1DGCA

The x-ray structure of the gcn4-bzip bound to atf/creb site dna shows the complex depends on dna flexibility
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 24
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1dgcA00
1G2DC 2YTFA 2YTGA 1YUIA 2EPPA 2EMGA 5KL5A 2YTIA 2EPCA 2EMCA 1B69A 3VHTB 2ELYA 1Z1BA 2EOFA 1AAYA 2EOQA 2EM9A 3EPLA 1TF6A 2EMBA 1A1KA 2EPAA 2MDGA 1A1JA 2EN7A 4R2CA 2VRDA 1A1LA 2ENCA 4R2AA 1X6FA 1X6HA 2ENAA 1BBOA 2EOEA 2EL4A 5KL3A 2EOXA 2EN6A 2EN4A 2EM0A 2YSPA 2EOHA 2EOSA 4R2QA 1LLMC 2ELZA 1ZAAC 2MKNA 3M99B 2EMXA 1A1FA 2EOMA 2MKDA 4R2EA 1P47A 2GLIA 2EMYA 2EN3A 4WSGA 2YTPA 5KL7A 2I13A 1NCSA 2EE8A 1TN9A 1A1GA 2JP9A 2EM2A 5KL4A 1TF3A 4R2SA 2EMHA 2PRTA 1DGCA 2EORA 1RMDA 2DLQA 1F2IG 1A1HA 2YRMA 4F6NA 2EMIA 2YTQA 2CT1A 4IJDA 2RSIA 2LV2A 2JPAA 1A1IA 2EPXA 2EMKA 2EOOA 1ZR9A 5KL2A 4IS1C 2EP3A 4GZNC 2EN8A 2HGHA 4M9VC 2YTJA 4R2RA 2EM8A 3MHSC 2EN2A 2YTDA 2YTNA 1WJPA 2J7JA 3MHHC 2EM6A 2YTEA 2YTOA 3EPHA 2EMWA 4F2JC 2EM7A 3EPJA 2A25A 2EMAA 3EPKA 1BB8A 2YU5A 4R2DA 5KL6A 2EOYA 1G2FC 1UBDC 1X6EA 4X9JA 2EPUA 2CSHA 2E72A 2EJ4A 2WCC3 2EQ3A 4F6MA 2EL5A 1YUJA 4R2PA 1X3CA 2EOIA 2EL6A 2EOZA 2EMZA 2EPRA 2EPZA 2GHFA 3UK3C 2ADRA 2YU8A 2LO3A 2EQ1A 2M9AA 2YRHA 1JK2A 2EM4A 1UN6B 2EQ0A 2EMLA 2DMIA 2WBSA 2ENHA 2EM5A 2WBUA 1X5WA 2YRKA 1MEYC 4FK5C 2LVHA 1ZU1A 2DLKA 2R1FA 2EM3A 2DGCA 2BB8A 1JK1A 2LT7A 2D9HA 2RPCA 2YSOA 2CTDA 2EMFA 2NABA 2EOJA 1KJKA 2EN1A 2DRPA 1YSAC 2WBTA 2LCEA
chains in the Genus database with same CATH superfamily
2UXBE 1BBGA 5KL5A 5T6JA 4DV5E 4F9CB 1XMQE 4GKKE 3J7AG 2L3CA 1AAYA 2MDGA 2MC5A 2EN7A 1A1JA 5AC5A 5AE2A 2MC6A 1A1LA 2ENCA 4R2AA 4X65E 1BBOA 3THNA 2EOXA 4WPYA 3ADIA 2YSPA 2DB2A 2EOSA 4DV1E 2DMYA 2YT4A 3M99B 2EMXA 1SR9A 4AQYE 5A69A 4JYAE 2LUPB 4R2EA 2EMYA 3C4BA 5KL7A 2EM2A 4L8NA 4R2SA 2UUCE 1DGCA 4WXDA 1F2IG 1QU6A 1IBLE 2EMIA 2YTQA 1A1IA 4KZSA 2EPNA 2EP3A 4GZNC 4O24A 3ADJA 2YTDA 4JV5E 2J7JA 3T1HE 3MHHC 4YHHE 2HJJA 2JOBA 2YTOA 2LTSA 1N34E 2VE7C 2EMAA 2R76A 3VK6A 3EPKA 4HEIA 4R2DA 3JAMC 2IHR1 4X9JA 3BGHA 2K7IA 2NA2A 2WZOA 4DV0E 3L00A 4JI8E 2EL5A 2LJHA 2EOIA 5LL6R 2YU8A 2L2NA 3IWDA 2EQ1A 2YRHA 5IT9C 1MGTA 1EH8A 1X47A 4O4KA 2JYAA 4M30A 1X5WA 4LF4E 3OMLA 4OX9E 1ZU1A 2DLKA 5AC4A 4WSPA 5TSEA 3K6QA 2LT7A 3F6HA 2JOXA 2VQEE 2EOJA 4P78A 3HTXA 4DR5E 1PKPA 2DRPA 4DR7E 4P7DA 3EQ1A 2N8XA 4ZYDA 2EPCA 3QG5C 4DV4E 2B7VA 2EOFA 1IBKE 3J80C 2EM9A 4DMIA 2EPAA 4DKKA 4GEQB 2UXDE 4WFTA 4BHCA 4BC9A 1X6HA 2EL4A 5AE3A 2N3HA 5AASA 2B3TB 1X48A 2MKNA 1HR0E 1HNWE 1YFHA 2N3GA 1O0WA 1DQ3A 2NUEA 2L33A 2FV4B 4WSGA 2EN3A 4DV3E 5KL4A 4BMJA 3HQ1A 5A6JA 2M4IA 1TF3A 4LFAE 4JI7E 1EKZA 4JI3E 1EH7A 3VYXA 2F4VE 1T4OA 5A6KA 4LF7E 2CT1A 3DF6A 5IWAE 2LV2A 1J5EE 4R03A 1QNTA 4KWYA 4B3TE 2EN8A 2HGHA 4M9VC 2M1SA 2EM8A 2RS6A 2EN2A 4YY3E 1GTKA 4BS9A 1DI2A 2FGGA 4X66E 2EM6A 2YTEA 2YWQA 3TQMA 2EMWA 3KWRA 4RH8A 3JU0A 5DNYA 4DUYE 4LF9E 1XNQE 1BB8A 2YU5A 5KL6A 2EOYA 2L2MA 3ADGA 4JI2E 5LLQA 2EPUA 2F8BA 2E72A 2EJ4A 4F6MA 2LE2A 5LMUE 2EOZA 2GHFA 2MDRA 2ADRA 1ZBQA 4DR1E 1JK2A 1PJTA 2ODRC 4NHRA 3DJWA 2WBSA 3MSWA 2YRKA 3LMLA 4JI0E 2LVHA 2RS7A 4JI6E 4MLVA 2DGCA 1N3GA 2D9HA 2RPCA 2L2KB 4L5NC 4JI4E 3H09A 3J7Yp 2LJUA 4TUIA 2LCEA 1G2DC 2E5LE 4N4RB 2K4VA 2EPMX 1WXRA 2YTIA 3THOB 2EMCA 1B69A 3VHTB 2ELYA 3ZOQB 2EZ6A 1Z1BA 3JTZA 4LF8E 4GKJE 2UXCE 4LTYA 2EOQA 4BCAA 3EPLA 1TF6A 2B9DA 1J26A 2RQLA 3BIDA 2ENAA 1WHQA 3RMPA 4X62E 2EN4A 1T39A 2EM0A 2JXPA 2EOHA 2DSYA 2G7HA 3BF2A 1LLMC 4R8OA 1GQEA 2EPLX 5FLXC 2CPNA 4B3SE 2VF1A 3LLHA 4BBYA 4DV2E 1P47A 2GLIA 2I13A 2YTPA 2LUQA 3AV0A 1NCSA 1A1GA 2JP9A 1N32E 1PJSA 2PRTA 1RMDA 1YZ9A 2DLQA 1A1HA 2YRMA 3F6GA 1T4LB 2BBGA 2NUFA 4IJDA 2RSIA 1FKAE 4I8OA 2EWLA 2EOOA 1ZR9A 1NEIA 4DR6E 2YTJA 4R2RA 3MHSC 2GPIA 1WJPA 4JI5E 1X49A 2JY9A 5F3WA 5A2QC 3EPHA 3HPSA 2JR1A 2B7TA 2V86A 4ZYGA 2KONA 2V88A 4F2JC 1XMOE 3EPJA 4M2ZA 2VQFE 4B3RE 2JWOA 4DR2E 1G2FC 1X6EA 3BBGA 2Q8UA 1IBME 5ADZA 2FTXB 1YYWA 2WCC3 4F9AB 2V83A 2L8TA 4LF6E 1HNZE 4R2PA 2L3JA 5A6BD 2LTRA 2EL6A 5A6BA 2LO3A 2M9AA 2I9IA 5CFFE 3P1XA 2EM4A 2RSMA 4NXME 1XNRE 2EQ0A 2EPOA 1N33E 4LFBE 1KYQA 3C6MA 4BC7A 1SFEA 4FK5C 3ECRA 1T4NA 2R1FA 5IV8B 3FIGA 2BB8A 1JK1A 4HTGA 2L6MA 4LFCE 3HPZA 2CTDA 1HNXE 2EMFA 1N36E 2E1MA 2H36X 4RHBB 2EN1A 1YSAC 3KZZA 1IQSA 1UILA 2V89A 4BHBA 3VYYA 2YTFA 2ZM6E 2YTGA 1YUIA 2EPPA 2EMGA 2DIXA 3HXLA 4O43A 4DR4E 1STUA 4X8WA 1T38A 2EMBA 1A1KA 1AH5A 1I94E 4R2CA 2UUAE 2VRDA 1YPNA 5LMNE 2UU9E 4DV6E 1X6FA 1YYOA 2EOEA 5KL3A 1UHZA 4WYQB 4O5GA 4ZYHA 3J81C 2EN6A 5AE1A 1GZ6A 1PJQA 4R2QA 4NZVA 2ELZA 4TUGA 1ZAAC 2V8QB 4WX9A 1A1FA 4DUZE 4LF5E 4LU9A 2EOMA 2EPKX 2M7QA 1EH6A 2MKDA 1RQ0A 2EE8A 1TN9A 2NUGA 2EMHA 2EORA 3T1YE 4F6NA 3IWCA 3AUZA 2RTXA 1WRJA 4DR3E 5A6AA 2JPAA 1L4SA 2EPXA 2EMKA 1IQOA 5KL2A 4IS1C 2YZTA 1FJGE 2UUBE 3C6KA 2YTNA 2V85A 2LBSB 3ADLA 4Q35B 2KOUA 4KHPE 4M0VA 4F54A 4Q28A 2EM7A 2A25A 3IWBA 1UBDC 1YYKA 3C4TA 5BR8E 2ODRD 2CSHA 2LMZA 2EQ3A 2V87A 4J8ZA 1YUJA 1X3CA 2KHXA 4OOGC 2HC5A 2EMZA 2EPRA 2EPZA 4DV7E 3UK3C 1UN6B 1ZBTA 2EMLA 3OTOE 2DMIA 4K0KE 2WBUA 2ENHA 2EM5A 4MLQA 4X64E 4WXCA 1MEYC 2L92A 2JVAA 2YPNA 3KZYA 5IXMB 4JI1E 4F9BB 2EM3A 4NXNE 1WHNA 4ZYEA 1RC7A 2YSOA 4B3ME 2NABA 2HHHE 1IMUA 1KJKA 1PDAA 2WBTA 2LRSA
chains in the Genus database with same CATH topology
1G2DC 2YTFA 2YTGA 1YUIA 2EPPA 2EMGA 5KL5A 2YTIA 2EPCA 2EMCA 1B69A 3VHTB 2ELYA 1Z1BA 2EOFA 1AAYA 2EOQA 2EM9A 3EPLA 1TF6A 2EMBA 1A1KA 2EPAA 2MDGA 1A1JA 2EN7A 4R2CA 2VRDA 1A1LA 2ENCA 4R2AA 1X6FA 1X6HA 2ENAA 1BBOA 2EOEA 2EL4A 5KL3A 2EOXA 2EN6A 2EN4A 2EM0A 2YSPA 2EOHA 2EOSA 4R2QA 1LLMC 2ELZA 1ZAAC 2MKNA 3M99B 2EMXA 1A1FA 2EOMA 2MKDA 4R2EA 1P47A 2GLIA 2EMYA 2EN3A 4WSGA 2YTPA 5KL7A 2I13A 1NCSA 2EE8A 1TN9A 1A1GA 2JP9A 2EM2A 5KL4A 1TF3A 4R2SA 2EMHA 2PRTA 1DGCA 2EORA 1RMDA 2DLQA 1F2IG 1A1HA 2YRMA 4F6NA 2EMIA 2YTQA 2CT1A 4IJDA 2RSIA 2LV2A 2JPAA 1A1IA 2EPXA 2EMKA 2EOOA 1ZR9A 5KL2A 4IS1C 2EP3A 4GZNC 2EN8A 2HGHA 4M9VC 2YTJA 4R2RA 2EM8A 3MHSC 2EN2A 2YTDA 2YTNA 1WJPA 2J7JA 3MHHC 2EM6A 2YTEA 2YTOA 3EPHA 2EMWA 4F2JC 2EM7A 3EPJA 2A25A 2EMAA 3EPKA 1BB8A 2YU5A 4R2DA 5KL6A 2EOYA 1G2FC 1UBDC 1X6EA 4X9JA 2EPUA 2CSHA 2E72A 2EJ4A 2WCC3 2EQ3A 4F6MA 2EL5A 1YUJA 4R2PA 1X3CA 2EOIA 2EL6A 2EOZA 2EMZA 2EPRA 2EPZA 2GHFA 3UK3C 2ADRA 2YU8A 2LO3A 2EQ1A 2M9AA 2YRHA 1JK2A 2EM4A 1UN6B 2EQ0A 2EMLA 2DMIA 2WBSA 2ENHA 2EM5A 2WBUA 1X5WA 2YRKA 1MEYC 4FK5C 2LVHA 1ZU1A 2DLKA 2R1FA 2EM3A 2DGCA 2BB8A 1JK1A 2LT7A 2D9HA 2RPCA 2YSOA 2CTDA 2EMFA 2NABA 2EOJA 1KJKA 2EN1A 2DRPA 1YSAC 2WBTA 2LCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2D C;  2YTF A;  2YTG A;  1YUI A;  2EPP A;  2EMG A;  5KL5 A;  2YTI A;  2EPC A;  2EMC A;  1B69 A;  3VHT B;  2ELY A;  1Z1B A;  2EOF A;  1AAY A;  2EOQ A;  2EM9 A;  3EPL A;  1TF6 A;  2EMB A;  1A1K A;  2EPA A;  2MDG A;  1A1J A;  2EN7 A;  4R2C A;  2VRD A;  1A1L A;  2ENC A;  4R2A A;  1X6F A;  1X6H A;  2ENA A;  1BBO A;  2EOE A;  2EL4 A;  5KL3 A;  2EOX A;  2EN6 A;  2EN4 A;  2EM0 A;  2YSP A;  2EOH A;  2EOS A;  4R2Q A;  1LLM C;  2ELZ A;  1ZAA C;  2MKN A;  3M99 B;  2EMX A;  1A1F A;  2EOM A;  2MKD A;  4R2E A;  1P47 A;  2GLI A;  2EMY A;  2EN3 A;  4WSG A;  2YTP A;  5KL7 A;  2I13 A;  1NCS A;  2EE8 A;  1TN9 A;  1A1G A;  2JP9 A;  2EM2 A;  5KL4 A;  1TF3 A;  4R2S A;  2EMH A;  2PRT A;  1DGC A;  2EOR A;  1RMD A;  2DLQ A;  1F2I G;  1A1H A;  2YRM A;  4F6N A;  2EMI A;  2YTQ A;  2CT1 A;  4IJD A;  2RSI A;  2LV2 A;  2JPA A;  1A1I A;  2EPX A;  2EMK A;  2EOO A;  1ZR9 A;  5KL2 A;  4IS1 C;  2EP3 A;  4GZN C;  2EN8 A;  2HGH A;  4M9V C;  2YTJ A;  4R2R A;  2EM8 A;  3MHS C;  2EN2 A;  2YTD A;  2YTN A;  1WJP A;  2J7J A;  3MHH C;  2EM6 A;  2YTE A;  2YTO A;  3EPH A;  2EMW A;  4F2J C;  2EM7 A;  3EPJ A;  2A25 A;  2EMA A;  3EPK A;  1BB8 A;  2YU5 A;  4R2D A;  5KL6 A;  2EOY A;  1G2F C;  1UBD C;  1X6E A;  4X9J A;  2EPU A;  2CSH A;  2E72 A;  2EJ4 A;  2WCC 3;  2EQ3 A;  4F6M A;  2EL5 A;  1YUJ A;  4R2P A;  1X3C A;  2EOI A;  2EL6 A;  2EOZ A;  2EMZ A;  2EPR A;  2EPZ A;  2GHF A;  3UK3 C;  2ADR A;  2YU8 A;  2LO3 A;  2EQ1 A;  2M9A A;  2YRH A;  1JK2 A;  2EM4 A;  1UN6 B;  2EQ0 A;  2EML A;  2DMI A;  2WBS A;  2ENH A;  2EM5 A;  2WBU A;  1X5W A;  2YRK A;  1MEY C;  4FK5 C;  2LVH A;  1ZU1 A;  2DLK A;  2R1F A;  2EM3 A;  2DGC A;  2BB8 A;  1JK1 A;  2LT7 A;  2D9H A;  2RPC A;  2YSO A;  2CTD A;  2EMF A;  2NAB A;  2EOJ A;  1KJK A;  2EN1 A;  2DRP A;  1YSA C;  2WBT A;  2LCE A; 
#chains in the Genus database with same CATH topology
 2UXB E;  1BBG A;  5KL5 A;  5T6J A;  4DV5 E;  4F9C B;  1XMQ E;  4GKK E;  3J7A G;  2L3C A;  1AAY A;  2MDG A;  2MC5 A;  2EN7 A;  1A1J A;  5AC5 A;  5AE2 A;  2MC6 A;  1A1L A;  2ENC A;  4R2A A;  4X65 E;  1BBO A;  3THN A;  2EOX A;  4WPY A;  3ADI A;  2YSP A;  2DB2 A;  2EOS A;  4DV1 E;  2DMY A;  2YT4 A;  3M99 B;  2EMX A;  1SR9 A;  4AQY E;  5A69 A;  4JYA E;  2LUP B;  4R2E A;  2EMY A;  3C4B A;  5KL7 A;  2EM2 A;  4L8N A;  4R2S A;  2UUC E;  1DGC A;  4WXD A;  1F2I G;  1QU6 A;  1IBL E;  2EMI A;  2YTQ A;  1A1I A;  4KZS A;  2EPN A;  2EP3 A;  4GZN C;  4O24 A;  3ADJ A;  2YTD A;  4JV5 E;  2J7J A;  3T1H E;  3MHH C;  4YHH E;  2HJJ A;  2JOB A;  2YTO A;  2LTS A;  1N34 E;  2VE7 C;  2EMA A;  2R76 A;  3VK6 A;  3EPK A;  4HEI A;  4R2D A;  3JAM C;  2IHR 1;  4X9J A;  3BGH A;  2K7I A;  2NA2 A;  2WZO A;  4DV0 E;  3L00 A;  4JI8 E;  2EL5 A;  2LJH A;  2EOI A;  5LL6 R;  2YU8 A;  2L2N A;  3IWD A;  2EQ1 A;  2YRH A;  5IT9 C;  1MGT A;  1EH8 A;  1X47 A;  4O4K A;  2JYA A;  4M30 A;  1X5W A;  4LF4 E;  3OML A;  4OX9 E;  1ZU1 A;  2DLK A;  5AC4 A;  4WSP A;  5TSE A;  3K6Q A;  2LT7 A;  3F6H A;  2JOX A;  2VQE E;  2EOJ A;  4P78 A;  3HTX A;  4DR5 E;  1PKP A;  2DRP A;  4DR7 E;  4P7D A;  3EQ1 A;  2N8X A;  4ZYD A;  2EPC A;  3QG5 C;  4DV4 E;  2B7V A;  2EOF A;  1IBK E;  3J80 C;  2EM9 A;  4DMI A;  2EPA A;  4DKK A;  4GEQ B;  2UXD E;  4WFT A;  4BHC A;  4BC9 A;  1X6H A;  2EL4 A;  5AE3 A;  2N3H A;  5AAS A;  2B3T B;  1X48 A;  2MKN A;  1HR0 E;  1HNW E;  1YFH A;  2N3G A;  1O0W A;  1DQ3 A;  2NUE A;  2L33 A;  2FV4 B;  4WSG A;  2EN3 A;  4DV3 E;  5KL4 A;  4BMJ A;  3HQ1 A;  5A6J A;  2M4I A;  1TF3 A;  4LFA E;  4JI7 E;  1EKZ A;  4JI3 E;  1EH7 A;  3VYX A;  2F4V E;  1T4O A;  5A6K A;  4LF7 E;  2CT1 A;  3DF6 A;  5IWA E;  2LV2 A;  1J5E E;  4R03 A;  1QNT A;  4KWY A;  4B3T E;  2EN8 A;  2HGH A;  4M9V C;  2M1S A;  2EM8 A;  2RS6 A;  2EN2 A;  4YY3 E;  1GTK A;  4BS9 A;  1DI2 A;  2FGG A;  4X66 E;  2EM6 A;  2YTE A;  2YWQ A;  3TQM A;  2EMW A;  3KWR A;  4RH8 A;  3JU0 A;  5DNY A;  4DUY E;  4LF9 E;  1XNQ E;  1BB8 A;  2YU5 A;  5KL6 A;  2EOY A;  2L2M A;  3ADG A;  4JI2 E;  5LLQ A;  2EPU A;  2F8B A;  2E72 A;  2EJ4 A;  4F6M A;  2LE2 A;  5LMU E;  2EOZ A;  2GHF A;  2MDR A;  2ADR A;  1ZBQ A;  4DR1 E;  1JK2 A;  1PJT A;  2ODR C;  4NHR A;  3DJW A;  2WBS A;  3MSW A;  2YRK A;  3LML A;  4JI0 E;  2LVH A;  2RS7 A;  4JI6 E;  4MLV A;  2DGC A;  1N3G A;  2D9H A;  2RPC A;  2L2K B;  4L5N C;  4JI4 E;  3H09 A;  3J7Y p;  2LJU A;  4TUI A;  2LCE A;  1G2D C;  2E5L E;  4N4R B;  2K4V A;  2EPM X;  1WXR A;  2YTI A;  3THO B;  2EMC A;  1B69 A;  3VHT B;  2ELY A;  3ZOQ B;  2EZ6 A;  1Z1B A;  3JTZ A;  4LF8 E;  4GKJ E;  2UXC E;  4LTY A;  2EOQ A;  4BCA A;  3EPL A;  1TF6 A;  2B9D A;  1J26 A;  2RQL A;  3BID A;  2ENA A;  1WHQ A;  3RMP A;  4X62 E;  2EN4 A;  1T39 A;  2EM0 A;  2JXP A;  2EOH A;  2DSY A;  2G7H A;  3BF2 A;  1LLM C;  4R8O A;  1GQE A;  2EPL X;  5FLX C;  2CPN A;  4B3S E;  2VF1 A;  3LLH A;  4BBY A;  4DV2 E;  1P47 A;  2GLI A;  2I13 A;  2YTP A;  2LUQ A;  3AV0 A;  1NCS A;  1A1G A;  2JP9 A;  1N32 E;  1PJS A;  2PRT A;  1RMD A;  1YZ9 A;  2DLQ A;  1A1H A;  2YRM A;  3F6G A;  1T4L B;  2BBG A;  2NUF A;  4IJD A;  2RSI A;  1FKA E;  4I8O A;  2EWL A;  2EOO A;  1ZR9 A;  1NEI A;  4DR6 E;  2YTJ A;  4R2R A;  3MHS C;  2GPI A;  1WJP A;  4JI5 E;  1X49 A;  2JY9 A;  5F3W A;  5A2Q C;  3EPH A;  3HPS A;  2JR1 A;  2B7T A;  2V86 A;  4ZYG A;  2KON A;  2V88 A;  4F2J C;  1XMO E;  3EPJ A;  4M2Z A;  2VQF E;  4B3R E;  2JWO A;  4DR2 E;  1G2F C;  1X6E A;  3BBG A;  2Q8U A;  1IBM E;  5ADZ A;  2FTX B;  1YYW A;  2WCC 3;  4F9A B;  2V83 A;  2L8T A;  4LF6 E;  1HNZ E;  4R2P A;  2L3J A;  5A6B D;  2LTR A;  2EL6 A;  5A6B A;  2LO3 A;  2M9A A;  2I9I A;  5CFF E;  3P1X A;  2EM4 A;  2RSM A;  4NXM E;  1XNR E;  2EQ0 A;  2EPO A;  1N33 E;  4LFB E;  1KYQ A;  3C6M A;  4BC7 A;  1SFE A;  4FK5 C;  3ECR A;  1T4N A;  2R1F A;  5IV8 B;  3FIG A;  2BB8 A;  1JK1 A;  4HTG A;  2L6M A;  4LFC E;  3HPZ A;  2CTD A;  1HNX E;  2EMF A;  1N36 E;  2E1M A;  2H36 X;  4RHB B;  2EN1 A;  1YSA C;  3KZZ A;  1IQS A;  1UIL A;  2V89 A;  4BHB A;  3VYY A;  2YTF A;  2ZM6 E;  2YTG A;  1YUI A;  2EPP A;  2EMG A;  2DIX A;  3HXL A;  4O43 A;  4DR4 E;  1STU A;  4X8W A;  1T38 A;  2EMB A;  1A1K A;  1AH5 A;  1I94 E;  4R2C A;  2UUA E;  2VRD A;  1YPN A;  5LMN E;  2UU9 E;  4DV6 E;  1X6F A;  1YYO A;  2EOE A;  5KL3 A;  1UHZ A;  4WYQ B;  4O5G A;  4ZYH A;  3J81 C;  2EN6 A;  5AE1 A;  1GZ6 A;  1PJQ A;  4R2Q A;  4NZV A;  2ELZ A;  4TUG A;  1ZAA C;  2V8Q B;  4WX9 A;  1A1F A;  4DUZ E;  4LF5 E;  4LU9 A;  2EOM A;  2EPK X;  2M7Q A;  1EH6 A;  2MKD A;  1RQ0 A;  2EE8 A;  1TN9 A;  2NUG A;  2EMH A;  2EOR A;  3T1Y E;  4F6N A;  3IWC A;  3AUZ A;  2RTX A;  1WRJ A;  4DR3 E;  5A6A A;  2JPA A;  1L4S A;  2EPX A;  2EMK A;  1IQO A;  5KL2 A;  4IS1 C;  2YZT A;  1FJG E;  2UUB E;  3C6K A;  2YTN A;  2V85 A;  2LBS B;  3ADL A;  4Q35 B;  2KOU A;  4KHP E;  4M0V A;  4F54 A;  4Q28 A;  2EM7 A;  2A25 A;  3IWB A;  1UBD C;  1YYK A;  3C4T A;  5BR8 E;  2ODR D;  2CSH A;  2LMZ A;  2EQ3 A;  2V87 A;  4J8Z A;  1YUJ A;  1X3C A;  2KHX A;  4OOG C;  2HC5 A;  2EMZ A;  2EPR A;  2EPZ A;  4DV7 E;  3UK3 C;  1UN6 B;  1ZBT A;  2EML A;  3OTO E;  2DMI A;  4K0K E;  2WBU A;  2ENH A;  2EM5 A;  4MLQ A;  4X64 E;  4WXC A;  1MEY C;  2L92 A;  2JVA A;  2YPN A;  3KZY A;  5IXM B;  4JI1 E;  4F9B B;  2EM3 A;  4NXN E;  1WHN A;  4ZYE A;  1RC7 A;  2YSO A;  4B3M E;  2NAB A;  2HHH E;  1IMU A;  1KJK A;  1PDA A;  2WBT A;  2LRS A; 
#chains in the Genus database with same CATH homology
 1G2D C;  2YTF A;  2YTG A;  1YUI A;  2EPP A;  2EMG A;  5KL5 A;  2YTI A;  2EPC A;  2EMC A;  1B69 A;  3VHT B;  2ELY A;  1Z1B A;  2EOF A;  1AAY A;  2EOQ A;  2EM9 A;  3EPL A;  1TF6 A;  2EMB A;  1A1K A;  2EPA A;  2MDG A;  1A1J A;  2EN7 A;  4R2C A;  2VRD A;  1A1L A;  2ENC A;  4R2A A;  1X6F A;  1X6H A;  2ENA A;  1BBO A;  2EOE A;  2EL4 A;  5KL3 A;  2EOX A;  2EN6 A;  2EN4 A;  2EM0 A;  2YSP A;  2EOH A;  2EOS A;  4R2Q A;  1LLM C;  2ELZ A;  1ZAA C;  2MKN A;  3M99 B;  2EMX A;  1A1F A;  2EOM A;  2MKD A;  4R2E A;  1P47 A;  2GLI A;  2EMY A;  2EN3 A;  4WSG A;  2YTP A;  5KL7 A;  2I13 A;  1NCS A;  2EE8 A;  1TN9 A;  1A1G A;  2JP9 A;  2EM2 A;  5KL4 A;  1TF3 A;  4R2S A;  2EMH A;  2PRT A;  1DGC A;  2EOR A;  1RMD A;  2DLQ A;  1F2I G;  1A1H A;  2YRM A;  4F6N A;  2EMI A;  2YTQ A;  2CT1 A;  4IJD A;  2RSI A;  2LV2 A;  2JPA A;  1A1I A;  2EPX A;  2EMK A;  2EOO A;  1ZR9 A;  5KL2 A;  4IS1 C;  2EP3 A;  4GZN C;  2EN8 A;  2HGH A;  4M9V C;  2YTJ A;  4R2R A;  2EM8 A;  3MHS C;  2EN2 A;  2YTD A;  2YTN A;  1WJP A;  2J7J A;  3MHH C;  2EM6 A;  2YTE A;  2YTO A;  3EPH A;  2EMW A;  4F2J C;  2EM7 A;  3EPJ A;  2A25 A;  2EMA A;  3EPK A;  1BB8 A;  2YU5 A;  4R2D A;  5KL6 A;  2EOY A;  1G2F C;  1UBD C;  1X6E A;  4X9J A;  2EPU A;  2CSH A;  2E72 A;  2EJ4 A;  2WCC 3;  2EQ3 A;  4F6M A;  2EL5 A;  1YUJ A;  4R2P A;  1X3C A;  2EOI A;  2EL6 A;  2EOZ A;  2EMZ A;  2EPR A;  2EPZ A;  2GHF A;  3UK3 C;  2ADR A;  2YU8 A;  2LO3 A;  2EQ1 A;  2M9A A;  2YRH A;  1JK2 A;  2EM4 A;  1UN6 B;  2EQ0 A;  2EML A;  2DMI A;  2WBS A;  2ENH A;  2EM5 A;  2WBU A;  1X5W A;  2YRK A;  1MEY C;  4FK5 C;  2LVH A;  1ZU1 A;  2DLK A;  2R1F A;  2EM3 A;  2DGC A;  2BB8 A;  1JK1 A;  2LT7 A;  2D9H A;  2RPC A;  2YSO A;  2CTD A;  2EMF A;  2NAB A;  2EOJ A;  1KJK A;  2EN1 A;  2DRP A;  1YSA C;  2WBT A;  2LCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...