IILA 5IK2A 5ILGA 1QDUA 1S01A 3T4XA 5I4KA 2OZKA 3NBZC 3HR8A 4PX9A 4HWSA 2HT6A 1KVTA 3PQ5A 4PIMA 5SYMA 3VI3B 1KQFA 3ZDBA 3H99A 4M1OA 4E5SA 5CVCA 3BWMA 4UCQA 3IP6A 4IFEA 5DCUA 1DADA 1Y42X 1GUYA 2NO6A 1X8JA 1Y80A 4QDXA 1CP2A 1KK2A 3G1TA 3N8IA 1IK6A 1EZZA 1GZDA 2XYVA 1W0KD 3BGIA 2SICE 5T67A 1OB5A 2NYRA 3TQFA 4AKHA 2G83A 2XPCA 1EDZA 2NM0A 5AKKA 3ZDDA 2MINB 2P7IA 2XDQA 2YHSA 5GAJA 3WQQA 1L5QA 2CXUA 1C2YA 2B5OA 2Q0HA 2JK0A 5FTJA 3V1TC 1C3JA 4ARVA 3A4LA 4GPZA 5EP2A 3L7NA 3I42A 1KDPA 1Z34A 3EGXB 4MUBA 5F2OA 2HK7A 2LW7A 4WNAA 1X3LA 4YJDA 5JVDB 1EFPB 5DSZA 1U2PA 4DB2A 1LDBA 3SP1A 2VTBA 2IA5A 3E7DA 3MWEA 3F6YA 3ICCA 2PUJA 3ESZA 3RVOA 3S7TA 4B6JA 4TX1A 5ECGC 1XK6A 4WBNF 1CB0A 1FMTA 2D1SA 3VPGA 3NOOA 3DGFC 1TKBA 2FYTA 1S9HA 1GKUB 2E5WA 3QENA 3UWMA 1JT9A 4WUTA 3V2HA 3AOEC 4XQCA 1PUIA 4ID9A 2YV1A 3ZWYA 1EHIA 4HAXA 2ZYVX 2A5JA 4P7BA 4BQIA 5GONF 1HNZB 4DBLE 4ND4A 2VATA 3L0SA 2AYXA 3DBLA 1CY0A 3COZA 1ZIOA 3RFTA 3RS8A 3VPFA 2XW6A 2FH5B 3LXRA 5BSWA 1K7CA 2QQEA 2VK1A 1I1NA 4RZ3A 4E46A 3TAUA 4AI6A 3EAFA 1QZTA 1O9HA 2PKYX 3GRVA 3MMXA 3L41A 3EG9A 3MJCA 1DBPA 1R4NB 1RHQA 3M81A 1BD4A 4MV0A 2QMEA 4IDCA 3DZIA 5DE3A 5JARA 3ZV5A 1UOEA 4JVOA 3OLWA 3NT2A 3NBUA 4L9SA 4TXHA 3VUFA 4BNHA 5FX2A 3D5EA 1BH2A 3EXIA 1SIWA 4BVHA 2Q6LA 2Q6TA 2OV8A 1SUBA 2ZKLA 2H2IA 3WKDA 4MTCA 1OXTA 3OF5A 4C22A 2CXQA 2RCYA 3HDJA 1H42A 4RA9B 4JKIA 5TIIA 3EUEA 3ERCA 1UBCA 2Q2NA 4MP8A 1YMUA 3CH4B 4PGHA 2Q3CA 4NABA 1NRWA 3MC1A 1V6SA 3IV6A 1ZK2A 2ENWA 1KYTA 5D3MA 1SIOA 4AO7A 4H4EA 2IYQA 2XH8A 1JX6A 3IUPA 3TQHA 5JU6A 1YQ9A 4MP3A 1H66A 4ZPJA 5CFNA 4Y9TA 3KVYA 1XFDA 4K6KA 1OZGA 1KO5A 3BJMA 3PBKA 4IHQA 3LYUA 3T34A 3D5TA 1BDMA 4FOSA 2ZXEA 3RRZA 1XG5A 4I55A 3I73A 4KLAA 4QDZA 1YWGO 2QZJA 1J0DA 1CIJA 1Q3TA 5K3CA 2R8PA 1N8SA 3U7JA 5HCIA 1BZYA 5AM5A 3VZPA 3STTA 4CEJA 1NN5A 3H9QA 4BFZA 1AKQA 4H1HA 4U8HA 1M1YB 3OO0A 2XZOA 5ALTA 3UMFA 1X7XA 3DFIA 1TK9A 3DQZA 3HCCA 4CCYB 3LW7A 2QG9A 4GG1A 2I6UA 2JFQA 2DUNA 3M4YA 4O4LA 1E5TA 5KJFA 3V4RA 4BQFA 2CNNA 3OOSA 2RHHA 3CCCA 4GQAA 4PC3A 5ALRA 3TR6A 2V7PA 2C3MA 3G2KA 1QMPA 2Q41A 4LECA 1X7WA 4O2BB 3JATB 1KMHB 4O4IF 5DOVA 5ECYA 3I92A 3OTGA 4Y6GB 3TOCA 2OLEA 4M7RA 1JDJA 2JLYA 5DISB 4GPEA 1IZYA 1FFXB 5ARCA 1CXZA 3UWOA 2BH2A 3QTTA 5ALSA 4B7UA 1UR5A 4CF5A 3ZUGA 4YR9A 4YUYA 4MJ3A 2FZ4A 4G4JA 1XXHA 3RUHA 3AU9A 1PHRA 3MT0A 4RMJA 1YKSA 2C1EA 3SZLA 3A27A 1JH8A 2X7XA 3IQDB 3PSHA 4OMFG 5AI4A 4EUFA 1PL0A 1S0UA 1XAHA 3W9YA 4PE5B 1IM5A 2XB6A 3EQZA 3JYNA 2AV6A 2YWBA 3ZPXA 4B6RA 5CJJA 4OP1A 2IPAB 3H1GA 2WKWA 2PA0A 1IN5A 1WUHS 2E89A 3CLTC 3GV0A 2BKLA 4IMPA 2VSYA 3WLLA 3VMMA 1B6SA 3FCAA 2FTKE 3FOBA 1V4BA 4LCJA 1S8FA 3PQDA 1RWWA 4ZK2A 4LY3A 2BCEA 4FQ7A 3FD8A 3NHWA 3ETEA 1FW8A 1KAQA 2JI9A 3Q1LA 2NU8A 1EA5A 3N53A 1JQ3A 2GMWA 1YQGA 2HJGA 2EIHA 4BU0A 3D4LA 4CE6A 3K1AB 3A8TA 3ZI0A 2ATVA 10MHA 5BT9A 2XE8A 2CL6X 3HUEA 3RAEC 2HA4A 3QX8A 1GVHA 2CLDX 3R6WA 3HKCB 1GNRA 2C2HA 2C7BA 3U4CA 3DGEC 1D8AA 2ZSKA 2JIZA 3DV0A 1S8NA 4Q3EA 1TQ8A 1FRZA 5JVDF 5LQUA 4HDNA 5C81A 4GQIA 1CZNA 1FP4A 3JZFA 4JODA 5BYKA 5JRDS 4V0NA 1J70A 3AB7A 4CR8A 4V1CB 2NVWA 4D57A 3D8BA 4PHFA 1XEXA 1YZYA 2Q07A 4RKWA 2CFIA 2FN4A 4XH9B 4C0SA 4BXOB 5LJIA 1UAYA 1K75A 3IALA 1IOLA 1B14A 1PR4A 1H93A 3T9FA 2BBWA 3SCZA 4G86A 2XUJA 4O2AF 4DIUA 1E99A 2Q4RA 4HVAA 2YHBA 1VPTA 5LKAA 4M6WA 2RB5A 1W29A 1ZRNA 1XDGA 5DWQA 1H0SA 3R0VA 3OAAD 1VE1A 2P2ZA 2V7QD 3HNRA 3E1SA 2BCGY 4OGKA 1TUGA 5AI6A 3CWQA 3Q41A 3RC1A 2MSLA 3DMPA 2WE7A 2X6RA 2JFBA 1XMOB 1U8CB 2Y1EA 3ELBA 3KOXA 4JB3A 4ARSA 3UHAA 2II6A 1SEPA 1G21B 2PRKA 5LZ5A 4BO5A 3D1JA 1OUMA 2XQVA 4K6HA 4JIGA 3C16C 2G9ZA 4EKIA 5HIAA 3F3YA 3ROFA 5FTLA 2QRPA 1L8QA 2PLFA 1PZFA 4G0MA 5DX1A 3ROXA 1NY6A 5J4VA 3KQLA 4JI4B 2C0CA 2RBGA 2Q46A 3GRZA 3UAYA 1CERA 2CMKA 4B33A 4TTPA 3TGWA 1I6WA 4V02A 2JHGA 2WJZB 4OJTA 4S2EA 3J80A 2XKAA 4CT0A 4E22A 4M37A 2W43A 1Z2AA 5B3KA 3ZGNA 2SKEA 2C92A 4Q39A 5EVCA 3ITKA 5JLAA 2ONZA 4UHKA 2WJHA 1VBFA 1EE1A 1PT8A 3F8SA 1DT5A 1IBSA 3JXEA 1TAQA 5D6OA 3T52A 4ZT7A 3G59A 1TCBA 1MJFA 1XALA 3O5AA 1E59A 3GCGA 3I4FA 3CA8A 4GI2A 4B3FX 4CCWA 1I4OA 2P79A 2W42A 1VLMA 3P45A 1QPZA 3BT7A 1CJTC 3EVZA 3AI2A 3MIZA 4YA6A 1Y4AE 4I1PA 1OF1A 5AK5A 4FNGA 2Q3FA 1G9SA 3HCFA 4MW4A 2OM2A 3HXPA 4HQFA 1SOUA 4I1YA 5BWCA 2FZWA 3C7CB 4C1BA 1XD2B 1G2QA 5FV4A 4PYKA 4M1WA 3HY4A 1P31A 3CZ4A 4JVMA 4D44A 3AIIA 3JQFC 1OFVA 2AL7A 4LF9B 1JDSA 1KP2A 5MHTA 5G40A 1SKAA 4KCGA 3DG9A 1E0JA 3TIIA 3V4LA 4AJNA 3U4QA 2AMYA 1G42A 1BOOA 3RG2A 5JSQA 2LKCA 3B82A 2OZLB 2E4YA 4RMGA 1M2HA 5DEOA 3BWYA 1E63A 2VNSA 4I50A 1ESDA 4B4OA 3MOGA 3TLEA 2IPNA 1XELA 1UBHS 2PO5A 3Q2KA 2OOKA 4RY9A 4TOIA 1RVDA 5B7NA 5M34A 4Z4GA 3GXBA 1XZQA 3K4HA 3DE0X 3T3MB 1MPXA 1WSDA 3D6TB 3IERA 3ILSA 3OY7A 4M38A 4AKGA 5EP3A 3DB2A 4GQBA 2YXLA 1CFJA 4Y98A 4B32A 2HV8A 2EBWA 3CNQS 5CD1A 1MX9A 4MV7A 1RPAA 4UUMA 5IM4F 2GAAA 3C39A 3I72A 2D3TA 3C3PA 3UZUA 3O84A 3WMRA 4BX0A 1NGSA 2PE5A 3G8BA 1TM1E 4X7MA 5JY1A 4DGSA 3QSYA 2BZGA 2IOFA 4OXNA 1JG4A 1BXGB 2DPYA 2ZGVA 4R1SA 1SXQA 1WSBA 4OLBA 3GRCA 4IKPA 1DDIA 3LZDA 1IBKB 3SQMA 2CUKA 4CEHA 1MJGM 3RB8A 4YK7A 2OBXA 3OM8A 4H60A 5AVXA 4IIFA 5G0UA 1BN6A 3WK5A 3AHHA 3WSWA 1H2RS 4AC9A 3N07A 4DLRA 4X6LA 5L3QB 4P32A 3RS9A 1NV9A 1ZZGA 2Z2IA 2W22A 1UXKA 3GPDG 4EPYA 1W35A 4RV9A 1R66A 1AU9A 1VCOA 2PTGA 4RH3A 1QYXA 5IAGA 3R6DA 5EMHA 2DG2A 4TWZA 2PD3A 2XV1A 5E9QA 2P62A 1A9SA 3ON5A 1WDTA 3FLAA 3PL1A 1TC1A 4H3VA 4JUDX 4IIYA 3FNIA 5C4MA 4LXTA 4LWQA 1NVEA 1XRPA 3FFXA 1YA8A 2Z0MA 1YDFA 3OLCX 2AZMA 4ZQIA 7ABPA 5JD6A 4D3DA 2ZI9A 4I8DA 4F56A 1HL3A 5G0SA 4AK9A 4W5NA 3CURA 3UK7A 1BCSB 4X41A 3GJ0A 1N8TA 2CB0A 3A28A 2ZR0A 2TMGA 4HGQA 4HYYA 5KI6A 4UDOA 2WQZA 3MWDA 3EWAA 3N39C 5E6UA 5LXTF 2OGWA 2R4TA 4EZBA 2W2NA 2PUCA 3ZW8A 3AUJB 3EULA 4ZDKA 4BJ6A 3BMOB 4R8SA 1GQSA 4J07A 3GFGA 5JH7B 1TYZA 2OFPA 3NIBA 4RV5A 4QASA 1RACA 5LQKA 3SOZA 2O52A 4LA4A 5K45A 4F45A 2XUQA 4LYDA 5CXQA 3SJUA 1TM2A 2UZ1B 5FP0A 3SXPA 3DL0A 3QKIA 1XTUA 2V58A 2VQ6A 3L01A 1D1PA 3IT3A 1C8BA 5A6SB 1TKAA 1MT0A 1OXXK 3L8EA 2ORVA 5IMBA 1BU8A 4K86A 1U0SY 1I4WA 1WF6A 2G76A 3GUHA 3H4IA 4O5OA 2P69A 2H51A 4A16A 5JAZA 1K97A 3LECA 4C4AA 1V7ZA 1Z4MA 2D00A 4FGUA 3L4JA 2O1XA 2GJAA 1TZJA 2WUFA 4JL6A 5EHIA 3F74A 3CVWA 1MABB 1Z0SA 5H8WA 2XRYA 3GRRA 3UUGA 4C05A 4YPOA 5KX5B 1RU3A 4G24A 4JELA 4B81A 2ZM5A 1LVHA 4AY2A 3BA1A 1ZEJA 3H2YA 2J6IA 4Q4JA 2H2GA 5FPQA 5EOVA 1P9WA 3DT6A 4AYTA 1D0IA 1C0EA 4UE6A 4DJ5X 1A9YA 3AIMA 3ID6C 4OXYA 5FBVB 4YC7A 4GKJB 3I2GA 4LBYA 1WUKS 1WDLA 3M34A 3ME5A 4AMYA 3HFJA 4J3JA 1GSHA 2BISA 2IXAA 1R9NA 3BIWA 4RL4A 5FWNA 3T3NA 3QLEA 4GZ6A 1MIHA 1YZGA 1Z8FA 3EB9A 3QKSB 4FYHA 4GF5A 3ZV3A 3SQWA 3N9IA 2BIFA 1NHGA 3HYLA 3GAFA 3EXEA 4MJLA 1NP3A 2PFGA 3T3HA 3OQHA 3W0LB 4BWFB 4C0XA 2X76A 3OOEA 1DDGA 3TMAA 4DB4A 1T4MA 4Y9UA 4JI1B 1XQ9A 2WV9A 4W7IA 2PX6A 4DMLA 1LSJA 2WHQA 4H3SA 4ER0A 5BY2A 1K6JA 2KX7A 3PUWA 2WT4A 4HCJA 5FADA 5GZ6A 3PRHA 4DLKA 4EI9A 5BOSB 5K01A 4C21A 3BB3A 1GZUA 3CLHA 5ER9A 4BE7B 1HG1A 3LRTA 1X0XA 3EODA 2C7QA 4TWJA 3VHXB 2ZXUA 3GGJA 1PQYA 4XWTA 4UXJA 2IYZA 1SCNE 2QR2A 5F9MA 3WK9A 4ZHQB 1ZFNA 1GZVA 1SUFA 4UULA 2QLTA 4GRAA 4DLNA 4EPTA 2P27A 5ALKA 5E4YA 5AKGA 4UVIA 3U56A 4WOBA 3RVLA 2PLRA 4DR4B 1G60A 3R7LA 2FPPA 3L0CA 4GI7A 3T4PA 4LQLA 1KOGA 4QYXA 2YZNA 3IS3A 1FDIA 2A94A 1Y8QA 3NBQA 4JYCA 3HR4A 3G3EA 3VTAA 3EXHC 3L1VA 5AVQA 4JBXA 4DV6B 3RFVA 4MW9A 3IJRA 1NXXA 1RKUA 2OWEA 1O95C 1E2MA 2MSEB 3EW7A 3MLAA 4FPXA 5EE9A 5HE8A 1R8SA 3N2LA 4K9RA 4AJLA 5BW5A 1SVUA 5G3YA 5KCMA 3GPIA 2EZTA 1EFVB 4Y6RA 5HZMA 2XMBA 3BQNB 1DXYA 3N2NA 1I4LD 5H59A 3TXYA 3IJ5A 2AXNA 4BV3A 5I7HA 2H5IA 3UANA 1R3DA 3ZR4B 4IH9A 4MVJM 1N7HA 5AHXA 1SCUA 2Z57A 1BVRA 2BM8A 1NI4A 1Z75A 3F5DA 1TUEA 4MQ6A 1HORA 3LLCA 4BZXA 2W83A 1NQUA 1QZZA 2BFPA 1LDMA 3O31A 3TRIA 3Q88A 2LP4Y 5JDCA 4FFNA 1D9ZA 1JIIA 1PQ4A 2JLRA 4G5YA 4ALJA 2OQRA 3G0CA 5BURA 2NTYC 4JYMA 1KOLA 3QFFA 1PR1A 1N77A 5CH3A 1JB9A 2B36A 4YUZA 1RAAA 4EG1A 5DI3B 4AJOA 1QWOA 2IUFA 2QNBA 4MMYB 4TSFA 4QM7A 1J0EA 5DV9A 1JFTA 2P2YA 3PUZA 3RT1A 2WYHA 3I34X 1XXHE 2Q7OE 1LDGA 1G5PA 1UFQA 1EUZA 1EAMA 3WZLA 4F4CA 4MCJA 3P71T 4HDMB 5P8WA 3QTLA 1XQXA 5CT8A 2PL5A 4GBJA 3PC3A 4XIYA 1LB1B 2IOYA 3U0VA 1W5TA 3W3AD 1XN4A 1E77A 4ASUA 4B4KA 1XMJA 2YHAA 4OGGA 1U0LA 3IHLA 1S1CA 1BWQA 3NTUA 2YIJA 3WYDA 2Q9AA 4BAGA 5J23A 5JECA 2F8TA 2VKTA 3KFLA 4P5EA 2GTHA 3OM0A 4IM7A 5BV8A 3LU1A 5BR4A 5EHXA 4B82A 2GLUA 2IZ7A 3ZLTA 3MCWA 5U9CA 1SKQA 1XDDA 2JDIA 5FTKA 3ZY3A 3E8XA 2YV5A 4JXXA 2AW3A 1JYFA 2FDCA 2HSEA 4BLWA 4DDWA 2EJWA 2J46A 3AWDA 3F4KA 3GT0A 3NHZA 1QHNA 1ZQ9A 1E9SA 4YALA 3BPSA 2GZDA 4QYIB 1EXNA 3PC4A 3W8RA 1AN9A 3EOZA 3EGDA 3FNBA 1PTJC 5H7XA 3A11A 4L5BA 5BPHA 2XD4A 3VNQA 1IRXA 2AIRA 2O54A 1V5GA 1F1BA 4YP0A 5CCBA 3AFIA 3DPUA 4DLUA 1SVOA 5D87A 3F5QA 3IHWA 4MQEB 4B34A 1W2GA 1KSFX 4IH1A 4YT8A 3HXOA 4H15A 1MQSA 3IUQA 3C7DB 3QH4A 4EPRA 1TA4A 4I9NA 4GD3Q 1KY4A 4GGMX 4B3XA 1XMXA 1RYZA 4TTTS 3SHVA 3VPBA 1RQNA 1BJKA 5DRYA 4BGUA 1VMKA 3BCHA 3KKMA 3DMTA 1UXIA 2WAAA 3M1LA 1AQYA 2LCFA 1P0CA 1JB1A 1UIMA 2Q5FA 4F3KA 5IK2D 5KTNA 4U6NA 2C7RA 1N1DA 1J49A 3FUXA 5BN5B 4C89A 3BMQA 4HWOA 2L69A 5KSOA 2GBIA 4YDRA 5CPBA 4WI1A 4MGEA 1KDOA 3OTWA 4JUCA 4RD3A 3ND8A 4KFTA 4Y6QA 1GCIA 3O4HA 3OEWA 1AZWA 3IQFA 5DBFA 1FFHA 1GG9A 2J45A 4YCNA 4HFNA 1DJMA 4X8MA 4WNCA 5L3VA 9LDTA 4RFSA 1ZS9A 1S3IA 1KJ9A 1N0WA 1ZNYA 2A5DA 5C7LO 3O8OA 1LLCA 2GJ4A 3QOYA 1EDEA 2XUKA 4KRYA 2FOLA 4L4XA 5DZSA 3VNUA 3DDUA 1SPBS 3DOEA 4RMNA 3ZX4A 3C24A 3HU2A 1LBQA 3OFNA 4HWTA 2IPLA 1XHFA 1T9ZA 1NJ8A 5ULLA 1MB4A 2FR8A 4OB8A 1DMSA 4I1RA 2H1WA 4LPKA 2JJ1D 2IYWA 1QP7A 3C7KA 2PMFA 4BLVA 3UJ7A 4X8LA 4A82A 1JEQA 2VQ3A 3A1EA 4UCXA 2D62A 4L9AA 3RF7A 3VNRA 4LRXA 2R1TB 2I6FA 3S28A 3PPXA 1FQJA 3O1JC 1CQIA 2LZ0A 4GZ5A 4MARA 1G9TA 4NSNA 3R9IA 4ZK6A 1RPZA 3MGKA 3L79A 4C20A 1KXJA 2Y1GA 1YQXA 2VRNA 3BHMA 4EX6A 2RHBA 4OSEA 1D7AA 1U04A 2NTJA 2A5LA 4E1BA 2YXDA 3TCNA 5B4UA 5C3MA 4ZJPA 2IIPA 5GADl 3R0ZA 1K0FA 1ADBA 2FLVA 1M72A 3OPXA 5ECDA