1DGCA

The x-ray structure of the gcn4-bzip bound to atf/creb site dna shows the complex depends on dna flexibility
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
total genus 24
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1dgcA00
2J7JA 2HGHA 4R2CA 2EMCA 2EN2A 2EMWA 2EMXA 2ELYA 1UBDC 2EQ3A 4F6MA 3VHTB 1A1FA 3MHSC 3M99B 2LVHA 1X6FA 2EORA 2YU8A 2EMKA 1BBOA 3MHHC 2YRHA 2EOEA 1MEYC 2ENAA 2LV2A 4R2SA 1P47A 1KJKA 2EM0A 2EL5A 2EMZA 2YTIA 1BB8A 2EOSA 2DLKA 2LCEA 2DLQA 1UN6B 2YTOA 2EOFA 4R2EA 2CSHA 2EPAA 1X3CA 2NABA 2YTJA 2DGCA 2EMYA 2LT7A 2YSPA 1X6HA 2EN7A 1B69A 2EM5A 2A25A 1TF3A 1YUIA 2RPCA 4R2QA 2YTQA 3EPLA 2WBTA 2YSOA 2YRMA 2EMLA 2EN6A 2LO3A 3UK3C 2WBSA 1JK2A 4X9JA 4R2AA 1JK1A 2GHFA 2YTNA 2EPRA 2R1FA 4IS1C 2EMAA 2EOZA 2M9AA 2YTFA 5KL3A 2EPZA 2EN8A 1YUJA 5KL4A 4F2JC 1TN9A 2EL4A 1NCSA 2YTGA 2EM6A 4M9VC 2JPAA 2EE8A 4F6NA 2ENCA 2EOXA 2EMGA 2MDGA 1G2FC 1A1HA 2EMIA 2MKNA 2EPPA 5KL5A 4R2RA 2VRDA 5KL6A 1WJPA 2CT1A 2EOJA 1X5WA 3EPHA 4WSGA 2PRTA 2EOOA 2CTDA 2EJ4A 2WBUA 2D9HA 4GZNC 2EM3A 1A1LA 2EPUA 4IJDA 2EM9A 2EM2A 1A1JA 4R2PA 4R2DA 2YTEA 2EM4A 1LLMC 2EN1A 3EPKA 1RMDA 2I13A 1A1KA 2YTPA 2DRPA 2EM8A 1YSAC 2ADRA 2E72A 1ZU1A 1TF6A 1ZAAC 5KL7A 1AAYA 2YRKA 2EOYA 2BB8A 2EOIA 2EOQA 2EQ1A 2GLIA 1ZR9A 2EN3A 2EN4A 1A1IA 2YTDA 2EQ0A 2EOMA 2WCC3 4FK5C 3EPJA 2EL6A 2ELZA 2RSIA 2MKDA 2EMHA 2YU5A 1DGCA 1X6EA 2ENHA 2EP3A 5KL2A 1F2IG 1A1GA 2EPXA 2EMBA 2EOHA 1Z1BA 2DMIA 2JP9A 2EPCA 2EMFA 2EM7A 1G2DC
chains in the Genus database with same CATH superfamily
2JWOA 2EN2A 3VK6A 1WHQA 4LF4E 3MHSC 2LVHA 5T6JA 2YU8A 3ADJA 2HHHE 2YRHA 2L2KB 4KHPE 2ENAA 1P47A 1X49A 2EM0A 3C6KA 2V8QB 4ZYDA 1EH6A 1DQ3A 4LFAE 2L2NA 2RS6A 4DV0E 2KOUA 2LBSB 1N3GA 5IV8B 4I8OA 3BIDA 3HPSA 1UN6B 2YPNA 4R03A 4TUGA 1IMUA 2FGGA 4DMIA 2L92A 1TF3A 4YHHE 3QG5C 4R2QA 1GTKA 3AV0A 5DNYA 1N33E 4JI8E 2LO3A 1MGTA 4R2AA 1JK1A 4JI3E 4X62E 4P7DA 1IBLE 1J26A 2YZTA 4X65E 2EMAA 5A6JA 1IBKE 3HPZA 2B7TA 2EN8A 1IBME 1YUJA 2UUAE 1TN9A 1GQEA 1DI2A 4BS9A 2EM6A 4M9VC 4JI6E 2JPAA 2EE8A 4F6NA 2ENCA 1A1HA 4BHBA 5KL6A 2CT1A 4DUYE 3EPHA 2NUFA 2PRTA 2LTRA 4GZNC 3JU0A 2EPUA 2EM2A 5FLXC 4AQYE 4NHRA 4DV4E 1LLMC 4LF7E 3JAMC 2DIXA 2M4IA 2ADRA 2R76A 3OTOE 1QNTA 3MSWA 4F9AB 1ZU1A 3C6MA 1PJTA 2HJJA 2YWQA 4N4RB 4DKKA 5KL7A 3EQ1A 2EQ1A 2K7IA 1ZR9A 4M0VA 2EN4A 2NUGA 2EQ0A 3J7Yp 4FK5C 3EPJA 2UU9E 2VF1A 5AE3A 1SFEA 1AH5A 4DR2E 2NUEA 1F2IG 1A1GA 2L3JA 1HNZE 5AE2A 2WZOA 2EMFA 1YYKA 2J7JA 2EMCA 2ZM6E 2EQ3A 3M99B 4M2ZA 4ZYGA 2LV2A 3J81C 2UUBE 4LF8E 4B3ME 1BB8A 4LF9E 2EOSA 4JI5E 4LTYA 2BBGA 4R2EA 2YTJA 2V87A 2YSPA 1X6HA 4X8WA 1B69A 4JI1E 3THNA 2YTQA 4TUIA 1EH8A 2LJHA 5IWAE 2WBTA 2YSOA 1XNRE 2V88A 5LMNE 2EMLA 1ZBTA 1N36E 3F6GA 2M1SA 4BC7A 2Q8UA 2YTNA 2DMYA 2R1FA 4B3RE 1SR9A 3IWDA 3KZZA 2EOZA 4GEQB 3J80C 4MLVA 4BC9A 4DUZE 1L4SA 2UUCE 4WYQB 1WHNA 2EPLX 5KL4A 2HC5A 2EL4A 4DR1E 3KWRA 4X64E 4DR3E 1XNQE 1NEIA 1G2FC 2EMIA 2MKNA 2EPPA 1WXRA 2EOJA 1X5WA 5LMUE 2JY9A 4WSGA 4DV3E 2EOOA 3ECRA 2CTDA 2JYAA 1T4LB 2N8XA 4KWYA 1N32E 1N34E 4R2PA 4DR5E 1UILA 2YTEA 2EN1A 3HXLA 2KHXA 2DRPA 2EM8A 2FTXB 1YSAC 2M7QA 2EPKX 1BBGA 4WFTA 2EWLA 1GZ6A 3VYXA 5LLQA 2EOYA 3L00A 4DV1E 2EOQA 1YYOA 1O0WA 4BHCA 4RH8A 4DV6E 2L8TA 2LUQA 4BCAA 2LJUA 2EL6A 4O24A 2RSIA 2MKDA 2YU5A 5AE1A 4O5GA 1X6EA 4YY3E 4BMJA 5CFFE 2B7VA 1WRJA 1ZBQA 2EMBA 2UXDE 2EPCA 2EM7A 4MLQA 4LFBE 1G2DC 3TQMA 4R2CA 5LL6R 3T1YE 2EMXA 2ELYA 4R8OA 3VHTB 1X6FA 2L33A 1BBOA 5A2QC 2EOEA 3LMLA 1MEYC 4R2SA 4NXNE 2ODRD 2YTIA 4O4KA 3C4TA 3BBGA 2LCEA 5IXMB 4K0KE 4B3TE 4Q35B 3IWBA 3BF2A 2DLQA 2YTOA 2EOFA 2EPAA 2LMZA 2LTSA 4GKKE 2FV4B 1FJGE 2EN7A 1X47A 2EM5A 2A25A 1YUIA 5AASA 1FKAE 3EPLA 1T39A 4JI2E 2EN6A 4WXDA 2B9DA 5A6KA 2WBSA 1JK2A 2EPRA 4DR7E 3C4BA 3RMPA 4HEIA 2NA2A 2MC6A 2MC5A 1XMQE 1IQSA 4F2JC 1HR0E 3THOB 2MDRA 2JXPA 2N3GA 2DSYA 4DV7E 1STUA 2JR1A 2EMGA 5KL5A 4L5NC 2VQFE 3ZOQB 2ODRC 1HNWE 2RSMA 3OMLA 2EJ4A 2D9HA 5A6BA 5BR8E 4IJDA 2UXBE 4F9CB 1I94E 2V85A 3JTZA 1X48A 3EPKA 1RMDA 2I13A 3AUZA 5TSEA 2YTPA 1A1KA 2E72A 4F9BB 2GPIA 3IWCA 1TF6A 4WPYA 1ZAAC 2V89A 2EOIA 2K4VA 2V86A 2IHR1 2YTDA 4JI0E 2EOMA 1QU6A 2VE7C 2RTXA 3HTXA 1RC7A 2ENHA 1HNXE 5KL2A 4JI4E 4ZYEA 2JP9A 2N3HA 1T4OA 2HGHA 1PJQA 2EMWA 1UBDC 4F6MA 1A1FA 3DJWA 5IT9C 4JYAE 2EORA 2E1MA 2EMKA 3MHHC 1UHZA 1KJKA 2LE2A 1YYWA 2L3CA 2EL5A 2EMZA 4LFCE 4P78A 1T38A 4RHBB 2DLKA 2JOXA 2RQLA 2RS7A 5A6AA 3H09A 2VQEE 4NXME 2CPNA 4OOGC 2LRSA 5F3WA 2V83A 4OX9E 2EZ6A 2CSHA 3P1XA 1X3CA 2NABA 2DB2A 1KYQA 2EMYA 2LT7A 3T1HE 2DGCA 4JI7E 1YZ9A 4GKJE 2RPCA 3BGHA 1YPNA 1XMOE 2E5LE 5AC5A 2YRMA 2EPMX 2KONA 1PDAA 3UK3C 4X9JA 2B3TB 2GHFA 4WSPA 2G7HA 4NZVA 5A6BD 2JVAA 3ADGA 4IS1C 5KL3A 2M9AA 2YTFA 2EPOA 3ADIA 2L6MA 1EKZA 2EPZA 4J8ZA 1T4NA 2YT4A 3DF6A 1NCSA 2YTGA 1YFHA 4LU9A 2EPNA 2I9IA 2EOXA 2MDGA 1PJSA 2H36X 4R2RA 2VRDA 1WJPA 4O43A 2F8BA 2WBUA 1A1LA 2EM3A 4BBYA 2F4VE 1RQ0A 2EM9A 3FIGA 4M30A 1A1JA 2JOBA 4R2DA 2EM4A 2LUPB 3KZYA 5ADZA 4JV5E 3ADLA 4KZSA 4ZYHA 4DR6E 3HQ1A 1PKPA 4L8NA 1AAYA 2YRKA 4Q28A 4DV5E 4LF5E 3J7AG 2BB8A 1EH7A 2GLIA 2EN3A 1A1IA 2WCC3 4DV2E 3LLHA 4WXCA 3VYYA 4HTGA 2ELZA 4DR4E 4WX9A 4F54A 2EMHA 4B3SE 1DGCA 3F6HA 2EP3A 4X66E 3K6QA 1IQOA 2EPXA 2EOHA 1Z1BA 2L2MA 2DMIA 1J5EE 5AC4A 4LF6E 2UXCE 5A69A
chains in the Genus database with same CATH topology
2J7JA 2HGHA 4R2CA 2EMCA 2EN2A 2EMWA 2EMXA 2ELYA 1UBDC 2EQ3A 4F6MA 3VHTB 1A1FA 3MHSC 3M99B 2LVHA 1X6FA 2EORA 2YU8A 2EMKA 1BBOA 3MHHC 2YRHA 2EOEA 1MEYC 2ENAA 2LV2A 4R2SA 1P47A 1KJKA 2EM0A 2EL5A 2EMZA 2YTIA 1BB8A 2EOSA 2DLKA 2LCEA 2DLQA 1UN6B 2YTOA 2EOFA 4R2EA 2CSHA 2EPAA 1X3CA 2NABA 2YTJA 2DGCA 2EMYA 2LT7A 2YSPA 1X6HA 2EN7A 1B69A 2EM5A 2A25A 1TF3A 1YUIA 2RPCA 4R2QA 2YTQA 3EPLA 2WBTA 2YSOA 2YRMA 2EMLA 2EN6A 2LO3A 3UK3C 2WBSA 1JK2A 4X9JA 4R2AA 1JK1A 2GHFA 2YTNA 2EPRA 2R1FA 4IS1C 2EMAA 2EOZA 2M9AA 2YTFA 5KL3A 2EPZA 2EN8A 1YUJA 5KL4A 4F2JC 1TN9A 2EL4A 1NCSA 2YTGA 2EM6A 4M9VC 2JPAA 2EE8A 4F6NA 2ENCA 2EOXA 2EMGA 2MDGA 1G2FC 1A1HA 2EMIA 2MKNA 2EPPA 5KL5A 4R2RA 2VRDA 5KL6A 1WJPA 2CT1A 2EOJA 1X5WA 3EPHA 4WSGA 2PRTA 2EOOA 2CTDA 2EJ4A 2WBUA 2D9HA 4GZNC 2EM3A 1A1LA 2EPUA 4IJDA 2EM9A 2EM2A 1A1JA 4R2PA 4R2DA 2YTEA 2EM4A 1LLMC 2EN1A 3EPKA 1RMDA 2I13A 1A1KA 2YTPA 2DRPA 2EM8A 1YSAC 2ADRA 2E72A 1ZU1A 1TF6A 1ZAAC 5KL7A 1AAYA 2YRKA 2EOYA 2BB8A 2EOIA 2EOQA 2EQ1A 2GLIA 1ZR9A 2EN3A 2EN4A 1A1IA 2YTDA 2EQ0A 2EOMA 2WCC3 4FK5C 3EPJA 2EL6A 2ELZA 2RSIA 2MKDA 2EMHA 2YU5A 1DGCA 1X6EA 2ENHA 2EP3A 5KL2A 1F2IG 1A1GA 2EPXA 2EMBA 2EOHA 1Z1BA 2DMIA 2JP9A 2EPCA 2EMFA 2EM7A 1G2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7J A;  2HGH A;  4R2C A;  2EMC A;  2EN2 A;  2EMW A;  2EMX A;  2ELY A;  1UBD C;  2EQ3 A;  4F6M A;  3VHT B;  1A1F A;  3MHS C;  3M99 B;  2LVH A;  1X6F A;  2EOR A;  2YU8 A;  2EMK A;  1BBO A;  3MHH C;  2YRH A;  2EOE A;  1MEY C;  2ENA A;  2LV2 A;  4R2S A;  1P47 A;  1KJK A;  2EM0 A;  2EL5 A;  2EMZ A;  2YTI A;  1BB8 A;  2EOS A;  2DLK A;  2LCE A;  2DLQ A;  1UN6 B;  2YTO A;  2EOF A;  4R2E A;  2CSH A;  2EPA A;  1X3C A;  2NAB A;  2YTJ A;  2DGC A;  2EMY A;  2LT7 A;  2YSP A;  1X6H A;  2EN7 A;  1B69 A;  2EM5 A;  2A25 A;  1TF3 A;  1YUI A;  2RPC A;  4R2Q A;  2YTQ A;  3EPL A;  2WBT A;  2YSO A;  2YRM A;  2EML A;  2EN6 A;  2LO3 A;  3UK3 C;  2WBS A;  1JK2 A;  4X9J A;  4R2A A;  1JK1 A;  2GHF A;  2YTN A;  2EPR A;  2R1F A;  4IS1 C;  2EMA A;  2EOZ A;  2M9A A;  2YTF A;  5KL3 A;  2EPZ A;  2EN8 A;  1YUJ A;  5KL4 A;  4F2J C;  1TN9 A;  2EL4 A;  1NCS A;  2YTG A;  2EM6 A;  4M9V C;  2JPA A;  2EE8 A;  4F6N A;  2ENC A;  2EOX A;  2EMG A;  2MDG A;  1G2F C;  1A1H A;  2EMI A;  2MKN A;  2EPP A;  5KL5 A;  4R2R A;  2VRD A;  5KL6 A;  1WJP A;  2CT1 A;  2EOJ A;  1X5W A;  3EPH A;  4WSG A;  2PRT A;  2EOO A;  2CTD A;  2EJ4 A;  2WBU A;  2D9H A;  4GZN C;  2EM3 A;  1A1L A;  2EPU A;  4IJD A;  2EM9 A;  2EM2 A;  1A1J A;  4R2P A;  4R2D A;  2YTE A;  2EM4 A;  1LLM C;  2EN1 A;  3EPK A;  1RMD A;  2I13 A;  1A1K A;  2YTP A;  2DRP A;  2EM8 A;  1YSA C;  2ADR A;  2E72 A;  1ZU1 A;  1TF6 A;  1ZAA C;  5KL7 A;  1AAY A;  2YRK A;  2EOY A;  2BB8 A;  2EOI A;  2EOQ A;  2EQ1 A;  2GLI A;  1ZR9 A;  2EN3 A;  2EN4 A;  1A1I A;  2YTD A;  2EQ0 A;  2EOM A;  2WCC 3;  4FK5 C;  3EPJ A;  2EL6 A;  2ELZ A;  2RSI A;  2MKD A;  2EMH A;  2YU5 A;  1DGC A;  1X6E A;  2ENH A;  2EP3 A;  5KL2 A;  1F2I G;  1A1G A;  2EPX A;  2EMB A;  2EOH A;  1Z1B A;  2DMI A;  2JP9 A;  2EPC A;  2EMF A;  2EM7 A;  1G2D C; 
#chains in the Genus database with same CATH topology
 2JWO A;  2EN2 A;  3VK6 A;  1WHQ A;  4LF4 E;  3MHS C;  2LVH A;  5T6J A;  2YU8 A;  3ADJ A;  2HHH E;  2YRH A;  2L2K B;  4KHP E;  2ENA A;  1P47 A;  1X49 A;  2EM0 A;  3C6K A;  2V8Q B;  4ZYD A;  1EH6 A;  1DQ3 A;  4LFA E;  2L2N A;  2RS6 A;  4DV0 E;  2KOU A;  2LBS B;  1N3G A;  5IV8 B;  4I8O A;  3BID A;  3HPS A;  1UN6 B;  2YPN A;  4R03 A;  4TUG A;  1IMU A;  2FGG A;  4DMI A;  2L92 A;  1TF3 A;  4YHH E;  3QG5 C;  4R2Q A;  1GTK A;  3AV0 A;  5DNY A;  1N33 E;  4JI8 E;  2LO3 A;  1MGT A;  4R2A A;  1JK1 A;  4JI3 E;  4X62 E;  4P7D A;  1IBL E;  1J26 A;  2YZT A;  4X65 E;  2EMA A;  5A6J A;  1IBK E;  3HPZ A;  2B7T A;  2EN8 A;  1IBM E;  1YUJ A;  2UUA E;  1TN9 A;  1GQE A;  1DI2 A;  4BS9 A;  2EM6 A;  4M9V C;  4JI6 E;  2JPA A;  2EE8 A;  4F6N A;  2ENC A;  1A1H A;  4BHB A;  5KL6 A;  2CT1 A;  4DUY E;  3EPH A;  2NUF A;  2PRT A;  2LTR A;  4GZN C;  3JU0 A;  2EPU A;  2EM2 A;  5FLX C;  4AQY E;  4NHR A;  4DV4 E;  1LLM C;  4LF7 E;  3JAM C;  2DIX A;  2M4I A;  2ADR A;  2R76 A;  3OTO E;  1QNT A;  3MSW A;  4F9A B;  1ZU1 A;  3C6M A;  1PJT A;  2HJJ A;  2YWQ A;  4N4R B;  4DKK A;  5KL7 A;  3EQ1 A;  2EQ1 A;  2K7I A;  1ZR9 A;  4M0V A;  2EN4 A;  2NUG A;  2EQ0 A;  3J7Y p;  4FK5 C;  3EPJ A;  2UU9 E;  2VF1 A;  5AE3 A;  1SFE A;  1AH5 A;  4DR2 E;  2NUE A;  1F2I G;  1A1G A;  2L3J A;  1HNZ E;  5AE2 A;  2WZO A;  2EMF A;  1YYK A;  2J7J A;  2EMC A;  2ZM6 E;  2EQ3 A;  3M99 B;  4M2Z A;  4ZYG A;  2LV2 A;  3J81 C;  2UUB E;  4LF8 E;  4B3M E;  1BB8 A;  4LF9 E;  2EOS A;  4JI5 E;  4LTY A;  2BBG A;  4R2E A;  2YTJ A;  2V87 A;  2YSP A;  1X6H A;  4X8W A;  1B69 A;  4JI1 E;  3THN A;  2YTQ A;  4TUI A;  1EH8 A;  2LJH A;  5IWA E;  2WBT A;  2YSO A;  1XNR E;  2V88 A;  5LMN E;  2EML A;  1ZBT A;  1N36 E;  3F6G A;  2M1S A;  4BC7 A;  2Q8U A;  2YTN A;  2DMY A;  2R1F A;  4B3R E;  1SR9 A;  3IWD A;  3KZZ A;  2EOZ A;  4GEQ B;  3J80 C;  4MLV A;  4BC9 A;  4DUZ E;  1L4S A;  2UUC E;  4WYQ B;  1WHN A;  2EPL X;  5KL4 A;  2HC5 A;  2EL4 A;  4DR1 E;  3KWR A;  4X64 E;  4DR3 E;  1XNQ E;  1NEI A;  1G2F C;  2EMI A;  2MKN A;  2EPP A;  1WXR A;  2EOJ A;  1X5W A;  5LMU E;  2JY9 A;  4WSG A;  4DV3 E;  2EOO A;  3ECR A;  2CTD A;  2JYA A;  1T4L B;  2N8X A;  4KWY A;  1N32 E;  1N34 E;  4R2P A;  4DR5 E;  1UIL A;  2YTE A;  2EN1 A;  3HXL A;  2KHX A;  2DRP A;  2EM8 A;  2FTX B;  1YSA C;  2M7Q A;  2EPK X;  1BBG A;  4WFT A;  2EWL A;  1GZ6 A;  3VYX A;  5LLQ A;  2EOY A;  3L00 A;  4DV1 E;  2EOQ A;  1YYO A;  1O0W A;  4BHC A;  4RH8 A;  4DV6 E;  2L8T A;  2LUQ A;  4BCA A;  2LJU A;  2EL6 A;  4O24 A;  2RSI A;  2MKD A;  2YU5 A;  5AE1 A;  4O5G A;  1X6E A;  4YY3 E;  4BMJ A;  5CFF E;  2B7V A;  1WRJ A;  1ZBQ A;  2EMB A;  2UXD E;  2EPC A;  2EM7 A;  4MLQ A;  4LFB E;  1G2D C;  3TQM A;  4R2C A;  5LL6 R;  3T1Y E;  2EMX A;  2ELY A;  4R8O A;  3VHT B;  1X6F A;  2L33 A;  1BBO A;  5A2Q C;  2EOE A;  3LML A;  1MEY C;  4R2S A;  4NXN E;  2ODR D;  2YTI A;  4O4K A;  3C4T A;  3BBG A;  2LCE A;  5IXM B;  4K0K E;  4B3T E;  4Q35 B;  3IWB A;  3BF2 A;  2DLQ A;  2YTO A;  2EOF A;  2EPA A;  2LMZ A;  2LTS A;  4GKK E;  2FV4 B;  1FJG E;  2EN7 A;  1X47 A;  2EM5 A;  2A25 A;  1YUI A;  5AAS A;  1FKA E;  3EPL A;  1T39 A;  4JI2 E;  2EN6 A;  4WXD A;  2B9D A;  5A6K A;  2WBS A;  1JK2 A;  2EPR A;  4DR7 E;  3C4B A;  3RMP A;  4HEI A;  2NA2 A;  2MC6 A;  2MC5 A;  1XMQ E;  1IQS A;  4F2J C;  1HR0 E;  3THO B;  2MDR A;  2JXP A;  2N3G A;  2DSY A;  4DV7 E;  1STU A;  2JR1 A;  2EMG A;  5KL5 A;  4L5N C;  2VQF E;  3ZOQ B;  2ODR C;  1HNW E;  2RSM A;  3OML A;  2EJ4 A;  2D9H A;  5A6B A;  5BR8 E;  4IJD A;  2UXB E;  4F9C B;  1I94 E;  2V85 A;  3JTZ A;  1X48 A;  3EPK A;  1RMD A;  2I13 A;  3AUZ A;  5TSE A;  2YTP A;  1A1K A;  2E72 A;  4F9B B;  2GPI A;  3IWC A;  1TF6 A;  4WPY A;  1ZAA C;  2V89 A;  2EOI A;  2K4V A;  2V86 A;  2IHR 1;  2YTD A;  4JI0 E;  2EOM A;  1QU6 A;  2VE7 C;  2RTX A;  3HTX A;  1RC7 A;  2ENH A;  1HNX E;  5KL2 A;  4JI4 E;  4ZYE A;  2JP9 A;  2N3H A;  1T4O A;  2HGH A;  1PJQ A;  2EMW A;  1UBD C;  4F6M A;  1A1F A;  3DJW A;  5IT9 C;  4JYA E;  2EOR A;  2E1M A;  2EMK A;  3MHH C;  1UHZ A;  1KJK A;  2LE2 A;  1YYW A;  2L3C A;  2EL5 A;  2EMZ A;  4LFC E;  4P78 A;  1T38 A;  4RHB B;  2DLK A;  2JOX A;  2RQL A;  2RS7 A;  5A6A A;  3H09 A;  2VQE E;  4NXM E;  2CPN A;  4OOG C;  2LRS A;  5F3W A;  2V83 A;  4OX9 E;  2EZ6 A;  2CSH A;  3P1X A;  1X3C A;  2NAB A;  2DB2 A;  1KYQ A;  2EMY A;  2LT7 A;  3T1H E;  2DGC A;  4JI7 E;  1YZ9 A;  4GKJ E;  2RPC A;  3BGH A;  1YPN A;  1XMO E;  2E5L E;  5AC5 A;  2YRM A;  2EPM X;  2KON A;  1PDA A;  3UK3 C;  4X9J A;  2B3T B;  2GHF A;  4WSP A;  2G7H A;  4NZV A;  5A6B D;  2JVA A;  3ADG A;  4IS1 C;  5KL3 A;  2M9A A;  2YTF A;  2EPO A;  3ADI A;  2L6M A;  1EKZ A;  2EPZ A;  4J8Z A;  1T4N A;  2YT4 A;  3DF6 A;  1NCS A;  2YTG A;  1YFH A;  4LU9 A;  2EPN A;  2I9I A;  2EOX A;  2MDG A;  1PJS A;  2H36 X;  4R2R A;  2VRD A;  1WJP A;  4O43 A;  2F8B A;  2WBU A;  1A1L A;  2EM3 A;  4BBY A;  2F4V E;  1RQ0 A;  2EM9 A;  3FIG A;  4M30 A;  1A1J A;  2JOB A;  4R2D A;  2EM4 A;  2LUP B;  3KZY A;  5ADZ A;  4JV5 E;  3ADL A;  4KZS A;  4ZYH A;  4DR6 E;  3HQ1 A;  1PKP A;  4L8N A;  1AAY A;  2YRK A;  4Q28 A;  4DV5 E;  4LF5 E;  3J7A G;  2BB8 A;  1EH7 A;  2GLI A;  2EN3 A;  1A1I A;  2WCC 3;  4DV2 E;  3LLH A;  4WXC A;  3VYY A;  4HTG A;  2ELZ A;  4DR4 E;  4WX9 A;  4F54 A;  2EMH A;  4B3S E;  1DGC A;  3F6H A;  2EP3 A;  4X66 E;  3K6Q A;  1IQO A;  2EPX A;  2EOH A;  1Z1B A;  2L2M A;  2DMI A;  1J5E E;  5AC4 A;  4LF6 E;  2UXC E;  5A69 A; 
#chains in the Genus database with same CATH homology
 2J7J A;  2HGH A;  4R2C A;  2EMC A;  2EN2 A;  2EMW A;  2EMX A;  2ELY A;  1UBD C;  2EQ3 A;  4F6M A;  3VHT B;  1A1F A;  3MHS C;  3M99 B;  2LVH A;  1X6F A;  2EOR A;  2YU8 A;  2EMK A;  1BBO A;  3MHH C;  2YRH A;  2EOE A;  1MEY C;  2ENA A;  2LV2 A;  4R2S A;  1P47 A;  1KJK A;  2EM0 A;  2EL5 A;  2EMZ A;  2YTI A;  1BB8 A;  2EOS A;  2DLK A;  2LCE A;  2DLQ A;  1UN6 B;  2YTO A;  2EOF A;  4R2E A;  2CSH A;  2EPA A;  1X3C A;  2NAB A;  2YTJ A;  2DGC A;  2EMY A;  2LT7 A;  2YSP A;  1X6H A;  2EN7 A;  1B69 A;  2EM5 A;  2A25 A;  1TF3 A;  1YUI A;  2RPC A;  4R2Q A;  2YTQ A;  3EPL A;  2WBT A;  2YSO A;  2YRM A;  2EML A;  2EN6 A;  2LO3 A;  3UK3 C;  2WBS A;  1JK2 A;  4X9J A;  4R2A A;  1JK1 A;  2GHF A;  2YTN A;  2EPR A;  2R1F A;  4IS1 C;  2EMA A;  2EOZ A;  2M9A A;  2YTF A;  5KL3 A;  2EPZ A;  2EN8 A;  1YUJ A;  5KL4 A;  4F2J C;  1TN9 A;  2EL4 A;  1NCS A;  2YTG A;  2EM6 A;  4M9V C;  2JPA A;  2EE8 A;  4F6N A;  2ENC A;  2EOX A;  2EMG A;  2MDG A;  1G2F C;  1A1H A;  2EMI A;  2MKN A;  2EPP A;  5KL5 A;  4R2R A;  2VRD A;  5KL6 A;  1WJP A;  2CT1 A;  2EOJ A;  1X5W A;  3EPH A;  4WSG A;  2PRT A;  2EOO A;  2CTD A;  2EJ4 A;  2WBU A;  2D9H A;  4GZN C;  2EM3 A;  1A1L A;  2EPU A;  4IJD A;  2EM9 A;  2EM2 A;  1A1J A;  4R2P A;  4R2D A;  2YTE A;  2EM4 A;  1LLM C;  2EN1 A;  3EPK A;  1RMD A;  2I13 A;  1A1K A;  2YTP A;  2DRP A;  2EM8 A;  1YSA C;  2ADR A;  2E72 A;  1ZU1 A;  1TF6 A;  1ZAA C;  5KL7 A;  1AAY A;  2YRK A;  2EOY A;  2BB8 A;  2EOI A;  2EOQ A;  2EQ1 A;  2GLI A;  1ZR9 A;  2EN3 A;  2EN4 A;  1A1I A;  2YTD A;  2EQ0 A;  2EOM A;  2WCC 3;  4FK5 C;  3EPJ A;  2EL6 A;  2ELZ A;  2RSI A;  2MKD A;  2EMH A;  2YU5 A;  1DGC A;  1X6E A;  2ENH A;  2EP3 A;  5KL2 A;  1F2I G;  1A1G A;  2EPX A;  2EMB A;  2EOH A;  1Z1B A;  2DMI A;  2JP9 A;  2EPC A;  2EMF A;  2EM7 A;  1G2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...