1DFGA

X-ray structure of escherichia coli enoyl reductase with bound nad and benzo-diazaborine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfgA00
5COBA 4ZN6A 5AVOA 1ONNA 1Y9AA 2UDPA 3HHPA 4YRDA 3QQPA 5JDIC 1ZIDA 5G0WA 3W8EA 5L7WA 3CEAA 4BHTA 1HE2A 2VZ8A 4CMKA 3EDMA 2PGDA 3NEPX 4XYMA 4G2NA 4NBUA 3UAGA 3VVBA 3ZHYA 3OF2A 4CM9D 4CM5A 4Y6SA 1JDJA 2O2SA 5AXCA 3WTCA 5BNIA 4BO2A 3DOCA 4ND4A 1HDZA 3FNGA 5EPOA 2FSVA 4RVDA 2OGUA 2VHWA 1E7MA 1I30A 1GYPA 1ENYA 1ULSA 2P68A 5BNTA 1TA4A 3VTZA 4DUPA 2P4QA 3JYPA 4P4NA 2XOXA 4O0LA 5A5EA 3H9EO 3MOGA 3CUKA 1KIFA 3LT1A 1P0FA 2HMTA 2NNLD 3O38A 1HLPA 5ENDA 4B3JA 3BMNA 1CETA 1YBAA 3GLQA 1UH5A 2NUAA 1N8KA 5KJFA 3CZRA 3EYWA 1Q0LA 4H7PA 3Q9UA 1T24A 1U5AA 1QORA 1C1XA 2C29D 1EDZA 2QRLA 4NG5A 4E4YA 3TRIA 4ID9A 4YTEA 1K6JA 5MGBA 4UVEA 4DYDA 3GRPA 4N54A 1D8AA 5JLAA 4ALKA 2NVWA 3LK7A 3GNSA 5JBIA 1OC4A 1PGPA 4WASA 3PHJA 2Y0CA 1R0KA 1PSDA 4C4OA 4ONEA 3H9UA 2WSBA 3ZV6A 3OM9A 2W2KB 1O6ZA 3JQAB 1PS8A 1YL7A 3AY3A 1U28A 3G79A 3H2SA 5A02A 1YL5A 4CLRA 5THKA 3FCOA 4M8SA 4MP8A 3WGOA 1O0SA 1J0XO 2E4AA 3ZU4A 5FWNA 4IQGA 5COQA 3K96A 3H5NA 4RV9A 2NU9A 5JSFA 3I3OA 4PLWA 2DTEA 3ETDA 1GTMA 3QVSA 1OBFO 4HFRA 1K89A 5KWEA 3NJ4A 1JKIA 2D3TA 4NFHA 4F3YA 2D0IA 3EK2A 1V6AA 2AG8A 2OFPA 1GPDG 1HXHA 3EHEA 2P5UA 3BTSA 1JKFA 3GQVA 2HMWA 4PLCA 2LDXA 4FGWA 3IJRA 1GUFA 1E6UA 3M1LA 4GWKA 1YWGO 4J3FA 4DC1A 5L53A 2GUGA 4EI2A 1J5PA 1BG6A 3H7AA 4CM4A 3ROMA 4ROSA 1YO6A 1NVGA 3VPHA 3ASVA 1YKFA 4XZ3A 1QYXA 2V7PA 2ZYGA 4RORA 1Z73A 5JMPA 1DO8A 3D5TA 4RPJA 1QXSA 4CMGA 4BMNA 4A7PA 3K2EA 4B3IA 1QSGA 1KS9A 3RSHA 4RL6A 1QYDA 3IIEA 3PYMA 4U5QA 5TT0A 4ZJUA 3OFSA 1DHRA 1ORRA 1GQQA 4MVJP 4CM6A 4KP7A 1WLYA 1A4UA 2JCVA 5K6AC 1U2GA 1QR6A 1LRLA 1P1FA 1X1TA 5DOZA 4YCAA 1T1SA 4BNTA 4LRTB 4TWRA 1YVEI 2J8ZA 1ZH8A 3H8VA 1YB5A 3CPSA 3PPIA 4YACA 5B4TA 1B3BA 3M1AA 4RPLA 4AG3A 1NM5A 3SBOA 3F3SA 4P22A 4MVJI 4WLEA 4OQYA 3V2GA 3F4BA 3NT2A 3R1IA 1U3WA 1HDXA 3CXRA 1GEEA 2QZ9A 2RIRA 4KUEA 2UUOA 2QIOA 5KKCA 4FGSA 4I5EA 2VUTA 4HKTA 1YONA 4O6VA 2HKIA 4LGVA 4NBRA 4YBZA 5LDGA 4E5MA 1VSVA 1SC6A 2CY0A 4R16A 3DB2A 4DLBA 2PZJA 2IDZA 3JQ6A 5HS4A 4IY1A 3GHHA 4B4UA 4U0JA 3V2UA 2WDZA 4D3SA 3RCBA 2O50A 1DRVA 2GSDA 2NADA 1OC2A 4CV2A 3PHLA 4OXNA 3Q0EA 1CQIA 3ZW8A 5U4QA 5A03A 5L3ZA 4TKLA 5CP8A 4J49A 3TOZA 3NX4A 3AM5A 4JBHA 3WGQA 1V9LA 1ZUD1 4BKOA 3KRTA 1Q2XA 3RBXA 2VZ0A 4B4VA 2D5AA 2VTEA 1F06A 1N92A 3WB9A 1EVZA 1XELA 4IMRA 3A1NA 5TX7A 1KVQA 3PZBA 1YOVB 2P9EA 5IXSA 1B2LA 4RVFA 4IGEA 4GGPA 3MJSA 3DTYA 2YZ7A 1HDYA 1UAYA 3ZGYA 3ETEA 3GY0A 4GX2A 2Z1NA 3MWEB 1RWBA 1M76A 2PD6A 3BXXA 4YJGB 4Q39A 4RLSA 4CQMB 2QRKA 1YS4A 1YOVA 5ITVA 1M2WA 3P19A 3AUSA 3GVCA 1LSJA 3UHAA 3KV3O 3QIVA 5EINA 4HADA 4ND5A 1GV0A 3QVOA 4J9VA 4CMIA 3UF0A 1E6EA 1R16A 4LCJA 1LSOA 4RO0A 5BSFA 2EW2A 3PXXA 4NJOA 1PS9A 4OOEA 1C1DB 4QSMA 2DPGA 4BO1A 1V3UA 4RZHA 4BMVA 2DAPA 3AOGA 4ZICA 4J16A 1SCUA 4DMLA 1BMDA 3OIGA 4XR4A 5DOVA 6ADHA 4E2ZA 3RASA 3PIIA 4JP3A 4YA6A 4ZQEA 3GG9A 4J6FA 2TMGA 5KIAA 4E30A 3WFIA 3DAPA 3DZHA 4J1NA 3ORFA 2VHVA 2I6TA 4GWGA 4N7RA 3JQFC 2Y67A 3T4EA 3DXFA 3MEQA 1SMKA 3JQDA 1J4AA 5C7LO 1E3EA 4O1MA 2NVUA 2DBQA 4Q3DA 1TXGA 5H81A 4IXTA 3E5MA 1PWXA 3AUUA 1PL7A 4ALMA 1YB4A 4B8ZA 2OHXA 3PRJA 2IZ0A 2CZCA 5HRUA 2C54A 2DLDA 2A9FA 2VT3A 3O4RA 1DLJA 3DQPA 4D42A 3H5AA 3BIOA 2NU7A 1XYGA 3UVEA 3LQFA 2FY8A 2DBRA 2NVUB 1BTOA 3RUHA 3OSUA 4E2WA 1UXGA 5DBGA 3B70A 2BI7A 4MVJH 3UCXA 3WGZA 3WBBA 1EEHA 4ND3A 1GCOA 5L4LA 1L1FA 4FIZA 4Z0PA 1PJCA 3I1JA 3S8MA 4FFPA 3ABIA 1GY8A 2I5PO 4UVIA 5A04A 1DHTA 3EAGA 3KZVA 4GBJA 1NR1A 1WAMA 4L9RA 3FNEA 3EMKA 5IN5A 5G4KB 4YXFA 4R68A 1NX6A 3V5NA 2C07A 3SC4A 2D5CA 3T7CA 4XX0A 3F1KA 4FBGA 1GUZA 3KYBA 2FN7A 4OMUA 4RF2A 4WLVA 5IG2A 5LDHA 3K9QO 1I0ZA 3BAZA 1P1IA 3PGXA 1QKIA 4CLOA 2X9NA 2H5LA 4CODB 1C0IA 1BXKA 3KEQA 4BVAA 3GFGA 4OKIA 4BO7A 3ZNNA 5H83A 5JCJA 2GYYA 4D3FA 4ESOA 1C14A 1JTVA 1R37A 2OZPA 1ADBA 1BHSA 3NT5A 4ZVVA 3WYEA 5C3MA 1E5QA 1K5HA 4HNGA 5DDIP 4YRBA 4EEXA 3PHIA 3WQSB 1A7AA 2BFMA 3EVTA 4D44A 2VHZA 2DUUA 1P1RA 2VOEA 3RUFA 4J4TA 4UULA 1NXQA 1Y9EA 2JCXA 1RJWA 1R0LA 2UAGA 1C0KA 4KWHA 1M67A 5JCJD 4W99A 4MVJG 4Z9FA 2PGJA 4JX8A 3UN1A 3OA0A 2C7GA 3TZKA 3ZWVA 4BL5A 2J3JA 4GX0A 2I9PA 2YV2A 1JLLA 4E6PA 4B7CA 4YJHA 2JFFA 4J90A 1E7WA 1ZEJA 3L4BC 3D0OA 2Y93A 3WLFA 4DREA 2VTDA 1U3UA 1LBEA 1T26A 4CMEC 5B12A 3K8ZA 5TQVA 3PLRA 3JQAA 4IM7A 1PJSA 2EKPA 4Z0TA 1PGQA 4BNYA 2YQ5A 2O2YA 2WE8A 4BIIA 2EGHA 3Q3CA 1H2BA 4E21A 5T8KA 1LSUA 2PNFA 2GERA 2Y99A 4H15A 3INGA 4JIGA 5AXAA 3AM3A 1ZSYA 3JTMA 5TLSA 3JYOA 5KOIA 2AE2A 3W6ZA 1I2CA 3ADPA 4NU5A 5A1TA 3WWYA 1LI4A 1B8VA 4RJTA 2AE1A 2I99A 2EERA 2J5KA 3LC2O 4BOYA 3OQ1A 2GN4A 3OJOA 5BSHA 5EMHA 4YJFB 1PZEA 1SB9A 4K6FA 4XQ9A 3S55A 3PP8A 1P1JA 1Q7GA 4ZRNA 2G5CA 2YY7A 1GZ3A 4WK6A 4HY3A 1G0OA 1HDCA 4CV0A 2FR0A 4F6CA 5AYVA 3VZPA 1E7QA 4HX5A 4WJZA 4AJPA 3RKRA 3IAHA 1C0PA 2O3SA 4R54A 1I3KA 1I8TA 2QW8A 4HWKA 1GZ6A 3OEWA 5IZCC 2GDZA 3OETA 3N58A 3ON5A 1DFGA 4EZBA 4KUHA 4L76A 2VUSA 1ZSNA 2HQ1A 3RC1A 4MVJF 1FDVA 2Y1EA 4WUVA 1WP4A 2X8LA 4WKGA 5COAA 4Z6KA 1D1TA 1EDOA 1Q0QA 3B1KA 1ADFA 5AXDA 1IOLA 3KETA 3GN1A 1HF3A 5A3JA 2POQX 2QHXA 1KBZA 4JCOA 5JO9A 2CFCA 2FZWA 4XYBA 4HBGA 4CV3A 3ZV5A 4YDRA 4AJNA 2VWQA 3KUXA 4N5NA 3H6KA 3A4VA 2VRCA 4TMFA 2PD3A 4Y9DA 3QVTA 5JMWA 3QWIA 4W9NA 3FPLA 3AFNA 3CE6A 4GX5A 3A9WA 1CEQA 3DBLB 3NRCA 3QVWA 1R12A 4I5GA 1EBUA 3KSDO 4NMHA 4BNHA 2P5YA 1EE2A 1U3TA 2OMEA 4GPD1 1T2DA 1ARZA 4NFYA 4R01A 5G0UA 4XA8A 1RYEA 1V8BA 2IXBA 3KXDA 3FN4A 2FOIA 4IJWA 1IL0A 1N7GA 4NIMA 3QWAA 1HETA 2ZQYA 4ZHSA 3HDJA 2X5JO 2A92A 2CDCA 3ZV3A 3RC9A 2HRZA 3HQ4O 1E77A 5KJ6A 1F8FA 1UAGA 3CINA 1JQBA 4XGKA 4D45A 2QYTA 3D64A 4YAJA 1T2EA 4XB2A 4B7XA 2C5EA 3JQ7B 3LT0A 5DZSA 1XWFA 1UDBA 3WLEA 1W73A 2ZTVA 4ND1A 2Q46A 4EGFA 1PZGA 4OSOA 1XA0A 1ONOA 1ISJA 1ADGA 2HJRA 1NFQA 2VWPA 1G1AA 4Z9XA 1N9GA 4E12A 2OBNA 5HWSA 5B1YA 2DTDA 1ZO8A 2Z1MA 4NQZA 4N5LA 1P44A 2JHGA 3JYNA 1F0YA 4AJLA 4OL9A 4ZRMA 1Y1PA 2EEZA 3GG2A 3AU8A 3V1UA 4YAKA 4GMFA 2QG4A 1MGOA 3E9QA 1ZK3A 3IP3A 3PTZA 2VZ9A 4FS3A 4Q3BA 1ISIA 5A3VA 2P91A 4CMCA 1BWSA 4DGSA 4IBOA 4LISA 4IXWA 4KOAA 3TPCA 1ZKMA 3C1OA 4DC0A 2ET6A 3F4LA 4P8RA 4RF3A 2YFQA 3WX0A 4WOJA 3KLMX 3R0IA 3UCFA 3MWDB 5A4DA 1ENZA 4ALLA 4PLYA 3ITKA 4O63O 1HYGA 3V1TC 2EGGA 2BH9A 3VZSA 1KEVA 5TGDA 4IZHA 1P1KA 2ZIZA 4BO5A 3TZHA 1DRWA 2D2IA 4RPKA 2QYSA 1U8FO 2AEFA 4ZQGA 1LTHR 4CV1A 2CDBA 4DXHA 5IZ4A 3RFTA 4YWJA 1NHWA 1E5LA 1X13A 1C1DA 3LLSA 3OP4A 4AJ1A 4ZGWA 1CYDA 2YW9A 4W4TA 5GY7A 4BNXA 4Z3KA 3OJ0A 5TSDA 1T2FA 3I83A 2GNAA 1NAIA 1QP8A 1LDBA 5T6BA 3RC7A 1ENOA 3QWBA 1JW9B 2ZB7A 3GNTA 3F1LA 3EZYA 3MJ4A 4NK5A 4B4WA 2VHXA 1VRWA 2CF6A 4J0EA 3TZCA 3AUTA 2O3TA 4D43A 3U4IA 4OQZA 1PJBA 4RLHA 2X0NA 3KYCB 5AXBA 2X9VA 5A05A 2J3HA 4GVXA 4MKRA 2Q3EA 1B15A 4PRKA 5G0SA 1O95A 1KETA 2EF1A 3C3XA 2C82A 2Y1CA 3T4XA 4P4LA 4ILKA 4TZTA 3ZWOA 3GEGA 4NFSA 4E3ZA 3KVOA 1Z75A 2PR2A 1SZJG 3KHUA 3HDYA 1XEAA 2IYOA 3ZN2A 1LEHA 4M54A 1KC1A 1ZEMA 3JQFA 1PJQA 1PJLA 5EIOA 3QVXA 1O8CA 4EUHA 3VVCA 1HSOA 4CM7A 1JVBA 5KJEA 1YQDA 2W2KA 4AVYA 3OBBA 3PDUA 1GPJA 3NAQA 1E3LA 2PZKA 3ZWXA 3MJVA 2I67A 3DZJA 4IDDA 2FPIA 4AJ4A 4KDFA 5I7SA 4WLNA 4KDEA 1H6DA 4HFJA 3E03A 3C24A 3IP1A 4I9HA 4BKRA 1EFKA 5L45A 4TRMA 3RJ5A 1RM3A 1E3SA 1A9ZA 3U49A 1JN0A 2R00A 2X5KO 1ZCJA 3NDJA 1IHXA 1V3VA 1VKNA 3KOUA 3OH8A 4LRSB 1P9LA 5EJ2A 2GRAA 4EDFA 1BGVA 1IULA 3GN2A 4OSPA 4IMPA 3RQSA 3TF5A 3RUCA 4BV8A 2EKLA 3QHAA 1BVRA 1H6CA 1AE1A 1GAEO 4NR0A 1K3TA 5JY6A 3C8MA 4IS2A 4II3A 3FRJA 4G5HA 5JDIA 3WGYA 1U4SA 1VL0A 3V2HA 4XDYA 4FSHA 1GEGA 2FR1A 1GYRA 4JROA 4X54A 2J3IA 4NJMA 3SJUA 3DEYX 4DL9A 3I5MA 4XCVA 1HKUA 3VH3A 1VJ0A 4WLFA 4OXKA 3GVPA 3KSZO 2AMFA 5I9LA 3UICA 3JD1A 2NTNA 3AY6A 3HDHA 2NVBA 2I65A 5DCYA 2OORA 1K2WA 3ADOA 4H16A 2BD0A 3G1UA 4CQMD 2YDYA 3AFMA 4DPMA 4GX1A 5B4UA 4GI2A 3D4OA 3JV7A 4QXMA 2NU6A 1YDEA 3KB6A 1F12A 4HP8A 3T7EA 4E13A 3NTQA 5FEUA 4OJNA 1DSSG 4ALNA 4K1LA 2RCYA 3ZI0A 2RHCA 1Y8QA 5I8WA 3TWOA 3E6AA 2W2LD 5CEFA 3OA2A 3OJLA 4LN1A 4ALIA 2DTXA 4LK3A 1KEPA 4QTZA 1RM5A 3DBHB 1DOHA 3EZLA 4DRYA 5TIIA 3ZU5A 1N5DA 3I52A 4L8VA 1O89A 3PFFA 3I9KA 3JD3A 4XRGA 4HFMA 5TRTA 3H4VA 3OQ6A 3OQBA 3U9LA 5K9ZA 3QJ5A 3OECA 4DA9A 4RF4A 3SX2A 2F00A 1UDCA 3GMSA 3UKOA 1Y8QB 2BGKA 3C1AA 3R6DA 4EEZA 3PHGA 1NQAO 1CJCA 1XQ1A 1V0JA 2EG9A 1PS0A 3W6UA 3IUSA 1PJ4A 4CMEA 1HL3A 1P45A 4PLGA 2GGSA 3RBZA 4FDAA 2AQHA 1UJMA 3NV9A 1AN9A 2X0IA 4I8XA 4NDNE 2YQ4A 1SEVA 4PLPA 1N9GB 1IPEA 1C0LA 4W7HA 2EP5A 1Z6ZA 4Y6PA 3AUAA 3ZNOA 1P0CA 1KVRA 4J1SA 4AJKA 2C59A 3MJCA 4M87A 4IQ8A 3WYBA 3JQ8A 3RBVA 5CAEA 5IF3A 3PDJA 4YJHB 4M86A 3QWHA 1YDWA 5CG2A 1WMAA 4E5PA 2Z95A 1PQUA 1QV6A 2X22A 2AW5A 2GN9A 2EP7A 1KVUA 3WQQA 3ZW9A 1I2ZA 4PVCA 1GADO 1SAYA 2A35A 5JNLA 4UVHA 3TQHA 2NV6A 5G0TA 3JQBA 3M2PA 1WXDA 3WSVA 2GF2A 3IOYA 4DVJA 1TEHA 2HSDA 1DDOA 1KERA 1EQ2A 1ZJYA 4KWIA 1MX3A 4MOWA 3DMTA 2YV1A 2C5AA 3WYCA 1VJ1A 5JAMA 3O8QB 1IZ9A 5BSGA 2D4AA 1WDLA 4DLLA 2YUTA 3ANNA 3L77A 3NGXA 5GMOA 2J5RA 1NFRA 3D3WB 4NZ9A 3GFBA 3ENKA 4YAIA 4A2CA 4DTIA 1EZ4A 5DP1A 3WJAA 4PRLA 7MDHA 2PTGA 2ZCVA 4YJFA 5TF4A 3H2ZA 5I9NA 3EVNA 4J0FA 7ADHA 4OO3A 2Z5LA 1EFLA 1LDNA 3L9XA 5C7IO 4S3MA 1EVIA 1UZNA 2R00C 3LF2A 4PG5A 3BA1A 3PIDA 3WFJA 3VHRA 4CQLB 1H0KA 2E82A 3CZMA 4UUMA 1B3RA 1QLJA 2QQ5A 3ICPA 4JK3A 4WLOA 1HZJA 3ZNPA 5L95A 1EK5A 2X4GA 3GF4A 1U9JA 3HE3A 1H6AA 4A10A 4M55A 5IJZA 3SVTA 4R9SA 1PJTA 4Z0HO 3ZWYA 2W98A 3JD0A 5G0VA 1DXYA 1U2DA 4AICA 1AXEA 2V6BA 3JD2A 5GZ3A 3GA0A 2VCYA 3SEFA 3W4JA 1AXGA 4YJGA 3U09A 4XDZA 4FJ1A 3IS3A 1HZZA 3VH1A 4YVFA 4HFNA 3BZUA 2V6FA 3V1YA 1NQ5A 2WMDA 1U7HA 1FJHA 4AL4A 3GGOA 2BI8A 1W0CA 2DQ4A 3O26A 4WEQA 5FI3A 1HSZA 3PJDA 2R6JA 1DPGA 3KBOA 4EBFA 3COSA 2BRUA 3DZGA 1WWKA 2DBVO 3QE3A 4A26A 5KVQA 3PHHA 3F46A 2JD0A 1D1SA 5TS3A 3H9GA 1DC5A 5GZ1A 3DZFA 4LVUA 3NDIA 3FR8A 1OI7A 4PLFA 5DULA 4CLEA 1ISGA 4OYRA 4RVSA 1FXSA 4NNJA 3WR5A 3SLKA 2X58A 1L7DA 4CMHA 3O9ZA 2ZB4A 4TROA 1BDBA 5ICSA 1LUAA 1UP7A 1X7GA 4U0KA 3VH4A 1IE3A 3BTOA 1X15A 2NLOA 4ALJA 5U1PA 2O48X 3DBRA 1EUCA 2PK3A 3HDQA 4BV9A 5JDCA 3VPGA 1I32A 1XCBA 2BFOA 1UZLA 1ZSVA 2CVQA 2FP4A 4CLOB 2VOJA 1MFPA 1NPDA 1ZMTA 2HK9A 1LLUA 2DC1A 3HB4X 4AFNA 4UEOA 4JGBA 3EGOA 2RH4A 3I6QA 1OMOA 4OOFA 1VL8A 2ZJ0A 4WOKA 1ZK1A 5I9MA 3I9LA 3ZCXA 3U62A 3ANMA 3QA9A 2CD9A 2HAEA 1ZMOA 4QFDA 3W4KA 5KJCA 1ZBQA 1KY5A 4NBWA 3BHMA 4LW8A 2B4QA 4JBGA 2EKQA 2IRWA 1Y81A 2JCYA 2O23A 2J3KA 1Z45A 1R15A 2IXAA 2OBYA 3DBHA 2B35A 1LQUA 4OXYA 2GLXA 4R5HA 3JQBC 5KKAA 4XQGA 3HN2A 1GDHA 3FBTA 4I9NA 4F46A 1Y6JA 1NASA 5ILOA 4FQ8A 2XAAA 5A5FA 1KYQA 3H5RA 3BMQA 4PG8A 2OO5A 3HWRA 4K9DA 4CR8A 3JCZA 1KVSA 2JD1A 4J91A 4ZU3A 1BDMA 3P5SA 4BO8A 3NYWA 1XU9A 5IAAA 1RYDA 3DO5A 4IDGA 4QUKA 4H3VA 4XQCA 3N74A 1AUPA 1ZVMA 1ZXLA 1H2HA 4YPOA 4EJ0A 1QYWA 3GH3A 3W4IA 1UR5A 4KQXA 1GUYA 5JC8A 3KYDB 3K5PA 3W8FA 1MLDA 3N7UA 4DPKA 4XB1A 1OFGA 3IDSA 2PH3A 4RCVA 4RQUA 4BQPA 4NBVA 3A14A 4W7IA 3A28A 2VUUA 4MO2A 4EUEA 3JYLA 4PG6A 4IIUA 1LDYA 3MJTA 1XG5A 2EV9A 2IEBA 4CLRB 5JYEA 1UP4A 4A03A 2FHSA 4GSLA 3L6DA 1V3TA 2VYVD 4RVHA 4XYEA 3G0OA 2BKAA 3U4DA 5F5NA 1B16A 3AI1A 4OH1A 4BB5A 4PG4A 3GT0A 3E18A 1IY8A 4L74A 3Q11A 3OHSX 4YQYA 3A06A 2ZATA 2WYWA 1JAXA 2V6GA 3C7AA 3ROQA 1ONPA 4ZQBA 2R2GA 1B7GO 2W8ZA 4CM8A 5L9AA 4BO9A 1C1XB 3DR3A 3F6YA 2VWGA 2YV3A 2FR8A 1GYQA 3GOHA 1VE9A 4NH4A 1Y8RB 5BNFA 2UVDA 3GK3A 1QLHA 3F9IA 4NHEA 4WLUA 8LDHA 1QG6A 2VYND 1PTJA 1WNTA 5KNLA 3AW9A 3HG7A 3ZWBA 3WGTA 1XU7A 2EJWA 2Y0EA 4GKBA 2HRBA 1Z82A 4CL3A 4EYEA 4P4GA 1YBVA 4UUOA 4BGIA 2FWMX 2X1HA 2Q1SA 3IKVA 4JQCA 1U1IA 1ZK4A 2GO1A 3BTUA 4AJHA 2ZTMA 2F1KA 1TT5A 3FF4A 4BNJA 1VC2A 1BXGB 1XKQA 1I01A 2O3QA 3NDRA 1EBFA 3P7MA 3X2EA 2YHIB 1KC3A 4FJ0A 4CPDA 1DBVO 1NPYA 1WDKA 4E5YA 4LVCA 5T64A 2EIHA 4XIYA 2NWQA 5I7VA 3DFUA 2X5OA 3K92A 2RH8A 4MIYA 1A4IA 3LDHA 3HN7A 5ITWA 4CMAA 1D7OA 3KM0A 3VH2A 3L6EA 3WQRA 3TOXA 2PY6A 3QV1A 5TT1A 2ZYAA 1MXFA 4EW6A 5HM8A 2PZMA 3ZU2A 1BSVA 4E2YA 4GMGA 4DLAA 3WBFA 1A72A 2GPTA 3WG9A 4YT8A 3VTFA 2YYYA 3TL3A 1M6HA 1Q7BA 3CSDA 2AA3A 3TFQA 1Z74A 1I10A 1SEPA 1Y5RA 3JQCA 1A71A 2PFGA 4U7WA 5GZ6A 3L4BA 4BB6A 1WPQA 2A94A 4MIEA 3BYZA 4WNIA 2Q4BA 3BMCA 3RROA 4Q3EA 3ONFA 4D0RA 3IMFA 3WSWA 1U8XX 4QT0A 1X7DA 2VRCD 1E0DA 1VI2A 4YEDA 3Q6IA 4DBVO 5IXYA 5DCWA 3DFZA 4TSKA 3TFOA 2VQ3A 1IUKA 2FRDA 2C20A 3H65A 5IDWA 4IUYA 4A5OA 4RZIA 3RKUA 4ZD6A 1NNUA 2G82A 4MKZA 1NP3A 5TJ9A 4BNIA 4BUCA 4TKMA 2NU8A 4MP3A 5KJ1A 2Q4EA 4TQGA 5ICMA 5IZCA 3LT2A 1H5QA 1V35A 2Q2VA 4UEKA 1NQTA 3D3WA 4Q3NA 3RUIA 2VYNA 4GLLA 3UUWA 2D1YA 1KY4A 1UDAA 2UYYA 4A0SA 4AJ2A 3R3JA 1DIGA 4UVGA 4E0BA 4DQUA 2HMUA 1R4MA 2CVOA 2OP1A 4KUGA 3BHJA 4IDBA 2I3AA 3DL2A 4GVLA 4Y98A 4RQTA 5CDUA 5L7TA 1Y5MA 2FPPA 1E1KA 3R3SA 1A5ZA 3I23A 3TZQA 1PEDA 2Q50A 5DCUA 3IQDB 3QLJA 2B69A 4KQWA 4GSKA 1B8UA 3DC2A 3KTDA 2CMDA 4WE3A 2NSDA 5T5QA 2NM0A 4CL8A 4FOSA 1X0XA 1Z7BA 2RBEA 1JWBB 1EUZA 3WMXA 2CNBA 1WDMA 4UAGA 2DM6A 4CMIB 2DKNA 3OJFA 3HFSA 1E7YA 2PD4A 3I4FA 5IDYA 3PWKA 3GZNB 1HE4A 3FPCA 4C7KA 4EJ6A 4U8GA 1BVUA 1SOWA 2Y68A 4I08A 4BO6A 1YH3A 5IDQA 9LDTA 3PJFA 4MVJM 1DJQA 2JAHA 2XF8A 4B79A 4JJIA 1WMBA 2GN6A 2E48A 3ANLA 3GDFA 4W9NC 4FJ2A 1BXZA 1EE9A 3BMOB 1DFIA 3WGHA 4EJMA 3I6IA 1ZJZA 3BMNB 3W1VA 1S6YA 3DAGA 4A73A 3B1JA 4FR5A 1K6XA 1O5IA 2ZKLA 1EQUA 4IDAA 2CUKA 4CMJA 1P3DA 1PR9A 3RJ9A 4J1TA 3G3EA 4LMRA 5F3RA 3DOJA 3OMLA 4WECA 5KVCA 1R6DA 2B83A 3F47A 1I33A 3PVZA 1EVYA 2O3JA 5L7YA 4AJJA 4PLZA 3WJ7A 4QFCA 1HWYA 5JCXA 4J7XA 1KVTA 4NU6A 1JAYA 3PI7A 3DDNA 3MZ0A 1TLTA 4L4XA 2Q49A 3RU7A 3GDGA 2NQTA 5J23A 1ENPA 5L4NA 1U4OA 3PJEA 2WEKA 3AJRA 2EHDA 1I3NA 5MDHA 4XWYA 4BKUA 4R41A 2IZ1A 3JYQA 4G81A 1CRWG 1Y8RA 3WMWA 5L40A 4LSMA 4XR9A 1VSUA 4D46A 1DAOA 3JQ9C 2VN8A 3NTOA 1NFFA 4IPTA 1XGKA 1YE3A 3HFGA 1YQXA 4QO8A 2WJPA 1KOLA 4Q3AA 3JQEA 2GN8A 4FN4A 3VC7A 4QO7A 2AXQA 1HTBA 2E37A 5ENVA 1HEUA 4BKQA 3DHNA 4JJFA 4B4OA 4YT4A 1YGYA 2W2LA 1AHHA 2X7HA 1GD1O 5CPFA 3FTPA 1FDSA 2ZB8A 4Y6RA 1UXKA 2D59A 5G4KA 4BKPA 2EWMA 1UUFA 3C85A 2O7SA 3JQ7A 1YL6A 1W8DA 5DF1A 3TDKA 2AEMA 1UXJA 2O7QA 4MKXA 4OAQA 2GR9A 2IE0A 1E1LA 1DEHA 1F17A 5JS6A 2DFDA 4GLOA 5CDGA 3DHYA 4I9UA 1XDWA 3RVDA 2E49A 2HMVA 2WD8A 4XIJA 4N5MA 3MTGA 2Y1GA 4IGFA 1MB4A 4IDFA 5ES3A 3FTNA 5BSEA 1P1HA 1LLQA 3M6IA 3OJEA 1NTOA 4CM9A 4DIFA 1E3IA 1I24A 4XYLA 3D4PA 3ICCA 4F45A 2GZ3A 4BGVA 1X7HA 4WCFA 1A9YA 2EXXA 5ER9A 3ZWWA 1G0NA 4BNMA 3PYLA 2FMUA 3RI3A 3GAFA 4CMBA 1HDGO 1LNQA 2BGLA 1PX0A 1QYVA 1HYHA 1IHYA 3PK0A 3KO8A 3WTBA 1YJQA 4NJMB 3VPXA 4AJOA 5LCXA 4FOOA 4CUZA 4BGEA 4XQEA 5K0ZA 2DU8A 1E3WA 1QV7A 4XGIA 5JYDA 2JD2A 2O3RA 4L4SA 3PZRA 3WIEA 3BMCB 4Y8VA 5TC4A 4DMMA 3JD4A 4JJGA 3ZHBA 1O9BA 4II2A 3IL2A 1ZK0A 5I7FA 5CDYA 4GAEA 1PR3A 2P9GA 1XLTA 3FHLA 2VNAA 2JL1A 1YXMA 3G1TA 4GH5A 5IFLA 1N2SA 3DBVO 4FCCA 3L4SO 1UZMA 4XEHA 1R4NB 1PWZA 3ST7A 4KMSA 2OUIA 3EC7A 2H1SA 3KEOA 1LA2A 4DPLA 2G17A 1OAAA 3FWZA 4R1NA 3DZIA 4HNHA 1LSSA 1ID1A 1GQYA 3LC1O 1NWHA 3I9NA 3KYDA 2AQ8A 1Y7TA 1ISHA 4IDCA 2VHYA 4E5NA 4Z9YA 1BW9B 1T2AA 3PJGA 4P38A 3AU9A 3ZDFA 4Y67A 1HLDA 4PLHA 3QP9A 4BNVA 3KSUA 1ZZEA 5CFZA 3B6ZA 4PZDA 4U6SA 3PFWO 1MG5A 2FZEA 1LU9A 3F5QA 2G1UA 4J7UA 3NGLA 3OEYA 4YT2A 2VT2A 3LT4A 3MTJA 4CLDA 1EMDA 1I36A 2C2XA 3WNVA 1BXGA 2EJVA 3BTVA 3ITDA 4FPXA 5CHEA 2Q1TA 4J1QA 1OOEA 5BQFA 1T4BA 1XIVA 2BFAA 3VDRA 2IODA 1FMCA 4J9UE 5EN4A 3E48A 1QRRA 4HXYA 4CM4B 4IIVA 3CH6A 3H9QA 4RDHA 2HCTA 1GQ2A 2C2YA 3GEDA 3GZNA 4DWVA 1ZNQO 3QRWA 2Y66A 2P4HX 4DQXA 2IZZA 3UFXA 2NTJA 4D0SA 1NVTA 1SPXA 3PLNA 2DVMA 4OGWA 4R9RA 3IC5A 4FFMA 1Q1NA 1MUUA 3DOOA 3QW2A 3FD8A 3CMMA 1U5CA 2GZ2A 4OHUA 1W4ZA 5ER6A 4J4BA 5T67A 3O8QA 2GD1O 4BNKA 3RD5A 1LX6A 3OICA 3GRKA 3B1FA 3GUYA 4R1TA 2J6IA 2P9CA 1J49A 4JNKA 4MJLA 3RU9A 3SC6A 3DBLA 1OZAA 3GR6A 4GQAA 4Q9NA 3E9MA 4FFLA 1J6UA 1ISMA 1LXCA 1HE3A 2P2SA 1DJNA 1PGOA 1VLLA 4AJEA 2IEDA 4FC7A 3ULKA 2I3GA 1ZXBA 2AHRA 4J2OA 4MDHA 3UCEA 3LZ6A 3CIFA 1X1EA 2GZ1A 4R3NA 2CDAA 3NKLA 4FC6A 3FNHA 2AEJA 4S1VA 4L4RA 5DBIA 1TT7A 4ZQHA 1DIHA 3NUGA 4Z3DA 2CF5A 3RUEA 4BNFA 1E7RA 4MIOA 1MC4A 4JBIA 3CTMA 4PVDA 4R51A 1IB6A 4GL4A 4QECA 4TRRA 1RM0A 2DT5A 5FI5A 1E1NA 1NAHA 3H3JA 3LVFO 3NJ8A 4XJSA 4EUFA 5ADHA 4YR9A 2D8AA 1WZIA 1LJ8A 4WEOA 1YBMA 2JKVA 3HB5X 3Q2KA 4HV4A 5B4VA 1CDOA 1MP0A 4BO4A 2G0TA 2SCUA 1XSEA 1PZHA 3HNPA 4CM1A 1PIWA 2ZQZA 4G65A 4IZIA 5EERA 1O94A 3FBGA 2ZK7A 4PZCA 3AM4A 5C37A 2EW8A 2Q99A 3F5SA 4B3HA 4W82A 1ZK2A 3ZWMA 3RC2A 1AHIA 3CKYA 5FFFA 4D7AA 3UGKA 3LF1A 5A9SA 1D3AA 2PGLA 2RAFA 1TB4A 1I2BA 1EUDA 1L7EA 1JKJA 3G49A 3NTRA 4KZPA 1BRMA 4PZEA 2X9GA 1AGNA 3GC6A 3GPDG 4IJKA 3RFVA 3L6OO 3EW7A 1PQWA 4PCVA 3Q9NA 2HLPA 1NQOA 3GUCA 3JQAD 4J4HA 3GZ4A 4XRRA 4CR7A 3JQ8B 4PLVA 3C7CB 2GASA 3U3XA 2O4CA 4MVJD 1DFHA 5U9CA 3AK4A 3VOSA 3UW3A 4UREA 3ZH2A 2XXJA 2ZCUA 3GDOA 4EITA 4CUJA 3JQGB 3K6JA 3FR7A 5JXWA 1MV8A 4OM8A 4BGUA 3WICA 1MC5A 4TVBA 6LDHA 4J43A 1SNYA 3AOEC 2X0RA 3LYLA 4R1SA 2QZZA 1F8GA 3GPIA 3E5RA 3IKTA 5F1KA 3I9JA 1R4MB 5AOVA 2HO5A 1Q0HA 3ONDA 4NI5A 1VM6A 2A4KA 1M66A 1NYTA 2ZJ1A 5JY1A 3WGIA 3BMOA 1T2CA 3QSGA 3WXBA 3VAZA 1DIBA 2OXIA 3WOHA 1DC3A 4WGGA 5L4SA 1M75A 3FNFA 1UXIA 5G4LA 1PJ3A 4F6LA 3OIFA 1PL8A 1T25A 1DLIA 3S1LA 2FSSA 3RIHA 3M2TA 4GGOA 2DUWA 5TJHA 1PZFA 3P2YA 3K30A 2DBZA 1YRLA 3SJ7A 4HUJA 4UEJA 2CVZA 1Q7CA 4LMPA 1R0SA 4R5MA 1LDGA 4URFA 4BNUA 4QQRA 1ISFA 1DRUA 4E5KA 4XJTA 5KVVA 2UUPA 2PKRA 4RGBA 1P74A 3Q2IA 3SLGA 3UOGA 4CQLA 4OIMA 3HUDA 5CG1A 2ZTUA 3PQFA 3ZWPA 1VJTA 4RPGA 3U5TA 4FW8A 2B36A 3S2EA 1S7CA 2Y1OA 5KTKA 3DMYA 4BS9A 3ZZNA 1B8PA 2C0CA 4XYGA 2VWHA 3G17A 1BW9A 3ENNA 4BNZA 4N18A 5KVSA 1I5RA 4YQZA 5CEJA 2O4UX 1H94A 1R66A 1NHGA 1EVJA 5TNXA 4CR6A 4PN3A 1KEUA 3S2IA 1P77A 3FI9A 2PLAA 4L73A 4PGFA 3ROPA 1PQPA 4R3WA 1NWCA 2G76A 5LC1A 4E32A 3L0DA 2DPHA 4ZQFA 3PQEA 4O5OA 3VZQA 4DIBA 5C7OO 2C7VA 5T8KC 2HU2A 3GNQA 4FFOA 4K6CA 4NBTA 1FDUA 3WS7A 3K31A 1IYZA 2DFVA 4YJDA 3VPSA 1JU9A 4FFRA 4RPHA 4BNGA 5I8ZA 1CERA 5T57A 3SXPA 5ILGA 4YB8A 3C7DB 1NPTO 4DYVA 4RVGA 2WTBA 1G6KA 5THQA 2BELA 1E92A 5JDCC 4FD3A 1I3LA 1NBOA 5DBFA 2PZLA 1MA0A 3DONA 4AJIA 2YHIA 3HSKA 4M49A 3W8DA 1HDOA 1DB3A 3PYXA 3RWBA 3WIDA 5C5IA 2WM3A 2Y0DA 5DT9A 1RPNA 2VRBA 3ZNQA 1GFSA 3VKUA 5DNAA 3IJPA 3I9MA 3WWZA 4BNWA 1HE5A 1LDEA 2Q1WA 4YT5A 1CWUA 2VYVA 3DTTA 2WWRA 2OP0A 4TRJA 2FPGA 5H82A 1MG0A 4K26A 5JC1A 4BO0A 4E2XA 1XHLA 5A9RA 3TJRA 3PWSA 3ETGA 1H9BA 2RHRA 3GEMA 2X23A 2WE7A 4CM3A 1UP6A 3DAFA 4CJXA 4JXKA 4INAA 3QY9A 3LC7O 1JWAB 1C3VA 5HBRA 3GGPA 4DIOA 1VL6A 5HA5A 1NR7A 3ZWNA 1B0AA 3EY4A 2Q2QA 4M1QA 1MFZA 4E31A 5F1PA 3PGJA 1VPDA 3ASUA 4BO3A 5F1OA 1JVSA 5F5LA 3K2BA 1DAPA 1MXHA 2PV7A 3U0BA 2QRJA 1LDMA 1HRDA 3IUPA 2LDBA 3O03A 5HS6A 1GV1A 1XQ6A 3FWNA 3ZU3A 4WCFC 4B7UA 3HJAA 3AY7A 3PEFA 3MJEA 3E8XA 4K28A 1QMGA 2BF7A 5AQ1A 4O59O 5FYDA 2B37A 2WYVA 2B4RO 4QX6A 3TN7A 5IDXA 3DMTC 2B5VA 4M89A 1PGJA 3GGGA 1ADCA 1E3WB 4OKNA 4YRAA 1N1EA 5A9SB 5CDSA 1FDWA 3P2OA 3E9NA 4CLHA 4WNCA 2NQ8A 1LC0A 3TSCA 2ZB3A 2ZTLA 3Q1LA 1TVEA 2Y05A 1JA9A 5EQDA 5JAIA 3D5QA 3PQDA 3ZWCA 2W4QA 5IN4A 2BLLA 2PWZA 4NK4A 1LLDA 1PL6A 1PU2A 1B26A 5DP2A 3FSRA 5KCZA 1WW8A 4L0QA 1H93A 2NTVA 5FF9A 1M6WA 1N7HA 1T4DA 3NT4A 3U4HA 3B20A 1A7KA 1R4NA 3U4CA 5K6AA 1F14A 3LLVA 3EUWA 5DN9A 3WDSA 3PWZA 4E33A 2YHUA 4DQVA 5CEEA 1VKOA 1T1RA 3JQGA 1U7TA 4RF5A 5JPIA 2YJZA 3TL2A 8ADHA 4YYZA 3C1TA 5JFOA 2XPCA 3LSYA 2GCGA 3VKVA 1DIRA 1B14A 3STHA 2AQKA 3KLPX 5JAZA 4XKJA 1IPFA 1RM4A 2HK8A 3H9JA 4MP6A 3WGGA 2I76A 3E82A 1YJ8A 1GU7A 2V6MA 3ZWAA 4CLXA 4XGNA 3GMDA 4PG7A 3MOIA 4CM8B 3D1LA 3GVHA 3I4CA 1X0VA 2BHLA 3CMCO 4WPGA 1U3VA 4CQMA 4MVJE 2JAPA 1N1GA 2Y1FA 3DZBA 1W6UA 1YQGA 1E1MA 2ILTA 2PH5A 4YAGA 3JQ9A 4JLWA 3ROKA 1SBYA 5EESA 2J5QA 1SB8A 3D4NA 1P31A 2PA3A 4UUPA 4J2HA 5JAQA 2VNSA 1ML3A 1H6BA 1A27A 1GZ4A 3ZHZA 3UXYA 1TT5B 3GAZA 3S2GA 2O3UA 5EL0A 1WVGA 3QWFA 1YB1A 3VDQA 3DHEA 2UV8A 5CDTA 1K6IA 4ZA2A 2Y1DA 4C7JA 4KTVE 3RUDA 4I1IA 3TNLA 1E3JA 1FK8A 1QYCA 4R4JA 3V8BA 5BR7A 4BNLA 4WCDA 5JE8A 1XR3A 1LC3A 4LSWA 2V65A 5B37A 2OOSA 3LU1A 1TI7A 2BGMA 2JFGA 4GKVA 2JFHA 3GVXA 9LDBA 4FFNA 4W6ZA 2BFPA 3GHYA 1E6WA 2H63A 2HMSA 4JP2A 2YFHA 4UVDA 1HYEA 2Q45A 3OIDA 2X0JA 3I9OA 5A9TA 3ZV4A 1KEWA 4TZKA 3ONEA 1PJ2A 2OL4A 2B0JA 1I3MA 3L9WA 1GCUA 5BT9A 3S2FA 4MVJA 3ZHXA 3HZZA 1E7SA 2E6UX 2NACA 3AI2A 4JN6B 4BNNA 4QEDA 1UXHA 4Q3CA 3RFXA 1FDTA 2H9IA 1H9AA 2Q2WA 3TZ6A 1LRJA 3E1KA 3AI3A 5CPBA 3GVIA 2Q1UA 4D41A 2CSUA 2WYUA 3HADA 1SOVA 4LCEA 1P33A 1K0UA 3DBRB 2TMDA 4UUNA 3X2FA 3RUAA 2XXBA 3MCVA 1ZW1A 3AWDA 1GR0A 2PKQO 4IINA 4XD2A 1ULUA 2AG5A 1EK6A 2QX7A 4RDIA 3VPFA 1WZEA 4MINA 4U6QA 4DBZA 4PIVA 4RVUA 1CQJA 3INTA 5EQFA 1D4FA 4PFJA 2JHFA 4I5DA 2WD7A 5I7EA 1IZ0A 4L75A 4ND2A 4CUKA 4R1UA 1NVMB 4J7CA 5G2OA 4TRNA 1DIAA 2B4TO 1Z7EA 5JO0A 3D7LA 3K73O 2YDXA 5F21A 2ZYDA 3UH1A 4IS3A 4WCFB 1LRKA 4IQ0A 2JJYA 4D79A 2IYPA 1DC4A 4R69A 3L07A 1SO8A 2WD7B 2X86A 3AOEA 3JSAA 2B5WA 3BHIA 4D3DA 1LQTA 1LLCA 4BMSA 1FF9A 3RAJA 5HTOA 2HK7A 1X14A 4B8WA 1PGNA 2BMAA 2X6TA 5A06A 4I5FA 5L51A 4YAEA 4PLTA 3WNQA 1DC6A 2I66A 2HUNA 4A27A 3INRA 4NPCA 3BMQB 3DWFA 3D3EA 4TVOA 1HT0A 3DZKA 2H6EA 1HDRA 4IJVA 3H3FA 4MPDA 1ZFNA 4KTTE 2W90A 2AQIA 2HJSA 4BQRA 4IDEA 1RKXA 3KYCA 2HDHA 4IJUA 3VZRA 4ITUA 5JW6A 4FB5A 1CIVA 2PKQP 1CF2O 1GL3A
chains in the Genus database with same CATH superfamily
1ONNA 2XNKA 3HHPA 4I50B 5JDIC 4G5RA 3ZJYA 3ZE1B 1LWNA 3MAJA 4KRGA 1HE2A 2VZ8A 1QCYA 1FJ2A 3HVUA 5H1YA 1PX2A 2PGDA 3RSCA 4NBUA 4FR2A 4KB5A 3VR4D 4BMYA 2RK6A 1EK0A 2BCEA 1OR8A 3GFOA 3ZVKA 1QTQA 1K3UB 2O2SA 3K94A 2V4ZA 2H92A 3TRFA 1ZQ1A 1CQZA 3FNGA 2OGUA 1RAFA 2P6RA 1I30A 3CRQA 4AWXA 2JGAA 3O6VA 4YALA 4WSOA 2CHFA 4DIUA 1NXSA 1E2BA 2P4QA 2YRWA 2ZBFA 3EVGA 5A5EA 2PWAA 1YI8A 3CUKA 1KIFA 3LT1A 2CL7X 1I0IA 3EF3A 1IM8A 2HMTA 4ZEXA 4WKNA 5C31A 4ACAA 5F7OA 1W88B 4V0LA 4HEJA 4L9SA 3HFJA 5A4JA 3SVZA 3KFXA 4AK9A 4DWOA 4BZZA 3CZRA 3DM5A 1Q0LA 2D2XA 3EYWA 1T24A 3B2EA 5D01A 1U5AA 5JXJA 1MX5A 2OO7A 2C29D 4R31A 1REQB 4A0GA 4D97A 3E15A 1Z0UA 2P2NA 4E4YA 3IVMA 3TRIA 1PV1A 1K6JA 3DF9A 3PVSA 4UVEA 4X1KA 3KWJA 1P5ZB 1HLFA 4N54A 4JJZA 3NASA 2C84A 1X80B 2NVWA 2VLIA 1O8BA 2WNIA 4I4LA 4Q9LA 1KK2A 4Q7LA 1PSDA 3D8RA 5E4JA 4C4OA 1JHZA 1JRLA 3S2SA 5CT9A 4ZIRA 3JQAB 2JGRA 3H2SA 5A02A 1ISPA 2AOUA 1VFPA 1KS2A 3LY5A 1RFGE 3DDWA 3FNQA 4QC2A 5COQA 1AMUA 1ESDA 1S2MA 1DEOA 3AR7A 1ZLXA 4FB4A 4OHVA 4RV9A 2NU9A 1QS0A 4ASUD 2HWYA 4N6OA 1LGYA 1GTMA 1OBFO 3KG2A 2V7BA 4NE2A 4X1IB 3GCZA 1K89A 1ULBA 4XPIB 5D3MA 2GK3A 2J33A 2MMCA 1JKIA 2D3TA 4F3YA 1U6KA 1UF9A 2D0IA 2KS6A 3EK2A 1HOXA 3HR8A 3LD9A 2X41A 4IF6A 4UE2A 4OHWA 5AKHA 1OB2A 3EQ9A 5KYXA 1V6AA 2IW3A 2Z1DA 3FM9A 1HXHA 1SHUX 2Y1XA 2OHFA 3KOZA 4MB6A 3RWOA 4WKPA 2VJKA 3G2IA 3FMFA 3D6UA 3IJRA 5H4GA 1E6UA 1JG4A 2AVNA 1EIWA 4R2IA 5H68A 3K0CC 4EKIA 4Y6OA 2GHIA 3ACBA 2YWCA 3CO0S 4N4AA 4UCWA 2CD7A 3R6LA 5DYNA 2AG0A 1HFEL 4XARA 5HIIA 3E84A 3SI7A 2WAMA 2C7PA 4EG8A 3QMPA 4LJ4A 3MD0A 1NVGA 3AR5A 3EOBI 1KJNA 3ASVA 4XZ3A 3VR1A 5CD9A 2HIHA 2H7CA 2EBFX 3U1TA 5JMPA 5HKOA 4D9CA 3FROA 3MGAA 1M3SA 4HH0A 2J45A 1DKQA 2C4UA 4BMNA 4EUKA 5HZKA 3IV9A 4HQKA 1M5RA 4ZMBA 1QVZA 2O2CA 1GFIA 1QYDA 2CL6X 4I8IA 1RYZA 3DKRA 4ZZIA 4CDGA 2YBEA 4TLLB 4FWBA 4DV1B 2VFAA 3E05A 1ZUNB 5HFJA 3OY7A 2J07A 3STYA 2QMYA 1JZTA 3ZHQA 4KQEA 2EX0A 3F6SA 4K40A 2D2VA 4HH3C 3C6BA 5J9FA 2G4LA 1O9HA 1V8OA 2V4UA 3C97A 5A0FA 2JCVA 1S4MA 2HC9A 4RGQA 2JEZA 4KOEC 3ZIDA 5JNRA 4US2R 4KPGA 2ZWIA 3TW8A 1X1TA 2NO6A 3HKDB 4U63A 5DOZA 4BNTA 4D8YA 1GTSA 4F4UA 3UH0A 3R8FA 2LIVA 1NRIA 1ZH8A 2R4TA 4G23A 1KOFA 4O4JF 1XNHA 2PHZA 4RPLA 5B4TA 5JCPA 4MYHA 2W4IA 2VCEA 2OBFA 1KI6A 3COZA 3HI4A 2AV6A 3BGWA 3KFVA 3V2GA 3P9SA 5HFAA 3ER6A 3DDZX 2BMVA 4IIYA 4M1ZA 2QJWA 1MDFA 2PZEA 2H59A 2D4HA 1FU4A 3EVZA 2ZIWB 2XCOA 1HDXA 3B7PA 4Y2YA 1YZHA 4ZCLA 2DWCA 1M2JA 4BB9A 2CXUA 3NYRA 5K05A 3BREA 1I4WA 3N8HA 5FUQA 3JWEA 4FGSA 1KDTA 1GHTA 1RD4A 3K09C 4MVXA 5K2MA 3SF8B 3PLAE 1T9CA 1ZD9A 1YONA 5LMCA 1OWOA 4NBRA 4YBZA 1KA9H 4WK2B 5D1NA 5LDGA 5BWLA 1N5MA 3JVUA 4XVQA 1SC6A 2OXTA 1LLFA 5IAEA 4C14A 4DLBA 1FXUA 2RGBA 3B9RA 3GRYA 3JQ6A 4MUHA 4MWSA 2D1QA 1UL1X 3F7MA 3KEMA 3NHYA 2ZJFA 4IXMA 3C8ZA 3IPLA 5CX1B 5AKJA 1FVHA 5KREA 4B3SB 2JJ2D 4WZAB 2GSDA 5JSUA 2PRIA 4CV2A 1W5BA 4AS1A 1JI3A 3KELA 1RQNA 1SRQA 5K99A 1KYTA 3X1KA 3DXYA 4XJVA 1JEAA 2EJTA 2XMBA 4D02A 5YASA 5A03A 4MUAA 4ZYLA 1Q17A 1WPXA 4L85A 1W5SA 1ZCBA 2RKWA 3NX4A 3JZFA 5EC8A 2JS7A 1V9LA 3HDTA 4G89A 4KKXB 2AFIB 3WGQA 2CFRA 3KRTA 3PNLA 4EARA 2JKZA 2R5FA 2GKSA 1SK9A 2VZ0A 2V7WA 3D7RA 3KSRA 3QFTA 4IJMA 4Q82A 5AJYA 4CG2A 1XV5A 1CUZA 2WAXA 4Y1RB 5HFNA 3VJMA 1XELA 2GCOB 4D4KA 5TX7A 3A1NA 5K0LA 1OZHA 3BQNB 3IMEA 4HTFA 4N3BA 5KSOA 3FZEA 4GGPA 5FL7D 4M76B 1JAZA 2QPAA 1R0XA 1KK3A 2YZ7A 3NHMA 3MTBA 4IH9A 4X7PA 3SJZA 3ZGYA 3PR3A 4JR1A 4WI1A 1FFHA 2ONCA 3VZBA 2ZE7A 2R7AA 2DJIA 3GY0A 3H2IA 4K7JA 1NXWA 4KN5A 4V2IA 4BFCA 4P7BA 5K3FB 3JWPA 4KIUA 4GX2A 2YHBA 4AIIA 3MWEB 4OFZA 4ATNA 3C6XA 2BKUA 3R5HA 2VBCA 4CL0A 2VDMB 1IAQA 4YJGB 2FFQA 3FPHA 1JTFA 4A9AA 2IBSA 2EFCB 3OLWA 4BCCA 1X7YA 4FYHA 4DLPA 1CUXA 1T0UA 5F2EA 2QRKA 1YS4A 4CCYB 2QLTA 4F72A 1M2WA 1UBNA 1X87A 1T1JA 3M5PA 3P19A 4B6GA 4EJFA 4CEHB 1TADA 3FNRA 2GK7A 1XEWX 3ND6A 4UBOA 4U7FA 1EBBA 1B2RA 2QOEA 4JOBA 4NJEA 4EA9A 2D74A 1ZN2A 1HT1E 2NXEA 3QIVA 3IODA 3U13A 3UHAA 4QVIA 1DQRA 1H22A 3UF0A 5B1EA 1E6EA 4F8EA 1KK0A 4HNAA 1F4PA 1CY4A 1NULA 1PSZA 1I1HA 3HZHA 4OOEA 1K8QA 2NV2B 4QSMA 1SHKA 1QM5A 1V3UA 3W2FA 3LHKA 4TSFD 4E1VA 3AT1A 3J81A 3HEMA 4NXMB 4BMVA 4EF5A 4CCYA 4ZICA 4J16A 1SCUA 4DCVA 3RTEA 1BMDA 7AT1A 1U2GC 1D03A 1TYZA 1WJGA 3QI7A 4ZCIA 1RJ9B 3D3QA 4H77A 2RHGB 4RVOA 4Q9JA 4ZQEA 3GG9A 4J6FA 1YR2A 2TMGA 1ZMBA 4A8TA 3IP7A 4WZBE 5KIAA 2BL4A 4J1NA 1Z0AA 4EI9A 1C9YA 1Z3IX 4OUKX 1EA5A 1JMVA 3ORFA 4V0ME 1WEHA 4QEKA 4XM0A 4QT4A 2Y67A 1T35A 3DXFA 4HWRA 4X94A 4CN8A 4MUEA 2RHOA 1GNRA 1U7PA 4RMGA 1TXGA 4K2HA 3KU4A 4IXTA 3E5MA 3NNDA 1PL7A 3SQLA 2V7TA 2FLVA 1N5RA 4EYOA 1TRHA 2WTNA 2IZ0A 2GNOA 4L7QA 4B17A 4HGZA 3L8GA 2XNDA 3MTIA 1WQ4A 2VT3A 1FL9A 4KPEC 3DQPA 1EXNA 2W0MA 4MQMA 1Y63A 3OZGA 3E3NA 1KP3A 3MRVA 2GAAA 4HL6A 4MQ4A 5DHQA 3A6HA 1OREA 4HVLA 3EMDA 2VP4A 3KXPA 1IVYA 2C4NA 1Z5GA 2AC2A 4UM9B 4H17A 3BQ9A 1UXGA 5EWMB 1DWPA 4UJ3A 3B70A 4MVJH 4MI6A 4WZZA 4IOJA 1WKVA 2BFWA 4QDOA 4KSCA 2CJPA 2DBYA 5L4LA 1L1FA 4CIAA 1IHUA 2IL1A 2XMRA 4JHLA 5C8YF 3IO3A 2XE4A 3OCZA 1XRMA 3ABIA 4FFPA 1GY8A 3PC3A 3S8MA 2I5PO 4UVIA 5D1HA 3IB6A 3MG9A 5M2QA 3EAGA 4GBJA 1NR1A 1THZA 3K35A 4B35A 1QO7A 4Q6BA 1OZGA 4YRMA 1FUIA 3VMFA 1W5FA 1XQYA 1TEZA 4G6ZA 5IN5A 2LCFA 3R7DA 2XRFA 4RFSA 3V5NA 3T3NA 4RH0A 1LTQA 2HRRA 4PXSA 1EKXA 2BBOA 2QD1A 2ZGVA 2ZJAA 4INJA 5F51A 4AMUA 4WA8A 4LHVA 3BL8A 4MV3A 4RF2A 4W5WA 1S3GA 4AXXA 5IG2A 2BR4A 4I6JA 3FCCA 4QGFA 1QKIA 3VU9A 1KHTA 3O2JA 2VJAA 3QPCA 4QQFA 4BQOA 5FL7A 1C0IA 1VBMA 2YXLA 1GPMA 4XH9B 3FDJA 4KFSA 1H3FA 4EY8A 3I1YA 4IHJA 2I0FA 3S3TA 5J2UB 4O4HB 5A7HA 4D3FA 4YV1A 2IPNA 4ESOA 2UZ0A 2OZPA 2ZRQA 1R37A 4ZP1A 4FWTA 4EJ2A 4ZVVA 5C3MA 3TX2A 4RVCA 5DDIP 1K7YA 2FQWA 3A6DA 4KL8S 4EEXA 3MGBA 1H2ZA 4PYRA 4XCXA 4D44A 3K9WA 3KS9A 2VOEA 5K5EA 2KE5A 3ZGVA 3U7FB 1FEZA 4NATA 4UULA 5IUNC 1NXQA 3O94A 4V39A 1T9HA 4INOA 4BVLA 4KWHA 1M67A 4X20A 3A0RB 4HRVA 1PI3A 1Z5WA 3EVBA 2PGJA 2QZPA 1CHDA 4UAUA 2OZEA 2J3JA 2ZIXA 3LKBA 1JLLA 1JIVA 2WLSA 4YMWA 1FA9A 3COVA 3LTEA 3HKCB 3CSUA 4IVNA 1KZ9A 4YJHA 2JFFA 3OE5A 4M7OA 1ZEJA 1PDWA 4DJDC 3EX7C 3QU7A 4QBGB 3SC2B 1RCTE 2F17A 3D0OA 1RRMA 3G7NA 2Y93A 1JSXA 4H4DA 1IN8A 1MZVA 1D6SA 3GT4A 3SX4A 4CHTA 2VTDA 1KZ4A 1LBEA 2NSHA 2YBDA 3HBLA 1T26A 1Y7HA 1O6FA 2IYFA 3FFBA 2NTEA 5B12A 1JA0A 4FQ5A 4O25A 4OUDB 3PLRA 3ILYA 1H5NA 3W6PA 3HLYA 1PGQA 1U31A 3JU3A 2WE8A 3U3OA 4WXEA 4Q48A 1OTHA 1X1QA 3U7IA 1EFRD 1NX9A 2BGJA 2ISSD 2PNFA 1EGMB 2GERA 3FYHA 3AVUA 4Q4JA 2VRNA 4LYJA 5L6LB 4CEJB 1JT2A 3AM3A 3NDBB 1QGUB 3JTMA 1W0KA 1SUWA 1R50A 1MQ8B 5EP4A 2PBLA 3W6ZA 1I2CA 3QBDA 4NU5A 1JQKA 2Z9CA 2ZPAA 3NWEA 4AW9A 3TMKA 1B8VA 1V7QA 2I99A 3HDGA 4U2GA 1Z0KA 4LF7B 3LC2O 4X8HA 4HF7A 2IX9A 1VG1A 3SBEA 3HVKA 4CQNA 2Y71A 2K87A 4BU1A 2X3YA 3OCVA 3UFXB 2MSKA 1G3QA 4FEGA 5EJ6A 2Z5GA 4XCQA 2H4WA 3K20A 3ODGA 3TVTA 3WYBA 3K71B 5F9HA 4XQ9A 3AJAA 5H5JA 3S55A 2Q41A 4YMUA 1KP2A 2BTQA 3ESYA 4RX1A 1RZ3A 3H05A 5EMLA 4QXAA 4WK6A 4ZTUB 4QDUA 3HU5A 1SCDA 3OTHA 3I8OA 3VSAA 2XGJA 1DEXA 1G0OA 3KTAB 1FFBA 3DA8A 5JBQA 5EP3A 3KQHA 5AYVA 4E6EA 1L4BA 2ORED 2GWRA 1C9KA 1J21A 3PCTA 2NPIA 4AJPA 4DBLC 1T4MA 2FQYA 4UBIA 4WD3A 1X3SA 5EMMA 2C61A 3RHFA 5IYZB 1I3KA 4P83A 4HWKA 1ICEA 3UXHA 3OTGA 1ZG3A 3FYCA 4MWCA 1A82A 4NV1A 4EB0A 5B58C 5IZCC 4L76A 2DFKB 2QLLA 5KTPA 1NMXA 2HHHB 4MVJF 1Y6QA 3PUIA 2ATVA 3NBFA 4RDXA 5HK9A 2ZE6A 5KX5F 3MCAA 2WQ7A 2WICA 3NC0C 4M0LA 3SF0A 4I2VA 4F12A 1D1TA 2FQQA 4QBKA 2YS6A 3K9BA 4UHCA 3EQZA 2HWXA 2QZ4A 2W11A 4K88A 5AXDA 4AKSA 1K6EA 1G5HA 1C7QA 3GN1A 1AQIA 1OFVA 2A5FA 4JWTA 3LL7A 4LWZA 1ZH2A 1PR5A 2CFCA 1XALA 2FZWA 3NHLA 4AJNA 3KKQA 2P6OA 2OCYC 3KUXA 4Y2QA 4ZZ1A 3H6KA 4NY1A 1S01A 4CF6A 1C3OA 2GM4A 2PD3A 3AR9A 2I7DA 3OMWA 5DRTA 2QTBA 1G64A 2H5EA 2W6QA 2Q5EA 1CJSA 3P9ZA 4UHDA 5GIPE 4GX5A 3DBLB 4R3UC 1E2IA 3LUCA 3KSDO 3S68A 4BXOA 2WVHA 4B8YA 8GPBA 3N9IA 4DB2A 1U3TA 3OZ7A 3LFUA 5EHIA 3W5DA 1GKUB 2C83A 3AUYA 4GPD1 3SIWA 1WHSA 1UMCB 1R5BA 3GEPA 2QUKA 3LRPA 5FTNA 1DKOA 2IXBA 1G5TA 5ARCA 2XV1A 3G68A 3LGAA 4D8VA 3NHWA 4LV6A 4UUAA 1G8FA 3QWAA 3GUZA 1SC3A 2RBGA 2ZQYA 4NNOA 5AKKA 3WL5A 4ZHSA 1YC5A 1CY6A 2A92A 3ZV3A 3L46A 4HGNA 3ZS9A 2HRZA 3HQ4O 4H9GA 1OAOC 5FIUA 4WERA 3TIIA 4F5WA 1UKZA 2GTHA 3F3KA 5EQJB 5WRFA 3VKHA 3CINA 2XWQA 4HZUB 3IE0A 4JR2A 4XGKA 2XCTB 1KOJA 4K9LA 1H4QA 4D45A 4E2FA 2KBFA 2WU4A 4CZ2A 4XB2A 3HZRA 3JQ7B 4WY5A 4EIWA 1XWFA 4LRWA 1Q77A 2O07A 3NATA 5C32A 5CYPA 4DMUB 4Q0MA 5K0JA 1SY7A 5ED0A 2YWBA 2I8CA 5D51S 1W8IA 4OSOA 3H5TA 1ONOA 1ISJA 3GA5A 2H1FA 4JLSA 1PJ8A 1GA1A 3H2YA 4GI1A 4UEQA 2WU0A 3ROFA 4CVNA 5B3KA 9ATCA 3U7HB 4E09A 3BD9A 4S2UA 2VWPA 1G1AA 3AF1A 4TZ0A 3ZDXB 1Z2PX 1IATA 1NDQA 3DL7A 5HWSA 1MJHA 4D9KA 4EHLA 1DWQA 1ZGAA 2VAXA 4HK4A 1J8YF 5CCDA 1RWPA 3ZCUA 4IOMA 5BYBA 5GIOE 1P44A 3OT4A 1SPBS 5E2AA 1F0YA 1IC6A 2DUMA 3E7DA 1AB5A 1R27A 2JAQA 4GMFA 3V1UA 1EVQA 1ACMA 1ZK3A 3HJCA 4FS3A 1DXQA 1H2RS 3EZ7A 1BWSA 4HUTA 2WZCA 4KQJA 4XOUA 3NYQA 4BV3A 2G71A 2FX3A 4IXWA 1E2NA 4WXRA 4M8LA 2ET6A 3F4LA 4MWEA 4BWYA 3WX0A 1Z7WA 4LXGA 3KLMX 3UCFA 3WKEA 3Q15C 4ESHA 1U3FA 3QFCA 4RY2A 1Q57A 5ALFA 1HC7A 4QELA 2IQIA 1T8UA 1ZI6A 5J4VA 1ZGGA 3JAWA 2JH3A 2EHJA 4BO5A 2ZIZA 3IALA 2Z9DA 3G8YA 1BS1A 2HMYB 1OX4B 1RIFA 3CRW1 2BKEA 1U8FO 4ZQGA 1LTHR 3IV7A 4DXHA 5IZ4A 3ZR4B 3RFTA 4YWJA 3W34A 4BE4A 1E5LA 3LLSA 1C1DA 4YX9A 2AF3C 1ZM2A 2PUWA 1T9GS 2RG1A 4UHFA 5GY7A 5DVZA 4Z3KA 2FAXA 5GM1A 3BICA 4PAGA 1S2IA 4QYMA 2BMWA 4GNRA 2ZYRA 3UAYA 4B76A 1Z6TA 3CX3A 4DQLA 4EPVA 2QVCA 2PUEA 3DAOA 5IJ0B 3GLIA 4G0YA 1F0PA 1EXWA 2SECE 3EZYA 1DS6A 2C58A 2DRIA 3GPBA 3L7AA 4FCVA 4J0GA 2VHXA 1VRWA 4ERNA 2CF6A 5DHTA 1MRNA 1XK7A 1M34A 4AMVA 3Q87B 5DFAA 1ELOA 3FLMA 1Y6ZA 3AUTA 4US1R 2BPOA 5IEBA 1MPXA 5EJGA 4RD1A 1T6BY 1PBTA 4OQZA 5DYTA 3KDSE 3TX6A 1CRPA 2X0NA 3KYCB 4N0QA 2X9VA 4BLSA 1GCIA 1WXWA 5LM3A 3DVAA 3VUEA 3RTDA 4ZVPA 3C3CA 5JNTA 4N39A 4DIDA 3NHKA 1R9MA 5EHQA 4P4LA 3TIVA 5FO0A 2VTBA 1MZPA 3GEGA 3KVOA 4YJ2F 3RYIB 4XWAA 3G8CA 1XEAA 3LUKA 4C04A 1LEHA 5KYTA 4AECA 1KC1A 1ZEMA 2H2DA 2D1FA 2PBRA 2VJOA 3QVXA 1O8CA 2Q1YA 5AM0A 3R7LA 3T5CA 5M04A 2EYUA 4JDUA 5GONB 5A4FS 2AC4A 1XFDA 1KZGB 1S1CA 3AWIA 1T5BA 3OBBA 3PDUA 2P6PA 2V9PA 4XWTA 1RC1A 4C4AA 3LHIA 1OROA 4I3FA 2XRZA 1Y37A 2FPIA 3UHPA 1V2GA 3VC2A 4WLNA 3LPMA 3ESQA 5A1JA 4LDPA 4HFJA 4HQOA 5C0OE 1QPGA 3WRXC 1LCIA 4BKRA 5H80A 4JXXA 4TRMA 1YIAA 5BN3B 3IQGX 4NZNA 1RM3A 2HQOA 3A6LA 2JEYA 5KQGA 1FVOA 5FUMA 5ITZB 3WHLA 2HHJA 2P2DA 3F6BX 2C9MA 4L08A 3SP1A 2R00A 4P7GA 5LKAA 3NDJA 1V3VA 3V1MA 3K6SB 2TSYB 4NU0A 2D7DA 1HYQA 1VLVA 2H7VA 2JFYA 3MXTA 5EJ2A 2GRAA 4XVCA 5L3SB 1OF1A 2FXVA 2W83A 2IUUA 1Y9ZA 4NDAA 3ZDDA 4QPPA 1T8PA 1QGZA 1NXVA 4GYKA 1Z4IA 2L19A 2VATA 1BVRA 4JNCA 4KYTA 3EPPA 4PYMA 3ZGOA 3QE9Y 3NG1A 4GGMX 4MQFA 3G1WA 3DLPX 3QMMA 1VLHA 5IT9A 4II3A 2NXCA 3T1NA 1ZJ4A 3CIOA 3LBNA 3AZQA 4KODA 1RSZA 5DTJA 1J8FA 1VL0A 3V2HA 4FSHA 3GGJA 3UA4A 3FOFC 3GLVA 1EINA 4RACA 1GYRA 2P35A 3CZ4A 3LRXA 3RYHA 2H1LA 1IWBB 1NN5A 1GRQA 5LNK1 3OZIA 3K1YA 1W36B 2QVXX 2W4MA 2QDKA 3YASA 1SIBE 3HO1A 1LBIA 3ISVA 5LP6A 4Z4QA 2O54A 4WLFA 3UB2A 1GNTA 2OG2A 1VCMA 3GVPA 3R3HA 5JALA 1P61B 1QBKC 5I9LA 3E2IA 5BWMA 2GN2A 2PKQP 5C8VA 1LS6A 2F43A 1GRNA 1ODTC 3KJEA 3SIXA 4C4PA 3UUGA 1WIWA 1XVLA 1QZUA 2GZSA 1NVEA 2Q5CA 3ADOA 4H16A 2NUTA 2YOHA 4BP8A 5DV9A 1GQFA 2EEPA 3G9XA 4GX1A 4P34A 3AVWA 4Y2GA 3TAUA 1K2VN 2C77A 2HU5A 1YDEA 3KB6A 4HQFA 2C2HA 1EDBA 3DW1X 3NTQA 1R8SA 4KGXA 4OJNA 1ABFA 2XWJI 1XZLA 4ALNA 3AIIA 2ETXA 1FU8A 1M1YA 3FKSD 3VSBA 4A3SA 2PUDA 4AMBA 3HA2A 3UXMA 3U3ZA 2RAUA 2EZTA 1ZD4A 1D6NA 2PMFA 3JARB 4C21A 1EXDA 2PS9A 3C14C 4X6LA 3L43A 4RTOA 1NNSA 3A11A 1KEPA 4PC6A 4QTZA 2ZXUA 4EABA 4BVEA 4M0DA 1UJCA 4L8VA 4Y9TA 4Z7JA 2PA0A 3BE4A 4H1TA 4NENA 4WFQA 5DYWA 4X64B 3ICEA 3OQBA 4FLFA 4YUXA 3TPFA 1BHQ1 2D5LA 3BK2A 4RPCA 2D6FA 3VX4A 4M0MA 2DE0X 1YNOA 2OQ2A 5EWJA 2ZRJA 3C1AA 3R6DA 3TLBA 5KYYB 3PHGA 1EUDB 1CNMA 1DBPA 1OCEA 3AUFA 5AM5A 3ED5A 3W6UA 5A62A 4NG4A 1A1SA 1KP9A 2P27A 4CMEA 4LYDA 2BHSA 3G6KA 3D54D 2YIVX 4EFNA 1CJVC 1E9VA 4G63A 2WJZB 4FDAA 3QBTA 4G0UA 1NVVR 3RC1A 1AN9A 2X0IA 3HUTA 4NDNE 1RKUA 1N9GB 3GJ6A 1Z6ZA 3PQ4A 3TW8B 4MWBA 1XHEA 4JT9A 2HBYA 2NYRA 1JXMA 2GJ8A 4RW0A 4UHEA 1XMOB 4NBKA 3RK0A 2GOYA 5LIPA 3JPWA 1TAGA 1I4EB 2W6JA 3PD1A 3QI2A 2GBFA 5EEGA 3OOHA 2ONZA 2BHTA 3PITA 5B1IA 2ZUTA 1JSLA 4N5DA 1Y0BA 5JLJA 5ERYA 4Y7DA 5DSZA 2HX1A 3LYHA 3K0FA 1IZYA 4O29A 3RREA 4MYCA 3PTLA 4PVCA 3U16A 1XL0A 3G6WA 5JZBA 1SAYA 1DC7A 3BM5A 3PU6A 1EJBA 2XIQA 4O08A 4YLGA 3WHKA 2ZRIA 4IWNA 5JNLA 5FPKA 2ZIUB 4WXPA 4CKCB 2GF2A 1KEEB 4TXJA 3GP8A 4GXNA 3VI3B 4X6YA 3S40A 3E8SA 2WG1A 2PRYA 4JT2A 4DAOA 1EQ2A 3RFUA 2A9QA 4LV8B 4BMXA 1MX3A 3NTVA 2JLUA 1M1NA 3DMTA 3ZLBA 5JAMA 1VJ1A 4WJLA 3O8QB 1IZ9A 2CLHB 1WDLA 2GXQA 2YUTA 3H97A 1QQ6A 3SZLA 2FK7A 3QKTA 3L77A 4RQAA 5GMOA 4D4LA 2J5RA 4U6NA 3D3WB 4OYLA 2R8EA 4QGHA 2QD4A 1EZ4A 4ZKEA 4AYTA 4JBWA 4X7RA 5HOQA 4LHZA 2W2XA 2ZCVA 2JLYA 3H2ZA 3EVNA 2JANA 2GF9A 3DL0A 1XYVA 4WQMA 1LDNA 3L9XA 4RFLA 1T5SA 1QIHA 4BP1A 1T3GA 1C5KA 1RFLA 3W05A 5LWQA 2HH9A 1M6YA 1UZNA 4BU0A 5EZ6B 3VHRA 3DKIA 2J31A 3AF2A 2WAAA 1CCWA 1CJUC 1BHJA 1Z6AA 1SOUA 3D8SA 3P9RA 1KE2A 2E82A 4UUMA 1IN6A 2HR1A 1UBGA 1CY2A 2E7ZA 3K9CA 4LXQA 3UHOA 4NDZA 4D81A 1E4EA 1CR2A 1ECBA 4RTQA 1EK5A 3FVRA 5L95A 2FH5B 1Z8HA 2Q2NA 1H6AA 1T5LA 1YI1A 3GT3A 4JL6A 4A10A 4ZWNA 1H0SA 4TS9A 5IJZA 3T06B 4HDAA 2XYPA 5CJ2A 3TLZA 2IYLD 1JG3A 3PGKA 3PX2A 3HNOA 4ZU6X 1XRNA 2NAFA 4C3VA 4HAYA 1RMQA 1U2DA 1OU4A 2GYWA 4P82A 1I7SB 1Q0UA 5TQ0B 1AXGA 1F3LA 4YJGA 5EPUA 1AV6A 4YV2A 3BD6A 4FJ1A 2G9RA 4V1CB 3VH1A 1IY1A 4WY2A 1EX1A 1D2EA 4WX2B 2NUPA 4JASB 4LS3A 2J9GA 1Y9JA 2VJNA 3GRZA 4WKCA 5CGZA 4Y9UA 3V3KA 1FJHA 3GGOA 5JCOA 1AF7A 2NT3A 2A0KA 4L9AA 3RS8A 5LLDA 3FTFA 3JWGA 1K06A 4E7PA 3RIXA 2IS6A 4Z86A 3KVNA 3T5MA 1C4XA 2ROQA 3D2LA 3BWBA 3PJDA 1M7GA 2AYZA 4M0EA 3KBOA 1C29B 2R97A 5IYZF 4M1TA 4ZYWA 2QUBA 3RGWS 1WWKA 2YMPA 3ICVA 2ZJ7A 4A26A 4KPUB 3F46A 4JBXA 3HKDA 5EWLB 4BZPA 2NUPB 4XTCS 1UAAA 3OG9A 5TS3A 2P9ZA 3H9GA 3H6GA 4PGAA 3VU8A 4WFKA 4TL8A 2QTAA 4JB0A 3D7SA 1DC5A 4N9WA 3A31A 2PCLA 2WTAA 4LVUA 1C0EA 1JEYB 3A2NA 1M1YE 2V9CA 1UFKA 5DTMA 4CLEA 3AG5A 2OHOA 1OH8A 2VYCA 2X58A 3T35A 3TKAA 5CYFA 3V4FA 3O9ZA 4EG1A 4V0NA 2PKYX 2ZB4A 4TROA 3DO6A 2J41A 2PQ6A 4BTLA 2BEVB 4RD3A 2OO5C 1C9MA 1X7GA 4ARZB 1G17A 2NLOA 5U1PA 3HA3A 1DOZA 1VYVA 2QEQA 2G72A 4DJFC 3GMTA 5GM2A 1E1CB 2PZBA 3DBRA 1EUCA 1GN8A 3HDQA 2X40A 2Q6LA 3VPGA 3PUYA 3IXMA 1ORVA 1XE3A 3OT5A 4IEEA 1UZLA 1ZSVA 3OHMA 4C7MA 5KSWB 3O8LA 5AM4A 4FWIB 1MFPA 4QJ5A 1Y4AE 1ZMTA 1KMHB 4C29A 1P7PA 5ECDA 1FP6A 3M3PA 1O9GA 4AFNA 2OAP1 4JGBA 4QOHA 4U7HA 5FLXA 1TF5A 4H7EA 2JHAA 1VL8A 1PKXA 2FFBA 4W5OA 1ZK1A 4MGKR 5I9MA 4YGYA 4LDJA 3U62A 3TAXA 2HAEA 2QORA 2UUBB 1RWKA 4QFDA 3INYA 3KLNA 3QLVA 3B60A 1MHTA 1ZBQA 4Q1EA 1G42A 2LNDA 3MIIA 3C0KA 4MS1A 4ABYA 3L8ZA 1TMGE 2EKQA 4MRRA 2ZJ3A 1Y81A 1WCYA 4OQLA 2FPRA 2J3KA 3CRRA 2IXAA 1F7VA 5I7RA 3JQBC 3LP6A 2BGNA 2I1QA 1T4GA 1L5NA 1ONSA 1RRGA 4KRYA 4P5EA 3ZD8A 4ENUA 3LQKA 4WW0A 5ALVA 4G0WA 3ENQA 2PPVA 1OV6A 3HKCA 2DEUA 1OIVA 1P0PA 4YQEA 5F52A 4BN0A 4DIEA 3PJRA 4INZA 4MRSA 3PD0A 3HWRA 4K9DA 1XBTA 2GBIA 3FE2A 4UNQA 1CDZA 3JCZA 3CKKA 1WHTB 4GW3A 3ZQUA 2JD1A 4J91A 1BDMA 2ZT8A 4G0MA 4XW2A 4BO8A 3IBCA 3PF8A 4HGOA 4YGXB 4QUKA 5JSHA 4BZWA 1AUPA 1ZVMA 2Z2ZA 3KD3A 4P84A 1HOTA 3GH3A 3W4IA 1AKVA 2Q6OA 2SKEA 1GUYA 1MJFA 4KQXA 4PN7A 4KSBA 3E58A 2AL7A 4RZ3A 3SZOA 1DDGA 5DGIA 1HZZC 1SULA 2W2OA 3C8UA 3W8FA 2O8CA 3A4TA 4KRFA 1SBQA 3DNPA 4DPKA 4KN6A 3GJZA 4BRWA 4H7FA 2P2GA 4RQUA 1L0BA 3EZ6A 1Z0SA 3FI0A 2G88A 3A14A 2BVNA 4YUVA 3TZBA 2VUUA 2Q1XA 4MO2A 4MQUA 1SWWA 2CBGA 4CQJA 2AZXA 4Z5XA 1QGYA 2POCA 1LDYA 4MCJA 3T94A 1XG5A 1CUGA 5AUNB 4BN5A 3DLIA 4CLRB 3A9CA 3AEUA 5JJCA 2FHSA 4GSLA 4XDHA 2W71A 1V3TA 1IN7A 2VYVD 2NSYA 2GFQA 5F1YA 4MW2A 4ZCMA 2BKAA 3PUWA 5JVDF 1BCRA 3AI1A 3E18A 2YXNA 3G0HA 1CNFA 2FW0A 1QBGA 4Q05A 1E89A 3CZ9A 3W8RA 3LYAA 3OHSX 4YQYA 5JARA 5AOAA 2WYWA 2Q3HA 2V6GA 2XY4A 3C7AA 5AFSA 2Z2KA 2R2GA 4PW0A 5IKPA 1W581 2O2JA 5B6JA 2VWGA 2YVLA 3IPAA 1AKTA 5C46F 2FPMA 1GYQA 4ZVRA 3SKXA 2VNJA 1FPMA 3RTGA 1Y8RB 1XXHB 3EUEA 1AKWA 3TD2A 4EVQA 1XZQA 4KGDA 8LDHA 1QG6A 1U7DA 3NYIA 3BDIA 1Z0ZA 4JLKA 2EJWA 5BT8A 3BGVA 3N8NA 3HLKA 3DQQA 2P6UA 2ZAIA 4GKBA 4QIHA 5KX5B 1L7XA 5AVUA 3OUZA 4CYMA 4F11A 3KKPA 3WL8A 3CT4A 4CT5A 2VHEA 2IV3A 3LUHA 2FWMX 1II8A 3G5AA 2X1HA 1THTA 3IKVA 3V8MA 5AJHA 1U1IA 1ZK4A 1WUIS 3GELA 1W4AA 1TECE 4D3XA 2F1KA 2WWXA 4HT3B 5JWOA 3FF4A 5JZOA 5JEDA 1U0LA 2JBAB 1EP9A 2YZMA 2EX4A 3PDIA 3MMPA 3NWPA 3IOMA 1EBFA 1FP7A 1QFZA 2MJLA 2YHIB 5EXPA 3S29A 3JRWA 4M88A 2A9KA 4PS0A 2FN9A 4G1UC 2GUWA 4YRJA 5P21A 4OKSA 4L6AA 1EX7A 4R1QA 2WHYA 3G9TA 2HFKA 3HEAA 3R5SA 1VSTA 2YN2A 3TB6A 2X5OA 4O1IA 1Z28A 3DQZA 2RH8A 2OCPA 2VXYA 1JHOA 4KNWA 4MIYA 3ZCVA 2Y77A 3EEQA 1JGTA 1JFSA 4HMOA 4CMAA 1TL7C 3ABRB 1Z4LA 2C2OA 3IUMA 1VCOA 3KM0A 3NOOA 4N3GA 3I28A 3AXSA 2BHRA 4IHJF 5JNUA 4YN3A 1W1IA 1CJTC 2ZYAA 3HUFA 2ZR8A 5EJ4A 3W5JA 5HM8A 1W76A 2C7QA 4E2YA 5AI9A 2YC4C 2RE8A 1R5OA 4LAFA 4W6QA 3STUA 3ZE2B 4N1AA 3K0EA 2XQKA 3K0SA 1ABEA 3G0GA 1C8BA 1NJ5A 3K3PA 3PTAA 1Q7BA 2L2QA 2QTGA 2AA3A 3PR2B 4BLUA 3MT8A 3LUBA 1EH5A 2XNSA 1SEPA 2VYFA 1DX9A 2Z4SA 3NWOA 1M54A 5J4YA 5JJ5A 1DIOB 1NY6A 2GCIA 2PFGA 2WDPA 3I0NA 3P4YA 4PE5B 5DNWA 5GZ6A 1MB0A 2G3YA 2QROA 1YMQA 4BBZA 2BZSA 2REBA 3VZDA 4BB6A 3CBQA 1WPQA 5H3HA 1FTYA 4MIEA 1Y8ZA 2ZJYA 3VR0A 2V7XA 1VKRA 5DTEA 4JU8A 4EHKA 2GCNA 3JWHA 3HPQA 5ICEA 5JR3A 1T6XA 3BSYA 3I04M 3FMVA 4XX1A 3L8EA 1OB5A 4HO1X 3VAYA 1U8XX 3K9HA 3WSWA 3U7GA 1JWLA 2C2GA 1XKTA 4LHYA 4YEDA 2XOKA 4XSHA 3ADDA 3UWDA 3H5VA 4TMYA 1G8YA 1OLSA 2K2WA 4XFKA 4QGAA 4TSKA 1GSOA 3SLRA 2N42A 2VQ3A 4AU1A 3F3YA 5DNVA 1IUKA 3OLVA 3KOYA 5LYYA 4D3ZA 5JSZA 4ZCPA 3L4EA 5AVVA 1UT5A 4MKZA 1FX0A 2W7TA 2WUFA 3E0XA 4FOTA 5HDQA 4AO7A 1JYFA 1P2SA 2EAUA 1MC1A 4N49A 4BUCA 3B1ZA 1KGSA 3FMGA 4TLAA 4BQEA 1C4WA 3S5UA 3U1BA 4MP3A 4F96A 4LJYA 5ICMA 3R09A 3OU6A 5KOJB 1V35A 1DG1G 4F38A 2WMYA 3UT6A 1L5YA 3UUWA 4FQ7A 2JZOA 2D1YA 1A7UA 1KY4A 1NVAA 1S7GA 2UYYA 4RL4A 4ZQCB 2PVCA 2WK1A 1AZWA 5HE9A 3RLFA 3ELYA 1IG3A 4Q1CA 5CAEB 1ZGJA 2YV5A 5JT1A 1KQFA 4HZIA 2BP7A 2R1TB 5GV7A 4E0BA 5A5VA 1RLMA 4ZYVA 1R4MA 1U3CA 4KUGA 2E18A 4CGZA 3DL2A 4BN4A 4UM8B 4WKBA 5F7ZA 4RQTA 5L7TA 1C7IA 2FPPA 4AQ7A 1E1KA 4DYHA 2ZSFA 4F5DA 1A5ZA 3V48A 2O0JA 1COZA 1ZIXA 2Q50A 3PQ2A 3TLKA 1QONA 3O9MA 3X1WA 3ZDRA 4KYVA 4GSKA 3EIUA 3ZCSA 3DC2A 1ZJJA 2PCJA 3QPVA 4JYPA 4LJSA 2YN4A 5DO9A 4CL8A 1OH7A 4N6NA 1Z83A 2ADFA 4IX1A 3F67A 1EUZA 1GOTA 2HNKA 3EXFA 2OVBA 3I2GA 3LBFA 2WFMA 4REQB 4UAGA 4QU8A 4DMHA 3M49A 5GJCA 3CF0A 3KFLA 2VSXA 1E7YA 4JX9A 2PD4A 3FCYA 1H4TA 4J75A 1HNZB 5IDYA 4F71A 2FW8A 3PWKA 4TLEA 1XVVA 4LXTA 4UFNA 5DH9A 1KHHA 1SOWA 1DXOA 3AFHA 1JHPA 1MV5A 3NIDB 3UMGA 2BEUA 4LUCA 4QZVA 2Q27A 1J99A 1KAHA 2R8XA 1KDVA 2GRJA 3AQIA 1W35A 2TRSB 3ND8A 4LOKA 4X1OA 1BE6A 1OA1A 1Y6GA 5LB2A 3AHHA 3FB1A 3DV9A 3EXFB 3LG2A 4REQA 1XMXA 1EE9A 4IJ5A 3BMOB 1LX7A 2AMJA 1CZOA 5HGJA 3MS2A 1YBFA 1L3CA 2BM8A 3OJXA 2V7GA 3LUFA 2RB4A 4CHGA 3W1VA 4X61A 4LC0A 3KSAC 4FR5A 1S89A 2M2IA 2R85A 1QHYA 3WMFA 4WY8A 4PC2A 4FYXA 4M0UA 4AULA 4IDAA 2CUKA 4NZMA 2FPIB 4AP6A 4CMJA 1N36B 3RJ9A 3D3NA 2CCGA 3G3EA 5K3AA 4H0CA 5K3BA 3DOJA 3OMLA 4F5YA 4F4HA 1JHQA 5KVCA 2NO4A 3LOQA 3WGLA 5G3ZA 1FFXA 1T36B 2IXTA 2QN8A 3NANA 3PVZA 4AJJA 1HWYA 1QH9A 4QRDA 1SR8A 4PHFA 3CZPA 4C0QC 2VJYA 1AA6A 1OXUA 8ABPA 3PI7A 3DDNA 1G2IA 2GPAA 2QRGA 4KQMA 1RCFA 5M7EA 3J7AC 1LZKA<