1DFGA

X-ray structure of escherichia coli enoyl reductase with bound nad and benzo-diazaborine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfgA00
3DR3A 4MOWA 2RAFA 3LT1A 1LDMA 4BMSA 4BB5A 1U4OA 3OBBA 4JJFA 1Z75A 3VC7A 4BMVA 1LDNA 2JFFA 2V7PA 3DZHA 3M1LA 4FGWA 2CVQA 4F3YA 3VPSA 2PK3A 4WCFC 1N9GB 2VUSA 3WMWA 4CL3A 4Y6PA 3PI7A 1HE2A 2DPGA 4RPHA 1HXHA 4BNJA 4IDAA 3ZHBA 1LLDA 5TQVA 1A7AA 5IDYA 1HDRA 2HK8A 4N54A 1PR9A 2A9FA 1JVSA 1E5LA 2UV8A 4CQMA 1PQPA 4MVJF 4CR6A 3OECA 3PRJA 5FEUA 3OP4A 4ZN6A 3W4IA 4YT4A 2CUKA 4IJWA 3OH8A 4ZQHA 1LX6A 4OMUA 5I7EA 4Q39A 3KV3O 2A94A 3W8FA 4A0SA 4BO6A 1DXYA 1OC4A 1QV7A 2NVBA 4IDEA 3NT2A 2EXXA 3S2EA 3CKYA 2PD6A 3QSGA 3UFXA 3K92A 1ONNA 4BNUA 2EKPA 4TRMA 3C7AA 4WCFA 3VTZA 4U6SA 3V8BA 4PVCA 5GMOA 2YW9A 3ZWVA 3GG2A 1JU9A 3OIFA 4BNYA 1UXJA 2YQ4A 4J0EA 4P4NA 1XU7A 2EHDA 4E13A 4XIYA 1DAOA 3EYWA 3VTFA 1PQUA 4IMPA 5L9AA 1O0SA 1F8GA 4MVJE 3UVEA 4CODB 1LQUA 4D3SA 2XXBA 4EYEA 3HNPA 1UXKA 4BIIA 4Z3KA 4IBOA 5JYEA 3JQDA 1ML3A 1EVJA 1YBVA 2I6TA 3I9JA 4DTIA 2WD7A 4CMKA 3C1AA 1GR0A 3JQ7B 1EK5A 3WNVA 4RF3A 3KSUA 3DBRB 1EK6A 1OMOA 2Q4BA 4LVUA 2UUOA 3DC2A 1U7HA 3FRJA 4NZ9A 1V3VA 3VDRA 3WICA 1HT0A 1B3RA 1ORRA 3ZGYA 2AW5A 5CEEA 3ZHZA 3I23A 3LC7O 1HDZA 1RM3A 3RFXA 4YJHB 2AE1A 3M2PA 3Q1LA 1D4FA 4BGVA 4QO7A 4YCAA 4IQGA 4XDYA 2OO5A 3GGGA 2PWZA 1NAHA 4WLOA 4PLPA 1SZJG 2ZYDA 4FFNA 4GVLA 3JTMA 4WEOA 1NFFA 4W6ZA 3ZNQA 3DAFA 5JCJA 1MX3A 3H8VA 1FMCA 4FFMA 3EHEA 2G17A 3H65A 3PWZA 1DC6A 4XX0A 1Q2XA 1YDWA 3KZVA 4XIJA 1YJQA 2RBEA 3VPFA 2Z1MA 2JAHA 3GGOA 1FXSA 4J2OA 1C1DA 1L7DA 5MDHA 1NP3A 3DWFA 3ENNA 1HE5A 5A06A 1G0NA 2PY6A 1GUFA 4MIYA 2I99A 1LSUA 2WSBA 5TNXA 1I3NA 4TKLA 1YWGO 2NU8A 1NHGA 3V1TC 2BGMA 1WAMA 2O3SA 3TNLA 3HN7A 1HYGA 1YB5A 3HFSA 3GVHA 1ZCJA 5I8ZA 2Q3EA 1N9GA 5G4KA 1NYTA 1H5QA 1BGVA 4HKTA 1N92A 3ZH2A 3PYXA 4TWRA 4UREA 4QECA 1UAYA 1I2BA 1JAYA 4IDBA 4XB1A 3HB5X 1CIVA 4DPMA 2UVDA 1QRRA 1ZSNA 3JQAB 3OJ0A 3W4KA 1XQ1A 4YAGA 1BXKA 4NU5A 1NWHA 2J3IA 4B4VA 1TEHA 1HE4A 1DFIA 2CMDA 5CG2A 1WMBA 3AUAA 1I2ZA 1DSSG 4AJEA 5L40A 3X2EA 2GUGA 3ZNOA 2VUUA 2VRCD 2YJZA 3L9WA 1HDCA 1YONA 5T67A 2HKIA 4R3NA 4BKRA 4LN1A 3BHIA 3U4IA 4DC0A 1ADBA 4J49A 1P1KA 5KVSA 3RJ9A 4FR5A 4R51A 1HWYA 3O03A 2Y67A 1HTBA 3PK0A 3UUWA 3PQFA 3KXDA 1G1AA 3H5AA 4J4TA 4J1QA 2QYSA 2NACA 3LF1A 4W9NC 3ULKA 2R00C 3ENKA 4WLVA 1ZK2A 2IZZA 3KLPX 4YJHA 4BNWA 1JWBB 5KVVA 4GWKA 1VC2A 5HWSA 3K8ZA 3HFGA 3BZUA 1RPNA 4UVEA 1T4BA 4EEZA 2VZ8A 5TGDA 4YT8A 3NTOA 5ILGA 4OL9A 2DQ4A 1DB3A 3KBOA 2E48A 4ESOA 2EKLA 3RBZA 3Q9UA 1H2BA 1T25A 4PN3A 4JP3A 1ADCA 4QQRA 5JCJD 1MFZA 2YDXA 3GRKA 4UUPA 6ADHA 1NVTA 1O8CA 3KSDO 5IXYA 1O89A 3I9KA 4RLHA 2V6MA 1IPFA 2BHLA 3G0OA 2DUWA 4ZQBA 2D3TA 3D4NA 3ZU3A 4EUEA 1M67A 3K30A 3UGKA 8ADHA 4OOFA 5L7YA 2JCVA 1YVEI 1V0JA 4TVOA 3QP9A 1OZAA 2A92A 2IXBA 2VYNA 3LDHA 9LDBA 3I52A 1KY5A 1LRKA 5TSDA 3MOGA 4CR8A 5GZ6A 1MG5A 3AM5A 5ILOA 3CZMA 1Z7BA 3OJFA 2OMEA 2E37A 2JFHA 2VRBA 3RUCA 4BNGA 1AUPA 1QR6A 3H9UA 2Y1DA 4MDHA 1K0UA 4Q3AA 4E0BA 2NQTA 2FP4A 2AG5A 5ES3A 5H83A 3GAFA 2VOJA 2GN9A 2NV6A 4UAGA 3FPCA 4IZIA 3IMFA 4ROSA 3V1UA 2DFVA 5BNIA 3WFIA 3RUFA 3PGXA 4Z6KA 4BGUA 1LDEA 4FC6A 2PGDA 1YQGA 2H6EA 4RJTA 1DRVA 2OP0A 2PZMA 4WLNA 1SO8A 2UYYA 4CM7A 5C7OO 4BL5A 2JHGA 4L4RA 1HLDA 4HV4A 3F1LA 2ZIZA 3LYLA 1HDYA 1HKUA 1Q0HA 2B35A 1XDWA 5T8KC 4ZHSA 1R4NA 1UJMA 2DPHA 2FR0A 2C20A 1IZ9A 4IJVA 4CMCA 5AXDA 3EW7A 3RI3A 2DFDA 1E77A 1VSVA 4RDIA 4PLVA 3UF0A 1Q7BA 4IZHA 4G2NA 5DBIA 1PJLA 3GAZA 4H16A 4CLOB 1NPTO 3RROA 1DIAA 1KEVA 1GPJA 2I3AA 3WSWA 5TX7A 2JD2A 1HZJA 3IUSA 2HMWA 3GDGA 1P9LA 4MP3A 4RVUA 2PD4A 3BYZA 5T8KA 1DFHA 1K2WA 5F1PA 1AXEA 1BHSA 2DAPA 1P1RA 3QWBA 1WNTA 3JD0A 1SAYA 1EUDA 1Z6ZA 3VPGA 3PJEA 4QXMA 2J8ZA 2HRBA 3PJGA 4O63O 4RLSA 4O6VA 4FN4A 4GGPA 4D43A 1PJ2A 3H4VA 3PP8A 2AEFA 4HFNA 2DBZA 4NR0A 2W2KA 3KYDA 3D64A 3SLKA 1ZEJA 4K6FA 1Y8RB 5C7LO 4Z9FA 4WLFA 4QFDA 2XOXA 4UVGA 1IPEA 3Q9NA 1E3WB 3E82A 4EJ0A 2I66A 2JL1A 1CF2O 1LQTA 1A4UA 3BMQA 4K1LA 3GMSA 4PLGA 4PLCA 1Q0QA 2IXAA 3QVSA 4EI2A 3ROMA 5JDCA 3QVTA 2O50A 1PGNA 3AFMA 4W9NA 3IQDB 2YV2A 4WJZA 3E5RA 3RD5A 1C0PA 1Z74A 4GAEA 4OKNA 3FPLA 1R0LA 2X5JO 2OORA 2ZATA 2BLLA 5GZ1A 4Y6SA 4R9RA 3W4JA 3I83A 3I1JA 4II3A 2Z95A 1N8KA 4DC1A 2GDZA 1PS8A 1FDUA 4MIEA 4RPLA 2C5EA 2HSDA 1YBMA 2B83A 3B1KA 3FR8A 3VH4A 5IZCA 4XQCA 5DBGA 1PJBA 5EN4A 4H7PA 1NTOA 5F1KA 3R3SA 4AJ1A 1PR3A 3CINA 3GLQA 3M1AA 5DP1A 1KVUA 3WDSA 3EMKA 3QJ5A 5JW6A 2I3GA 3VZSA 1XIVA 1HZZA 5FF9A 4UUMA 3FWNA 4YJGA 4AJOA 1B16A 4NJMA 2JHFA 3I6IA 2EG9A 1ZUD1 3IS3A 4J9VA 3ZCXA 2Y0DA 3DB2A 2E82A 4OYRA 2W4QA 2OBNA 1HDGO 4TRJA 3Q2KA 5G0WA 5IAAA 1ZK3A 1NWCA 4NPCA 2D5CA 3T7EA 4E5NA 3SEFA 1C3VA 1R4MB 1JW9B 3IDSA 1BW9A 1XKQA 5F5LA 3QWFA 3WFJA 4LRTB 4D3FA 3BTVA 1U2DA 4NDNE 1VKOA 4A2CA 5IXSA 3KEOA 4GL4A 1GFSA 5A9RA 1ISMA 2C2XA 1I24A 5JPIA 2H9IA 3P7MA 2NADA 2CFCA 4OHUA 5I7VA 4XR9A 4R5MA 5TJHA 3HB4X 3DOJA 5T57A 5G4KB 3JQAD 4FC7A 4RF2A 1W8DA 3JQ8B 4CM9D 2HO5A 1FK8A 2JKVA 4G81A 4R1NA 3ZWBA 1MFPA 1P33A 3EAGA 4QSMA 3FNEA 4RORA 5AQ1A 3K31A 2J5QA 1ZSYA 2X4GA 2DTXA 1LRLA 4DLBA 3C8MA 2FMUA 2Q1WA 5DNAA 3WGGA 1UDCA 2X22A 1LLUA 3Q6IA 5B1YA 2H5LA 3ANMA 4MVJI 1MXFA 2XXJA 1YL7A 3BTUA 4J7XA 4BNVA 3GPDG 1DJQA 1GY8A 4MKRA 4NBWA 3VPXA 3IKTA 1P1FA 3ZV4A 1J49A 1ZO8A 4KUEA 1U3WA 2BI7A 2IZ1A 4WLEA 1DIRA 1PZEA 2AE2A 2WJPA 3MJ4A 1ENZA 4M55A 4YT5A 3LLVA 4IY1A 3WQSB 5IDQA 4ND4A 3HN2A 2NVUB 3ZI0A 2EP5A 1PJTA 4GX0A 4LK3A 4CLOA 2ZB3A 2Y1OA 1E7RA 3VZQA 3F1KA 2O7SA 5B4TA 2VTEA 3H3JA 1JKFA 2X0RA 1BWSA 3B6ZA 3PHGA 1HL3A 3DMTC 2CD9A 4A5OA 5L45A 5JO9A 3SX2A 2NLOA 3WJAA 4YJFB 1GADO 1H2HA 2VNSA 2D0IA 1YB1A 2HRZA 2GCGA 4OSOA 4D41A 5JBIA 4M89A 4QX6A 4BO8A 3JQBA 3GC6A 2DKNA 5EQFA 3AI2A 3P2OA 1QKIA 1LI4A 2OGUA 3JQ9A 4OGWA 4XA8A 5F1OA 1Q1NA 3RWBA 2HMVA 4DUPA 1KBZA 3IKVA 3FNGA 4XYMA 4ZD6A 5CDSA 3KETA 4R3WA 4E3ZA 3IOYA 4HFJA 5KCZA 4E5MA 1A27A 2D1YA 5U4QA 2QW8A 1Y7TA 3CPSA 4GMFA 4S1VA 3TDKA 2FWMX 3MJTA 4DQVA 4Y67A 5T64A 3ETEA 2HJSA 3PGJA 1HLPA 3H9QA 4L75A 3QWHA 4E4YA 3SLGA 5KOIA 4A73A 2ZYAA 4K28A 4B4OA 3RJ5A 5ICSA 3OEWA 3PYLA 4ZQEA 3DO5A 4LMRA 1UP4A 5G0UA 1IOLA 1CERA 3NT4A 1X1EA 4YAKA 1TT5A 2EJVA 3DONA 3NJ8A 3FTNA 4AJIA 4BHTA 1I36A 3GDFA 2FY8A 1IYZA 4W7IA 3A28A 2P4HX 3ZDFA 2O4CA 2VWPA 2RHRA 1K6XA 5BT9A 3ZW8A 1P44A 2DBVO 3ZWMA 4KZPA 1E3WA 7MDHA 1R12A 1ZBQA 3K2EA 3W6UA 2BMAA 4IJUA 4BNNA 4C7KA 1A9YA 1DRUA 1N1EA 5A9TA 4NU6A 4TROA 4KOAA 3FI9A 4GX1A 1ZK1A 1WVGA 3PXXA 4R1TA 5A1TA 1A5ZA 1BMDA 1SPXA 1LEHA 4BV9A 3DEYX 4L8VA 3VH1A 3TL2A 4E2ZA 5A04A 2JCXA 3TZ6A 5EJ2A 3JQ8A 3FWZA 4HP8A 3RU9A 4YAEA 4RVHA 4B7XA 3AK4A 1KEWA 3KYBA 1R16A 1OBFO 4BS9A 4E2YA 3GY0A 3KUXA 2P5YA 1VRWA 1TI7A 2C0CA 4DREA 4E5KA 3INTA 3STHA 4CQLA 1DJNA 4FSHA 1KEUA 1Z73A 4Y6RA 3ITDA 3PHLA 3KTDA 4IXTA 4L9RA 3RC2A 1U4SA 1R66A 4Z0PA 2DC1A 1VE9A 2X9VA 5AXBA 3G1TA 3KYCB 3WNQA 2NTVA 3PHIA 2VT2A 4J1TA 1EQ2A 1Y81A 5B12A 3QW2A 3PIIA 2EEZA 3UICA 4DIFA 4GLOA 4MKXA 4WUVA 1C0LA 4E2WA 2D5AA 3NTRA 3NGXA 3K6JA 2NQ8A 2D59A 2CDAA 3GUCA 1TT5B 3KO8A 1BDBA 3DL2A 4ZJUA 5HBRA 1DLJA 1NPYA 1E1LA 3LC2O 1XCBA 4HX5A 1NNUA 3DOOA 1WXDA 3RBXA 2X6TA 3V5NA 4ALKA 2ZCUA 1JDJA 4DQUA 4XYBA 4UEKA 2Q4EA 4RGBA 4XGKA 1NPDA 1P74A 3ZWWA 1N5DA 4D46A 1E7WA 3ZWXA 3ETDA 1P3DA 1E3IA 2VRCA 2B36A 3AI3A 4B7CA 4HUJA 2GLXA 3CXRA 4DLAA 1AHHA 4CLXA 1HDXA 2QQ5A 4ZU3A 1GEEA 3AU8A 4UVHA 2C54A 1DLIA 4NBTA 5ER6A 3ETGA 4R68A 3WTBA 3OA2A 4Y8VA 5ENVA 5KVCA 1W73A 1JN0A 5K9ZA 1PZHA 3WBFA 1TXGA 1VI2A 3MJSA 4XKJA 4BNMA 5B4UA 4EGFA 1PL6A 3CZRA 3CUKA 1PEDA 3MJVA 3QIVA 5C7IO 1H0KA 4EJ6A 4XCVA 4BMNA 2FPIA 4PLHA 1B0AA 1M2WA 5K6AA 2VTDA 2Q99A 3IP1A 1AHIA 4O5OA 1QORA 1EDZA 3GHYA 1H9AA 3DZJA 3EVTA 2EWMA 3EGOA 2IEBA 4WNIA 4CLDA 4M87A 4IGFA 2FPPA 5JC1A 1IY8A 4ZVVA 3OM9A 1WZEA 4AJPA 1QYWA 3WR5A 1HDOA 3U3XA 1F8FA 1N7HA 3QQPA 1H9BA 4NI5A 3ZU5A 1M66A 1BVUA 1BXZA 4CLHA 4B4WA 4MKZA 4CV3A 3KHUA 3QVWA 2YFQA 4HADA 4LMPA 5G2OA 4PZDA 4IDGA 4K26A 3I9MA 5DCWA 1GUYA 5FI3A 2X86A 1GCUA 1ZK0A 2AMFA 3NGLA 4JK3A 5TS3A 5JNLA 2Y0CA 1UZLA 2VWQA 4M1QA 1HRDA 3CH6A 3GVIA 2BI8A 3HUDA 3K5PA 5G0VA 5K0ZA 1VKNA 5CP8A 3DZBA 4AJNA 2PFGA 3SJUA 5HS4A 2Q1SA 4DGSA 4ID9A 2GZ1A 1DC5A 3PVZA 1VJTA 3QVXA 5C37A 3GG9A 3L0DA 3F3SA 2X1HA 3JYPA 3INRA 5CHEA 2HLPA 4GWGA 3NRCA 3RC9A 2QIOA 3EZYA 3CSDA 1VM6A 3GZNB 2WD8A 4KUHA 4TZKA 5JY6A 1VL0A 4FDAA 2HK7A 4Z9XA 5JE8A 4FIZA 3PTZA 1F06A 2HJRA 5HTOA 1TLTA 4B8WA 4ND2A 5A5FA 7ADHA 4XR4A 3DOCA 4BO4A 2Z1NA 3KVOA 1ULSA 5AYVA 5KNLA 4CUKA 3V2HA 1NR1A 5CDYA 1IZ0A 1LA2A 4PLYA 3ZWYA 2VUTA 2V6FA 1YQXA 1PX0A 4I9HA 4NFSA 5BSHA 4IIUA 1ZMTA 4U0KA 2V6BA 5KVQA 3PDJA 1D3AA 1MXHA 4HFMA 1BG6A 2C59A 2FSSA 4CMBA 2O3JA 4N5LA 3L6EA 3TZCA 2Q1TA 3DZIA 5I9LA 1OFGA 4YR9A 2AEMA 4P8RA 1I3KA 1EZ4A 3C7DB 4UVIA 4N5MA 4HWKA 2TMDA 5IN5A 3ST7A 2Y05A 1E0DA 3HDQA 5JDIC 1GQ2A 3H3FA 3PLRA 4Z3DA 3DBRA 1BRMA 2IZ0A 1UAGA 4RL6A 4OIMA 2Q2WA 5AOVA 3WBBA 3ZW9A 1EFKA 1KERA 4WLUA 2JCYA 1W0CA 1T2FA 4L0QA 3JQGB 1SNYA 3LZ6A 4XRRA 4MPDA 3WJ7A 3PJFA 3TFOA 3SC6A 5DP2A 1K6JA 4K9DA 3TPCA 1NHWA 4C7JA 1H6CA 4HNGA 4KDEA 4BO5A 4J4BA 2PKQP 1ISFA 1LC0A 4GSKA 4L73A 4WK6A 4UEJA 3G3EA 2B4TO 1VL8A 2HCTA 4CMHA 2JJYA 5JC8A 4MJLA 4EBFA 1DRWA 4RPKA 4UEOA 1K3TA 3ZV6A 2ET6A 3FR7A 3ITKA 5DT9A 1R0KA 2BF7A 3CTMA 4AL4A 1P1HA 4F46A 1RM5A 2WEKA 2OHXA 4Q3CA 5B4VA 2RIRA 2RH4A 2J5RA 4AVYA 3GVCA 3MEQA 2AA3A 5COQA 4B4UA 1ISGA 2YY7A 1BDMA 2CVZA 4BNFA 5U9CA 2G0TA 4YQZA 1A9ZA 3RC7A 3B1FA 3BMOA 1E3JA 4WKGA 4E30A 2QRJA 3F9IA 5LCXA 3RAJA 1I2CA 2X0IA 1LDBA 3D3WB 2CVOA 4IUYA 1FJHA 2ZJ0A 4DBVO 3L6DA 1E1NA 3VOSA 5TF4A 4CM8B 3DBLB 4JBHA 3RFVA 2ILTA 4TMFA 2VWGA 1I5RA 4IGEA 4DYDA 4EZBA 4RVDA 2QYTA 1VLLA 1YL5A 2E49A 2P9EA 2Z5LA 4LISA 4J7CA 4OKIA 3GN1A 1WLYA 1N2SA 4U7WA 4YJDA 4U0JA 4CQMB 1Q7CA 2WYUA 2NU7A 3NX4A 3KM0A 5JO0A 2O2YA 4RVFA 4MVJA 3HE3A 3C85A 1XWFA 2W2LA 3I4CA 4BNHA 4DMLA 4C4OA 2VN8A 3H2SA 4LRSB 3LT2A 4XQGA 1YKFA 1K5HA 4S3MA 4J6FA 1IHYA 3D5TA 3F5SA 3JD1A 3IJRA 1V3UA 2OBYA 2ZTVA 3UCXA 4UUNA 4BKPA 4D44A 3DBHA 4E2XA 3DBHB 2CNBA 1HYEA 3JCZA 4GKBA 1YOVA 4YB8A 4LW8A 2ZCVA 3PZBA 3RQSA 1NBOA 4XWYA 5EESA 4Z0TA 2ZJ1A 5KJ1A 3JQAA 3QWIA 1I8TA 1P31A 4NJMB 4XYLA 1SBYA 1C1XA 4OQZA 3RKRA 2VHYA 1AE1A 3WQQA 2O2SA 3ASVA 1YS4A 2GN8A 4PG7A 5A4DA 4LGVA 4RZHA 2YDYA 4PLTA 1PL8A 2PKRA 4GH5A 2NUAA 3E8XA 4JJIA 1D8AA 1PJQA 3WGHA 4A7PA 5CDUA 2ZTMA 1YL6A 3N7UA 3ROPA 1T2EA 3OQBA 3SC4A 3PDUA 1NFQA 3RUAA 3BHJA 2G76A 3A06A 2PA3A 1MC4A 4AICA 1SOVA 2I76A 3WOHA 2HMUA 3I5MA 4NIMA 1LSOA 2DLDA 1E5QA 3JQGA 5CPFA 1JVBA 4CUJA 5JY1A 2BELA 3INGA 3GMDA 2GSDA 1KS9A 2PGLA 1D7OA 3GGPA 2B5VA 4W82A 1XYGA 3U49A 3VH2A 1P45A 3FNFA 1FDSA 1EBFA 3GF4A 1LNQA 3AUSA 1ZW1A 3H2ZA 2V65A 1I10A 2FR8A 1YXMA 4IDFA 2FPGA 2CSUA 3F5QA 2X0NA 3JD2A 3OJLA 4L76A 5DCYA 2X0JA 1EEHA 2H63A 3PIDA 1XLTA 3PQDA 4YA6A 5A05A 3ZWNA 4MO2A 1U3UA 3MTGA 3RC1A 3GFBA 1HETA 3GR6A 3R1IA 3AY6A 3EVNA 1MLDA 1HF3A 1SOWA 4FOOA 3TFQA 4R54A 1CQJA 1FDTA 1C14A 1LTHR 3ROKA 4I5GA 4ALJA 4PG5A 4BNIA 3GUYA 2SCUA 4IINA 4XQ9A 3NJ4A 1O94A 1ENPA 3NDIA 1GV1A 4BV8A 1Z7EA 1UDBA 4OAQA 1LBEA 2GZ2A 5C3MA 1U5CA 1R6DA 1E3LA 1U3VA 2NNLD 1UXGA 4QEDA 4DMMA 4KWHA 4FFPA 2X5KO 3KOUA 5G4LA 4JROA 3DMTA 1J5PA 2W8ZA 4RCVA 3S8MA 4CMEC 1U1IA 4G5HA 4D42A 4ZQFA 3U62A 3GZ4A 2E6UX 4BO3A 5DOZA 1QYVA 1MA0A 2P68A 4FPXA 4BB6A 2PZLA 3U4HA 4D0RA 4I8XA 1D1SA 3QE3A 3OQ1A 3QV1A 1SC6A 2OOSA 3EK2A 4EDFA 3ORFA 1J0XO 1YJ8A 4TSKA 3FSRA 4CV2A 4I5EA 4NFHA 1PL7A 4J91A 3LU1A 4HY3A 5CDTA 2WDZA 1UXHA 4OJNA 3FBGA 1LSJA 3QRWA 1ZVMA 3H9JA 4R4JA 3OHSX 3WMXA 1X7GA 3ANLA 3AJRA 1RM0A 4DWVA 1CYDA 4TZTA 3RSHA 1F14A 2YV1A 2FR1A 3HQ4O 3RUDA 1P1IA 4ZRNA 1B2LA 1GZ3A 4WCDA 2EGGA 2Y1EA 4IIVA 3MJEA 4B7UA 1I3LA 2EW2A 1O5IA 4HFRA 5JMPA 4I9NA 1X0XA 1WPQA 4WNCA 5JS6A 4JNKA 4CMEA 3TQHA 2C07A 3S2GA 5T6BA 1NR7A 4CM9A 2X9NA 1JA9A 1KVTA 2ZKLA 3I9LA 4D45A 1GD1O 4WE3A 3JD4A 1KEPA 2UDPA 3E9MA 4XZ3A 1KVRA 1PIWA 3MWEB 4GI2A 4ONEA 3LT4A 3KLMX 2QRLA 1GYQA 3VAZA 1E7SA 1CRWG 4MVJM 4ZA2A 2EV9A 1KC3A 5JAZA 3R6DA 1RYDA 4J1NA 1U8XX 4GX2A 2C7VA 3HADA 3IC5A 4KTVE 3ZWCA 5DULA 5A02A 3TF5A 4GX5A 4AJLA 2YHIB 3KRTA 3WGYA 4W4TA 1ZMOA 1TT7A 3D7LA 3FN4A 3MTJA 3MZ0A 4ND1A 3FD8A 4DPKA 2B5WA 1MP0A 2F00A 4XD2A 3I4FA 4QT0A 4BO9A 4BO0A 1KVQA 1RM4A 6LDHA 1LSSA 1QYDA 3OETA 3L07A 4X54A 1ZIDA 1UH5A 2GO1A 3C7CB 1ZXLA 1UR5A 3O8QA 2AQKA 5IG2A 2VHXA 3I6QA 3JQCA 4I9UA 3TN7A 2QRKA 4RF4A 2PKQO 2DTDA 3D5QA 1XR3A 2LDBA 3BMOB 1QG6A 2YQ5A 1Y9EA 2ZQZA 3QWAA 4EITA 4F45A 3UCEA 1SB9A 3NEPX 3ON5A 2JAPA 3WGZA 2OXIA 2WM3A 1SEVA 1RWBA 1GYRA 3OQ6A 1LDGA 3OA0A 4FGSA 1B8UA 4J7UA 4KMSA 1GDHA 2ZTUA 5H81A 5IJZA 5JAMA 3NV9A 4RQUA 4D0SA 2H1SA 1A4IA 5LDHA 5L4LA 1B8PA 4QFCA 5LC1A 2BGLA 3BTSA 4MVJP 4XDZA 3S1LA 5MGBA 4FFRA 3VKVA 3SBOA 1UDAA 3R3JA 3S2FA 4J16A 1GQQA 3L9XA 4FJ1A 3O8QB 2EF1A 2B4QA 5EERA 3WS7A 1NQOA 3A4VA 5A03A 2WE7A 3ASUA 1Y8QA 5TIIA 1I01A 2NVWA 4PIVA 2OUIA 5A3VA 3G1UA 1RYEA 3C1OA 1M75A 1YDEA 4RVSA 3GDOA 1QP8A 5F5NA 3E03A 3E9QA 4L74A 2P9GA 1OC2A 2ZB7A 5JLAA 1D1TA 3TZKA 4E33A 1P77A 1E1MA 1CQIA 2DBQA 4CM6A 4JX8A 4LSWA 1R0SA 3PYMA 1Q7GA 4NK4A 1P1JA 1Z45A 5ENDA 5ICMA 1ZFNA 4B3HA 3PHJA 4JJGA 4ILKA 1BTOA 2ZB8A 1HYHA 4BNTA 3OIDA 5CEJA 1YH3A 4PG4A 3JYOA 2FZEA 3PQEA 3WLFA 4YYZA 4Z9YA 2WYVA 1WDLA 4Q3EA 5JSFA 1B26A 4MP6A 4ND5A 3ROQA 4QUKA 3OMLA 5JDIA 4HXYA 1W6UA 2WE8A 1ZK4A 1PTJA 1NQAO 4FJ0A 5DZSA 4BOYA 3ADOA 2LDXA 4RF5A 1PS9A 1OI7A 3DFUA 2CF6A 5BSEA 1BVRA 2IYOA 5TT1A 1I32A 1IB6A 2W90A 1SB8A 4HBGA 3OSUA 1S7CA 2ZK7A 4M49A 3QLJA 3E9NA 4IS3A 4P4LA 1GZ4A 2X23A 2JD1A 4PRKA 4XQEA 1X14A 4BO7A 4CMJA 4AJ2A 4WGGA 1F12A 2Y1CA 4I5FA 2VYVA 1DC4A 3WYBA 1R4NB 1WZIA 1Y1PA 2WTBA 4CV1A 4CM8A 3TOZA 3TOXA 4MVJG 1E6UA 1K6IA 4GMGA 1JLLA 3M2TA 4IPTA 3BA1A 5B37A 2FOIA 2J6IA 5I9NA 1ADGA 4CMIA 4MIOA 1T24A 4OH1A 3E1KA 4WOJA 1JAXA 2J3HA 4I5DA 1J4AA 3GEMA 1QYXA 4I1IA 1O9BA 3Q0EA 1C0IA 3HHPA 4ZICA 1IUKA 1E3EA 2HU2A 2Y1GA 3F4BA 2GASA 3FBTA 3WB9A 2Q2VA 3G79A 3H5RA 1C0KA 3LVFO 4BGEA 3GNQA 3SJ7A 4IDDA 3LC1O 3B1JA 4R69A 1O95A 3BMNB 3AOGA 4OM8A 1IE3A 1TVEA 3COSA 4K6CA 1GZ6A 1BXGB 4YQYA 2GZ3A 4NNJA 5ADHA 3PHHA 3TJRA 1VJ1A 3WXBA 5COAA 1YRLA 2NVUA 1MC5A 4NH4A 2NU6A 5DCUA 3IP3A 4ZRMA 3LLSA 4ND3A 2X8LA 1DDOA 3RUEA 4R5HA 5TRTA 1PGQA 2XPCA 3JQ7A 1DHRA 4TVBA 3R0IA 1EBUA 3UKOA 3CEAA 5A9SA 1LC3A 1B8VA 1FDWA 3I3OA 4GSLA 4YPOA 4YDRA 1XSEA 3GQVA 4R1SA 1CETA 3F47A 3FHLA 2GN4A 2ZB4A 4KQWA 5F3RA 4BVAA 3PWSA 4URFA 4BO1A 2VZ0A 1LXCA 3O26A 3UW3A 2CF5A 1E6EA 4NQZA 1HE3A 3V2GA 5JAQA 2R00A 2HMSA 2OZPA 2GF2A 4XB2A 2P5UA 4RQTA 5ITWA 5K6AC 3F46A 3QA9A 3ZWOA 1T2DA 5KKAA 3HG7A 3KYDB 3UAGA 2W2KB 3DZKA 3JYLA 3MCVA 4XGNA 5HA5A 2P2SA 1Y9AA 2AQIA 1PJCA 4CM4B 2O3UA 5C5IA 4NK5A 5G0SA 4LCJA 2GERA 3E6AA 5EL0A 3GEGA 4BQRA 3JSAA 1GPDG 1DO8A 3EZLA 3ZN2A 3L4SO 1E3SA 2FHSA 2W98A 1WP4A 1ARZA 3ONFA 1X1TA 4JXKA 9LDTA 4YXFA 4GVXA 1XEAA 2Y66A 1AN9A 2G1UA 5KJ6A 3B70A 1EVYA 1R15A 3ICPA 4E5YA 4GBJA 3M6IA 4YBZA 3ICCA 2O23A 4B3JA 1HEUA 3BAZA 4CLRB 2PH3A 1LLQA 1GQYA 1PQWA 3DMYA 1QMGA 3LSYA 4OO3A 3G17A 1PSDA 4PZEA 1DIBA 3EC7A 3V1YA 3OIGA 4XRGA 3MWDB 4YRBA 4DLLA 3HZZA 4RZIA 2J5KA 4OSPA 1QYCA 1KC1A 1Y5MA 3DTTA 4INAA 3FCOA 4WASA 2WWRA 4CQLB 1EVZA 3UH1A 2VHWA 4RVGA 4N5NA 5A3JA 2PV7A 4BQPA 3ZNNA 1N1GA 1S6YA 3W1VA 1MG0A 3ZNPA 2EJWA 5DDIP 2PLAA 4Q3NA 2PZKA 1XU9A 1OAAA 1KY4A 3AI1A 3OEYA 3CMCO 3GNTA 4L4XA 4Y9DA 2JFGA 3A14A 3U5TA 1Q0LA 2AQ8A 5JYDA 3Q2IA 3JYNA 3RFTA 4Y98A 4ZGWA 4IMRA 3BMCA 2YV3A 1ULUA 3RKUA 3MOIA 5DF1A 4L4SA 1MUUA 2A4KA 1GV0A 2C7GA 4XEHA 4DQXA 2RCYA 3GHHA 2VCYA 4M8SA 4TRRA 4E32A 1U9JA 4AJKA 2OFPA 2TMGA 2HDHA 4YJGB 4YJFA 2X7HA 1KOLA 4BO2A 4YRAA 1Y6JA 2QZZA 5AXCA 2POQX 2VOEA 1NQ5A 4TRNA 3AUUA 3V2UA 1ZSVA 4ZQGA 4D79A 2CDCA 5BNFA 2DVMA 1V6AA 2DM6A 1UXIA 1ONOA 3DDNA 3G49A 5G0TA 1EE9A 4H15A 2QG4A 4Q9NA 2A35A 2BRUA 4XYGA 3NKLA 1CJCA 1QLJA 1BXGA 3K73O 1T4DA 4RPGA 2RHCA 4FJ2A 3JQ9C 3H5NA 4U5QA 1VSUA 2XAAA 4ALNA 3ZU4A 4XYEA 2ZQYA 3D1LA 4IS2A 3AFNA 1AXGA 1T2CA 2J3JA 4NG5A 2BFAA 1UP6A 2HQ1A 4E5PA 3WYEA 1PWZA 4BNKA 2R2GA 2NWQA 4NBVA 1DIGA 4NHEA 2PTGA 4DL9A 4GPD1 4UULA 3UN1A 1ZZEA 3CIFA 4XJSA 3WTCA 5TLSA 4YEDA 4AJJA 5JAIA 3NT5A 1ISIA 2X9GA 2EGHA 2YHIA 3S55A 5ER9A 5EINA 3CE6A 1LU9A 1LRJA 3GFGA 4DVJA 4RO0A 4CPDA 3DAGA 1DHTA 5FFFA 3RASA 3JQFA 3RCBA 2O48X 5JFOA 1CWUA 1P0CA 1TA4A 3HDYA 3W6ZA 3NDJA 4FFOA 4DYVA 3EY4A 3WGQA 4P4GA 1GCOA 2W2LD 5HS6A 1PGOA 4PVDA 3TRIA 2J3KA 3JQBC 3H9GA 2Q49A 4AG3A 5EQDA 1YOVB 1UZMA 1VL6A 1T26A 4NJOA 1H94A 4IQ0A 1ISHA 3K96A 1B7GO 1NVMB 1QV6A 4FCCA 4PLWA 2Q45A 4DIBA 1E6WA 5IF3A 2DTEA 4NBRA 1YGYA 4EW6A 4P22A 4J0FA 1F17A 4PRLA 1BW9B 2E4AA 2I67A 3IUPA 3O38A 3ZHXA 1JWAB 4CLRA 5CEFA 3OICA 4BNLA 1UZNA 3VH3A 4BNZA 3HSKA 1QLHA 1DFGA 1M6WA 4D7AA 2O7QA 3L6OO 4OXKA 2DT5A 2Q1UA 2OP1A 4YAJA 4CL8A 3F6YA 1O6ZA 2FZWA 3DHYA 5H82A 3WIDA 4MVJD 4FS3A 4YT2A 1X15A 3TWOA 2GYYA 3UOGA 5AXAA 4R9SA 2VHZA 2QZ9A 4Q3DA 2BH9A 3DAPA 1JQBA 4ITUA 3DQPA 3GEDA 4JLWA 1WDKA 4AJHA 3NAQA 5HRUA 1GL3A 1ZNQO 3GVXA 3JQFC 3PJDA 2NSDA 3PFWO 4HNHA 3W8DA 4CMAA 2YYYA 4LCEA 4U6QA 4J9UE 4E12A 3DBLA 5A9SB 2HMTA 3O4RA 1WMAA 3AY3A 4EJMA 3I9OA 2HUNA 5KJCA 3RIHA 3AM4A 4PLFA 5KJFA 3IL2A 4PG8A 2G82A 3QVOA 2O3QA 1ADFA 3JQEA 3NDRA 4Q3BA 1H93A 4TKMA 1T2AA 2YFHA 5FI5A 4GKVA 3GRPA 3WYCA 4R16A 4KQXA 5EIOA 3NTQA 1PGJA 3PLNA 4CUZA 4WEQA 1ZKMA 1X13A 3DXFA 3LQFA 1U2GA 1W4ZA 2FRDA 3E48A 4WOKA 1PZFA 4OXNA 1Y8RA 1JKJA 1A72A 4FFLA 3A9WA 4KDFA 4KWIA 3PEFA 4U8GA 1B14A 3ZV3A 3TL3A 4YWJA 5JCXA 3VHRA 4N7RA 1I30A 1CDOA 1XA0A 3IIEA 1A71A 1YB4A 4OOEA 4GLLA 3L4BC 1M6HA 4J90A 1U5AA 4P38A 1V35A 3ZZNA 4JIGA 3EDMA 4PCVA 3U4DA 2C2YA 3RUIA 3OJOA 3HWRA 5JDCC 5CG1A 4IQ8A 4EUFA 3N58A 1ONPA 1NXQA 5EMHA 3K9QO 3WSVA 4H3VA 3VPHA 3D4OA 1T1SA 1V9LA 3Q3CA 3VVBA 3WQRA 8LDHA 3ZU2A 5KIAA 1BSVA 2FN7A 1ID1A 2BFPA 4A03A 3BIOA 4D3DA 1ISJA 5IZCC 2VNAA 5L95A 3JV7A 2VT3A 1Z82A 1E7YA 1NFRA 3AWDA 3KB6A 4G65A 3GZNA 4PGFA 1ENYA 1LJ8A 2DUUA 2IEDA 5IDWA 2PD3A 4WECA 3OFSA 4DBZA 3P5SA 3D0OA 4YVFA 5U1PA 1PJ3A 1A7KA 4PZCA 3U4CA 5DN9A 1XQ6A 3BHMA 2PGJA 1WW8A 3AOEA 3KYCA 1M76A 1B15A 1DC3A 2X58A 2GD1O 2JD0A 3VVCA 3UCFA 3PPIA 1X0VA 1X7DA 4KP7A 2Y68A 5F21A 5L7TA 5COBA 3JD3A 3VKUA 3DHEA 3Q11A 3WIEA 4M86A 5I7FA 1XGKA 3ONEA 4JBIA 3AW9A 3JQ6A 1MV8A 1YBAA 4O0LA 4YAIA 1G6KA 3BTOA 1L1FA 2EERA 1U8FO 1KYQA 4OXYA 1PJ4A 1IHXA 4B3IA 2O3TA 3T7CA 5L3ZA 4YACA 3WLEA 2AXQA 4AJ4A 3RVDA 4CM4A 2CZCA 4N18A 4DA9A 2EW8A 1KETA 5LDGA 4UUOA 2DBRA 2VYVD 2VZ9A 2B0JA 3T4XA 4AFNA 4ALIA 1JKIA 4CQMD 3OF2A 1NX6A 3WWYA 1XG5A 4GQAA 4J43A 1HSZA 3GA0A 1YO6A 1EUZA 5JMWA 5KWEA 3DZGA 2I9PA 4CR7A 4FD3A 5FWNA 1ZH8A 3D3WA 4II2A 2WD7B 3DFZA 2ZYGA 2PZJA 3BXXA 1QSGA 2O4UX 4A10A 3U0BA 2BD0A 2BKAA 1GEGA 2R6JA 5AVOA 1DBVO 2O3RA 2BGKA 2Y0EA 2D8AA 4RPJA 4O59O 5L7WA 2G5CA 4WPGA 3TZQA 2OL4A 5I7SA 4RV9A 5BNTA 1T1RA 5EPOA 1DEHA 3C24A 1KIFA 3ANNA 5FYDA 3ADPA 4A27A 2Q50A 3GOHA 1DOHA 1XHLA 4NMHA 1RJWA 2C5AA 5IZ4A 4KUGA 1Y5RA 4PFJA 1B3BA 4CM1A 4W99A 2GR9A 2NTJA 3BMNA 5GY7A 1EE2A 1GYPA 3U9LA 4ALLA 1H6BA 4CLEA 3EUWA 3AM3A 3GH3A 4EUHA 1UP7A 3A1NA 4DRYA 5IN4A 2Q46A 4CM5A 3ZHYA 4R41A 3L77A 3WGOA 2C82A 3IJPA 3T4EA 3H9EO 2PR2A 5ITVA 1P0FA 2AQHA 1EDOA 4XGIA 4CMIB 2HK9A 2IYPA 2QX7A 4NFYA 3LK7A 1ZXBA 4TQGA 2YZ7A 3WX0A 5L51A 1QXSA 3ABIA 2VHVA 3PFFA 2NTNA 1E7MA 2EKQA 1LLCA 1J6UA 4FB5A 1I0ZA 1NASA 4B79A 4E21A 5HM8A 5T5QA 2P9CA 3H7AA 1PS0A 4JQCA 1H6AA 4WCFB 4DIOA 3VZRA 1V8BA 1YE3A 1NM5A 3FNHA 2Q2QA 3E5MA 4MP8A 4IDCA 1E1KA 1L7EA 2WMDA 2IE0A 1ENOA 3KSZO 3IAHA 4XJTA 3D3EA 2IRWA 3LF2A 2XF8A 3GN2A 5L4NA 4ALMA 4O1MA 4PG6A 3U09A 1F0YA 4PLZA 3N74A 4R1UA 4YTEA 5L4SA 1WWKA 2QHXA 3RBVA 1PWXA 2P91A 1NAIA 4FQ8A 5J23A 3GPIA 1I3MA 3GNSA 1VPDA 1V3TA 2GN6A 4B8ZA 4BGIA 4FOSA 3PZRA 4I08A 4NBUA 4JN6B 4IJKA 1X7HA 3DTYA 1GTMA 2C29D 5DBFA 5CFZA 2PNFA 3KEQA 2BFMA 2WYWA 4EEXA 1DAPA 1AGNA 3H6KA 4J3FA 1E92A 2I5PO 4CJXA 4RDHA 2HAEA 2Y99A 3F4LA 1GAEO 2V6GA 4KTTE 2AHRA 2DU8A 3K2BA 3SXPA 4JBGA 4DPLA 2AG8A 3ZWPA 1LUAA 1ZJZA 2EIHA 3AUTA 5TC4A 3MJCA 3P19A 5BSGA 2UAGA 2X5OA 5GZ3A 4M54A 1NQTA 2UUPA 3AOEC 3AU9A 3ONDA 2D4AA 3HDHA 4MVJH 1C1DB 1FDVA 2EP7A 5CDGA 1Y8QB 3S2IA 3WG9A 4CMGA 5DOVA 1R4MA 2F1KA 3OJEA 1EVIA 2AEJA 1LDYA 4CM3A 3SVTA 1EMDA 5IDXA 3TSCA 4UVDA 3PWKA 1I33A 1ZEMA 2D2IA 5THQA 3LT0A 2Y1FA 1DPGA 1UUFA 1VJ0A 1XELA 2IDZA 4FBGA 1CEQA 2Y93A 5TJ9A 2FSVA 2GNAA 3HDJA 2RH8A 1FF9A 4IXWA 4J2HA 1JTVA 1YQDA 3O9ZA 2B4RO 1KVSA 1U28A 1U3TA 1NVGA 1DIHA 2GRAA 1GU7A 3CMMA 3AY7A 3FTPA 4JGBA 4JCOA 4DXHA 3FF4A 3L4BA 4F6CA 4IM7A 3HJAA 3UXYA 1IULA 3DZFA 3DHNA 5A5EA 3ZWAA 4R01A 3BMCB 3DBVO 5JXWA 1HSOA 1MGOA 3P2YA 3VDQA 2ZTLA 2YHUA 1ZJYA 4F6LA 5L53A 3GT0A 2B37A 4BNXA 5THKA 1R37A 4A26A 2CDBA 3RUHA 4E6PA 4OQYA 2GGSA 1TB4A 2P4QA 3B20A 2B69A 1MB4A 1SEPA 1OOEA 3C1TA 3VZPA 4BKQA 1IL0A 2PH5A 5I8WA 3ZV5A 1H6DA 4J4HA 3W8EA 5KTKA 5CAEA 1N7GA 3X2FA 4MINA 4E31A 1WDMA 4QTZA 3RU7A 2VYND 4BUCA 5IFLA 3WWZA 5BR7A 3BMQB 3E18A 5I9MA 1SCUA 3TZHA 3I9NA 1PU2A 3JYQA 4BKOA 1GUZA 1PJSA 3GK3A 2GPTA 4FW8A 1K89A 4J1SA 1G0OA 2IODA 4GGOA 4W7HA 4LVCA 3WGTA 1PZGA 3NUGA 3UHAA 5BSFA 4Z0HO 5KKCA 2CY0A 1EFLA 5KJEA 2NM0A 1EQUA 1EUCA 1RKXA 1SMKA 1U7TA 3QY9A 5CPBA 4CV0A 3GVPA 5BQFA 3WGIA 1C1XB 1E7QA 3D4PA 5TT0A 2VQ3A 1PGPA 4LSMA 2BFOA 2VWHA 4YRDA 2YUTA 4JP2A 2NU9A 4QO8A 3NYWA 3C3XA 3QHAA 2I65A 4BKUA
chains in the Genus database with same CATH superfamily
2I7XA 3DR3A 1T4CA 3ED1A 1LBHA 1UMBA 1ILWA 1NNSA 4UQPA 3VC7A 1SBZA 2VHJA 5LB2A 1M33A 3KQQA 4OHCA 4DDVA 1G38A 3T9AA 4CVNA 1YI0A 5JSUA 2Q5LA 1N9GB 2FF7A 3DDZX 2G07A 3PI7A 2FWNA 4Y6PA 2PL1A 4C04A 1BS2A 1HXHA 2PWYA 2RBKA 3LO5A 4IDAA 3LDFA 4M9QA 4OI2A 3RQIA 1ETUA 2BSQA 2HBZA 1A7AA 5JROA 2BFCB 2PLNA 2M1XA 1XRQA 2F1OA 1MR3F 2DUNA 1PR9A 3OOEA 4HDNB 4OHVA 1E5LA 4ARCA 5C8ZA 1L7VC 4TMTA 4XWTA 1BMFA 2ZE8A 3DEAA 3PSAA 2EQBA 2PUBA 1BWPA 2B3TA 3G9ZA 2JAQA 3EE6A 3OP4A 5FEUA 5I7OA 2PQ0A 3WRWA 2A5LA 1JTEA 2OD2A 1GQOA 3GLGA 2ZJFA 1TJNA 3HNOA 5KC9A 2JGRA 1QZUA 2ZWMA 2XZDA 3OH8A 5K8LA 1J1IA 2H51A 3TLXA 3CKMA 1YR2A 3PGMA 5I7EA 1CEXA 2GBPA 4F3RA 1GPUA 3C8UA 2A94A 2XB8A 4WY2A 4EG4A 1DXYA 1OC4A 5IX8A 5P8WA 5IC6A 3SEAA 1GZDA 1TK3A 5E6RB 1GQRA 2F64A 2F43B 2PUTA 2XTAA 3CKYA 3O93A 3QSGA 1IBMB 1ZL0A 2FJUA 1P7WA 3U26A 3LQQA 1ORDA 4TRMA 1S89A 4BNUA 3SS7X 1UBUS 1FFEA 3EXG2 5CXSA 1OX4B 2FEKA 2H4WA 3FFWA 3VTZA 1WJGA 4ICIA 4NQRA 2B8NA 2JFUA 1U7DA 1WU7A 4ENVA 1N2HA 1QGZA 1TF5A 2O2EA 4M53A 3RYCA 4YNBA 2EWWA 3GG2A 3B3AA 1UXJA 4CEJB 3N0WA 5LP6C 4C3VA 5K2OA 5LLSA 4D81A 2XE6A 3CNHA 4ARZA 1AKTA 4EW1A 4MRSA 2J9GA 3MT9A 2P69A 1Z4KA 4NU0A 3R7AA 3U4AA 4DAOA 1GKIA 1L5VA 4CODB 3A31A 4FD2A 5DHUA 1W5BA 1GZSA 2XXBA 4YGXB 4C4YA 3LUHA 3O9MA 4CCWA 2JZNA 1KZ6A 1VIAA 4Z3KA 4IBOA 4QYTA 3IOBA 3K2IA 4P3OA 3K16A 3LUJA 1EVJA 4TTVA 2WQZA 3HP1A 2XXAB 4RK0A 1EFVB 1OJ7A 1UKZA 1ZDMA 2WD7A 3M3HA 4CDMA 4CMKA 2D0DA 2HXSA 2NSJA 1CB7A 3PEEA 1EK6A 1OMOA 2FG6C 2Q4BA 3EARA 1K8ZB 2ZG6A 4FQ7A 4KMRA 4LVUA 3BGSA 3DC2A 4NZ9A 1V3VA 5ALYA 3ZD8A 2CXNA 1KSHA 4ITRC 4JLPA 3NYQA 3UY4A 1ORRA 4AS2A 3D2AA 3HWWA 2AW5A 4KWEA 3RS5A 1KYYA 3KIPA 5E9QA 4BECA 3OUUA 5FOWA 2X19A 4C2AA 1DO2A 2PRSA 2YS6A 5HYVA 1EWYA 4YJHB 2I91A 3M2PA 6GPBA 5MHTA 2I6UA 2NP6A 4MV0A 1ZUNA 4LY9A 2WT4A 3GLVA 3AILA 4QO7A 5A2GA 2LNDA 4GMXA 4XDYA 1D07A 1NI5A 1NMYA 2RGCA 3GGGA 4J07A 2IYLD 2ZJBA 1TD1A 1NAHA 3FPSA 4PLPA 1SZJG 4V0MA 4WLOA 2ZYDA 4WZAA 4ZU1X 1PYGA 1C1HA 1W35A 3T7RA 4JYCA 4WEOA 4N6GA 4ER0A 4G4SP 3X44A 4HAUA 1D9XA 2X15A 3TTWA 2IE8A 2EJCA 5JCJA 2AR0A 4DJEC 1VYUA 1E89A 2V6JA 2ZB2A 3DB1A 4EVQA 5F9FA 1U0BB 1E2BA 3T4PA 1Q2XA 3F98A 2GPYA 3O4GA 1WB6A 3LBHA 1YDWA 5CVCA 3RW9A 4MV7A 1YJQA 4XIJA 1J5XA 3AJ9A 4YCBA 4UHBA 3WSTA 3ZEIA 2Z1MA 1DQNA 2JAHA 3D02A 3GGOA 3GJYA 3MTBA 2ECOA 4YYEA 3ZWKA 5HDQA 2F17A 3SIWA 2UYGA 3UV6A 1L7DA 1NP3A 1PRYA 3V48A 2Z09A 3TTSA 2G5PA 2GPWA 4HUQA 3FDJA 4X61A 5BMVF 3T7KA 5TNXA 4KFTA 4IIHA 3DDUA 3I5UA 4DV1B 1QZXA 1YWGO 2AMLA 2NU8A 1K75A 4EQ6A 2ZE6A 2P40A 4G1UC 3VU9A 3HN7A 1YZQA 3W6OA 3ID6C 3L7IA 3IVGA 1YSCA 5JCZA 2WQ6A 5G4KA 2AFHA 2GEJA 1BGVA 3KHTA 3H17A 3L8DA 5HTKA 4Y6QA 3ZH2A 2FW9A 1HH4A 4QECA 3GQBB 5ALQA 2WLSA 5IJ9B 3OC0A 1YDHA 5ELMA 3BGOS 5GINE 3D1VA 4JC0A 1F7VA 4MYTA 1M0WA 5TE9A 1CIVA 3I9V6 2QTHA 2UVDA 4JFRA 5EQFA 4MQEB 5K4AA 1AKUA 1C4XA 3MAJA 3V8EA 4B3RB 3DR5A 1GCGA 3WLQA 3N2LA 1HZZC 5E8JA 4B4VA 1TO1E 3TFWA 4D8VA 3R5HA 2W6PA 2CYBA 2F4NA 1UBFA 3RYHB 4ZZ0A 1DSSG 1KQPA 1JXOA 1X2BA 2VUUA 2VRCD 2YJZA 4HS4A 5ED0A 2H29A 2W2OA 2YNMA 3L9WA 1S02A 4UM8B 3U48A 2NNWB 3KHSA 1I7QB 2NSHA 5T67A 2YOFA 5CVJA 4RJIA 1E3MA 4BKRA 3T5TA 4D26A 1IBSA 2QR5A 4OXQA 5CYOA 2DPXA 3RJ9A 4FR5A 4H35A 1HWYA 4CBVA 1HTBA 1M3SA 1YVUA 2OBLA 3KXDA 2O8DB 4QXQA 3WK7A 2QYSA 1T43A 2W2VA 4NMXB 2VQEB 2R00C 3NIBA 5ALPA 1DAFA 2IZZA 3KLPX 4FX2A 1G8KA 4YJHA 4ZOLA 3E3AA 4C1BA 4E5VA 4B2IA 4RLQA 1FS5A 2JLSA 3EWSA 5KVVA 1KJQA 1QLWA 1T3HA 3HFGA 2CEKA 2JA2A 1OXKB 1DT5A 3B5JA 3DQZA 3H04A 4DUZB 2OZLA 2GPNA 3ER6A 1DOAA 3PDIA 4DMGA 1A7UA 4G1EB 4P3YA 1SVIA 4NBSA 4YT8A 1R7RA 2CLFB 2I1QA 2HIHA 2XCQA 5ILGA 1Z16A 5EFOA 4ESOA 1U4NA 1X2EA 3Q9UA 1D4OA 1XLWA 3E22A 1B42A 1EFVA 3F8WA 1UJ2A 3I61A 3NIDB 1RAGA 3EMBA 3BWVA 5E2AA 2O8EB 2ZVDA 3FCEA 3NGMA 3GRKA 1E79D 3A3OA 3EXHA 2PMWB 3OUZA 5CYFA 4AY5A 3KSDO 4Q1AA 4CQJA 1NTRA 3N0XA 1W0KD 3AVOA 4AUKA 5CH3A 2D3TA 2PRYA 2W2QA 1JT2A 2AOUA 1HG1A 2C04A 4IW3B 2H0QA 4RV5A 5L7YA 1QCCA 4N12A 3TQRA 4YXWD 3BA6A 2VQ6A 1YE8A 3QP9A 1KBQA 3KD3A 3O0TA 3PKZA 4TVOA 4UMEA 2VI5A 5LQSA 1O95D 3IEPA 3LDHA 4OGGA 4XVUA 4CR8A 5ILOA 3CUVA 1E3DA 5MN6A 4L08A 4R8VA 2VRBA 3V1LA 2ZI9A 4LQLA 1AUPA 1O94D 4X1KA 4B7AA 1MEJA 4MDHA 3M7IA 4AECA 4E0BA 1CP3A 2FP4A 3PFHA 3BORA 2HDOA 5DBOA 4UW9A 4ZAVA 5FWDA 2GN9A 2O7VA 2QL9A 4ZV4A 3IMFA 2H5IA 3V1UA 3I05A 3IUJA 3HLKA 3WYDA 3RUFA 4U2CA 4C4ZA 3F96A 3PGXA 1T2VA 4YV7A 4BGUA 3BH0A 2JIQA 1G3RA 3MUOA 3ZU6A 3SMQA 3OAAA 4HGPA 5CA0A 5ALEA 3FBWA 1DRVA 1PVOA 1GN9A 2BM1A 3LXMA 4XWWA 1L7XA 2UYYA 2G5TA 5MFPA 2O19A 2BR4A 3NWBA 5C7OO 4BL5A 1Y98A 2PS9A 2JHGA 2Q4TA 4L4RA 4X3OA 1DBQA 4HV4A 1M8JA 3MINB 5A2QA 4D3XA 2ZSDA 5IHXA 1W6RA 4FM9A 4DB2A 2OYSA 2QZ4A 5HQ3B 2ZWOA 4FE4A 2J3DA 1G98A 4QUDA 1K4KA 4TTQA 1XCJA 3CW8X 5FFMA 1IDOA 4E1AA 2ATCA 3Q8MA 4PHFA 1UJMA 2FZ5A 4NYIQ 4I9FA 1UXOA 1PVDA 5KYTA 1IZ9A 1U9IC 2C8KA 3E58A 1YAHA 1JYFA 3GRYA 1RRVA 2IDJA 4KPGA 1XZDA 2ONZA 5EIHA 2M6LA 4A0HA 4CMCA 4EHDA 2XMGA 1UJBA 1Z36A 4PLVA 3PITA 2FGJA 2PT7A 1Q1AA 5F4ZA 5HCUA 3RS3A 1AV7A 1J56A 1Q7BA 2FMIA 4IZHA 1BVHA 5DBIA 3O8NA 3GAZA 4MPPA 4A2QA 4CU5A 1KEVA 3VR6H 3NONA 1GU0A 3IE2A 2I3AA 4CHTA 4MO9A 4W5RA 4TLEA 5TX7A 2JD2A 1HZJA 2WIFA 1XTJA 2YY6A 4JXJA 3H5IA 4MP3A 4RY8A 3M70A 4JP8A 1AXEA 3E35A 4KO2S 2PO5A 2V03A 2R7KA 1XNHA 1M5TA 4AZTA 3JD0A 2BLNA 1DT3A 1EUDA 2WZCA 1Z6ZA 5DB4A 3VPGA 4NCNA 1U04A 3L7YA 4GOMD 2J8ZA 4UD2A 5C4IA 2HRBA 4O63O 3ZX4A 1NBHA 4O6VA 3RTDA 1J42A 3OD1A 3LVBA 1FFSA 1PJ2A 3VPDA 3H4VA 4BFLA 1C81A 1ZUWA 3O8OA 4HFNA 3TGWA 4F2PA 2IPAB 3DKVA 3ZHOA 4Z49A 1ULZA 5A4JA 4BFWA 2AD5A 4DR3B 3B7WA 5IYZB 1CB0A 1CE8A 3LY7A 3OEHD 2PRKA 1ZEJA 2QMEA 5FADA 1CRZA 1OFTA 3GUVA 1O9HA 2AGVA 3V8NA 1L8AA 5C7LO 1Q74A 3A9RA 5TPWA 4Z9FA 3VU0A 1JIVA 5KNBA 4QFDA 3D3QA 4D57A 4CU2A 4DXDA 3U4MA 2GO7A 3RS4A 1QONA 3Q9NA 5KJ6A 3BMQA 4UHFA 4K1LA 4PLGA 5CYGA 5K0BA 4CFSA 4LK2A 1CY7A 4PTYA 1C8KA 2PANA 3PENA 2O50A 1MVLA 3HCCA 2VPQA 4W9NA 3FRIA 3IQDB 1NLUA 1JSLA 2ACEA 4WJZA 4BQOA 2ID4A 4MLZA 4P3KA 1Z9BA 1T2UA 1UKAA 5GJBA 1Z74A 4LQDA 3HV0A 4HGNA 4B6GA 4GAEA 3RU3A 4PWYA 2CXOA 2Q3BA 3CCCA 4DCVA 2X5JO 4PC2A 3WIUA 4MQ6A 4MV8A 1NZDA 2ORVA 1UEJA 3H16A 4M0FA 4Y6SA 4KR0A 3LQKA 5GZ1A 3BL5A 3I83A 4II3A 4ETNA 2Z95A 4N9QA 2IBSA 1JAHA 3RUPA 1EX1A 1PS8A 1FDUA 4K1XA 1A50B 2C5EA 3JVEA 1BH6A 1P5JA 2B83A 2ZM6B 4XQCA 3JX9A 1TQHA 3N76A 4H7PA 4RK1A 2XYRA 2BMEA 4AJ1A 5ADWA 3ND8A 1UMCB 1ZD5A 3BIFA 3CINA 1KVUA 3F5FA 1E2NA 3EMKA 3CJTA 5FA5A 2PSSA 5BRNA 5JSZB 4OB7A 4PO9A 1Y33E 1XIVA 1HZZA 1M0TA 3D6MA 1PEKE 5HIIA 5K51A 1NYRA 1GNSA 4Q1DA 4MI6A 1TVKA 4AG6A 3RDPA 1CDDA 1MQAA 2YVLA 3FHJA 1ZUD1 4DY4A 2V0CA 4HZUA 1Z4MA 2BISA 2I2AA 2R6HA 3QLEA 4OYRA 2G4LA 4D8YA 1RLMA 4I4CA 5G0WA 3TKLA 1IUPA 3MD9A 1ZK3A 1NWCA 1J99A 4UNIA 1QHHB 1Z34A 2SNIE 2AZMA 3G13A 3T7EA 4LOIA 4WOPA 1BX1A 4GEKA 1C3VA 2BGTA 4F04A 3UFXB 1JW9B 5ES4B 5KWVA 5F5LA 1BW9A 3I92A 2QSJA 2WJ6A 2BMWA 4LRTB 4IG4A 2P90A 4D3FA 2C96A 4EPWA 5EEHA 2J87A 3QKRB 3QY0A 2TYSB 2OM6A 5AVTA 1VKOA 5IXSA 3LSTA 3WGNA 3KEOA 4GL4A 3R5SA 1U2GC 5LP1A 5CMLA 1SXHA 3CF4G 1SG0A 1XTPA 2C9MA 3D6FA 4G85A 1QFSA 2C2XA 4U9IS 4DSUA 2R6R1 5JPIA 3OIWA 3P7MA 2VHQA 3DAYA 3VI3B 2H0RA 3OT4A 3AG5A 1IAQA 3AYZB 2EQAA 2JZCA 3E27A 4BJ3A 3T34A 3HB4X 3IAXA 3VO1A 4NCBA 13PKA 1U7ZA 4FC7A 2VKQA 4WDRA 1SG6A 1W8DA 4FW9A 1OT5A 2HO5A 2JKVA 3DTVA 1ZH6A 2A14A 5IVIA 4R1NA 5TVKA 3ZWBA 2I29A 3UGJA 5ALNA 4GYWA 1P33A 4PZ0A 3MB8A 4QSMA 4AY2A 5KYYA 2J5QA 1FTQA 3OPYB 4RMIA 2X42A 2FZGA 2HBRA 3LOUA 2QTMA 2FMUA 5C4GB 1US8A 4BB0A 3U16A 1V8OA 2A1TR 3DZCA 2X22A 1LLUA 5B1YA 2PRIA 4DTCA 1X7YA 3IV7A 1L7PA 4UFOA 4E5SA 4J7XA 4X71A 3TNFA 1EXWA 4I1UA 4JVOA 4DSTA 3VYUB 3EH1A 1GY8A 4WKCA 4BVGA 1VE7A 5EXDA 3IKTA 1MOQA 3P26A 4L6CA 4J29A 4DJFC 3SI7A 2R25B 3ZWDA 1QK5A 4KUEA 1U3WA 2BI7A 2QY6A 4CG3A 4W5TA 3KSBC 1DIRA 2XBUA 2AE2A 1RP7A 2ODQA 3ESZA 3MJ4A 4A2WA 4DLUA 3BFKA 4M55A 3FROA 4QFBA 3WQSB 3E9DA 3CH7A 4R2KA 3HN2A 4UJ5A 5DHPA 3IQXA 2FFRA 2A78A 1E66A 2A8YA 3ZI0A 4GX0A 5TVGA 2X4IA 1J33A 2W6QA 4TX1A 4DDHA 2ZZMA 3V4SA 1DQYA 2UVPB 3JQPA 3SZGA 3ZZ1A 1ZN8A 4K6OA 5SV2A 3U3JA 2XNSA 3F1KA 5CIWA 4URVR 2O7SA 4HS9A 1Y8CA 4GYYA 2HY7A 2I6GA 1K5DA 2W00A 3KAKA 3L49A 3SPXA 1EWTA 1TQ4A 3B6ZA 3TRDA 1F5NA 3MELA 2VP5A 3WB0A 2VJMA 1H2AS 3FZEA 2C9ZA 1X1BA 2M98A 3VR0A 4K6MA 1ZD4A 3HVHA 3SX2A 2GZRA 3FVTA 3VKGA 2PSHA 2PA0A 4RAQA 3PQCA 3C6KA 4LBZA 3WISA 5C5DA 2WTUA 1IM5A 2C3OA 2YJTD 3OZWA 4IL5A 1YB1A 3PC8C 3V1NA 1BAPA 2FX2A 2NZJA 1E3QA 1T8WA 1O94C 2FPSA 2GCGA 1ZJ6A 2HRZA 3PNSA 1RMQA 4QDKA 5JBIA 5JUWA 5KYUA 3TI9A 1LI4A 3VNAA 4RJKA 3GFOA 1E6KA 1ORHA 3IKVA 3KKEA 3AINA 1JGTA 4ABYA 4DV2B 1KPIA 4E3ZA 4PHTA 4BN4A 4WOCA 3ZGLA 2YRXA 2D1YA 5U4QA 1Y7TA 3CPSA 4H2DA 3EVDA 3NHAA 2FWMX 3D2LA 5GONA 1VLQA 3AGQA 2IX9A 5T64A 3ETEA 4G1FA 2O1WA 1LB1B 3PGJA 1HLPA 4DA0A 4EGJA 5EJ9A 1AGXA 5CHYA 2PX2A 2SKCA 1HOXA 2QRVA 3QWHA 1V48A 3VKWA 3SLGA 3TO5A 2WP8J 1E5TA 1X9GA 1VCHA 1WABA 3RJ5A 5IJ0B 1QFYA 2HLDA 3OEWA 1JEEA 2VVTA 4YUAA 5EKSA 1ZY2A 3ODGA 1CUWA 4R2WA 5HZKA 2R1TA 2EJVA 3W34A 1EK0A 3NJ8A 4C5BA 3BKWA 3FTNA 2ZJ2A 2QBYA 4TZ6A 3HWX1 1OXMA 2MINA 1GGJA 3BWYA 4W7IA 3PRHA 1WXHA 4RKWA 4JOQA 4FOTA 2O4CA 3ZDFA 4YN3A 1EFHA 5EFZA 3B9BA 3VOTA 4YP6A 5BT9A 4C0WA 3ZW8A 1MHPA 1DG3A 1P44A 2WNIA 2IW1A 3ZWMA 2WLTA 3TAXA 2R6DA 2ZXEA 1H2EA 4PZAA 4UDYX 3TR5A 5CB0A 1XRLA 4IQ4A 2O9JA 4C7KA 1B6GA 3A6EA 3LCRA 1N1EA 3WKBA 4ZEMA 3U7FB 3O91A 1E1YA 4PNEA 1FSFA 4NKRA 1USIA 1ZK1A 2D1QA 4GX1A 3RLFA 3DCYA 3PQ3A 3RC8A 2FP3A 1AIPA 2PIDA 2D7JA 4P5PA 1YFKA 1SPXA 3ED5A 3A4NA 4GLBA 4WIAA 3R7BA 4RIHA 4ISBA 3TZ6A 2Z3ZA 3VDNB 3JQ8A 2QN6A 1H5NA 1FRQA 3FWZA 5B7QA 2A0UA 2KW5A 4B7XA 3OCXA 1HL7A 2Z30A 3M6MD 3OAAD 4D9BA 2WV9A 1ECGA 3I45A 4W8GA 2IUUA 4C2UA 3H11A 1TI7A 3L8GA 3LPAA 3CJQA 1W48A 4RMGA 4DSAA 1C4OA 3ZGZA 4AU1A 1D9ZA 4Y0NA 1A0OA 4GBGA 5CLGA 4E5KA 2YICA 4GUDA 3T5BA 5JI2E 4I55F 1RXVA 9MHTA 2IYQA 3D2BA 4TLBA 1JR6A 1RNLA 3A05A 2J46A 1I4TD 4F7DA 1I3CA 1MJNA 3DA8A 2C7BA 1L4LA 3JWGA 3KTDA 4RCZA 3CW2A 5JSYA 3V3KA 5ABPA 4M2LA 4MV1A 2CSXA 4GQIA 1TKAA 3W2IA 1TD9A 2A1UA 2PX4A 3G1TA 3KYCB 5AXBA 1R6AA 1Y8AA 4MGZR 4HDRB 1KHTA 1NNI1 2QVLA 1YACA 3QW2A 5E4FA 3WWCA 1T1IA 4DIFA 1VFNA 1BA3A 1X80A 2IV3A 4YJ2F 3WV5A 3AT1A 1B4DA 4XAQA 5BMVB 3GB9A 2C0PA 5SY4A 3NGXA 2NQ8A 4EL0A 1GZ5A 1M72A 4ZXPA 3KO8A 2B21A 2WAOA 3EYAA 4CE6A 4E88A 5CFNA 3CVUA 4Q6BA 3ME5A 1QO7A 3Q8KA 1E1LA 2KBEA 2OFOA 3CVYA 1NNUA 4RM2A 3S70A 1U98A 2KQUA 3FYUC 4M7RA 4LRQA 2G6BA 1FCJA 2ZBUA 3HEAA 4QATA 4TUYF 2H2WA 4XGKA 4B75A 1QK4A 4YP5A 3TE7A 1LGYA 4TMYA 1VLJA 1Z6GA 2AG0A 2GTIA 3KJQA 3B38A 4FSDA 2XNDA 4KR9A 1OYOA 2Z9BA 5ELLA 4EUNA 4B7CA 4JKYA 3V9PA 3VSCA 3C15C 4UNRA 1MOZA 5DGXA 5C46F 5JWOA 1DCKA 1ESNA 2CYAA 4WZZA 3I73A 3IPCA 4IDOA 4NEQA 1CPYA 4AZ3B 2QQ5A 1BZYA 5ICGA 1TM1E 4FE7A 4K9NA 3AU8A 2R8XA 1J9EA 1TPYA 4KJZA 2Z2XA 1GPKA 2B34A 3FSGA 3EEQA 3IPXA 4QRIA 1UANA 1W9HA 2PBLA 5I7AA 3USCS 1PZHA 3FWKA 1TXGA 2NV0A 4BNMA 8MHTA 4HATA 5EIFA 1OASA 3Q5GA 2VDUE 2RC5A 2XW6A 4EGFA 1A5BB 1QH9A 4UOEA 3MJVA 2KX7A 3H5WA 1PWEA 3VJKA 4BFSA 3FTFA 3T9FA 2ERCA 3S5UA 1B0AA 1Y6GA 2CCGA 1GFZA 2Q99A 4HRYA 1H1LA 1AHIA 2A67A 1PDWA 1R8JA 1SKBA 2A84A 3K6RA 4RJLA 5B36A 5KQLA 1UK9A 5KOJA 1EDZA 3W90A 4RD2A 1FLDA 1K3UB 4LWQA 4BLUA 2OG2A 3EVTA 4WNIA 1W0JA 2IEBA 1WX1A 3IPLA 3KTOA 2YWEA 1IY8A 4OHWA 2D5LA 4FGJA 1E3TA 2J3QA 1LZLA 1WZEA 4AJPA 1CRLA 4RMJA 1T3LA 4DMCA 1M66A 3BQ9A 4M83A 4MKZA 3BIWA 4OHKA 4CV3A 3QVWA 4EB8A 1J24A 1V7ZA 1OI2A 1TCBA 2QLNA 4U6NA 3TYXA 5E6RA 1AXRA 4C2TA 5DCWA 1O8BA 5GVSA 1RQNA 5TS3A 2AMFA 4FNGA 4PZ9A 3KKZA 5G02A 1LTQA 3FOZA 2GCPA 3QEOA 4MA0A 2Y0CA 1UZLA 5E0OA 3JTEA 5JYCA 1U90A 2BSAA 2EVWX 1EUQA 4EFNA 4TVSA 3K5PA 5GP1A 1E5VA 2ZSIA 5K0ZA 1VKNA 3JVVA 4GOOD 4UAJA 2B8EA 3SJUA 3HABA 4ER3A 1SBQA 2GZ1A 5LPNA 1KSJA 1YQQA 2XTMA 3PVZA 1YZVA 4FBMA 1DI0A 3SQMA 4BU0A 1VJTA 2WKQA 2E6KA 3RB8A 4D8UA 1I2DA 3ELWA 3EGDA 1H5UA 4O4LA 2J0EA 3R5FA 5A4AA 2X1HA 3JYPA 4MTCA 3SXUA 4YPVA 3INRA 1I1NA 1IMJA 3M5PA 1BXRB 1SIWA 4HGOA 4TL9A 4UEWA 5CHEA 5M29A 3O4FA 4ZEOA 1ECBA 2OQVA 1ZH2A 3TDNA 3FYCA 2OXCA 4E1BA 2I62A 5JRJA 3EZ2A 3ORRA 2GAIA 2WD8A 4MPTA 4Z9XA 1AA6A 4DNPA 1DWQA 3Q15C 1CUXA 2AK3A 1HI9A 2ID7A 4V2IA 1WM1A 2HJRA 4ZO6A 4TTSA 5C31A 5BV1A 4W9MC 1TLTA 2IVZA 2FLKA 2HTEA 3VOAA 5A5FA 5JEDA 3E15A 1XHFA 4BRUA 2Z1NA 1NULA 4FYVA 4S1PA 1OBHA 2C3UA 1ULSA 2XGGA 2JGJA 3CO0S 4YASA 5AYVA 3UMMA 4X65B 8AT1A 1NR1A 4YAWA 3AR9A 2ORWA 5CDYA 4BWFB 4PS1A 1OIVA 4F4IA 3ZWYA 1O0BA 2XUPA 2VK4A 4K5QA 4OJYA 1PX0A 4MUNA 4INPA 1S9HA 4IIUA 1I9GA 1N6KA 1ZP6A 1ZMTA 4TT8A 5BSHA 5KVQA 4AN1A 2AUMA 3MW8A 1MXHA 3OKPA 3ZTTA 2C59A 1H8HA 5BXYA 3LCUA 3QMVA 4YJ2A 4X1KB 2O3JA 2VP9A 1FEZA 3L6EA 4UCXA 2JH3A 4QOFA 5I9LA 5KTSA 1OFGA 3SJZA 16PKA 4O8CA 1VCMA 3EGIA 4JB0A 2AEMA 4WNAA 1TC1A 4DCTA 1X8XA 2XB6A 3CT6A 4NMWA 1G16A 4WN9A 1T3TA 5IN5A 5LWQA 2FMFA 1UMDA 1MO5A 3QNUA 2Y05A 5EWJA 4YP7A 1KL7A 1HNWB 4C6TB 3ZTYA 1B6TA 3LZDA 2A5JA 1N8TA 1XMVA 1ZJ5A 2LPMA 3BJRA 3DBRA 1Q0ZA 3P0JA 3PLRA 4GRAA 3R23A 4RL6A 4EX6A 1QBKC 4YRPA 4J16C 4YRIA 5CUQA 1W36D 5LA6B 3ZW9A 4PYOA 5DLEA 4EPXA 4LZAA 1KERA 4EA7A 3UXHA 1X7WA 2JCYA 4K2AA 1GG9A 1T2FA 1W0CA 4L0QA 1C3OA 1SNYA 4M99A 4XRRA 3W78A 2WSSA 4NZPA 5AKZA 5HKAA 1AKRA 5HMMA 2BGGA 3WJ7A 4KGXA 3TFOA 2WFAA 1OTHA 3TPCA 2GDJA 2I03A 3UK1A 3GLRA 4KDEA 5DKFA 2IHKA 2JJ1A 2JLRA 5AHWA 1TCAA 5ALRA 2CL7X 4RA9A 4S2UA 5IYZF 4KKXB 2J30A 1LC0A 1EX7A 4UEJA 1NBEA 1CQJB 2HCTA 3G3EA 4Q3LA 3ZJTA 2JJYA 2QAGB 4JI0B 1X1QA 3VYRB 4EBFA 4RPKA 1QQBA 4FSXA 1PT9A 3D6UA 1O03A 3G9UA 5CB8A 3AWIA 2V7QA 2C03A 3PQ4A 4JB2A 5DT9A 3ZY2A 1P1HA 1XJWA 3BBLA 2QN1A 4XWOA 2AJCA 4BVLA 5IANA 1DAEA 1CDEA 3QNMA 5JVDF 2HT1A 2GOYA 1U2SA 4K03A 3GCGA 3HZHA 3IIMA 3VU3A 2IEAA 4GEGA 4B4UA 1S2NA 3OPMA 1LNSA 2CVZA 3B9QA 4BNFA 5U9CA 3SU8A 3VMFA 3MWEA 3EODA 1O6BA 3BMOA 1E3JA 1GSAA 3FHCB 3TVTA 3W5UA 4E30A 1YA6A 3F9IA 3RAJA 3ZIAD 3GRCA 1KOFA 2ZJ3A 2R7LA 4J3JA 2E1RA 2B7BA 3D3WB 5FV7A 2GEBA 2Z2KA 3OSZA 4IUYA 4YMSA 5LQAA 1FJHA 1YJBA 2QLFA 2ZJ0A 3QEBZ 5AKEA 3OFVA 3AZQA 1ECFA 3A32A 3N07A 3A11A 4JBHA 3RFVA 2Q7DA 4W5NA 4WRRA 2IBTA 1HY3A 1J1ZA 1AC5A 2PX8A 1TQ6A 3EXEA 2XDAA 3FOWA 4IH9A 1R50A 3CLVA 2PWPA 1I5RA 3GWGA 2R4UA 2X6QA 1QDEA 1QWSA 4RVDA 3SK0A 4DABA 4F56A 1AZTA 3V4PB 5J43A 1SXGA 3E2PA 2CJPA 3QTBA 3G9TA 3IVCA 1UOPA 1GLVA 3Q7PA 5D3QA 3ZJUA 3UAOA 3OEEA 4OQNA 3O3CA 4RS3A 5K6RA 2VP6A 3IOCA 4YJDA 4I14A 5E9AA 1YR1A 4BV2A 1W4CA 2WYUA 3NX4A 3KM0A 4TQUS 1UJ4A 2O2YA 2P6NA 1OH5A 3PQ2A 1S8NA 1UT8A 1Z0ZA 4O5AA 3MQ2A 4YP0A 3SHWA 4BQSA 1YZ3A 3OI7A 3W05A 3QVKA 4YJKA 1G8FA 2Y71A 4F3KA 2BUBA 3LT2A 2OECA 4OLBA 2ZVPX 1RZRD 3OF5A 4FYKA 1SVKA 2GBFA 4HQFA 2N1BA 1K9VF 4L27A 1XL1A 2ZTVA 4BKPA 5HIAA 3TTTA 3R6WA 3TEFA 3WRXC 3GGDA 4PFQA 4E2XA 1RIIA 1DUVG 2WFLB 3EXFA 3N7AA 2PCJA 3JCZA 4IRUB 5CT5A 2FFQA 3VR3D 2F8SA 4X1YA 2CNOA 3QF7A 4LW8A 5F33A 1H3FA 1XALA 5GGYA 4CF6A 1T8YA 2IH5A 4NZNA 3DFFA 1PQYA 1I80A 1XLVA 3JWHA 4AM8A 1KE1A 2QP9X 3GCWA 1KEZA 3NH6A 3MUEA 1I8TA 2IP4A 2JK1A 1XRSB 2CJFA 2YIMA 3UHJA 4NJMB 1EHCA 2C9OA 1BXRA 1SBYA 1C1XA 4O2BF 1IN4A 2DYKA 3FVRA 4UBKA 3RKRA 4COKA 1UPUA 2WKRA 3WQQA 3F6EX 1X19A 5A3QA 2O2SA 3ASVA 4ROTA 3EBOA 1EXDA 5FULA 4XIGS 3UEOA 3LDGA 4FLEA 2JIPA 4X0EA 2YDYA 1JHQA 3MGGA 4MB6A 1Z4JA 4GH5A 4PLTA 4LZPA 3ZLVA 5H8WA 3TTVA 4YV1A 3HB0A 3E8XA 2HA0A 2J4DA 4BQIA 3NR2A 5CDUA 1NBAA 5FQOA 4D9CA 4G0OA 4ZVNA 1JWLA 1YL6A 1JPUA 3NH9A 1CD5A 5BNWA 1TLLA 4YO7A 3CLSD 3PDUA 1TM7E 1UBMS 3RUAA 3CPHA 1M6YA 4RGQA 2AIRA 3VKHA 4OLJA 5FUWA 1WDTA 4AN4A 4M9CA 1Y5LA 3WOHA 2AOTB 3I5MA 2GQ0A 4OD0A 1XWIA 5JD4A 4ZDJA 3SD7A 2RAPA 3KD2A 1D6JA 5EIAA 3A2NA 5JY1A 4TLAA 4ZJYA 4MR9B 3INGA 4AKTA 2GSDA 1Z5VA 3G2HA 3MTIA 5CJJA 1KS9A 4QXPA 1D7OA 4W82A 1NRIA 2OV8A 3TUIC 3FOEC 2HW8A 1P45A 4LY3A 1XAJA 3GF4A 3B2NA 2QRZA 4ESHA 1I10A 2CSUA 2NXCA 3DW3X 3EFOA 3F5QA 3JD2A 1Z5UA 1OJLA 3R09A 2X0JA 5AI4A 5DCYA 1EEHA 3PIDA 1AF7A 1KI1A 1XLTA 1ONSA 3C5CA 3IHWA 4YC7A 1UMDB 1ZOLA 1A8UA 2DSNA 3CF4A 4J6EA 3MTGA 4MO2A 3RC1A 4E51A 2B0CA 3SDSA 2F55A 2RKBA 2NT3A 3GFBA 1L7BA 2JIZD 1NJSA 2RJ3A 4GOND 3EVNA 2BJHA 3VU8A 2O1EA 1E9VA 1DXHA 3TFQA 1CIPA 3KSAC 2F8LA 2WHXA 2Z8YM 3WL7A 4PG5A 1QR2A 1AZLA 1OAOA 1SHJA 1U02A 2PX3A 3LBFA 3NJ4A 3D8UA 4IINA 5HKLA 1GTG1 1ENPA 2CBZA 3HRKA 4BX8A 1JZQA 4C0XA 2FUG6 2GK6A 3MLBA 1Z7EA 3E05A 3BJEA 1Z0AA 1X86B 5BN3A 6REQA 1U5CA 2MSEB 4KYVA 1U3VA 2IEZA 2NNLD 1UXGA 2ZZKA 5DNEA 5JPCA 3UB3A 3T5AA 3U1TA 4UMDA 1EAMA 5IF9A 4UOZA 2X5KO 1TZCA 4JROA 2GJ8A 5LU8A 4QU5A 4RCVA 3DLIA 3S8MA 4EO4A 2MR5A 4CMEC 3K6SB 4IG9A 4FLMA 2VHTA 4D42A 1WULS 3U62A 3V8RA 4BMPB 3FDXA 1JHMA 1UBSB 1I2AA 2BUAA 4HDMB 4PTLA 1FJ2A 5AKJA 1J39A 5TDHA 5B6IA 1QYVA 5J3JA 2QN3A 4D9EA 3QMPA 3R3VA 4V38A 4YJ3A 4HAZA 1L0BA 3WKCA 4RTQA 2PUGA 2CKDA 2Q2OA 4GXNA 4AF8A 3PFIA 3L8EA 2IKQA 3HY4A 4KSBA 2H1FA 1NQWA 2I2WA 4AC9A 2WK1A 5IVKA 1YJ8A 3FSRA 2DETA 3SXUB 2RMKA 1UFOA 1KYZA 4CV2A 2ZUDA 4O4LB 2IYVA 1BROA 1ZPDA 7REQA 1XVLA 4OJNA 3B1ZA 2E4ZA 4BEBA 1CU1A 2HPAA 2QDXA 2WSYB 4R4JA 3FLBA 1X7GA 4PE5B 1POXA 4RHUA 2VSXA 1SXJE 3AJRA 5CBKA 2O8BB 1T0HB 5FTLA 1QIHA 2BJWA 2Z5GA 3SC2A 3DZ8A 1UBEA 1N8NA 4TZTA 5CVUA 3TD9A 2YV1A 3OQIA 4L8FA 4ZRNA 1H4SA 1B2LA 3DLCA 1MB3A 3G85A 4RVNA 3E2IA 4UAUA 4DQ0A 4RYLA 5KMGA 2QVYX 3K4PA 3HPRA 4EH1A 5BT8A 2QPTA 4B7UA 1QQ6A 2CW5A 4A8JA 3RSLA 5IKMA 1HR0B 4QT4A 5GAJA 4I9NA 2XQJA 2NO7A 2Q0XA 2FPWA 1VE3A 5BW8A 2D3WA 4E14A 3FYSA 2M6RA 4INZA 5HIKA 3OPXA 3F71A 4FLFA 1E32A 2C07A 3L93A 5E9WA 3S2GA 3TQHA 4CT4B 1ZAKA 2ZRHA 3AKCA 1GD1O 3JD4A 4DCMA 2UDPA 4B3CA 5IC4A 5JJLA 4XZ3A 5EP3A 3LVQE 1PYOA 2RB5A 2IYTA 3ILSA 3UYKA 5C1DA 3TLJA 3KLMX 5AM2A 3VAZA 3MSCA 1U6JA 1CRWG 1K4YA 1U7UA 2UYCA 4W8OA 5K0EA 2HNAA 1UBHS 3C3CA 1QHIA 5PGMA 4YIKA 1RYDA 4J1NA 2QD5A 3TGPA 3HM2A 3HADA 3I0ZA 1CHDA 2XITA 2FB9A 3G0BA 3IC5A 5CGQB 4PINA 4O02B 1U2DC 5JPDA 3TF5A 4G0UA 1UEIA 5FHRA 3TTUA 5J9FA 2AHOA 1ZMOA 2W6NA 5KSPA 4CF3A 1ZOPA 3MZ0A 4DPKA 4DWOA 3FD8A 4G5SA 4N40A 3LXRA 4B3XA 3KOZA 5KNDD 5TMDA 5KYNA 1XDBA 4MUYA 4QT0A 2CJYA 2HC9A 4C6RA 1KVQA 1KP9A 4XSVA 1DMRA 4QOEA 1CY2A 2J31A 1PW7A 3LYHA 4QDTA 5HKKA 3F78A 4X54A 4OUDA 2Q5QA 3VKFA 2FEXA 2GO1A 4LHXA 4KXFB 5AO9A 2FZVA 4O1HA 1WUIS 2AMYA 4TL8A 4EHLA 3V1KA 4GZ6A 1A04A 2VHXA 4HQ6A 3CGGA 5CK5A 2D5IA 2IGBA 1DRKA 3K32A 4QOHA 4RF4A 5P21A 3DPSA 4IV8A 2PKQO 4RXMA 3D5QA 4LCBA 2CYCA 2LDBA 3KWJA 1M2EA 5I3ZA 1ACLA 3HH8A 1QG6A 3WAJA 2SICE 1KZ7B 1MABB 4FQ5A 1E6MA 2IXEA 4LG1A 4ZI5A 3KXIA 1CZRA 4K86A 4NE9A 5REQB 3WGZA 5CBPB 1E6CA 2OCXA 2MHCA 3HUEA 1JI3A 1RWBA 5A62A 2QI9C 1GYRA 1WCYA 4YAOA 3T38A 3T3EA 1SVLA 1B8UA 4KMSA 4RZSA 4OPMA 2IPMA 2AC2A 5LMCA 5H81A 4LYYA 5IJZA 4REMA 3QM1A 4IKPA 1F7UA 1SXJA 2BRUC 4D8TA 1LPNA 4D0SA 1AKQA 2HLDD 5EHIA 1KYWA 1KBOA 4QFCA 3K1AA 1EP2B 3M6LA 5LC1A 1M7BA 2CFTA 3BTSA 3F3KA 2GNOA 1OKKA 3S1LA 5HUJA 2Z1DA 1CUCA 1F5SA 2XYVA 1P5ZB 1UDAA 1CY4A 1KJJA 2C77A 2EKZA 4LJ9A 2H1CA 3R3JA 5TV2A 1RACA 4J16A 4B73A 3L9XA 2YBDA 4Q9DA 4DQLA 4Z1OA 1R6VA 2EF1A 1JJIA 4YUYA 3RYTC 1IIBA 5A03A 3ASUA 3RIXA 3PUHA 5A6SB 3MN1A 3G1UA 3KUKA 4OX9B 1YDEA 2E4YA 1SK9A 2R48A 2WUFA 3KAPA 3QKSB 3L8FA 3EDRA 4C3UA 1FIUA 3FNBA 1G291 1U8YA 5DYNA 3GO4A 4DV0B 4LXUA 4MCJA 4ZT6A 2P0AA 3E03A 3CUUA 3I04A 4FVTA 3M6FA 5JLAA 3TRJA 4E33A 1P77A 1CQIA 1PLKA 3QNWA 2GSWA 3PU6A 1NXOA 4B6OA 2WZDA 1QB8A 1NVVQ 1Z45A 2OHJA 4I2VA 5ENDA 2C83A 1G7TA 4AX8A 3R3XA 4QBFA 1RQLA 2WOOA 4GLJA 1ZC3A 1A77A 4Z8XA 5JXIA 2PZFA 2YUIA 1NURA 2X41A 1HYHA 4BNTA 3OBIA 1MX1A 3R9KA 1QIFA 4XB6B 1CS4C 3JYOA 5K45A 3OHMA 1J8QA 3PEVA 2F9MA 4GR4A 4HYQA 4UBNA 5BR1A 2C00A<