1DFGA

X-ray structure of escherichia coli enoyl reductase with bound nad and benzo-diazaborine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfgA00
3W4JA 1UXKA 1SPXA 2FZWA 5B4TA 3WS7A 4QXMA 4XGKA 3SLKA 4ZRNA 1BW9B 2WMDA 4J2OA 5JAQA 4AJKA 4JN6B 2Y93A 3GPDG 3UN1A 3PFWO 3S2FA 1LEHA 4PG6A 1UAYA 3FWNA 2HJRA 2VWHA 4Z3KA 3VH4A 1A4UA 2UUOA 4BGUA 4GGPA 4J4TA 1MB4A 3H3JA 1BXGA 5CDYA 5JFOA 4MVJI 4PRLA 3QWAA 2DKNA 2F00A 2ZQYA 5EPOA 1EZ4A 3JCZA 2BI8A 3JQAA 3UICA 3U4CA 1PJTA 5JO9A 1HDXA 3VOSA 3SX2A 4XEHA 2FPPA 2HU2A 1SBYA 2BFMA 2NQ8A 1UDBA 4JJIA 3HZZA 1DRUA 3L6DA 4ND4A 2DQ4A 3ICPA 3DWFA 2VTEA 3DQPA 4NBRA 3DAFA 4CPDA 1CEQA 3ZZNA 3RASA 4JROA 1NFQA 1JKFA 1PQPA 3M1LA 3EYWA 4NBUA 3WX0A 2C0CA 3BMCA 3NAQA 5KKAA 1FDVA 2WYUA 4PFJA 4IY1A 1KYQA 3V2HA 1C0KA 1P45A 1HEUA 5I7EA 3CZRA 1U4SA 3C1OA 4O0LA 3S1LA 3ANMA 3FCOA 4Q3NA 1WDMA 3DO5A 2OUIA 5KJ6A 1R4NB 1PTJA 3H9UA 4GKVA 4F45A 1Q7CA 2BKAA 1X15A 5A3VA 5TRTA 2YFQA 5JO0A 1QYDA 4QQRA 4XJTA 3W8DA 3UCEA 1MA0A 1NFFA 3PYXA 4FJ1A 4Y6RA 1F12A 1T2CA 4J2HA 1WDKA 3VHRA 1G1AA 3INRA 3LT1A 4YJHA 2CUKA 1MG0A 3ONDA 1HZJA 1KBZA 3H5RA 3OECA 3AUSA 1SEVA 4KP7A 3GZ4A 1LDBA 3WB9A 2GR9A 4M1QA 5JCJA 1ORRA 4BKQA 2NTJA 3RKUA 1GV1A 2BFOA 3ZNPA 2CD9A 4MVJE 4UVIA 1U3VA 1PSDA 3T4EA 3ON5A 1XKQA 3RWBA 5I8WA 3F4BA 1LDMA 1JKIA 3WSVA 3WICA 4PVCA 3TSCA 2ZYDA 4FFOA 1YL7A 2J3IA 4DTIA 3P19A 1ISMA 2NNLD 3VZPA 3D0OA 3JQ9C 2RH8A 3JQ7B 4ONEA 3IKTA 2I76A 2ZQZA 1MLDA 3KO8A 3DBHB 1WMAA 3GRPA 4M54A 3ZHXA 3ST7A 3G1TA 3GEDA 3MJSA 4Y98A 2DAPA 1UXHA 4HNGA 4OKIA 1JDJA 4MINA 1A7KA 4I9NA 3SJUA 1Y8QB 2I5PO 4URFA 4W7HA 2C07A 1P1HA 2WEKA 4A73A 4D45A 2HQ1A 3TPCA 4RVGA 4PLVA 3TZQA 5T64A 2AG5A 4CLHA 2UUPA 4PLZA 2J5RA 1ADFA 4AJ1A 4WNCA 1I2BA 4B7UA 2J3JA 2B36A 1B0AA 1SOVA 3GAZA 2SCUA 4O5OA 5TQVA 4RVDA 1UP4A 4L8VA 1LTHR 1Y8RA 3TNLA 1DLJA 4O6VA 4AJLA 3HJAA 4FR5A 3JQCA 3VH1A 1IYZA 4I5FA 2VZ0A 3ZI0A 4ALKA 3SBOA 4OXNA 2RAFA 3NT2A 2FMUA 4CMEC 4P4NA 3QV1A 1V0JA 3IIEA 3P5SA 5L4NA 4DIFA 3AOEC 1YB1A 3WOHA 5CAEA 4Q9NA 3WMXA 1PL6A 4D3SA 4NBTA 2E4AA 4HNHA 4FFPA 1H0KA 4YR9A 3NDJA 3HUDA 1P1IA 3D4PA 1V35A 4AJ2A 3AM4A 3LYLA 2AE1A 3GFGA 1KOLA 4D7AA 2DBRA 5A06A 4B4UA 2GO1A 1NYTA 3AI3A 5B4VA 4N54A 3AOEA 3DB2A 1B16A 2Y1EA 3ETGA 3WBBA 2CDBA 1HF3A 3OQ1A 4BHTA 2YV2A 4WCFC 5CG1A 1X13A 2HDHA 4CR8A 3AM3A 2IEDA 1C0LA 4FGWA 4PLFA 3LQFA 4CM9A 3QRWA 5BSGA 2ZB4A 2V6BA 3FNGA 1ZO8A 2ZTVA 1U7HA 3GNSA 4XRGA 3RBVA 3HDQA 4DQUA 3PGJA 3PDUA 1HLPA 5ES3A 5IJZA 3QP9A 3RBZA 4PG5A 1D1SA 1VSUA 3I9MA 4YJFA 3H65A 2O3UA 2HRBA 4J1TA 4XX0A 4IJKA 2EERA 1U1IA 3OFSA 1ZMTA 3CIFA 1DAOA 3F3SA 5DNAA 3KLPX 2AQIA 3FI9A 3W4KA 3GVPA 3QWIA 1KY5A 4BB5A 2PGJA 1LNQA 4BUCA 1A9ZA 4DIOA 1YBAA 1N2SA 3PI7A 1E5QA 3SLGA 2B83A 3RU7A 2O3JA 4L74A 4A03A 3QWBA 4KUEA 3BTVA 1ISJA 1OAAA 5T5QA 3ZV5A 4CODB 4DBZA 3JD4A 3KYCA 1U4OA 4JQCA 2BGMA 2Q45A 5DOVA 2JCXA 1C1XA 4FCCA 5EESA 5IG2A 1RPNA 3A28A 3GFBA 2X5KO 1GYRA 3WQSB 5TJ9A 3UKOA 3AUUA 2HMUA 4TRJA 2X4GA 4R1SA 3C24A 1Q7GA 4UEKA 3P2YA 2X0RA 3EGOA 1A27A 1E3WB 2OOSA 2WTBA 4NFHA 1X7HA 2UYYA 3VPHA 3FWZA 4JBIA 2OZPA 2X0IA 1RJWA 4NFSA 4P22A 3JQ8A 5G2OA 2VHZA 3RC1A 3V8BA 1ZH8A 1V3UA 3TL2A 5DP2A 4B3HA 5L53A 4WPGA 1PZHA 1K6XA 2WD8A 4GVXA 1TT5B 4JNKA 5CDTA 2RIRA 4E13A 4CLRA 4XYLA 4W82A 5GY7A 2OL4A 1IB6A 4N7RA 5BSFA 4CM4A 5A9SA 4W9NC 2A92A 2A35A 3BTSA 1VJ0A 3UCFA 1ZBQA 5JCJD 3KRTA 1WZEA 4PRKA 1Y81A 5G0UA 5DBGA 1HRDA 1UXIA 1XLTA 2FN7A 3DXFA 3K2BA 5HS4A 3V5NA 3IUSA 3R0IA 2VOJA 3DOJA 4ZQEA 2ZYAA 1W4ZA 3E5MA 3BHIA 2A4KA 2VTDA 1Y7TA 3D5QA 4E32A 4BNFA 4Q3BA 1H93A 4XYGA 5LDHA 2Y0CA 3JQGA 1GFSA 1BVUA 1YE3A 4YRDA 3RC2A 1NNUA 3RKRA 1ZEJA 1YRLA 3PIDA 4R4JA 1KC1A 3WR5A 1K2WA 4FJ0A 4WLNA 1O94A 4E0BA 4IPTA 2NWQA 3E9QA 3HQ4O 5EERA 2AXQA 3FPLA 1AUPA 5L3ZA 1YJ8A 4DIBA 5G0SA 2ET6A 3HHPA 3FN4A 1MC4A 3KYDA 3KYDB 1HWYA 4Z0TA 1SC6A 4RVFA 4XJSA 4J7CA 1PZGA 3RUEA 3ITDA 3WNQA 3LLVA 3KEOA 3ZV4A 5BQFA 2GSDA 4LMPA 3ABIA 3D3WB 5HS6A 2EP5A 2R00A 4YT8A 4MP8A 4HUJA 4XQEA 3PPIA 4XB1A 3T7CA 4J0FA 1NFRA 4UVHA 4F3YA 2UDPA 3ROQA 4ZN6A 1C0IA 3AU9A 4UUPA 4YCAA 4R3NA 3GLQA 1EQUA 2OHXA 2CVQA 4L0QA 4RJTA 1D3AA 5T57A 2EHDA 2HSDA 2EV9A 1B8PA 4IQ8A 4MVJF 5JDCC 4PLGA 2Y1CA 3LF1A 3IKVA 3QIVA 3CSDA 4ILKA 5G0TA 1H5QA 2D8AA 3H2ZA 4W4TA 3I4CA 2QYTA 5ER9A 4J0EA 2Z95A 3K5PA 3D7LA 4XYMA 1DO8A 3U3XA 3KYBA 4AJPA 4FC7A 3WWZA 3M2TA 4TVBA 1C1DA 4LVUA 1E1KA 2G0TA 4PZEA 5CEFA 3O38A 2ZJ0A 2VNAA 1SOWA 2Y66A 2I9PA 1N7GA 2IXBA 1T2EA 3JQ8B 4TKMA 3H6KA 4HFJA 3RD5A 1I2ZA 4BNJA 1QR6A 5BSHA 3DTTA 3ZHYA 3TOZA 5ENVA 5F1PA 3CKYA 1D4FA 4AICA 5GZ1A 4YT2A 4CQLA 3HNPA 1TEHA 4MP6A 4YT4A 1DFGA 3K2EA 4GX0A 3RUFA 4QO8A 5JYDA 2YW9A 3K96A 2POQX 5KJCA 4P4LA 2DM6A 3L77A 1P1RA 2AG8A 2PZLA 3OJLA 2ZATA 4EEZA 1U2GA 4BNZA 1JWBB 4DYDA 4IGEA 2PKQP 3N7UA 1DFHA 4D41A 1HDZA 3B70A 3FHLA 3HFSA 4U7WA 1PJLA 3AY3A 4XDYA 4R01A 2W98A 4TRRA 1OFGA 4ZRMA 3UOGA 3W8EA 1HL3A 1LXCA 2X5JO 2VZ8A 4YYZA 2FRDA 2VUSA 1KVTA 1W6UA 3KUXA 3D4NA 2V6FA 1L1FA 4MKRA 2ILTA 5C7IO 2VRBA 4ZHSA 9LDTA 3IL2A 2HO5A 3GY0A 1HLDA 2Z5LA 2CDCA 5JNLA 2J6IA 2I99A 3WG9A 4BO0A 4BNWA 4BGVA 2ZB8A 5JLAA 3ZHBA 4DL9A 2CY0A 3NTQA 2E6UX 5FWNA 1A7AA 1C1DB 4PLPA 3RVDA 1LRLA 2O2SA 3GG2A 5F1KA 4CR7A 4BQRA 5KVVA 2HK7A 2IODA 1IZ0A 3KYCB 3H9JA 1NAHA 5A9TA 1N9GA 1KETA 1Z82A 3GRKA 4GBJA 4RF5A 1B14A 2BGKA 2NVUA 5IDQA 1TB4A 5IZCA 3PYLA 3FD8A 1NWCA 1I33A 1DLIA 3PLRA 3ADOA 1ZK1A 4DPLA 3PXXA 1VL6A 4LISA 4QUKA 2Y1OA 3M6IA 3F1KA 5BNFA 4YAIA 6LDHA 3GHHA 2QRKA 4GMFA 4FJ2A 4E30A 5KJFA 1K3TA 3NV9A 5CDSA 1TVEA 2YHUA 1M67A 4IXWA 3WQQA 1J4AA 1F17A 2RHRA 3JQFC 5CPFA 3LT0A 1GZ6A 4E31A 4B8ZA 3GUYA 1HXHA 4UEJA 5BR7A 3C1TA 2GDZA 2C2YA 4IINA 2VZ9A 4Y6SA 3JD1A 4NJOA 2JFHA 2GLXA 3PQDA 1AE1A 1Q0LA 3MJVA 3FPCA 3AFNA 3I83A 4MKZA 4PLTA 4E6PA 3RFXA 4DVJA 1E1MA 1EFLA 4BVAA 4E5MA 4EBFA 3JQGB 1IY8A 1LU9A 4FS3A 1I8TA 4HP8A 1PWXA 4BS9A 2C7GA 4RQTA 5COQA 3LT2A 1DIRA 4G81A 2EF1A 3H7AA 1WXDA 1K6JA 1ZJYA 2X22A 2AEMA 3S55A 3TOXA 5IFLA 2JD0A 5AOVA 2CMDA 4B3IA 2FSVA 3S2IA 4GPD1 3NX4A 4DA9A 3QA9A 1T2DA 4OYRA 3HB4X 4FBGA 2B37A 2HMWA 4ND5A 5ADHA 3VVBA 1ZK4A 4CQMD 2NM0A 2PTGA 3PZRA 3UVEA 4CM4B 4HFRA 3LC2O 2VT3A 3H8VA 4ITUA 2P91A 4B79A 4RL6A 2D1YA 3ITKA 2X0JA 1P77A 1BTOA 4NNJA 1MG5A 4KTTE 1T2AA 1R37A 1XDWA 5F21A 2P2SA 2Q1UA 4GWKA 4XR9A 1OBFO 1BDMA 2E37A 4CMAA 2YFHA 3H9GA 4G65A 5DDIP 3DHYA 3UCXA 2PZMA 1WLYA 5L40A 3DC2A 1YKFA 4II3A 4RZIA 1OMOA 1Z7BA 2VWPA 4RGBA 4CM8B 2JCYA 4IDAA 3JQ7A 4OXKA 1BWSA 4RF3A 3TWOA 4BNUA 1EUZA 2I6TA 4PG7A 3PJDA 3RBXA 1JAXA 4BGIA 4FQ8A 2HUNA 1H9BA 1XCBA 1SCUA 2W2KB 4GQAA 2Y05A 4OAQA 3RI3A 1ZCJA 4RO0A 2Y1FA 1N7HA 3QY9A 1GL3A 4NK5A 2AQKA 2EGHA 4Z0PA 4BO5A 3KETA 4K1LA 1ZK3A 1D7OA 4IDGA 5BNIA 3G0OA 4B7XA 2FPIA 1MX3A 4I1IA 4IMRA 4UAGA 1PIWA 1H2BA 2ZTUA 4FFLA 3ANNA 4U0JA 4YAJA 4JBGA 3VKUA 1UXJA 3DDNA 3KB6A 4MIYA 3VPXA 4OSPA 4UEOA 2O7QA 5JC1A 2OXIA 5H82A 3MOIA 3DL2A 3BTOA 4RPKA 4E21A 2GUGA 2RBEA 2JD1A 3JD2A 1GCOA 4WOKA 3I1JA 3C8MA 3PIIA 4B4WA 3F46A 3H5AA 3GG9A 4EJ0A 3L4SO 4BNLA 4UVEA 1LBEA 4JP2A 3B20A 1CETA 1NAIA 1YVEI 3OBBA 4IJVA 3I5MA 4WOJA 4CM9D 3ZDFA 1P1FA 1E3LA 1ZXLA 3IDSA 3EVNA 4IJWA 1I24A 1P31A 5JDIC 1KS9A 1LDNA 3MJCA 3OJ0A 3U5TA 4UUOA 2EW2A 4L4XA 3PLNA 1HYEA 1NQTA 4J4BA 1GZ3A 4RQUA 2C7VA 3I23A 5JMWA 3EMKA 1VL8A 2GD1O 4IQ0A 1H2HA 2QZ9A 4UULA 4BOYA 1RM4A 3VTZA 4AJEA 3SEFA 3GVIA 4M55A 1OC4A 3WDSA 1X14A 2JD2A 3H9EO 1PEDA 3R1IA 2C5AA 1E77A 1ZZEA 4IQGA 1BXGB 2HKIA 4W7IA 1R4MB 2NV6A 4II2A 2JCVA 1MV8A 4E2ZA 1R0KA 2O4CA 2ZTLA 4J1SA 4F46A 6ADHA 1IUKA 3I4FA 1EE9A 3PTZA 3VTFA 3DMYA 2IYOA 2G5CA 1M76A 1EVIA 1AN9A 1MFZA 2BGLA 2GNAA 4J1QA 1NR1A 1BMDA 5DOZA 1H9AA 4O63O 2CFCA 2BF7A 4I5EA 1TXGA 4YBZA 4MVJH 3MJTA 1LX6A 2CF6A 4NI5A 1C0PA 3DONA 4DRYA 2D5CA 3VKVA 1NM5A 1IOLA 4KQWA 3GGGA 4YQZA 3DAGA 3QQPA 3MWDB 4YVFA 3NEPX 3H9QA 4HFMA 1KIFA 1Y8RB 1J0XO 4IDBA 3TL3A 2YV3A 3FNFA 5AVOA 4GMGA 2V6GA 3VH2A 3NDIA 3ROKA 2X1HA 1YDEA 3R3SA 3VDQA 2GASA 1EE2A 2D3TA 2WD7A 3CINA 3GDGA 1P1JA 2VYNA 2YQ5A 5IF3A 4J9UE 3MOGA 2B4QA 2O4UX 2DFVA 1MP0A 1I0ZA 5DF1A 1E1NA 2HMSA 3I9OA 3LC1O 2HRZA 3FNHA 3I9JA 1Y8QA 3IJPA 3OEYA 1FDUA 1ZUD1 4CLEA 3HN7A 3N58A 5JW6A 3JV7A 4RPLA 5TIIA 1GEEA 1LRJA 2AW5A 4DC1A 2IZ1A 2PKRA 1XU7A 1ZK2A 3CMMA 3DBHA 4AFNA 5I7VA 1TA4A 3CTMA 1F06A 4WECA 5FFFA 3DBRB 4CLOB 5JC8A 3DMTC 1MUUA 1UZLA 4LMRA 3I3OA 2PY6A 1M2WA 4INAA 1HKUA 2OORA 2Q2QA 4P38A 1CIVA 2WDZA 3JD0A 1R4MA 3INGA 1E7MA 5KWEA 4M87A 3RC7A 3MJEA 1U8FO 1RYEA 1NVTA 4OOFA 1HDYA 2B4RO 3GK3A 1B3RA 3UUWA 2YJZA 2X9NA 1P0CA 1YXMA 5T8KA 4KZPA 1JU9A 2P4HX 5TT1A 3ROMA 3OMLA 1GADO 5TGDA 1IHYA 4PVDA 4E4YA 5A1TA 3BIOA 2QQ5A 1LUAA 2P5YA 1B7GO 2NU6A 3CEAA 1KEVA 3NYWA 2JFGA 1U9JA 2J3HA 4W6ZA 3OETA 3OIDA 4ALNA 2JHFA 4PZCA 1O95A 2NU8A 1N9GB 4DC0A 2PZKA 4YAEA 5A4DA 1T1RA 1LC3A 4CUZA 1SEPA 1PL7A 3TZHA 4LGVA 4W9NA 4QFCA 5L7TA 2YV1A 4BNTA 5IN5A 2I3AA 5COBA 2FR0A 3JQFA 4A5OA 1BRMA 4XIJA 3WYEA 4NZ9A 4JLWA 1YJQA 3PWSA 4D79A 4RLHA 3I9NA 3GR6A 4ZD6A 4H3VA 4AJOA 1BW9A 3WLFA 2JKVA 3VZRA 2BHLA 4L76A 4PLHA 3GC6A 4HFNA 3U4DA 4CQMA 1PJ3A 1CQJA 4HBGA 1GQQA 3A14A 3TFQA 4U6SA 5COAA 2B69A 3UFXA 4Q3EA 3ZCXA 2FR1A 1Q0HA 3I9KA 3WGHA 2BI7A 3LK7A 1JA9A 5JXWA 3U0BA 5C7OO 1Y9AA 4WCDA 4XQ9A 1PS9A 1YH3A 1HTBA 4LSMA 4PZDA 3ZWWA 3PWZA 3NKLA 5L51A 3JQAB 3PJGA 1QV6A 1QYXA 1GV0A 3AUAA 5A9SB 2JJYA 1PQUA 5L4LA 4DYVA 4CLRB 2GZ3A 2Q49A 4BIIA 5EL0A 2J8ZA 1P9LA 3L6EA 2VCYA 2HK8A 4GGOA 5A5FA 1ZK0A 1E7SA 3FR8A 2RHCA 4J6FA 5TS3A 3WLEA 3GVXA 4Y67A 2W2KA 5KIAA 4B4VA 2EIHA 5I9NA 4BV8A 2FOIA 1LLDA 1HDRA 2DUWA 4KDFA 5CP8A 3ZNOA 2X23A 3M2PA 4R1UA 1U3WA 4CR6A 2PK3A 4E33A 3O8QA 3Q3CA 2W2LD 1A4IA 2QG4A 4ZQFA 1I36A 2Q2WA 3Q1LA 5H81A 5F5NA 3W1VA 2JHGA 3PHIA 4EJ6A 5G4KA 2EJVA 1ZMOA 5KVCA 1ZKMA 3BMQB 5JCXA 4CUJA 3OSUA 4TZTA 1F8GA 3D5TA 1AGNA 2Y1DA 3WSWA 5C3MA 5CEJA 4NHEA 5A5EA 8LDHA 3GNTA 4ZICA 5ER6A 1PJ2A 1XYGA 3FTNA 1P74A 1MXFA 1NX6A 1ONPA 3PQFA 4RV9A 2A9FA 4MJLA 2IXAA 3E9MA 3CMCO 1HETA 4QX6A 3JTMA 1NQAO 3WTCA 4D44A 3H3FA 5B1YA 2Q1SA 1Q1NA 1PZFA 4UUMA 3DFZA 1A9YA 3WQRA 2XOXA 1DPGA 4CQMB 4ROSA 1W0CA 4A27A 1DRVA 1QLJA 2O2YA 3FBTA 3FR7A 4P4GA 1E0DA 3QSGA 4NU6A 2HMTA 1JQBA 3AOGA 2JL1A 4E5YA 2PD6A 2ZB3A 4B8WA 1LSSA 3D3WA 3DBLB 5G0WA 1IPEA 4FGSA 3RFVA 1U5AA 1LSJA 1WP4A 2R00C 3L0DA 2O50A 4FC6A 3FBGA 4BKRA 2GN8A 3GUCA 3GF4A 3V1UA 2BLLA 3IAHA 5AXAA 1C14A 2O23A 4N5MA 1HT0A 2BFPA 5U9CA 1E7RA 3O4RA 5JS6A 1NR7A 3AWDA 2LDBA 4GLOA 4MVJP 3ETDA 1HE5A 1R0SA 1B2LA 4BMNA 3ZWCA 4K26A 1EDOA 1HE2A 3DOCA 4JCOA 2HLPA 5AXBA 5IDWA 4RDHA 2PA3A 3DZKA 3VPSA 4BL5A 1JLLA 3ENKA 3STHA 1PGJA 4NJMA 3S8MA 4QTZA 3SJ7A 2C54A 3C7CB 3MTJA 1E3SA 3RFTA 1KERA 2QRJA 3E48A 3LSYA 2NLOA 2Y0EA 3GOHA 4E5KA 1PS8A 3H2SA 1ZSVA 3G17A 2QW8A 5IXYA 2NVUB 2X5OA 4O1MA 1ONNA 1V3TA 2E49A 2H9IA 3P7MA 4XIYA 3GVHA 1YOVB 4ZQGA 1YBMA 5KJEA 1Y6JA 3GMSA 2VUTA 4KUGA 3U4HA 4CL8A 2VYND 4A26A 1E92A 1ZSNA 5C7LO 1SMKA 2Q3EA 2AA3A 5TSDA 1N92A 4DBVO 1NVMB 3O03A 1O89A 4Y9DA 5I9MA 1PL8A 4RPHA 5IDYA 4CL3A 4XWYA 4HY3A 3U62A 4ZGWA 1GPDG 5CDUA 5CFZA 5AQ1A 4J4HA 1E6WA 3EVTA 3DZGA 4JJGA 3WBFA 1D8AA 4XQCA 3QE3A 3Q11A 1X0XA 2VRCD 3A4VA 2VYVA 4D3FA 3R3JA 1NTOA 3A9WA 3HDJA 4FN4A 4RZHA 1PR3A 3GZNB 1YONA 5FYDA 2FP4A 3NGXA 2DTXA 1ZFNA 1EK6A 4WLEA 5U1PA 1IE3A 1ZXBA 5DP1A 1I5RA 4AJ4A 4BGEA 2TMGA 3Q2KA 2I66A 5K6AC 4RCVA 4NIMA 1QYCA 4A7PA 1LDYA 2C59A 1KVRA 3I9LA 3OA2A 1QMGA 4NMHA 2BELA 1XR3A 5ICMA 2H5LA 4FFNA 1E5LA 4R41A 3WGQA 1VKNA 3JQBA 3ZWMA 4Q3CA 4YJGB 4HWKA 4QFDA 2W4QA 3CZMA 4LK3A 4MVJG 2EP7A 1YDWA 1LDEA 1BDBA 3K30A 2CSUA 1T1SA 2X9GA 3KHUA 4YRBA 1TT7A 4IUYA 1TLTA 2O3SA 1PS0A 1IZ9A 3DZJA 5HBRA 1NP3A 3RUCA 1GD1O 1DRWA 1I3LA 3WGTA 1I10A 5JY6A 2YDXA 4IXTA 5ILGA 1DIAA 1NHGA 1EBUA 3NTRA 2TMDA 3W6UA 4BO8A 1ID1A 5GZ6A 3RUHA 3BMCB 1JWAB 2IYPA 5KCZA 1G0OA 3GGOA 1CF2O 2CVOA 2I65A 1EVJA 4NBVA 3S2GA 3JYNA 3U9LA 4XD2A 4AJJA 4EDFA 2OBNA 1JTVA 4HX5A 1SB8A 5AXCA 4YTEA 2PR2A 1ADGA 1PJ4A 3DHEA 3WYCA 3E9NA 4Z6KA 3UXYA 3IS3A 3Q0EA 5B12A 4ALJA 5EINA 1PJBA 1QORA 4RDIA 2ZK7A 1FDSA 1T4BA 4U0KA 1LSUA 1WWKA 1O5IA 1U3TA 3FF4A 1GTMA 3KEQA 1U7TA 4FW8A 3DMTA 3D4OA 2AHRA 3NT4A 4I08A 4L75A 5G0VA 3O26A 3Q9NA 2UVDA 3E5RA 5TX7A 1M6HA 3KXDA 4A2CA 5J23A 1CQIA 3PHGA 3W6ZA 4DMLA 1XQ1A 1FK8A 1LQUA 2GGSA 4CLDA 5JBIA 3OJOA 3B1KA 4WLFA 4R3WA 5L45A 1F14A 1QG6A 1PQWA 1WAMA 3EC7A 2EXXA 1QSGA 4Z9YA 4Z3DA 1EBFA 4YDRA 3IC5A 4RF4A 2HMVA 2OFPA 3AU8A 3ZWYA 3ANLA 3LU1A 4BQPA 2Y67A 4FPXA 2QZZA 2PNFA 2WE7A 4YWJA 4D43A 1NVGA 4DLBA 3F47A 3QLJA 2GYYA 2XF8A 3QVOA 4HXYA 1F0YA 1DC4A 4J1NA 2EGGA 1E3JA 1EQ2A 5I8ZA 2DVMA 3F6YA 4ND3A 4QEDA 2W2LA 3PDJA 1E1LA 3ZGYA 1YWGO 3PVZA 1JVSA 1RM0A 1DB3A 2GN4A 5U4QA 4EJMA 1DAPA 3PWKA 2VHVA 4ZJUA 2ZKLA 3QWFA 4R1NA 1DIBA 1GU7A 1Y5RA 3Q6IA 3X2FA 2FWMX 1L7EA 2C82A 4PG8A 3DZIA 3MTGA 3JQ9A 3OICA 3Q9UA 1HYHA 1PJCA 2O3QA 4LCEA 1I3KA 5ILOA 3PQEA 4GSLA 4BO4A 2DTDA 3KOUA 4FOOA 3KM0A 4BO3A 4GX5A 4BMSA 3ZV6A 1CRWG 2GF2A 3PGXA 3PRJA 4H16A 5L7WA 3LZ6A 3L4BC 1KY4A 1LC0A 3MZ0A 4CUKA 1FXSA 2ZCUA 3MCVA 4PLYA 3JYLA 5K6AA 4YJHB 4DPKA 1H6BA 2IE0A 3W4IA 1R66A 3GMDA 2P5UA 2Z1MA 1B3BA 1ULUA 5KVSA 4XCVA 1I30A 3G1UA 1PU2A 4IS2A 4GL4A 5EMHA 4CJXA 2PLAA 4LVCA 3ORFA 1DC5A 1WMBA 4XGNA 1HSOA 2ZIZA 1EVYA 3KBOA 3DTYA 4KOAA 1LJ8A 4OSOA 5JAZA 3L6OO 1R12A 5IXSA 2WYVA 1BG6A 2V7PA 1HZZA 4NPCA 1HE3A 1YO6A 4R9SA 1HDCA 4EW6A 5KJ1A 3GN2A 5HM8A 4MO2A 4Z9XA 3ROPA 4NK4A 4CV2A 1LLQA 2P68A 4W99A 5HA5A 4CMBA 3IOYA 1R15A 4RVSA 3DZFA 5KOIA 3ZWXA 1DEHA 1GUZA 3OJEA 2X6TA 3ZU4A 3K8ZA 3AI2A 3C1AA 1VLLA 1AXEA 4GI2A 3CXRA 4R68A 3QHAA 1NQOA 5L95A 1QYWA 4RORA 4TQGA 3U49A 3Q2IA 4WNIA 4J9VA 3GDFA 2OP1A 5TC4A 4MIOA 3ZN2A 4Y6PA 4GAEA 4YT5A 1SZJG 4X54A 2VT2A 3BTUA 1ARZA 4BNHA 1QV7A 3EZYA 2B35A 1UJMA 1B26A 4UREA 4KMSA 4IBOA 1CERA 1E6EA 1H6CA 4XDZA 1ISFA 2P9CA 3HDYA 4CV3A 1XA0A 2CDAA 4MIEA 5TLSA 3JD3A 7ADHA 2GPTA 1UDAA 3NJ4A 3WJAA 2AE2A 1YL5A 3JYOA 2NADA 2YQ4A 4DXHA 2O3RA 4IGFA 3UHAA 4D46A 4L9RA 3O8QB 4MP3A 5F5LA 3VAZA 2YHIA 3AFMA 2Q1WA 4DGSA 1UP7A 4YA6A 1LRKA 5C37A 2Y1GA 1V8BA 4YJGA 1R6DA 4ALIA 2RCYA 3IJRA 3N74A 3OIFA 4DQVA 4B3JA 1VI2A 1ULSA 3BZUA 1T24A 1VC2A 3G79A 3ICCA 1NWHA 1T26A 2Q4EA 4YJDA 2FSSA 4A10A 2D4AA 2BMAA 3CUKA 4UVDA 3I6QA 5AYVA 1PGNA 2PH5A 1JKJA 2XXJA 3GHYA 5JAIA 5KVQA 1VPDA 4NFYA 1NXQA 1NASA 1YGYA 4NU5A 5DBIA 3TZ6A 1PWZA 2EKQA 5K0ZA 5HTOA 2YZ7A 3GH3A 3QWHA 1QLHA 5CDGA 3W8FA 1N5DA 3B6ZA 3GNQA 2C29D 5F1OA 3RC9A 5C5IA 1CDOA 2J5QA 2NU7A 1U5CA 4ZA2A 3ZWPA 5L4SA 4PG4A 3BMOA 2X7HA 5DCWA 2LDXA 3ASUA 4BV9A 5FI5A 1VSVA 3RU9A 4M8SA 3GGPA 3JYPA 4K28A 4O59O 4YACA 4BNXA 9LDBA 1E7WA 3KSDO 3VZQA 1T25A 1X7DA 4I5DA 5KNLA 4L4SA 1Y9EA 2I3GA 1BVRA 3TJRA 3QJ5A 3FRJA 1B15A 3H4VA 3MWEB 2GZ1A 4GLLA 3V1YA 1VL0A 4BKOA 5JY1A 1P1KA 2YYYA 4DQXA 2Y68A 3A1NA 2YUTA 1MC5A 4XR4A 1UR5A 2OP0A 4R54A 3ASVA 1UP6A 4R9RA 2CNBA 3SC6A 1HYGA 3JQAD 4K6CA 2IEBA 4WKGA 4TROA 1E6UA 2NTVA 4E3ZA 1C3VA 5MGBA 2JAHA 4AG3A 1RKXA 3SXPA 4OIMA 4BKPA 2NUAA 1PGOA 3GPIA 3E8XA 4IZHA 1A72A 2OBYA 1OOEA 1NQ5A 1WPQA 4XA8A 1D1TA 1QXSA 3JQ6A 1VE9A 1KC3A 3UW3A 1CWUA 5JMPA 4OMUA 3COSA 2IZZA 4OHUA 2Q2VA 1E7QA 1DOHA 4IMPA 5TNXA 2G76A 1XWFA 3IMFA 1SNYA 4GSKA 3WXBA 3ZHZA 4H15A 4E2YA 5JPIA 2V65A 2OGUA 4TRNA 2NU9A 3C85A 3TFOA 1YOVA 4BO2A 2JAPA 2VUUA 2VHXA 1JVBA 1XG5A 1VM6A 3OQ6A 4C7KA 4DUPA 3QVTA 3IUPA 1GCUA 1HDOA 3QW2A 2VWGA 2OO5A 3X2EA 3PYMA 4Q3AA 4BNGA 1ONOA 4MKXA 5EIOA 2Q4BA 5TF4A 3ZWOA 4L4RA 3EHEA 4EUEA 3RSHA 4MVJM 4F6LA 5JDIA 3S2EA 4B7CA 1YQDA 3G49A 4KUHA 1VRWA 4G2NA 4LCJA 4U8GA 4OJNA 3VPFA 1PJSA 5L9AA 2D59A 2XXBA 3GEMA 4HV4A 3E6AA 3L9WA 1DSSG 4J90A 1Z75A 3KSZO 2H63A 1GYQA 5DZSA 5B4UA 3JQBC 5BNTA 5DULA 1BHSA 4MVJA 4WLUA 1VJ1A 3HE3A 2NTNA 1Q2XA 4KWHA 3IP1A 4JXKA 3PHHA 2X0NA 3TRIA 3DZBA 2NSDA 3GT0A 2F1KA 2QX7A 1RM3A 2EG9A 1GPJA 1YBVA 2HK9A 4YEDA 5BT9A 3JSAA 5I7SA 4S3MA 2J3KA 3BMQA 4NH4A 5A3JA 3KSUA 3EK2A 2GRAA 1B8VA 4BMVA 4R16A 4D42A 5IZ4A 1EVZA 3A06A 4PLCA 4CMIA 3UGKA 1DBVO 3KLMX 4CM6A 3WGIA 3WGGA 3T4XA 2B4TO 2X58A 3UAGA 4R5HA 1E3WA 4KDEA 3WNVA 1GY8A 3NDRA 1ENOA 3AW9A 3RUDA 3VH3A 4IM7A 5ITWA 1NPDA 1FJHA 1JW9B 3DHNA 3OEWA 1X0VA 5G4LA 2WD7B 1PR9A 4OOEA 1KVQA 4RVHA 1PJQA 1T2FA 1T4DA 5CHEA 3ONFA 2H6EA 4GX1A 1U3UA 2G17A 1ZJZA 4OXYA 3LT4A 4KWIA 5LDGA 2B0JA 5I7FA 1ML3A 4CMKA 1IHXA 4BNKA 3L4BA 2DLDA 1K89A 1PGPA 3BA1A 1CYDA 4IZIA 3UF0A 1XSEA 1UUFA 3U4IA 2HAEA 3E03A 1Q0QA 4WJZA 2FZEA 3FNEA 3FSRA 1ENZA 1LLCA 2HJSA 1DC6A 1Y5MA 1YB4A 3BYZA 2H1SA 1NBOA 4E5PA 3TN7A 5TT0A 2R2GA 4MOWA 1BGVA 4Z0HO 3HDHA 1DIHA 2YHIB 3KZVA 1R16A 1X7GA 1LQTA 4TMFA 4CMGA 4R5MA 2DBVO 2QIOA 3K31A 2GN6A 4F6CA 4M86A 3V2UA 4CM1A 1B8UA 2C5EA 1C1XB 2AQ8A 2PGLA 4DWVA 1QKIA 3AJRA 4AJIA 3RQSA 1AXGA 3PFFA 2FY8A 4D3DA 1NPYA 2PD4A 2VQ3A 1IL0A 1DHRA 1NHWA 4J16A 5T8KC 4QSMA 1XGKA 4OO3A 4CV1A 4WCFB 3HG7A 3HN2A 4N5NA 1ZSYA 4Q3DA 2GERA 2VHWA 1BXZA 3LVFO 3HADA 1H94A 3IP3A 3SVTA 1ISGA 1XIVA 2Y99A 3F5QA 3F4LA 1K6IA 4WE3A 3QVXA 1DHTA 2DFDA 4K9DA 1M75A 2NVWA 3LLSA 4Y8VA 2UAGA 3VVCA 1O8CA 1YQGA 3RAJA 4IIUA 3RJ9A 4CM3A 3L9XA 4RPJA 3C7AA 4PLWA 3GA0A 3NUGA 4R1TA 1HSZA 5A03A 1XELA 4PGFA 2YDYA 4R51A 2EWMA 4CM5A 1Z73A 4DLLA 2OMEA 3INTA 4YB8A 1N1GA 3TZCA 1EK5A 2BD0A 2PV7A 5IZCC 3GAFA 3OF2A 1UDCA 3DAPA 2AEJA 3JYQA 5DBFA 3OA0A 1FDTA 1Z6ZA 3HWRA 3ZU3A 1ENPA 1ISHA 4NG5A 1H6AA 2GCGA 3BMNB 4CM8A 2D2IA 2Q1TA 2FHSA 4IDEA 4FIZA 4HADA 2P9GA 4MDHA 4ZQHA 3PP8A 5T6BA 3WYBA 4J7XA 4LN1A 3ZWNA 1E3IA 3G3EA 4BKUA 4GX2A 1WNTA 3GQVA 4I9HA 3AK4A 4N18A 4OKNA 1DJQA 3R6DA 3TQHA 2Y0DA 1QYVA 1VJTA 3ZWAA 4G5HA 4FD3A 4XYBA 1HE4A 4JJFA 3RJ5A 1PGQA 4EUHA 4NQZA 1U28A 3KV3O 4ND2A 3WJ7A 1FF9A 3DR3A 4WGGA 2DT5A 2E48A 4ALMA 2C20A 1X1TA 1EFKA 3H5NA 3C7DB 3GZNA 5ENDA 4IIVA 5FEUA 1G6KA 1BXKA 1WZIA 4EYEA 2DPGA 4A0SA 4CM7A 3E18A 2VRCA 2VYVD 2WWRA 5EN4A 5FF9A 2D0IA 4BNIA 4DMMA 3WFIA 4IDFA 4BB6A 3CE6A 4CV0A 3K73O 1LDGA 4GWGA 3T7EA 1OZAA 5JAMA 1U8XX 1M6WA 4TKLA 3ETEA 1E7YA 2DPHA 4S1VA 3MEQA 4AL4A 3E1KA 1GUYA 1MXHA 1XU9A 3L07A 5KTKA 3PEFA 4I5GA 1YB5A 2DBQA 2AMFA 2ZJ1A 3PJFA 4ZQBA 1IPFA 3BHJA 5A04A 3WTBA 4N5LA 2AEFA 1FDWA 3GDOA 4B4OA 2QRLA 2ZB7A 3ZNQA 1WW8A 1DJNA 1LA2A 5EQDA 4C7JA 1EUCA 3F1LA 2O48X 1U2DA 4RPGA 3FTPA 4AVYA 3DBLA 2DC1A 2CF5A 2PH3A 1BSVA 3BXXA 2IZ0A 4BO9A 4EITA 4RVUA 4YQYA 1EMDA 2UV8A 2Z1NA 2EEZA 4OGWA 4EGFA 2GN9A 4ID9A 1K0UA 2FPGA 2PGDA 4ZU3A 5CG2A 1KEWA 2DU8A 4NJMB 5DCYA 1ZW1A 3V1TC 3ZNNA 4CMJA 4J49A 4OL9A 5KKCA 3NTOA 2ZTMA 5CEEA 1UZNA 2I67A 1ZEMA 3RIHA 3TF5A 1G0NA 4HKTA 3HB5X 1Z74A 2JFFA 3ADPA 5CPBA 1XHLA 4JGBA 1P44A 3F9IA 3BMNA 3PK0A 1O0SA 3V2GA 3U09A 2D5AA 2VNSA 3K92A 4D0SA 4UUNA 2PKQO 4WUVA 4DLAA 1R4NA 4ALLA 1P3DA 4EUFA 4E5NA 1ISIA 4M89A 1YS4A 4GVLA 4I9UA 1RM5A 5B37A 5T67A 2X86A 2BFAA 2VOEA 4CLXA 2DTEA 4JK3A 2IRWA 4CMEA 4WEOA 3BHMA 2GZ2A 3WWYA 2G82A 2X8LA 3OM9A 4Q39A 1LI4A 3ZU5A 1I3NA 1S7CA 4IS3A 1NPTO 4YXFA 1KEUA 2QYSA 3SC4A 3NGLA 1UH5A 2PD3A 2VWQA 1J6UA 3ENNA 4P8RA 4WEQA 2HCTA 2BRUA 5MDHA 1JN0A 1GZ4A 2O7SA 4ND1A 4JIGA 5THKA 2IDZA 5ITVA 5EQFA 3OQBA 1TI7A 1VKOA 5A02A 5DCUA 1K5HA 1YL6A 3DZHA 4RLSA 1O6ZA 4FDAA 4LW8A 4WCFA 1EUDA 3ULKA 4BNVA 1A71A 5H83A 1V3VA 1PZEA 1ZNQO 5A05A 4BNMA 3DOOA 3EUWA 3OP4A 1Q7BA 4J91A 3D1LA 2VN8A 1EEHA 4Z9FA 3WFJA 4E2WA 4JBHA 3EZLA 1AHIA 5G4KB 4YPOA 3VDRA 4PCVA 1DDOA 3WGYA 1LSOA 3RROA 2O3TA 4CQLB 1N8KA 3B1JA 2PZJA 4JX8A 4J3FA 3ZV3A 5DT9A 3WIEA 1A5ZA 1ADBA 8ADHA 5EJ2A 1GUFA 2Q50A 1YQXA 3M1AA 4CMIB 3PJEA 1W73A 4BO6A 3EY4A 3AY6A 4FFMA 1CJCA 3I6IA 3AUTA 2C2XA 4YAKA 1R0LA 4LRSB 2RH4A 1UZMA 4XKJA 1IULA 3K6JA 4K6FA 3MJ4A 4EEXA 3HSKA 2CVZA 3D64A 3LF2A 3ZWBA 3JQDA 1XEAA 4I8XA 1I32A 1FMCA 3BAZA 2QHXA 3VPGA 5LCXA 2V6MA 1S6YA 3ZH2A 3TZKA 3DEYX 2NVBA 5JSFA 3B1FA 4PN3A 3OJFA 4PIVA 4XGIA 1W8DA 2E82A 4JP3A 4BO1A 1I2CA 4GKBA 4UVGA 4M49A 4FB5A 3RCBA 4U5QA 3RUIA 1E3EA 1ENYA 3QVSA 4J43A 1GQYA 1Z7EA 2X9VA 3GEGA 3JQEA 4FOSA 4C4OA 3VC7A 3AI1A 1ZVMA 4CMHA 5AXDA 3ZW9A 1EDZA 1MGOA 1GEGA 3ONEA 5GZ3A 2XPCA 1GDHA 1HDGO 4EZBA 3PHJA 1X1EA 3EW7A 4FSHA 4TVOA 5K9ZA 2FR8A 1KEPA 3NJ8A 5GMOA 3O9ZA 4XRRA 1UXGA 3EAGA 3PHLA 4RF2A 1SB9A 1H6DA 4KTVE 2G1UA 5IN4A 1N1EA 4XQGA 4KQXA 4XB2A 1MFPA 4WLOA 5IDXA 1OC2A 2EKPA 3F5SA 4IDDA 3CPSA 4NR0A 5JYEA 2YY7A 4FFRA 5HRUA 5L7YA 4OH1A 4OM8A 1DXYA 2B5WA 2VHYA 4TWRA 4XYEA 3LDHA 5JE8A 3UH1A 5LC1A 1ADCA 1V9LA 4QT0A 4BNNA 2EKLA 2ZYGA 5DN9A 3K9QO 4LSWA 4OQYA 2A94A 1XQ6A 1QRRA 3WGZA 4LRTB 3LC7O 4E2XA 3VZSA 1V6AA 2AQHA 2ZCVA 1WVGA 3OH8A 3AY7A 2WM3A 3DBVO 2WJPA 3OHSX 3PZBA 5JDCA 5TJHA 4H7PA 1SAYA 1WDLA 3CH6A 4J7UA 4DPMA 3P2OA 4NDNE 4EI2A 1P33A 2PWZA 1AHHA 1KVUA 2NQTA 1RWBA 4NBWA 4R69A 4E12A 2NACA 2WE8A 3TDKA 1OI7A 1ZIDA 2DBZA 3DBRA 4U6QA 4CLOA 1GQ2A 2P4QA 3KVOA 1TT5A 1GR0A 2PFGA 3I52A 1PX0A 4MVJD 2J5KA 1J49A 2Q99A 1GYPA 1I3MA 2W8ZA 4GH5A 5THQA 3WMWA 1Y1PA 1P0FA 3ZWVA 4D0RA 2EJWA 4QECA 4XZ3A 4ZVVA 3RUAA 2BH9A 3BMOB 1Z45A 3DFUA 3KTDA 1M66A 3E82A 3ZW8A 4MPDA 2XAAA 4CMCA 2WYWA 5BSEA 5F3RA 2CZCA 2W90A 4AJNA 1DFIA 5ICSA 4TRMA 3D3EA 4BO7A 3NRCA 1GAEO 3GN1A 4QO7A 2Q46A 4WLVA 4BNYA 3HFGA 4IJUA 4AJHA 5A9RA 3C3XA 4WASA 3NT5A 3AM5A 3WGOA 1LLUA 3IQDB 1J5PA 4IDCA 4WK6A 5I9LA 4OQZA 4YRAA 5IAAA 3EDMA 1F8FA 2B5VA 4TSKA 4DREA 4ESOA 2WSBA 1O9BA 1L7DA 2R6JA 7MDHA 1KVSA 4YAGA 1QP8A 1I01A 1DC3A 1DIGA 2P9EA 2EW8A 4TZKA 5FI3A 1JAYA 1SO8A 3GVCA 4L73A 3QVWA 3ZU2A 2DUUA 4YJFB 1UAGA 3OIGA 5HWSA 1RYDA 3WIDA
chains in the Genus database with same CATH superfamily
3HPRA 2DPYA 1SPXA 1C2YA 2V0NA 5GINE 3SLKA 4ZRDA 1I6WA 4J2OA 2ZI5A 3IHWA 4AJKA 1XCLA 1FFYA 3OCVA 3A1WA 3GPDG 3UN1A 5AKHA 2QAGA 2QPLA 1HPLA 2A8YA 1LW6E 5C5DA 3GLGA 2AFVA 4MVXA 4U2FA 3TGWA 3FVVA 3LXMA 1A4UA 2UUOA 4ML3A 4Z3KA 4G0VA 1MB4A 2PL9A 1KRXA 3LRTA 4D2IA 2XEXA 1EX9A 1KA9H 3QXSA 3HXQA 2ABWA 1REQB 1RWOA 3F6SA 2DKNA 4MITA 5SY9A 4BEJA 5JATA 2B61A 5F9FA 4G1EB 1C9NA 1MOPA 4HVCA 2TECE 1HDXA 3FHOA 1NNI1 1H1LB 3IDZA 4RM3A 1KYWA 4EKEA 3TG2A 2FPPA 3EC2A 3TO5A 1JALA 1SBYA 4HGNA 2C2HA 1AGYA 1Q0SA 5IAOA 4JJIA 3HZZA 4D6XA 1DRUA 3TOSA 1DBQA 1NLUA 4B0PA 2V7GA 2IXGA 4HPJB 2B99A 3O0DA 4UTPA 3DWFA 1A8PA 2VTEA 3WMFA 1VE5A 1RQXA 3DAFA 5BSVA 1QIFA 3V9AA 5CIWA 4MV6A 4KXVA 1PQ4A 1FPMA 4BV2A 2VDPB 4N8EA 2HA5A 2YVQA 1SQ0A 4FYJA 5JAHA 2IYFA 4P3KA 3M1LA 1MW9X 4EHKA 2XCUA 5E9WA 3UMBA 3IDQA 2PV0A 1OU0A 2MU1A 5F3DA 3GGCA 3HC7A 2CW5A 1I1HA 4FMCF 4IY1A 1KYQA 3H1BA 3V2HA 1KXJA 5T4FA 3I8OA 5EYPA 1SPBS 3FZYA 1X7YA 4L07A 2HRDA 1RTKA 4Q3NA 3HYTA 2VQFB 3DO5A 1WS6A 4FDUA 3EAQA 4CKBB 1YA6A 1T1EA 4F6RA 3H9UA 1RWWA 4RC9A 3DMGA 4A2PA 4KNWA 3HCDA 4F1WA 3OTWA 1VIMA 1CF4A 1X15A 5IUNC 3CLUD 1A2BA 4MPPA 2D00A 2YFQA 4M7RA 3WYDA 4C4RA 2W6ID 4DWWA 4QQRA 5JO0A 3V80A 2VH5R 1MA0A 5AH0A 1PG5A 1QQ6A 1YZ3A 1X2EA 3W2FA 4H27A 2OA0A 1DEKA 2B9VA 1WDKA 2CYCA 4JZKA 4BC1A 1DTSA 4R1LA 3ROXA 4BY9E 3V4VB 2QAGC 1F8XA 1E1CB 1KFCB 1TEXA 1VSTA 4PFSA 5DYGA 2P77A 5KX5F 3Q9SA 3OECA 4HMOA 4MO9A 4BE9A 3GZ4A 1LDBA 4D4LA 2GR9A 3OM1A 2FWJA 3I5UA 2FSHA 1JPNA 3PDHA 2NO9A 4M1QA 4R2IA 3VR6H 5HUJA 3FETA 2D2EA 3TR5A 3JWEA 4UVIA 3MWJA 1QM5A 3T4EA 2R8BA 1UQUA 1RKUA 2ATXA 4W9RA 2DHEA 1B0ZA 4OCZA 3WSVA 3KOWA 4EX7A 3I0ZA 4PVCA 2QAIA 2J41A 3TM5A 4LEIA 4AF7A 1TJYA 1NI3A 1E2JA 2IGBA 1N32B 2WY2D 2VJDA 2OHIA 4DDHA 2C9MA 2IWHA 3PQ2A 3GCZA 2AWOA 3TI9A 1YZYA 1Y37A 4K6KA 4PRYA 1XDDA 2ZQZA 3U6KA 1BCRA 2WM9B 2L18A 2JHCA 1PK9A 2WUEA 4KN9S 3OQIA 3ST7A 4C43A 3L1JA 1VCMA 3H5VA 3JVDA 4BX3A 4DQDA 3C74A 2JIPA 1Z0DA 5D5PA 1TYZA 2IHTA 1T8UA 4OKIA 4A0RA 2KI5A 3K8YA 3ETCA 2JGEA 5ALEA 4DCPA 2I5PO 1HR0B 2JJ2A 5A4KA 1JG2A 1R9MA 4BECA 4DB2A 1IN4A 2G63A 2NSHA 5DLDA 2WEKA 4U7DA 3D4LA 3VGJA 4DMLA 1NMXA 4RAQA 3MWGA 4TM8A 5H4HA 3OMXA 3WQBA 2FMKA 3KJFA 3O2NA 5KSPA 4C2BA 5MN6A 1OYYA 5FOXA 3U17A 1AKMA 2AIRA 1W88A 4PLZA 1ADFA 1GNTA 3DR5A 2R7MA 4B7UA 2G4LA 4A0HA 3U2QA 1FJ2A 5CBPA 4WD3A 1B0AA 2QB5A 3A04A 1CT9A 3HL0A 2QN2A 5AJZA 3ZE2B 3GAZA 2SCUA 4ZP1A 4O5OA 2EU8A 3H1AA 5TQ0B 5KQPA 1SHLA 2AKAB 3L8GA 4HMPA 4KLRA 1DX9A 4L8VA 3LP8A 4PZUA 3EXEA 4Q18A 2C42A 5C80A 3WK9A 1NNSA 2IC5A 4O6VA 3V4OA 4AJLA 1YRQA 1ZU4A 2ZI6A 4V0NA 4WXEA 1ZINA 1TTQB 3JQCA 4LJ4A 3PC8C 3U48A 2YMQA 1DAKA 3HUFA 4XCXA 3FDXA 1MO3A 5K3DA 1XEFA 3ZI0A 4WBNB 3AGPA 1MTOA 3GCXA 1RT9A 3IEPA 4P4NA 5L4NA 1IM5A 1KI2A 1V4VA 2VDNB 3CB4A 4MQBA 2YH2A 1YB1A 3DUFB 1CVLA 2PX5A 2YWJA 4EY3A 2GAFA 1PL6A 1US8A 2J5XA 3I61A 3PRHA 1JHMA 3ZI4A 4BN5A 1H0KA 2F43A 1HI9A 3CIOA 3D4PA 4XPIA 5B3AA 4AJ2A 1GTJ1 3LYLA 4Q9KA 2ZVJA 3INYA 3V4ZA 2WA1A 1NYTA 3WGVA 4H4DA 3HKDB 1B16A 2Y1EA 4INZA 2O2ZA 3ETGA 5IAGA 3WBBA 5JXJA 4EPXA 4MYTA 3U3KA 3U3RA 2QJFA 3OQ1A 2FPMA 1S1MA 2QYOA 1E18A 1SUWA 5TVGA 1X13A 3H2IA 2NVOA 2X13A 5SV2A 3IO3A 3TTVA 1WXWA 4YRJA 1C0LA 1SHJA 2H07A 4FW9A 1N2CE 4CM9A 4D9JA 4JYAB 5DNUA 2J3DA 3L0IB 5BSGA 3OURA 2WPDD 5HQTA 1SIOA 2C5SA 1ZO8A 2Q5FA 3A31A 4UNQA 2EX0A 3GNSA 5ALPA 3D8TA 4DQUA 1QIGA 3PDUA 3PGJA 5G3ZA 5C8XA 2OM6A 3ZKWA 5ES3A 2I9KA 4NECA 3FG9A 2G83A 3ET4A 5DTJA 2HRBA 3E84A 3OIYA 1SD2A 1EFUA 1A8IA 2WWHA 3OFSA 3QX3A 2Z2XA 3CIFA 2IHUA 3GUZA 3A1EA 4P3PA 3KLPX 1XDZA 2AQIA 3IMEA 4YDSA 1J21A 4BB5A 1KY5A 4YY3B 2PGJA 1LNQA 2PIDA 4JKOA 2V3CC 1A9ZA 2FRDC 1FP2A 4LOKA 4B3FX 4ECEA 4OK3A 1CJSA 5LQKA 2B83A 2O3JA 3DTVD 4KHZA 1XMSA 1MJFA 2GO7A 2P65A 4KUEA 4L95C 4XQ0A 5T5QA 2MSEB 3KYCA 4P5EA 1HA3A 1WZUA 4MH0R 2Q45A 2ZUWA 1Z83A 2YW2A 1SVUA 1TEZA 2FLWA 3MF4A 2V59A 3FB4A 5EESA 2P4EA 5JJBA 5FPQA 3SQNA 1UM9B 2I8LA 3TIIA 3J7AC 3UKOA 4IEFB 2RAPA 1ZDMA 2XGSA 4BVHA 4TMYA 1Q7GA 2Y2UA 4KODA 3VZCA 3GYBA 2FPXA 3MELA 2X0RA 2FN4A 4ZI7A 2WTBA 4NFHA 4LC0A 1FU8A 2PTHA 2OO3A 2UYYA 1GQRA 5ALXA 5GPBA 3WK5A 2IH2A 5EZYB 4UE2A 4MNTA 3RC1A 1U6IA 1W4RA 1K5DA 3LVRE 1QFMA 4BPBA 1XTSA 5DP2A 4BLTA 3FMVA 5L53A 1DQRA 1Y0BA 3F4KA 2WP8J 3OQPA 5AMXA 3RS0A 4U7GA 3GLHE 5A4AA 1LV7A 2WJVA 1E9BA 2M98A 1TT5B 3Q98A 4CLRA 4E13A 4KO3S 4YI3A 3ZGVA 5HZKA 4XYLA 2VXOA 2FF5A 4W82A 1IB6A 1XAGA 1P3Y1 2FEMA 2AN1A 2DUMA 3SNHA 5BSFA 4YCCA 4ENQA 1TJ3A 2A92A 3PGMA 4MGYR 2EHJA 3ESZA 1J22A 1VJ0A 4FT2A 3UCFA 5JCJD 4PRKA 3IVMA 3C8DA 2YWEA 4OL0A 3OIWA 1UXIA 3A4LA 1CJKC 5E6SB 4HSGA 5IKMA 1N34B 1SOAA 4LDPA 1XCOA 3RNOA 4ZQEA 3GJ3A 1DELA 3OHPA 3GAMA 1ORWA 2ZUTA 4MMZB 4DMCA 1W4ZA 3D6MA 3E5MA 4QT4A 3PPYA 3GDWA 3RYCA 4E32A 2INGX 4FSXA 4Q3BA 4XYGA 2WHYA 3CFYA 3N2ZB 1DJMA 4WY2A 1YE3A 1G42A 3HMQA 1H1TA 1YQEA 1NNUA 3RKRA 2DLCX 1HTTA 3P71T 4KQHA 1WTCA 3PIDA 1JMVA 4UUQA 4R4JA 5DM70 4KQCA 4JI2B 1T29A 1BCRB 2CHUA 4FJ0A 5IEJA 1KF0A 1EQAA 1Z7GA 2I6UA 3HQ4O 4AWBA 4Q66C 2LRHA 2AXQA 3L4KA 2RCNA 4HCJA 1QOPB 4HI0E 1J2UA 2V6IA 3FB1A 3KVNA 5BV7A 5C8YB 1ZHOA 1TAUA 3HHPA 3OE4A 5E4TA 3I37X 3ZOKA 3ROFA 4EYGA 1QDEA 3EWNA 1HWYA 1W2WB 2R7KA 4YP6A 4YUAA 4KR6A 1U28C 4UHBA 4XXHA 3RUEA 3TDMA 1PZGA 3QLTA 2WILA 5T7BA 4PYKA 3LLVA 3KEOA 4QQ8A 5C1BA 3B1VA 5B3JC 4BVLA 1ABEA 2AFHA 2GSDA 3ROTA 1ZICA 3D3WB 1RQ7A 5HS6A 1ZD4A 2GRJA 3H04A 4RE5A 3TNYA 2XA1A 4XTRA 3HM9A 3GJRA 1FP1D 4MP8A 1P4AA 3EVEA 3JWHA 3PPIA 4RE6A 5TDHA 3SOZA 4PFQA 1E96A 4IIGA 3VR5A 1K06A 4Z51A 5HEKA 4AZTA 4PHCA 2F55A 5EJ4A 2HXGA 2R6GA 2JFVA 4AS2A 5HYVA 1E0AA 3LRPA 2CHEA 3FOCA 4UUPA 1EFAA 1JIJA 4NESA 1Y9ZA 1BJTA 1N4DA 1U0NA 5D01A 2GHRA 2CVQA 4F9TA 4X84A 1D3AA 3FSGA 1FMJA 4W8HA 3WHPA 2AN9A 2JKZA 3CO5A 3U9SA 4HX2A 4MVJF 4Y2TA 5JDCC 5TF0A 4PPNA 3OTOB 3DAYA 1VTKA 3EFOA 3IB6A 3LF1A 2WQ7A 4ILKA 3TAUA 5IABA 1X42A 1QYIA 2IVFA 1V5EA 1KP9A 1NJ1A 1VMKA 3MCZA 4IDNA 3I4CA 4IXDA 4TQAA 2PGOA 4W4TA 5DEOA 1U7PA 4MV8A 4CF3A 2Z95A 3RRBA 1VIVA 3K5PA 4M9RA 2H54A 2VJQA 4RK0A 2RONA 4RBNA 5HJ7A 3GFTA 3OEHD 4BX2A 4ENVA 2UYOA 4TQ9A 2GAIA 5LN1A 5AVYA 2C95A 1E1KA 3AWIA 4PZEA 1QF9A 2B4AA 2C4HA 2GPBA 1UT8A 3OTGA 2UZAA 2ZJ0A 2CNNA 2W42A 3B78A 2AXPA 1N7GA 2Y66A 1T2EA 4QNMA 4EG3A 3GEHA 3PL1A 4HFJA 1R0XA 3P9QA 3RD5A 4B80A 2FEWB 2YWGA 3AUJB 3NHAA 3BEOA 4JMLA 3CKYA 2H59A 4NENA 2NUAB 1NBIA 3A9TA 4IUCS 5CLGA 1GR1A 1A5TA 3HNPA 1SKBA 1QZTA 1UK6A 1I94B 4P3XA 5MFZA 2XQFA 1DFGA 1P5ZB 4GX0A 5EG5A 5CU7A 3ANSA 1CV2A 1SH7A 2W8BA 5CFQA 3WGKA 4EB0A 2AG8A 4D80A 2OV1A 4EEZA 3GJ4A 5ALDA 3ZIAD 3PHBE 1HNZB 4UHKA 4X1YB 4BATA 1L7PA 3N7UA 4D41A 1XV5A 3B82A 2NUTB 3O93A 2WWTA 1AHNA 4HC4A 3ZLJA 2C96A 2V54A 4U7WA 1PJLA 3I1YA 4EI7A 3PE3A 1U5BB 2AHOA 2G28A 5BSWA 3H4IA 3OM8A 5K4GA 2HADA 1OPXA 1S9HA 3ITEA 3W8EA 1X7WB 2FMIA 4OXQA 2VZ8A 4LOAA 5ALSA 4CTNA 2MSLA 2GUWA 1L1FA 3CJRA 1SCQA 5FWYA 3GEBA 1NW6A 2P75A 5FA6A 9LDTA 1XALA 3IQHX 5I9IA 2NX2A 2Z5LA 4HGPA 4NS4A 4RCYA 5JFGA 5JNLA 2J6IA 2I99A 2JJ1D 3R0XA 3LG2A 5DGXA 4BO0A 4BNWA 1FQWA 2HLDD 2IU3A 3IPRA 3KLOA 2IEGA 5DX1A 3SS7X 1YU9A 4DL9A 1R00A 1BEEA 1VCHA 4I46A 5ALRA 2CY0A 3AKYA 4XH9B 2E6UX 4DLTA 1BROA 3RVDA 3UXMA 1LRLA 2O2SA 3C48A 1KNXA 3PXAA 5C2JB 4NNPA 4BZQA 4ENRA 4AN1A 2C4TA 5HTKA 3KKZA 5K7SA 5KVVA 3N6XA 1WR8A 1P81A 4AWAA 3C3EA 5CNKA 3TQIA 5JH7F 3HYLA 4ZU6X 3DTNA 3EGIA 2AKEA 4F84A 3ZE8A 3H9BA 3AHFA 4B34A 4C89A 4QICA 5ADWA 1GKYA 4DDKA 1SRRA 4JC8A 3Q7SA 3GRKA 5KC8A 1EP2B 1CZOA 1R0ZA 4FFDA 5B6PA 1XJQA 2CYBA 3NKVA 2BDTA 2PCLA 4LKOA 3S2UA 7AT1A 1DLIA 4U2DA 3PLRA 3DUFA 4YPFA 4JENA 1E61A 1GVHA 9ABPA 4RTSA 4L0MA 3PXXA 4UHCA 1VL6A 2QM8A 3DF7A 4QUKA 3EGVA 1QVAA 2HCJB 4YAIA 5FOTA 4WN9A 3R7WA 5MN5A 1FNBA 4GZ3A 4E30A 4FNOA 4Q00A 4B73A 1OASA 4C20A 1QGOA 3RTCA 1BKYA 3U13A 4Q7LA 1I6MA 3TJMA 4KV9A 2RHRA 3OPQA 2R6HA 5B1DA 4NDAA 1JZSA 1QWSA 3Q40A 4JI8B 3EW9A 1GZ6A 4B6RA 4KLNA 1FFWA 2B4YA 2ODEA 5I7OA 5AW9A 2W48A 4BP3A 1RYBA 4IINA 2HIGA 2VZ9A 4HDNB 3NHUA 3SSAA 4C4TA 4M0DA 2F6RA 2GLXA 1AE1A 2WYOA 4X00A 1B8NA 3OIVA 2RC6A 1PD0A 1KS2A 3FPCA 3MJVA 3I83A 4NHOA 4OBXA 1NMZA 1O03A 1HQCA 3EVAA 4DVJA 4E6PA 4YRNA 3VNUA 1BYUA 1FQKA 2IUUA 5C4IA 2JDID 4RIFA 3EUEA 4RHFA 4BVAA 3PJRA 4J2TA 4E5MA 5H59A 2UVQA 1CUJA 4Q12A 3FBWA 3SQLA 1ESDA 1E2UA 5CX1A 3FPAA 1M73E 4GP6A 4HP8A 2FHPA 4RQTA 5COQA 1L4EA 5HILA 4G81A 4P0TA 4GXQA 4V03A 3B6JA 2EF1A 1ZD5A 1R6TA 2PZEA 1WXDA 2FZVA 3OQJA 4F3NA 3W2HA 2JLSA 2HHHB 1KFEB 3BKWA 1SC1A 4GPD1 2XNDA 4AZSA 4MI9A 1ZH2A 3HS3A 5BQXA 1TUBB 5KQRA 4G0NA 1XTPA 1L0BA 3KX2A 5C7YA 2ZI7A 1EIWA 5K3FA 2B37A 4TS3A 2ATCA 5ELXA 3LMKA 4YRRA 4WZBE 1QBKC 3RYTC 4JLBA 1FQJA 3LKBA 4HFRA 3F5DA 1YFJA 1T8WA 4NYIQ 5ERYA 4B76A 5AKXA 4MAMA 1G6OA 1Z26A 2D3WA 3ITKA 4FYVA 4RL6A 4RV5A 4UNSA 4B79A 1EZZA 1VZ3A 4NNJA 1OB5A 2VP9A 3MQ4A 5EI5A 4EG5A 2R2AA 4MWBA 1EEXB 2BEKA 4P4SA 3H97A 1ORVA 4GWKA 1MW8X 2E37A 1OBFO 1BDMA 1WP9A 2YFHA 1YZGA 1QNFA 3CJQA 2P2ZA 4DY6A 2I4TA 3SKYA 3DV0A 3HVKA 4II3A 4QUGA 2BFCA 3KDSE 4HDMB 3DPSA 2VWPA 4RGBA 5FORA 1ZMXA 3KT8A 2JCYA 4CM8B 5KNBA 4H9GA 3HB9A 3JQ7A 5LMNB 2KSQA 1NLFA 2ZSDA 3R5FA 5G53C 3TWOA 3U81A 1EUZA 3A1VA 4PG7A 3ZLUA 3RBXA 4FI3F 1JAXA 3CHYA 1OXBB 1Z39A 5HFNA 4E15A 3SJZA 3EPHA 1HMYA 3PXUA 4OAQA 3RI3A 5IK2D 1WPXA 4UFPA 2Y1FA 1GL3A 3ODGA 4Z4CA 1FXWA 4BO5A 4G9EA 2XODA 1X3SA 1NBAA 3EWAA 1U0HC 2QP4A 3PNYA 3R6GA 3V8PA 9GPBA 3NOOA 5HMMA 5LBTA 4XVHA 1OX4B 2Z58A 3G0OA 3N8KA 1QG0A 3JALA 2FPIA 4IMRA 4UAGA 4DNFA 3G68A 4DV2B 1RHQA 3ZHVA 2NQ2C 1JAHA 3ANNA 4B3DA 4DJFC 2O7NA 1BE0A 4D8XA 2LCIA 1SXIA 5CXSA 4ZAFA 5FUYA 4WBNF 2EBFX 5DFAA 4CTOA 1YQWA 4OSPA 2O7QA 4PYIA 4UEOA 2ZSBA 5YASA 1N5KA 1O6FA 2ZRIA 4PCLA 1Y5IA 5SZIA 2QVGA 4J0HA 5B5SA 1IG3A 1C3OB 1YQQA 2PRYA 3WLTA 4GOMD 3IAFA 5CFNA 1GGVA 4PC1A 1T5SA 3M6WA 3LL4A 1PBNA 1T15A 3PIIA 1KIMA 3WA7A 3LE8A 2JIOA 3H5AA 3R44A 5FI1B 5LYJF 3BFKA 3L4SO 2IZOA 1B6SA 5CGZA 1REQA 4LS3A 4UVEA 2JAWA 2Z6AA 4W9MC 3RHFA 1RSZA 2DEUA 4JP2A 1U0EA 1W85A 2V9PA 1YVEI 1JJBA 1LBSA 4LKRA 4D92A 1CF9A 3HVUA 3U1TA 2B0CA 2FI1A 4DQKA 5D5HA 1FA9A 3PUKA 2P62A 3E4CA 4TV9B 4DLYA 3GLIB 2FQXA 4D4GA 5HKBA 1E4OA 3ICOA 5L3VA 1WD5A 1G3RA 5IM4F 1F20A 3R7AA 4YDHB 4ZO8A 4IVQA 4D26A 5GJBA 3MBIA 4K9MA 2WT8A 3MJCA 1U1EA 1IU9A 1E0SA 3BGIA 3OJ0A 1FJGB 2H17A 4Q5IA 2EW2A 3PLNA 1DKLA 1TQDA 4J4BA 4CUKA 4H1TA 4JJEA 1W48A 3GARA 1WA5A 3KAJA 1Q3KA 2CLSA 1QP4A 4O4IF 4EHDA 2C84A 1TCVA 4Q4HB 3BRCA 5EHZA 3MRVA 4JX9A 2GD1O 4ZDIA 4X64B 2AC4A 3SR0A 4LXUA 4TT3D 3HO1A 3RQIA 4AJEA 2H1LA 2EWWA 4Z4HA 3SEFA 1YQTA 5GGXA 2FDXA 2C4UA 2I7CA 2XDQB 5I48A 4NOMA 3NHLA 1XP5A 2ZSAA 4E3WA 4NICA 3JALB 1E77A 1ZZEA 1W44A 2XYHA 3EIOA 2C88A 2FA9A 4RDXA 1VHWA 5IJ0A 1MJGA 2XWSA 3MLBA 2ZAYA 4F2HA 4HHEA 1TX4B 1RQNA 3P26A 2ZTLA 3KXPA 4J1SA 1NIPA 1PVVA 1U7UA 1U9IA 4F46A 4X91A 5ISMA 3VDMA 1EE9A 3PTZA 3DMYA 4P3YA 2IYOA 2Y1KA 1C3LA 3GRRA 4HQFA 4LXIA 1AK2A 1GGEA 1IWBB 4J1QA 3U3JA 4AX4A 4KPGA 1O9GA 1KPGA 2FUKA 2HSWA 1H9AA 1IVYA 2XUQA 4O63O 5DOZA 1J2RA 2WUGA 3GJ8A 4I5EA 4WXHA 4YBZA 1DZ3A 3MJTA 2EFYA 2Q28A 2PJZA 2PT9A 4EO7A 3GGGA 4YQZA 2EYQA 4JOCA 1QKJA 1Q92A 2ISQA 2ZWPA 3KDAA 1AQUA 5CYGA 3LXUX 5FUVA 1FPQA 1HG0A 3NEPX 1FFSA 5CD9A 2O5CA 3SHFA 3Q7EA 4KJZA 1DKMA 2FZKA 2WBLC 2VDVE 2YV3A 1NV9A 2NUPA 2CJWB 2JEOA 4E4TA 1BHJA 1WQ3A 2GVNA 2V6GA 1M2OB 1MOZA 4OEHA 3LFTA 3VI4B 1QUFA 1M8FA 1V26A 3BSYA 2X1HA 5H16A 3ROKA 3QKSB 2KE5A 3VDQA 4LOIA 1BE6A 5FXMA 1EE2A 1N5JA 5E2AA 3CLRC 4URXR 1DAIA 2PE5A 4XWKA 4LF4B 4Z86A 4PAMA 3TSZA 3BWMA 3FZEA 5DF1A 3DKKA 2O4UX 3DLCA 3MOGA 5IF3A 2CV0A 4K03A 1YVRA 5HKKD 3A3OA 3BK7A 3F3MA 3HKCA 1GL7A 3WRXC 3TMKA 3OEYA 1Y8QA 3ZBPA 4CIDA 4HB0A 3O4JA 1NVBA 1KJZA 5EWMA 4AM8A 1S3IA 3NIBA 5KYVA 1KYYA 5BRJA 1LRJA 2WHPB 3PCTA 1V5GA 4HUQA 3DDCA 5HQJA 1CUHA 1U7WA 1Z16A 2PKRA 1F60A 3CB2A 3S3TA 3CVXA 4YP9A 1ZK2A 3SF8A 3ZK7A 4AFNA 5K0JA 2I7DA 4JKIA 2X2EA 1YS7A 3UGJA 1T9GR 1N25A 1X1RA 3U44A 3DBRB 5LA6B 1W2HA 1MUUA 4K8RB 1IXYA 2EBUA 2Y3IA 4XDHA 2XR1A 3ICVA 4QGFA 4JDPA 4LSGA 1F6WA 1W94A 2OORA 4HAVA 4QJIA 1NQUA 2WDZA 1NN5A 1ZMBA 4PSAA 4IHKA 1VRVA 1Z3IX 5LZ9A 4QPNA 5FBLB 2VXYA 4JOQA 3WY9A 3WAJA 4M1SA 1TUIA 1E7MA 3COZA 2O1EA 4H2DA 3IESA 4ND8B 3TQTA 5KWEA 5CT5A 1UJCA 1B8OA 2I6SA 4PZ9A 5I3CA 2TYSB 3KIPA 5JECA 1C9DB 3L7OA 4RHXA 3UJCA 2C5BA 3QOYA 4JI7B 4TSFA 4YGYA 4YQEA 3TIFA 1KK1A 4LOJA 1G9TA 2MWMA 5AK4A 4RSRA 4BEBA 1G98A 4H7FA 1YXMA 2E55A 1RAIA 1SWVA 1ZW6A 3KP1A 3Q2OA 1H3FA 2FW9A 2P4HX 5T8KA 3R7WB 1II8B 3DAOA 1M2GA 1J1UA 1JDVA 1IHYA 1ZOLA 5DGDA 1TKAA 4QTXA 3D1JA 1CK4A 1SBTA 3RYHA 1M8JA 1RCTE 2PX6A 3WGMA 2JNWA 3ESCA 1MQAA 1K7CA 3DDHA 3OIDA 4ALNA 4PZCA 2ZCJA 2IE8A 2H1CA 4H59A 1E58A 4LJ7A 4YBRA 2AYYA 4MRRA 5IX8A 4NCNA 1H85A 1LC3A 3YASA 1SEPA 5KNCA 4WNAB 5DWDA 1L7RA 1VGQA 4LSZA 3IBTA 5JPCA 5K8VA 5COBA 2H2IA 2VA9A 4A5OA 2ZRMA 4NZ9A 1UBFA 3LHSA 2WU8A 2IUYA 1J2TA 4U7PB 1TJ4A 4JR0A 2Q9BA 4HBZA 2A5YB 2G04A 3FIUA 1P4SA 4UM9D 4D02A 2C4VA 2NIPA 5CFLA 2JLAA 4DJDC 1BW9A 3PA8A 3WLFA 3EGXB 4OJTA 5AW4A 5J58A 3BXOA 1ZC4A 3VZRA 4F1JA 3FTEA 2HR1A 1XHFA 2C83A 3TLBA 3M1YA 3O92A 4I55F 4M1WA 4FE7A 1QFZA 1FX1A 1SXJE 5COAA 1UMKA 2XQVA 4I4CA 4PY2A 4IJ6A 3K2QA 3WGHA 1NBMD 1OWMA 1D8TA 2BI7A 1JA9A 4V0ME 4MDEA 5TPZD 5GIOE 2F1IA 4ZEVA 3UBMA 3K1JA 3UJ3X 1UWLA 1C4XA 2Y76A 4KKXB 3TLXA 1DTEA 3IOEA 3B36A 2ZBDA 1X7WA 3PWZA 4HDOB 1TF7A 3TIXB 4U02A 1XMQB 4N03A 1QV6A 2CFRA 1LPAB 4B74A 1QYXA 3CVOA 5JQGA 1IBRA 5A9SB 5EAIA 1GLVA 1PQUA 2AJBA 2EL9A 5AOAA 1ZJJA 5HF9A 5JXHA 2JLBA 3LXXA 5L4LA 2Z5FA 3DKVA 4DYVA 3AIKA 1IVSA 1Y48E 2H65A 1IY1A 5DWVA 1IXKA 2HN9A 3PCXA 4FZ5A 3VI3B 1JGTA 2I1VB 3BILA 2DHRA 3VR5D 4ESHA 5A5FA 4IH4A 2O0JA 1G3MA 5FIUA 2WWYA 1E7SA 4DANA 4J6FA 4INJA 3TEJA 2LKDA 5J5CA 3WLEA 4Y67A 1XTVA 3NBFA 4AF6A 3RC8A 4JKYA 2QPTA 2DUWA 4KVGA 1CVIA 3O7MA 4O8CA 3ZNOA 1IIRA 5FL3A 3DTVB 2BMDA 2PMBA 4R1UA 5KREA 1SELA 4RA6B 2VL7A 1V7PC 1QIIA 1W35A 2F17A 3F98A 4UBOA 3SZUA 5LIRA 2PWYA 4LTMA 4K6HA 4UNNA 5G4KA 2EJVA 3CZAA 5LQUA 2JRCA 2F4NA 3BMQB 4JR2A 2ZJZA 3OT5A 4POOA 2A59A 2X8BA 3NIDB 3NVAA 4KH0A 3ED1A 5MGNA 4LMBA 1W36C 3SS9X 4YGXB 2FW6A 5GM1A 2ODBA 3GJSA 1U98A 3QNWA 4PC2A 3RRFA 3P97A 5C3MA 2XYPA 1B0UA 8LDHA 4C6TB 2E5WA 1PV2A 2G6BA 2PO7A 2Q7DA 5KZMB 1BS2A 1PJ2A 2VRWA 3P9XA 4A8JC 1GFIA 1T10A 3H5LA 2JGLA 1E2MA 3IPYA 4CI0B 1MXFA 3UK7A 3EFOB 1QR2A 4QJ3A 2P0EA 2Q3MA 2XYVA 1ZUHA 2DFNA 2JFBA 3LJKA 5AHKA 5BQPA 4DCJA 3E9MA 4RLQA 3UGTA 3ZCUA 1DDGA 2EJCA 1HETA 3CMCO 1MB9A 3LUFA 3BL8A 4L5CA 2X8JA 2HWKA 3ISTA 3FH0A 3H3FA 3I5AA 4OXXA 3WTCA 4AG6A 3NH9A 1Q1NA 3TECE 3T3GA 2FEXA 3C8UA 3DFZA 3Q9LA 4Q02A 5ITZB 3WQRA 1DX4A 2JLYA 1ECJA 2VA8A 4FZVA 4P7KA 4RX1A 1T34A 3TRHA 4A15A 2PUAA 2AJCA 4OU5A 2B7LA 1QLJA 1BN6A 1E66A 3L02A 2HF2A 4L3VA 4P4GA 3AR5A 3QSGA 4Q19A 1FMTA 1U1CA 2HMTA 2FUG6 2CNKA 3LLCA 4D9FA 2I7XA 4IOLA 4CDMA 1XRRA 3GLHB 4B8WA 5GTDA 3LIIA 3D3WA 2PN1A 3DBLB 1I9GA 1SUIA 4L57A 3OE5A 3T6KA 2QL5A 4YP0A 4KPYA 2BH2A 1JXQA 3DEZA 1GWNA 1XPRA 1F7UA 2O50A 5L8VA 4FC6A 4MB2A 1IOWA 4BKRA 1RJGA 2C00A 3GUCA 5B3JA 2C3PA 3GF4A 1VJ5A 1QE0A 2OAP1 2GI4A 2W6MA 1AQIA 3IAHA 1V1RA 1C14A 5AXAA 3V1UA 1QB8A 4N5MA 4AQDA 1F51E 1HT0A 2BFPA 2VEOA 1JFLA 4U9UA 3GW8A 3IXLA 1ZM4A 2LDBA 1JA1A 1DL5A 3ETDA 3I2HA 4MVJP 2NN3C 2QRPA 5AKGA 4FWTA 2I4MA 2JFNA 1LW7A 1NVWQ 1QK3A 2BM8A 5CFMA 5KWVA 1HV8A 2H4HA 1VA4A 1GKKA 4MX8A 3DZKA 3BZWA 3EIEA 2JFOA 1JLLA 3ENKA 4GWLA 4Y2RA 2Z4RA 2ZI9A 3C14C 1PGJA 3LDGA 1LD3A 3LLMA 4NJMA 4TN5A 5DJ5A 5DX0A 4AXBA 3SD7A 1OLXB 3QLUA 3BL6A 4Q16A 4Y2GA 3W5JA 3ZUPA 4ARCA 1L8XA 2AN3A 2W4MA 1TYCA 2OWEA 2PPLA 4HQKA 3UMSA 5F2EA 1NT2A 3BWVA 1E3TA 4X8LA 3JAMA 2R6DA 4UUBA 1DUIA 2ZYWX 3IUEA 1QS0A 2QT1A 3GOHA 3LSYA 1QVWA 2O2GA 2YJ4A 4AUMA 1XYYA 3T5MA 2H1OA 4C2TA 1EK1A 3DYBA 1FS4A 4G24A 4JSRA 1L9KA 1S2OA 2WKWA 4O1MA 1DMRA 5KQLA 4HYQA 1R9NA 1LY1A 2UUBB 2E49A 3PEVA 5SYAA 3GVHA 3WL3A 4ZQGA 1YBMA 2YUIA 4QJ4A 4G8JA 1U9CA 2A3NA 1Y6JA 1YFLA 3TEFA 3GMSA 4KN5A 2VUTA 5JS7A 1APBA 4P5PA 2OR3A 5FL7A 1UKYA 4NLLA 2Z6UA 4CL8A 1ZISA 2LBPA 1E92A 1T9GS 2VYND 1QCZA 1NYRA 3R09A 4L5IA 5I7WA 1D03A 4DBVO 5EPEA 1CJVC 3SPXA 4A6XA 4CL3A 1EAYA 2UZ1A 1Y4UA 1Q7TA 1QTNA 3U62A 4EA9A 3E1GA 3GBVA 2YN4A 3SYNA 5CFZA 5JZOA 2I87A 3BGVA 1M6EX 3CYFA 5AQ1A 3NHYA 3PX2A 3V1LA 1P0PA 3AR3A 1XTTA 2D2XA 5JNRA 1L6IA 4XQCA 4ZDKA 1ZM9A 2CMGA 1WY5A 1M1YE 4XLZA 3QE3A 3NP7A 1GPBA 2VRCD 2VYVA 1DU4A 3Q11A 2OGTA 3R3JA 3DKPA 3G5LA 3HDJA 1SM4A 4NBSA 2BBSA 4LHXA 3EPJA 2I33A 5KSWB 3GZNB 2FP4A 1PTJC 1ZOOA 4GR9A 5KYUB 2HH9A 3T15A 3P9ZA 3QEJA 3GA7A 3BA6A 4NV0A 3LBIA 1RYHA 3KOXA 1XZEA 4H7DA 1WJGA 2I66A 2P30A 1CFJA 5K6AC 2JVKA 5JNTA 2Z8YM 2WHRA 2VPZA 4F8YA 5CT8A 2C59A 2QD4A 2VLIA 2C04A 5E1DA 1QMGA 1K8XB 1YZKA 2QZ4A 3WVNA 1XR3A 3AR2A 5TPZA 1DS6A 3HEMA 3RABA 5BPFA 2H29A 4C9BA 3O75A 1LZKA 4DUYB 2XT6A 2NO4A 3H5OA 1NT4A 4TYWA 4OJYA 1GTL1 4ESEA 4W5WA 1UCFA 1ULAA 1XZNA 1M5UA 4JGIA 5ALYA 3ZZ1A 4MVJG 4MS1A 3RNLA 3OZIA 3QKTA 4QFMA 4EFNA 2BHNA 2J9FB 3KT0A 1HE8B 1YDWA 1BDBA 4TLMB 2KW5A 2XBUA 4NYIR 4S1PA 3A37A 4EFDA 1TT7A 1EHCA 3D9QX 1EWYA 3HCPA 4COOA 2YIJA 3PUHA 4RKRA 1UJ6A 2GZDA 1GD1O 1I3LA 1YJAA 3WGTA 3U3ZA 1C7ZA 4FDVA 4B5KA 4URYR 2YDXA 1JDPA 3JASB 1SA0A 3PA6A 4IXTA 4A8TA 4KYIB 1NHGA 3D6TB 4PGGA 3WYGA 1LPPA 4C3UA 4CKEA 4D9EA 2QOEA 5IVDA 1NW3A 1ZGGA 1TZKA 3N2EA 1JEOA 5KCZA 1GOTA 4WJKB 2AYZA 3TLGB 4EHFA 3GGOA 1CF2O 1Z25A 2QVYX 5CJPA 1NVVR 2FQQA 1EVJA 2F43B 3RRXA 3Q7PA 3Q15C 4NFLA 1K6EA 1U1FA 2OBNA 2FF7A 2H1WA 1KU0A 1NUSA 4QODA 4YTEA 1UJ5A 3P94A 4TXLA 5LZ2A 3ER9A 3WKEA 1HEIA 3F5FA 4BKMA 4DM4A 3PQ6A 4ZCMA 2PL1A 1EVKA 2ADOA 4RDIA 4GOOD 8OHMA 1ID8A 1GTZA 1LSUA 1O5IA 2YMLA 1GTMA 4C05A 4N3CA 3AHGA 4BFYA 4DAOA 2ESRA 4FW8A 3D4OA 4NAUA 4L75A 1K7FB 3Q9NA 2XBLA 1EXNA 4F5WA 1A97A 2UVDA 3EXFA 3BRSA 1NU6A 4FS8A 1FS5A 1TC1A 3BGSA 4LG1A 4J0GA 4RNDB 5HW0A 4LC1A 1RAEA 3GYGA 4V2UA 4D4HA 3IBFA 1B23P 4KSBA 1LQUA 1VHQA 4PBRA 4RFVA 1JV2B 4UM7A 4LE1A 5ESDA 1NXVA 3OD5A 4CLDA 5CBPB 2QMUA 4HAOA 1NYQA 2OSVA 3B1KA 3B5JA 4OFXA 4WLFA 5L45A 1S8NA 2RHHA 1GPH1 2QDKA 2XZPA 5AW6A 1BDIA 4YRCA 2EXXA 4LFAB 4MJ3A 1RPZA 4Z9YA 3OLQA 1EBFA 1TK9A 2BM9A 2V5UA 3IC5A 4RF4A 3COYA 4YDRA 3DV2A 3QUAA 4LIPD 4O2AF 5EHNA 3K20A 4QWMA 1H2AS 2VHUA 1E1DA 3A1FA 3LU1A 4FPXA 2QZZA 2I34A 2QEQA 1U9ZA 3EPRA 2YNMC 1I4DD 3W1EA 4IVNA 4AD8A 3KLNA 4D43A 2PSJA 3H17A 1KTIA 4U2BA 1J8MF 3QVOA 1P2SA 1F5SA 4G1FA 1RWMA 1YU6A 3NETA 4J1NA 4IKEA 1DBSA 1E3JA 4JHLA 5AKEA 4HWTA 4ATNA 5LDDC 3QU5A 3AL0C 1NUHA 4QEDA 4AMYA 5IJ9A 1ETUA 2OXRA 3PDJA 4RTOA 3AKCA 3K3PA 3PVZA 1JVSA 3TNFA 1DB3A 2HK6A 2EFHB 2LUOA 3H6HA 5CK4A 3PWKA 3UAVA 2GPSA 2YNMD 4AKHA 3QWFA 1NMQA 1DIBA 1GU7A 2I3ZA 2YTZA 1H3NA 2J7PA 1FP6A 1XNHA 4P4UA 3UJDA 3VNRA 1L7EA 2QU7A 4L08A 5DHRA 1QHHA 4XCQA 1DKQA 1XZBA 3DGEC 3BCRA 3Q9UA 4I9GA 1I3KA 4BJ6A 5FOQA 4GSLA 4S24A 4AMVA 3VC3A 4TV8A 2GZAA 2PQMA 1IHPA 3HCRA 1FTQA 1N2IA 3KS9A 2G7ZA 2PX3A 2ZR0A 3GPBA 3PGXA 4C0BA 1I2AA 3LZ6A 2ORIA 3R4VA 1KZHA 3ADKA 3PKIA 4EAQA 1UPBA 5E9JA 3BSFA 3BDIA 4TLCA 4TTPA 5REQB 4C2UA 2IEYA 1KIAA 1E1CA 2ZKIA 1S2GA 4LQLA 3RS4A 4OLBA 1NP7A 1S3GA 4RDCA 4LFCB 3FY4A 4B4KA 1MPTA 3JX9A 4QYTA 1QVVA 2X77A 2VP0A 1W46A 3CPJB 2V5VA 4XCVA 1I30A 4V39A 3SY8A 2OPBA 2TMYA 2E5FA 2FPLA 4GL4A 2SHKA 4LNUB 4CJXA 3P9KA 5BV8A 3AEZA 3FWKA 3AG6A 1Y1SA 1JHXA 1EVYA 1M2NA 1PYDA 2ZIZA 3KBOA 1U90A 1JNYA 3MILA 2ZU6A 2ECKA 3WLLA 1N8SA 3E9RA 3L6OO 3NM4A 1EB8A 2I6QA 1F38A 4MW6A 3H18A 2PLNA 4FUQA 2H4ZA 2WF5A 3QPAA 4NPCA 5J9FA 4EW6A 4P35A 4PZLA 3UA4A 1HT1E 2J3QA 1XCGB 2OFXA 4BLSA 2BV3A 2EJTA 4PO1A 1HT3A 3T3DA 1ZGHA 3ROPA 3F3YA 5FNVB 4MHTA 1FSSA 1LLQA 1P6XA 3FYCA 3ZDEA 4FZRA 4AMBA 1ODLA<