1DGCA

The x-ray structure of the gcn4-bzip bound to atf/creb site dna shows the complex depends on dna flexibility
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 24
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1dgcA00
1G2DC 2JPAA 2LVHA 2J7JA 3MHSC 2YTOA 2EMKA 1G2FC 2JP9A 1ZAAC 2EMXA 3VHTB 1TN9A 2CT1A 2EPPA 2EN8A 2LCEA 5KL4A 2EM0A 2EM3A 2LV2A 2E72A 2EMHA 2EOFA 2BB8A 1LLMC 4R2RA 2EM2A 2WBTA 2YTFA 1AAYA 3EPHA 2D9HA 2WBUA 2MKNA 1A1HA 4M9VC 2EOEA 2EM7A 3UK3C 2EMBA 1BB8A 2EE8A 2EPCA 1A1JA 1ZU1A 2EORA 2DLQA 2EMIA 1A1GA 2EOHA 2EN1A 2EJ4A 2YTNA 1B69A 2GHFA 2YTIA 2ELYA 2ENAA 1F2IG 2EPUA 4FK5C 1KJKA 3M99B 1MEYC 1RMDA 5KL2A 2CSHA 1WJPA 4R2SA 4R2PA 2M9AA 2EPXA 2NABA 1NCSA 2PRTA 1A1LA 2EOMA 4F6MA 1TF6A 4F2JC 2EL4A 2VRDA 1JK2A 1A1KA 2YTJA 4GZNC 1X5WA 2LT7A 2EN7A 2GLIA 2R1FA 4R2AA 2YSOA 2I13A 2EPAA 2RPCA 2A25A 2EMAA 2YTEA 2EM8A 1UBDC 2DRPA 2EMFA 2LO3A 2WBSA 1UN6B 2EOIA 2WCC3 2EQ1A 4X9JA 1TF3A 2ADRA 1ZR9A 2EN2A 1Z1BA 2MDGA 2EMGA 4R2CA 2ENCA 1X6EA 2DMIA 2EOYA 2RSIA 1YUJA 2EN3A 2EL6A 2YU5A 2EM5A 2EPZA 2EQ3A 2EOJA 2YSPA 3MHHC 2YTQA 2EL5A 2EMCA 2EM6A 2EP3A 1P47A 1X3CA 2YRMA 2YRKA 4IJDA 1YSAC 2EOXA 5KL3A 4F6NA 1YUIA 2EN4A 2EMLA 5KL5A 2EOSA 3EPLA 1X6HA 1X6FA 2EM4A 2EMWA 2EOOA 2EPRA 2EMYA 2MKDA 1JK1A 2YRHA 2DGCA 2EOZA 4IS1C 3EPJA 2DLKA 5KL6A 1BBOA 2EM9A 2EQ0A 2YU8A 2ELZA 2EMZA 2YTDA 2YTGA 2CTDA 4R2EA 4R2QA 2HGHA 2YTPA 5KL7A 3EPKA 1A1IA 2ENHA 4R2DA 2EN6A 1DGCA 2EOQA 4WSGA 1A1FA
chains in the Genus database with same CATH superfamily
1G2DC 1J26A 2J7JA 3MHSC 2EMKA 1G2FC 2EZ6A 3VYYA 2V88A 1NEIA 2EPOA 4B3SE 2JOBA 4R2RA 1EH7A 2RS7A 1IQOA 5F3WA 4JI5E 2EPCA 4M0VA 1ZU1A 4GKKE 3BIDA 2RQLA 2YTNA 3C6KA 2L6MA 2GHFA 3VK6A 2LUPB 1AH5A 3OMLA 1STUA 4X66E 2FGGA 5FLXC 1DI2A 1WJPA 4LFAE 1FJGE 3BBGA 4R2PA 5LMNE 1L4SA 2M9AA 1EH8A 2UU9E 3ZOQB 2VQFE 4F2JC 1GZ6A 1JK2A 1J5EE 2I9IA 1HNXE 2KONA 2YSOA 1RQ0A 3TQMA 3IWCA 2YTEA 2DRPA 2B7VA 2WBSA 4F54A 2ODRC 2G7HA 2M4IA 1EKZA 1TF3A 1ZR9A 4R03A 2MDGA 2ZM6E 1IQSA 1IBME 2M1SA 4F9CB 3F6HA 4BC7A 5A6AA 2LTSA 1XNRE 5A6KA 2EQ3A 4B3TE 2L33A 3MHHC 2EMCA 1YPNA 3AV0A 4BCAA 2EOXA 3KZYA 1IBLE 4LU9A 2EMLA 3F6GA 2EOSA 3P1XA 2LE2A 4KHPE 2KHXA 1X6HA 2ODRD 2YT4A 5BR8E 2EM4A 2EOOA 4JI0E 2DGCA 1I94E 5AC4A 4LF7E 3ADGA 4DUZE 2EOZA 1BBOA 2EQ0A 2YU8A 5IV8B 2ENHA 4ZYEA 1T38A 4DV5E 2WZOA 3OTOE 4WYQB 4M30A 2LVHA 5IT9C 2KOUA 2JP9A 2EMXA 1TN9A 5A69A 4LTYA 3H09A 2CT1A 2EPPA 2EN8A 4TUIA 2LCEA 5KL4A 2LV2A 3HQ1A 1LLMC 2MDRA 1YFHA 2EM2A 2WBTA 1SFEA 4NHRA 2JOXA 2D9HA 2EPMX 1A1HA 2MKNA 4M2ZA 2NUFA 1QU6A 2E1MA 2VE7C 1PDAA 2NA2A 2CPNA 1T39A 3JU0A 2EN1A 2ENAA 4KWYA 1FKAE 5LLQA 4FK5C 3T1YE 3M99B 2BBGA 1RMDA 4BC9A 4DV7E 4R2SA 3BGHA 2LTRA 4LF4E 2NABA 5A2QC 1NCSA 2PRTA 2EOMA 2L92A 4F6MA 1TF6A 4L5NC 2JXPA 1HR0E 3QG5C 1WXRA 3J7Yp 1YYOA 2R1FA 4DUYE 4B3ME 4GKJE 1WRJA 1HNZE 2RPCA 2A25A 2L2MA 3THOB 1IMUA 3IWBA 2EM8A 1T4OA 1DQ3A 2LO3A 4KZSA 4R8OA 2YPNA 4ZYHA 2EOIA 1UN6B 3AUZA 2WCC3 4L8NA 4X9JA 1HNWE 2JYAA 2ADRA 1Z1BA 2EN2A 4P78A 3ECRA 2HHHE 4O5GA 2ENCA 1X6EA 2M7QA 2NUGA 2EOYA 2V85A 4F9AB 1YUJA 2UXDE 2RSMA 2EPZA 2N8XA 1X48A 2EPLX 3IWDA 4DKKA 2YSPA 4JI3E 5T6JA 1UHZA 2LBSB 2YRKA 2H36X 2Q8UA 1YSAC 5KL3A 4F6NA 1WHNA 3HPZA 5KL5A 2F4VE 5A6JA 5AE1A 4Q28A 2EPRA 3HXLA 4O4KA 1JK1A 2V87A 3MSWA 4IS1C 3EPJA 2LMZA 3HPSA 2EM9A 1BBGA 1IBKE 2LJUA 4WXDA 2ELZA 1MGTA 2HGHA 4R2QA 3LMLA 2UUAE 1DGCA 4Q35B 4DR1E 1GQEA 5LMUE 1ZAAC 3VHTB 2EM0A 2N3GA 4LF6E 5AC5A 2HC5A 2E72A 2EMHA 4O24A 2EOFA 2BB8A 4DMIA 4DV3E 5IXMB 2YWQA 4DR4E 3C4BA 5AASA 4DV2E 1AAYA 3EPHA 3LLHA 4NXNE 2WBUA 4M9VC 2EOEA 1RC7A 1QNTA 1GTKA 3UK3C 2IHR1 2JR1A 4BMJA 2V83A 1A1JA 4JI6E 3ADJA 2EOHA 2L2KB 4ZYGA 2E5LE 1XNQE 2EJ4A 4DR7E 5A6BA 2UXCE 2JWOA 2YTIA 4JI7E 2K4VA 2EPUA 4X62E 3DJWA 4WPYA 3C6MA 2EPXA 3ADIA 2VQEE 4JI8E 1A1LA 2UXBE 4X64E 2VRDA 1A1KA 4RHBB 5A6BD 2LT7A 4B3RE 2EN7A 2EPNA 4R2AA 3BF2A 1XMQE 2EMFA 2LRSA 4WX9A 4WXCA 2DSYA 4RH8A 5CFFE 2EQ1A 1O0WA 1UILA 2V89A 1T4LB 2FV4B 1PJQA 4DV6E 2L2NA 4LF9E 2B7TA 4DV0E 4R2CA 2JY9A 2LJHA 3C4TA 1X47A 2RSIA 3RMPA 2EM5A 1PJSA 1PKPA 4DR5E 4WSPA 2YTQA 2B9DA 2EL5A 5IWAE 2EM6A 1P47A 1X3CA 4OX9E 5AE3A 4NZVA 3FIGA 4LFCE 4P7DA 1YUIA 2EN4A 4MLVA 2V86A 3EPLA 2DIXA 4BHCA 1X6FA 2B3TB 1EH6A 2EMYA 2YRHA 4N4RB 5TSEA 2NUEA 2LUQA 2RTXA 2N3HA 2YTDA 2YTGA 1YZ9A 3VYXA 1N36E 2YTPA 4X8WA 2HJJA 3EPKA 1A1IA 4LFBE 4R2DA 2EN6A 1N34E 2GPIA 3L00A 2EPKX 2JPAA 2YTOA 4JI2E 2R76A 2EM3A 4LF8E 4AQYE 1WHQA 3KWRA 4OOGC 2YTFA 1SR9A 3JAMC 4JV5E 2EM7A 2EMBA 1N3GA 2EE8A 1BB8A 2EORA 5ADZA 2DLQA 2EMIA 4DV4E 1A1GA 1ZBTA 4LF5E 2L3JA 1B69A 3JTZA 2MC5A 2ELYA 1F2IG 3KZZA 2RS6A 5LL6R 4HEIA 1KJKA 1MEYC 5KL2A 2DMYA 2CSHA 2VF1A 4DR6E 2V8QB 4WFTA 2FTXB 2DB2A 4GEQB 1YYKA 2EL4A 4JI4E 4NXME 4BBYA 2YTJA 4F9BB 4GZNC 1X5WA 4BHBA 2GLIA 2I13A 2EPAA 4DR3E 2L8TA 2EMAA 1UBDC 1XMOE 2JVAA 4YY3E 2MC6A 4MLQA 4O43A 3J80C 4DR2E 1T4NA 1YYWA 4X65E 3J81C 4K0KE 2K7IA 4BS9A 1KYQA 2EMGA 4JI1E 4TUGA 2DMIA 3EQ1A 3J7AG 2EN3A 2EL6A 2YU5A 4J8ZA 3T1HE 2EOJA 4I8OA 2EP3A 2L3CA 1PJTA 5AE2A 4YHHE 2YRMA 3HTXA 4IJDA 3ADLA 1N33E 4JYAE 1X49A 2YZTA 1N32E 3THNA 2UUBE 2UUCE 2EWLA 4HTGA 2EMWA 5DNYA 2MKDA 2F8BA 2DLKA 5KL6A 1ZBQA 4ZYDA 2EMZA 2CTDA 4R2EA 3DF6A 5KL7A 4DV1E 3K6QA 2EOQA 4WSGA 1A1FA
chains in the Genus database with same CATH topology
1G2DC 2JPAA 2LVHA 2J7JA 3MHSC 2YTOA 2EMKA 1G2FC 2JP9A 1ZAAC 2EMXA 3VHTB 1TN9A 2CT1A 2EPPA 2EN8A 2LCEA 5KL4A 2EM0A 2EM3A 2LV2A 2E72A 2EMHA 2EOFA 2BB8A 1LLMC 4R2RA 2EM2A 2WBTA 2YTFA 1AAYA 3EPHA 2D9HA 2WBUA 2MKNA 1A1HA 4M9VC 2EOEA 2EM7A 3UK3C 2EMBA 1BB8A 2EE8A 2EPCA 1A1JA 1ZU1A 2EORA 2DLQA 2EMIA 1A1GA 2EOHA 2EN1A 2EJ4A 2YTNA 1B69A 2GHFA 2YTIA 2ELYA 2ENAA 1F2IG 2EPUA 4FK5C 1KJKA 3M99B 1MEYC 1RMDA 5KL2A 2CSHA 1WJPA 4R2SA 4R2PA 2M9AA 2EPXA 2NABA 1NCSA 2PRTA 1A1LA 2EOMA 4F6MA 1TF6A 4F2JC 2EL4A 2VRDA 1JK2A 1A1KA 2YTJA 4GZNC 1X5WA 2LT7A 2EN7A 2GLIA 2R1FA 4R2AA 2YSOA 2I13A 2EPAA 2RPCA 2A25A 2EMAA 2YTEA 2EM8A 1UBDC 2DRPA 2EMFA 2LO3A 2WBSA 1UN6B 2EOIA 2WCC3 2EQ1A 4X9JA 1TF3A 2ADRA 1ZR9A 2EN2A 1Z1BA 2MDGA 2EMGA 4R2CA 2ENCA 1X6EA 2DMIA 2EOYA 2RSIA 1YUJA 2EN3A 2EL6A 2YU5A 2EM5A 2EPZA 2EQ3A 2EOJA 2YSPA 3MHHC 2YTQA 2EL5A 2EMCA 2EM6A 2EP3A 1P47A 1X3CA 2YRMA 2YRKA 4IJDA 1YSAC 2EOXA 5KL3A 4F6NA 1YUIA 2EN4A 2EMLA 5KL5A 2EOSA 3EPLA 1X6HA 1X6FA 2EM4A 2EMWA 2EOOA 2EPRA 2EMYA 2MKDA 1JK1A 2YRHA 2DGCA 2EOZA 4IS1C 3EPJA 2DLKA 5KL6A 1BBOA 2EM9A 2EQ0A 2YU8A 2ELZA 2EMZA 2YTDA 2YTGA 2CTDA 4R2EA 4R2QA 2HGHA 2YTPA 5KL7A 3EPKA 1A1IA 2ENHA 4R2DA 2EN6A 1DGCA 2EOQA 4WSGA 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2D C;  2JPA A;  2LVH A;  2J7J A;  3MHS C;  2YTO A;  2EMK A;  1G2F C;  2JP9 A;  1ZAA C;  2EMX A;  3VHT B;  1TN9 A;  2CT1 A;  2EPP A;  2EN8 A;  2LCE A;  5KL4 A;  2EM0 A;  2EM3 A;  2LV2 A;  2E72 A;  2EMH A;  2EOF A;  2BB8 A;  1LLM C;  4R2R A;  2EM2 A;  2WBT A;  2YTF A;  1AAY A;  3EPH A;  2D9H A;  2WBU A;  2MKN A;  1A1H A;  4M9V C;  2EOE A;  2EM7 A;  3UK3 C;  2EMB A;  1BB8 A;  2EE8 A;  2EPC A;  1A1J A;  1ZU1 A;  2EOR A;  2DLQ A;  2EMI A;  1A1G A;  2EOH A;  2EN1 A;  2EJ4 A;  2YTN A;  1B69 A;  2GHF A;  2YTI A;  2ELY A;  2ENA A;  1F2I G;  2EPU A;  4FK5 C;  1KJK A;  3M99 B;  1MEY C;  1RMD A;  5KL2 A;  2CSH A;  1WJP A;  4R2S A;  4R2P A;  2M9A A;  2EPX A;  2NAB A;  1NCS A;  2PRT A;  1A1L A;  2EOM A;  4F6M A;  1TF6 A;  4F2J C;  2EL4 A;  2VRD A;  1JK2 A;  1A1K A;  2YTJ A;  4GZN C;  1X5W A;  2LT7 A;  2EN7 A;  2GLI A;  2R1F A;  4R2A A;  2YSO A;  2I13 A;  2EPA A;  2RPC A;  2A25 A;  2EMA A;  2YTE A;  2EM8 A;  1UBD C;  2DRP A;  2EMF A;  2LO3 A;  2WBS A;  1UN6 B;  2EOI A;  2WCC 3;  2EQ1 A;  4X9J A;  1TF3 A;  2ADR A;  1ZR9 A;  2EN2 A;  1Z1B A;  2MDG A;  2EMG A;  4R2C A;  2ENC A;  1X6E A;  2DMI A;  2EOY A;  2RSI A;  1YUJ A;  2EN3 A;  2EL6 A;  2YU5 A;  2EM5 A;  2EPZ A;  2EQ3 A;  2EOJ A;  2YSP A;  3MHH C;  2YTQ A;  2EL5 A;  2EMC A;  2EM6 A;  2EP3 A;  1P47 A;  1X3C A;  2YRM A;  2YRK A;  4IJD A;  1YSA C;  2EOX A;  5KL3 A;  4F6N A;  1YUI A;  2EN4 A;  2EML A;  5KL5 A;  2EOS A;  3EPL A;  1X6H A;  1X6F A;  2EM4 A;  2EMW A;  2EOO A;  2EPR A;  2EMY A;  2MKD A;  1JK1 A;  2YRH A;  2DGC A;  2EOZ A;  4IS1 C;  3EPJ A;  2DLK A;  5KL6 A;  1BBO A;  2EM9 A;  2EQ0 A;  2YU8 A;  2ELZ A;  2EMZ A;  2YTD A;  2YTG A;  2CTD A;  4R2E A;  4R2Q A;  2HGH A;  2YTP A;  5KL7 A;  3EPK A;  1A1I A;  2ENH A;  4R2D A;  2EN6 A;  1DGC A;  2EOQ A;  4WSG A;  1A1F A; 
#chains in the Genus database with same CATH topology
 1G2D C;  1J26 A;  2J7J A;  3MHS C;  2EMK A;  1G2F C;  2EZ6 A;  3VYY A;  2V88 A;  1NEI A;  2EPO A;  4B3S E;  2JOB A;  4R2R A;  1EH7 A;  2RS7 A;  1IQO A;  5F3W A;  4JI5 E;  2EPC A;  4M0V A;  1ZU1 A;  4GKK E;  3BID A;  2RQL A;  2YTN A;  3C6K A;  2L6M A;  2GHF A;  3VK6 A;  2LUP B;  1AH5 A;  3OML A;  1STU A;  4X66 E;  2FGG A;  5FLX C;  1DI2 A;  1WJP A;  4LFA E;  1FJG E;  3BBG A;  4R2P A;  5LMN E;  1L4S A;  2M9A A;  1EH8 A;  2UU9 E;  3ZOQ B;  2VQF E;  4F2J C;  1GZ6 A;  1JK2 A;  1J5E E;  2I9I A;  1HNX E;  2KON A;  2YSO A;  1RQ0 A;  3TQM A;  3IWC A;  2YTE A;  2DRP A;  2B7V A;  2WBS A;  4F54 A;  2ODR C;  2G7H A;  2M4I A;  1EKZ A;  1TF3 A;  1ZR9 A;  4R03 A;  2MDG A;  2ZM6 E;  1IQS A;  1IBM E;  2M1S A;  4F9C B;  3F6H A;  4BC7 A;  5A6A A;  2LTS A;  1XNR E;  5A6K A;  2EQ3 A;  4B3T E;  2L33 A;  3MHH C;  2EMC A;  1YPN A;  3AV0 A;  4BCA A;  2EOX A;  3KZY A;  1IBL E;  4LU9 A;  2EML A;  3F6G A;  2EOS A;  3P1X A;  2LE2 A;  4KHP E;  2KHX A;  1X6H A;  2ODR D;  2YT4 A;  5BR8 E;  2EM4 A;  2EOO A;  4JI0 E;  2DGC A;  1I94 E;  5AC4 A;  4LF7 E;  3ADG A;  4DUZ E;  2EOZ A;  1BBO A;  2EQ0 A;  2YU8 A;  5IV8 B;  2ENH A;  4ZYE A;  1T38 A;  4DV5 E;  2WZO A;  3OTO E;  4WYQ B;  4M30 A;  2LVH A;  5IT9 C;  2KOU A;  2JP9 A;  2EMX A;  1TN9 A;  5A69 A;  4LTY A;  3H09 A;  2CT1 A;  2EPP A;  2EN8 A;  4TUI A;  2LCE A;  5KL4 A;  2LV2 A;  3HQ1 A;  1LLM C;  2MDR A;  1YFH A;  2EM2 A;  2WBT A;  1SFE A;  4NHR A;  2JOX A;  2D9H A;  2EPM X;  1A1H A;  2MKN A;  4M2Z A;  2NUF A;  1QU6 A;  2E1M A;  2VE7 C;  1PDA A;  2NA2 A;  2CPN A;  1T39 A;  3JU0 A;  2EN1 A;  2ENA A;  4KWY A;  1FKA E;  5LLQ A;  4FK5 C;  3T1Y E;  3M99 B;  2BBG A;  1RMD A;  4BC9 A;  4DV7 E;  4R2S A;  3BGH A;  2LTR A;  4LF4 E;  2NAB A;  5A2Q C;  1NCS A;  2PRT A;  2EOM A;  2L92 A;  4F6M A;  1TF6 A;  4L5N C;  2JXP A;  1HR0 E;  3QG5 C;  1WXR A;  3J7Y p;  1YYO A;  2R1F A;  4DUY E;  4B3M E;  4GKJ E;  1WRJ A;  1HNZ E;  2RPC A;  2A25 A;  2L2M A;  3THO B;  1IMU A;  3IWB A;  2EM8 A;  1T4O A;  1DQ3 A;  2LO3 A;  4KZS A;  4R8O A;  2YPN A;  4ZYH A;  2EOI A;  1UN6 B;  3AUZ A;  2WCC 3;  4L8N A;  4X9J A;  1HNW E;  2JYA A;  2ADR A;  1Z1B A;  2EN2 A;  4P78 A;  3ECR A;  2HHH E;  4O5G A;  2ENC A;  1X6E A;  2M7Q A;  2NUG A;  2EOY A;  2V85 A;  4F9A B;  1YUJ A;  2UXD E;  2RSM A;  2EPZ A;  2N8X A;  1X48 A;  2EPL X;  3IWD A;  4DKK A;  2YSP A;  4JI3 E;  5T6J A;  1UHZ A;  2LBS B;  2YRK A;  2H36 X;  2Q8U A;  1YSA C;  5KL3 A;  4F6N A;  1WHN A;  3HPZ A;  5KL5 A;  2F4V E;  5A6J A;  5AE1 A;  4Q28 A;  2EPR A;  3HXL A;  4O4K A;  1JK1 A;  2V87 A;  3MSW A;  4IS1 C;  3EPJ A;  2LMZ A;  3HPS A;  2EM9 A;  1BBG A;  1IBK E;  2LJU A;  4WXD A;  2ELZ A;  1MGT A;  2HGH A;  4R2Q A;  3LML A;  2UUA E;  1DGC A;  4Q35 B;  4DR1 E;  1GQE A;  5LMU E;  1ZAA C;  3VHT B;  2EM0 A;  2N3G A;  4LF6 E;  5AC5 A;  2HC5 A;  2E72 A;  2EMH A;  4O24 A;  2EOF A;  2BB8 A;  4DMI A;  4DV3 E;  5IXM B;  2YWQ A;  4DR4 E;  3C4B A;  5AAS A;  4DV2 E;  1AAY A;  3EPH A;  3LLH A;  4NXN E;  2WBU A;  4M9V C;  2EOE A;  1RC7 A;  1QNT A;  1GTK A;  3UK3 C;  2IHR 1;  2JR1 A;  4BMJ A;  2V83 A;  1A1J A;  4JI6 E;  3ADJ A;  2EOH A;  2L2K B;  4ZYG A;  2E5L E;  1XNQ E;  2EJ4 A;  4DR7 E;  5A6B A;  2UXC E;  2JWO A;  2YTI A;  4JI7 E;  2K4V A;  2EPU A;  4X62 E;  3DJW A;  4WPY A;  3C6M A;  2EPX A;  3ADI A;  2VQE E;  4JI8 E;  1A1L A;  2UXB E;  4X64 E;  2VRD A;  1A1K A;  4RHB B;  5A6B D;  2LT7 A;  4B3R E;  2EN7 A;  2EPN A;  4R2A A;  3BF2 A;  1XMQ E;  2EMF A;  2LRS A;  4WX9 A;  4WXC A;  2DSY A;  4RH8 A;  5CFF E;  2EQ1 A;  1O0W A;  1UIL A;  2V89 A;  1T4L B;  2FV4 B;  1PJQ A;  4DV6 E;  2L2N A;  4LF9 E;  2B7T A;  4DV0 E;  4R2C A;  2JY9 A;  2LJH A;  3C4T A;  1X47 A;  2RSI A;  3RMP A;  2EM5 A;  1PJS A;  1PKP A;  4DR5 E;  4WSP A;  2YTQ A;  2B9D A;  2EL5 A;  5IWA E;  2EM6 A;  1P47 A;  1X3C A;  4OX9 E;  5AE3 A;  4NZV A;  3FIG A;  4LFC E;  4P7D A;  1YUI A;  2EN4 A;  4MLV A;  2V86 A;  3EPL A;  2DIX A;  4BHC A;  1X6F A;  2B3T B;  1EH6 A;  2EMY A;  2YRH A;  4N4R B;  5TSE A;  2NUE A;  2LUQ A;  2RTX A;  2N3H A;  2YTD A;  2YTG A;  1YZ9 A;  3VYX A;  1N36 E;  2YTP A;  4X8W A;  2HJJ A;  3EPK A;  1A1I A;  4LFB E;  4R2D A;  2EN6 A;  1N34 E;  2GPI A;  3L00 A;  2EPK X;  2JPA A;  2YTO A;  4JI2 E;  2R76 A;  2EM3 A;  4LF8 E;  4AQY E;  1WHQ A;  3KWR A;  4OOG C;  2YTF A;  1SR9 A;  3JAM C;  4JV5 E;  2EM7 A;  2EMB A;  1N3G A;  2EE8 A;  1BB8 A;  2EOR A;  5ADZ A;  2DLQ A;  2EMI A;  4DV4 E;  1A1G A;  1ZBT A;  4LF5 E;  2L3J A;  1B69 A;  3JTZ A;  2MC5 A;  2ELY A;  1F2I G;  3KZZ A;  2RS6 A;  5LL6 R;  4HEI A;  1KJK A;  1MEY C;  5KL2 A;  2DMY A;  2CSH A;  2VF1 A;  4DR6 E;  2V8Q B;  4WFT A;  2FTX B;  2DB2 A;  4GEQ B;  1YYK A;  2EL4 A;  4JI4 E;  4NXM E;  4BBY A;  2YTJ A;  4F9B B;  4GZN C;  1X5W A;  4BHB A;  2GLI A;  2I13 A;  2EPA A;  4DR3 E;  2L8T A;  2EMA A;  1UBD C;  1XMO E;  2JVA A;  4YY3 E;  2MC6 A;  4MLQ A;  4O43 A;  3J80 C;  4DR2 E;  1T4N A;  1YYW A;  4X65 E;  3J81 C;  4K0K E;  2K7I A;  4BS9 A;  1KYQ A;  2EMG A;  4JI1 E;  4TUG A;  2DMI A;  3EQ1 A;  3J7A G;  2EN3 A;  2EL6 A;  2YU5 A;  4J8Z A;  3T1H E;  2EOJ A;  4I8O A;  2EP3 A;  2L3C A;  1PJT A;  5AE2 A;  4YHH E;  2YRM A;  3HTX A;  4IJD A;  3ADL A;  1N33 E;  4JYA E;  1X49 A;  2YZT A;  1N32 E;  3THN A;  2UUB E;  2UUC E;  2EWL A;  4HTG A;  2EMW A;  5DNY A;  2MKD A;  2F8B A;  2DLK A;  5KL6 A;  1ZBQ A;  4ZYD A;  2EMZ A;  2CTD A;  4R2E A;  3DF6 A;  5KL7 A;  4DV1 E;  3K6Q A;  2EOQ A;  4WSG A;  1A1F A; 
#chains in the Genus database with same CATH homology
 1G2D C;  2JPA A;  2LVH A;  2J7J A;  3MHS C;  2YTO A;  2EMK A;  1G2F C;  2JP9 A;  1ZAA C;  2EMX A;  3VHT B;  1TN9 A;  2CT1 A;  2EPP A;  2EN8 A;  2LCE A;  5KL4 A;  2EM0 A;  2EM3 A;  2LV2 A;  2E72 A;  2EMH A;  2EOF A;  2BB8 A;  1LLM C;  4R2R A;  2EM2 A;  2WBT A;  2YTF A;  1AAY A;  3EPH A;  2D9H A;  2WBU A;  2MKN A;  1A1H A;  4M9V C;  2EOE A;  2EM7 A;  3UK3 C;  2EMB A;  1BB8 A;  2EE8 A;  2EPC A;  1A1J A;  1ZU1 A;  2EOR A;  2DLQ A;  2EMI A;  1A1G A;  2EOH A;  2EN1 A;  2EJ4 A;  2YTN A;  1B69 A;  2GHF A;  2YTI A;  2ELY A;  2ENA A;  1F2I G;  2EPU A;  4FK5 C;  1KJK A;  3M99 B;  1MEY C;  1RMD A;  5KL2 A;  2CSH A;  1WJP A;  4R2S A;  4R2P A;  2M9A A;  2EPX A;  2NAB A;  1NCS A;  2PRT A;  1A1L A;  2EOM A;  4F6M A;  1TF6 A;  4F2J C;  2EL4 A;  2VRD A;  1JK2 A;  1A1K A;  2YTJ A;  4GZN C;  1X5W A;  2LT7 A;  2EN7 A;  2GLI A;  2R1F A;  4R2A A;  2YSO A;  2I13 A;  2EPA A;  2RPC A;  2A25 A;  2EMA A;  2YTE A;  2EM8 A;  1UBD C;  2DRP A;  2EMF A;  2LO3 A;  2WBS A;  1UN6 B;  2EOI A;  2WCC 3;  2EQ1 A;  4X9J A;  1TF3 A;  2ADR A;  1ZR9 A;  2EN2 A;  1Z1B A;  2MDG A;  2EMG A;  4R2C A;  2ENC A;  1X6E A;  2DMI A;  2EOY A;  2RSI A;  1YUJ A;  2EN3 A;  2EL6 A;  2YU5 A;  2EM5 A;  2EPZ A;  2EQ3 A;  2EOJ A;  2YSP A;  3MHH C;  2YTQ A;  2EL5 A;  2EMC A;  2EM6 A;  2EP3 A;  1P47 A;  1X3C A;  2YRM A;  2YRK A;  4IJD A;  1YSA C;  2EOX A;  5KL3 A;  4F6N A;  1YUI A;  2EN4 A;  2EML A;  5KL5 A;  2EOS A;  3EPL A;  1X6H A;  1X6F A;  2EM4 A;  2EMW A;  2EOO A;  2EPR A;  2EMY A;  2MKD A;  1JK1 A;  2YRH A;  2DGC A;  2EOZ A;  4IS1 C;  3EPJ A;  2DLK A;  5KL6 A;  1BBO A;  2EM9 A;  2EQ0 A;  2YU8 A;  2ELZ A;  2EMZ A;  2YTD A;  2YTG A;  2CTD A;  4R2E A;  4R2Q A;  2HGH A;  2YTP A;  5KL7 A;  3EPK A;  1A1I A;  2ENH A;  4R2D A;  2EN6 A;  1DGC A;  2EOQ A;  4WSG A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...