1DGCA

The x-ray structure of the gcn4-bzip bound to atf/creb site dna shows the complex depends on dna flexibility
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
b'PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 24
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1dgcA00
2EQ1A 3EPHA 2ENAA 2YSOA 2EN1A 2EMHA 1A1IA 4R2DA 2EQ3A 2EMFA 2EOMA 2LV2A 2YU5A 1X6FA 2EM4A 1A1FA 2EN4A 2YTDA 3MHHC 2GLIA 2ADRA 2EL6A 1A1JA 1G2DC 2LO3A 4WSGA 2EE8A 4IS1C 2ELZA 4R2AA 2CT1A 2EP3A 2EORA 2YRKA 2MDGA 3VHTB 2PRTA 2EPCA 2EPUA 1B69A 5KL2A 2LCEA 2EM9A 3UK3C 4F2JC 2I13A 2EMYA 1LLMC 1BBOA 2JP9A 2EN7A 2EPZA 1UBDC 2DGCA 2DLKA 2EMCA 2EPRA 1BB8A 4X9JA 1ZU1A 2EPPA 2EMLA 3M99B 2EM6A 2EMXA 1YUJA 1UN6B 4R2PA 2EOJA 2M9AA 5KL6A 2CSHA 2YTEA 4IJDA 2CTDA 1A1LA 2RPCA 2EOXA 1A1GA 3EPJA 2R1FA 1TN9A 3EPKA 2E72A 1P47A 2ENHA 2EOHA 2EMKA 2EQ0A 2EM7A 2YTPA 1NCSA 4R2CA 2JPAA 1MEYC 2EMAA 4FK5C 2EMGA 2EPXA 2EMWA 2EMZA 1F2IG 2EOYA 2YRHA 2EN6A 2YTNA 5KL5A 2YU8A 2EL5A 2YTIA 1ZR9A 4M9VC 2YTFA 2DRPA 2EOSA 4GZNC 3MHSC 2EPAA 2YRMA 2YSPA 2EN3A 2YTOA 4R2EA 1YSAC 2ENCA 2DMIA 2EOEA 2EM8A 5KL4A 1WJPA 2EN8A 4F6MA 2ELYA 2J7JA 1YUIA 1DGCA 2EOZA 4R2SA 5KL7A 2WCC3 2LVHA 2EN2A 2MKDA 2WBTA 1TF3A 4F6NA 1X5WA 1Z1BA 1JK1A 1A1KA 1X3CA 2EM2A 2EOOA 2EOQA 2NABA 2YTQA 1ZAAC 1X6HA 1AAYA 2EM0A 2EOIA 2RSIA 2EOFA 2WBUA 2VRDA 2YTGA 1G2FC 3EPLA 2DLQA 1TF6A 1RMDA 2A25A 2WBSA 4R2RA 2MKNA 2LT7A 5KL3A 2D9HA 2HGHA 2EMIA 2EL4A 2EJ4A 1A1HA 2EM5A 4R2QA 2BB8A 1KJKA 2YTJA 1X6EA 2EM3A 2GHFA 1JK2A 2EMBA
chains in the Genus database with same CATH superfamily
2EMHA 2EMFA 1N33E 4WFTA 3LMLA 4B3TE 2JXPA 4DV4E 2EN4A 4DR1E 3MHHC 4KZSA 4B3ME 1G2DC 2L2NA 1HR0E 2EE8A 4DR2E 3DF6A 3IWBA 4IS1C 1HNXE 2UXBE 2ELZA 4R2AA 2EORA 2EPNA 2I9IA 2LUQA 2GPIA 3C6KA 2B7VA 2EPUA 1GZ6A 2RSMA 1B69A 1BBGA 1WRJA 3AUZA 4F2JC 4RH8A 2EMYA 1LLMC 2JP9A 2V86A 5AE2A 1UBDC 4LFCE 2LUPB 2EMCA 1BB8A 4BHCA 2V8QB 1N32E 2M9AA 5KL6A 2L2KB 4DR6E 1UILA 3C6MA 3EPJA 2R1FA 1YZ9A 5T6JA 2B7TA 4O24A 5IXMB 2ENHA 3IWDA 2EOHA 2EMGA 3HPSA 2JYAA 1PKPA 3MSWA 2EMWA 2EMZA 2UU9E 2N3HA 3HXLA 4JI7E 5LLQA 2L8TA 5LL6R 5KL5A 2LJUA 1ZR9A 4X65E 4M9VC 2JWOA 3F6HA 2DRPA 1I94E 1YYOA 2V88A 1AH5A 2KOUA 2K4VA 2DSYA 2EN3A 5A2QC 4BMJA 2ENCA 2VE7C 5ADZA 2EM8A 3ZOQB 2L33A 1FKAE 5KL4A 1WJPA 4DKKA 4F6MA 1T4LB 4DUYE 1DGCA 3OMLA 5KL7A 2WCC3 2MDRA 2ODRC 1T4OA 2EN2A 4BC9A 3J80C 2WBTA 4LF5E 2YTQA 4YHHE 5IT9C 1X6HA 2MC6A 5A6KA 3KWRA 4DV1E 4B3RE 4NXNE 2YT4A 2H36X 4R2RA 3JU0A 2EM5A 4R2QA 2HJJA 2M7QA 5AASA 1X6EA 4DR3E 3EPHA 2ENAA 2EN1A 2WZOA 1A1IA 2EQ3A 3LLHA 2LV2A 4KWYA 1X6FA 2EM4A 1MGTA 4O4KA 4R03A 4TUGA 1N34E 1UHZA 2EL6A 4HTGA 4DUZE 5A6BA 1X47A 2CPNA 3F6GA 2EPLX 2MDGA 2YRKA 1O0WA 5AE3A 4BHBA 5KL2A 2EM9A 4KHPE 4JI8E 2I13A 4M0VA 1QU6A 2LJHA 1SFEA 5A6JA 3THNA 4Q28A 2LE2A 2EMXA 2ODRD 4P7DA 1EKZA 2CSHA 3C4BA 2CTDA 3KZZA 1A1LA 3T1HE 3BF2A 2EOXA 1A1GA 1TN9A 3EPKA 2NUEA 2HHHE 2EMKA 2B3TB 1STUA 4NHRA 2HC5A 3FIGA 1F2IG 3RMPA 3J7Yp 2M1SA 2EN6A 2YTNA 2UXCE 4JYAE 2EL5A 2YTIA 1YPNA 3BIDA 2NUGA 4WYQB 2YTFA 3DJWA 2EOSA 4GZNC 2YSPA 2YTOA 4R2EA 4B3SE 4LF9E 2EOEA 2UXDE 1PJSA 1DI2A 4X64E 3T1YE 2FGGA 1IBME 1XMQE 4DR5E 3IWCA 2JOXA 4OX9E 3AV0A 3HQ1A 4JI2E 4WXDA 2DB2A 1X5WA 4F9BB 1JK1A 2RS6A 1X3CA 2EOOA 4F54A 2EOQA 1ZAAC 2YZTA 3VYYA 2BBGA 1AAYA 2EM0A 2R76A 2EOFA 2MC5A 5DNYA 4WX9A 2WBUA 1J26A 1G2FC 3EPLA 2V87A 3J7AG 4DR7E 1N3GA 2D9HA 2EL4A 2F4VE 2EZ6A 1A1HA 4DV2E 2BB8A 2VQEE 4YY3E 2YTJA 3BGHA 4ZYDA 4R2DA 4LF4E 5LMNE 2YU5A 3VK6A 2N8XA 4WSPA 4J8ZA 2YTDA 4L5NC 2EPOA 2V85A 4F9AB 1SR9A 4ZYGA 4WXCA 5AC5A 2L92A 4WSGA 3BBGA 2K7IA 4O43A 3VHTB 2PRTA 1RC7A 2EPCA 4M30A 5A6BD 4L8NA 1DQ3A 1T38A 4ZYEA 1BBOA 4WPYA 3L00A 2EPZA 4DV6E 2DLKA 2L3CA 2EPRA 4DV3E 1GTKA 1XMOE 2G7HA 4X9JA 1ZU1A 2EMLA 2VQFE 4F9CB 1UN6B 4LU9A 3J81C 4DV0E 1HNZE 5TSEA 5A69A 4JI3E 4BBYA 4BS9A 2RPCA 2EPKX 2E72A 1ZBTA 1YYWA 4ZYHA 2YTPA 1NCSA 4R2CA 1IBKE 4FK5C 2EMAA 2EPXA 2L3JA 4JI4E 2LTRA 4DR4E 4BCAA 5IV8B 2M4IA 2YU8A 4AQYE 2JOBA 2N3GA 4JI5E 2JVAA 4GKJE 2DIXA 4N4RB 1ZBQA 3EQ1A 2E1MA 2EPAA 1FJGE 2JR1A 5BR8E 4JI1E 2EN8A 3K6QA 4LTYA 2ELYA 2LVHA 4F6NA 2NABA 2EOIA 3QG5C 2LBSB 5IWAE 4TUIA 1TF6A 1RMDA 2A25A 2DMYA 2MKNA 2LT7A 1WHQA 5AE1A 5KL3A 3ADJA 2EMIA 1XNQE 2EJ4A 1HNWE 2RS7A 2UUCE 2EM3A 3THOB 1J5EE 3KZYA 2EQ1A 2YSOA 1IBLE 2KHXA 1YYKA 5CFFE 2EOMA 2RQLA 2YPNA 1A1FA 2VF1A 1EH7A 2GLIA 3HTXA 2ADRA 4X66E 1A1JA 2LO3A 4O5GA 4Q35B 2CT1A 2EP3A 2LRSA 2L2MA 2B9DA 2V89A 2EWLA 2LCEA 2FTXB 3UK3C 4JV5E 3ADLA 1EH6A 4LFBE 3TQMA 1EH8A 3JAMC 2EN7A 2KONA 2LMZA 2DGCA 4RHBB 1X48A 4NXME 4R8OA 2EPPA 5LMUE 3VYXA 2L6MA 3M99B 2EM6A 1YUJA 4R2PA 2EOJA 2YTEA 4IJDA 1GQEA 4GKKE 4MLQA 4DV5E 3ECRA 1L4SA 4M2ZA 1T4NA 2NUFA 4JI6E 1P47A 2EQ0A 2EM7A 1WXRA 4HEIA 2JPAA 1MEYC 4I8OA 4MLVA 4BC7A 3ADGA 4DV7E 4DMIA 3H09A 2EOYA 2YRHA 5A6AA 2UUBE 1XNRE 3C4TA 1PJTA 1WHNA 1X49A 2LTSA 1RQ0A 2IHR1 3JTZA 3MHSC 2YRMA 2FV4B 1YSAC 4LF8E 5AC4A 4LF6E 4P78A 4NZVA 2JY9A 3P1XA 4X8WA 3ADIA 2YWQA 3OTOE 4LF7E 2EPMX 2J7JA 1YUIA 1YFHA 1IQOA 2EOZA 4R2SA 1N36E 1T39A 1IQSA 1NEIA 2MKDA 1TF3A 1Z1BA 1A1KA 4JI0E 2EM2A 5F3WA 4LFAE 2RTXA 3HPZA 4K0KE 1IMUA 2RSIA 2NA2A 4GEQB 4OOGC 1KYQA 1PJQA 2VRDA 2YTGA 2E5LE 4X62E 1PDAA 2DLQA 2UUAE 2V83A 2WBSA 2F8BA 5FLXC 2ZM6E 2Q8UA 2HGHA 1KJKA 1QNTA 2DMIA 2GHFA 1JK2A 2EMBA
chains in the Genus database with same CATH topology
2EQ1A 3EPHA 2ENAA 2YSOA 2EN1A 2EMHA 1A1IA 4R2DA 2EQ3A 2EMFA 2EOMA 2LV2A 2YU5A 1X6FA 2EM4A 1A1FA 2EN4A 2YTDA 3MHHC 2GLIA 2ADRA 2EL6A 1A1JA 1G2DC 2LO3A 4WSGA 2EE8A 4IS1C 2ELZA 4R2AA 2CT1A 2EP3A 2EORA 2YRKA 2MDGA 3VHTB 2PRTA 2EPCA 2EPUA 1B69A 5KL2A 2LCEA 2EM9A 3UK3C 4F2JC 2I13A 2EMYA 1LLMC 1BBOA 2JP9A 2EN7A 2EPZA 1UBDC 2DGCA 2DLKA 2EMCA 2EPRA 1BB8A 4X9JA 1ZU1A 2EPPA 2EMLA 3M99B 2EM6A 2EMXA 1YUJA 1UN6B 4R2PA 2EOJA 2M9AA 5KL6A 2CSHA 2YTEA 4IJDA 2CTDA 1A1LA 2RPCA 2EOXA 1A1GA 3EPJA 2R1FA 1TN9A 3EPKA 2E72A 1P47A 2ENHA 2EOHA 2EMKA 2EQ0A 2EM7A 2YTPA 1NCSA 4R2CA 2JPAA 1MEYC 2EMAA 4FK5C 2EMGA 2EPXA 2EMWA 2EMZA 1F2IG 2EOYA 2YRHA 2EN6A 2YTNA 5KL5A 2YU8A 2EL5A 2YTIA 1ZR9A 4M9VC 2YTFA 2DRPA 2EOSA 4GZNC 3MHSC 2EPAA 2YRMA 2YSPA 2EN3A 2YTOA 4R2EA 1YSAC 2ENCA 2DMIA 2EOEA 2EM8A 5KL4A 1WJPA 2EN8A 4F6MA 2ELYA 2J7JA 1YUIA 1DGCA 2EOZA 4R2SA 5KL7A 2WCC3 2LVHA 2EN2A 2MKDA 2WBTA 1TF3A 4F6NA 1X5WA 1Z1BA 1JK1A 1A1KA 1X3CA 2EM2A 2EOOA 2EOQA 2NABA 2YTQA 1ZAAC 1X6HA 1AAYA 2EM0A 2EOIA 2RSIA 2EOFA 2WBUA 2VRDA 2YTGA 1G2FC 3EPLA 2DLQA 1TF6A 1RMDA 2A25A 2WBSA 4R2RA 2MKNA 2LT7A 5KL3A 2D9HA 2HGHA 2EMIA 2EL4A 2EJ4A 1A1HA 2EM5A 4R2QA 2BB8A 1KJKA 2YTJA 1X6EA 2EM3A 2GHFA 1JK2A 2EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ1 A;  3EPH A;  2ENA A;  2YSO A;  2EN1 A;  2EMH A;  1A1I A;  4R2D A;  2EQ3 A;  2EMF A;  2EOM A;  2LV2 A;  2YU5 A;  1X6F A;  2EM4 A;  1A1F A;  2EN4 A;  2YTD A;  3MHH C;  2GLI A;  2ADR A;  2EL6 A;  1A1J A;  1G2D C;  2LO3 A;  4WSG A;  2EE8 A;  4IS1 C;  2ELZ A;  4R2A A;  2CT1 A;  2EP3 A;  2EOR A;  2YRK A;  2MDG A;  3VHT B;  2PRT A;  2EPC A;  2EPU A;  1B69 A;  5KL2 A;  2LCE A;  2EM9 A;  3UK3 C;  4F2J C;  2I13 A;  2EMY A;  1LLM C;  1BBO A;  2JP9 A;  2EN7 A;  2EPZ A;  1UBD C;  2DGC A;  2DLK A;  2EMC A;  2EPR A;  1BB8 A;  4X9J A;  1ZU1 A;  2EPP A;  2EML A;  3M99 B;  2EM6 A;  2EMX A;  1YUJ A;  1UN6 B;  4R2P A;  2EOJ A;  2M9A A;  5KL6 A;  2CSH A;  2YTE A;  4IJD A;  2CTD A;  1A1L A;  2RPC A;  2EOX A;  1A1G A;  3EPJ A;  2R1F A;  1TN9 A;  3EPK A;  2E72 A;  1P47 A;  2ENH A;  2EOH A;  2EMK A;  2EQ0 A;  2EM7 A;  2YTP A;  1NCS A;  4R2C A;  2JPA A;  1MEY C;  2EMA A;  4FK5 C;  2EMG A;  2EPX A;  2EMW A;  2EMZ A;  1F2I G;  2EOY A;  2YRH A;  2EN6 A;  2YTN A;  5KL5 A;  2YU8 A;  2EL5 A;  2YTI A;  1ZR9 A;  4M9V C;  2YTF A;  2DRP A;  2EOS A;  4GZN C;  3MHS C;  2EPA A;  2YRM A;  2YSP A;  2EN3 A;  2YTO A;  4R2E A;  1YSA C;  2ENC A;  2DMI A;  2EOE A;  2EM8 A;  5KL4 A;  1WJP A;  2EN8 A;  4F6M A;  2ELY A;  2J7J A;  1YUI A;  1DGC A;  2EOZ A;  4R2S A;  5KL7 A;  2WCC 3;  2LVH A;  2EN2 A;  2MKD A;  2WBT A;  1TF3 A;  4F6N A;  1X5W A;  1Z1B A;  1JK1 A;  1A1K A;  1X3C A;  2EM2 A;  2EOO A;  2EOQ A;  2NAB A;  2YTQ A;  1ZAA C;  1X6H A;  1AAY A;  2EM0 A;  2EOI A;  2RSI A;  2EOF A;  2WBU A;  2VRD A;  2YTG A;  1G2F C;  3EPL A;  2DLQ A;  1TF6 A;  1RMD A;  2A25 A;  2WBS A;  4R2R A;  2MKN A;  2LT7 A;  5KL3 A;  2D9H A;  2HGH A;  2EMI A;  2EL4 A;  2EJ4 A;  1A1H A;  2EM5 A;  4R2Q A;  2BB8 A;  1KJK A;  2YTJ A;  1X6E A;  2EM3 A;  2GHF A;  1JK2 A;  2EMB A; 
#chains in the Genus database with same CATH topology
 2EMH A;  2EMF A;  1N33 E;  4WFT A;  3LML A;  4B3T E;  2JXP A;  4DV4 E;  2EN4 A;  4DR1 E;  3MHH C;  4KZS A;  4B3M E;  1G2D C;  2L2N A;  1HR0 E;  2EE8 A;  4DR2 E;  3DF6 A;  3IWB A;  4IS1 C;  1HNX E;  2UXB E;  2ELZ A;  4R2A A;  2EOR A;  2EPN A;  2I9I A;  2LUQ A;  2GPI A;  3C6K A;  2B7V A;  2EPU A;  1GZ6 A;  2RSM A;  1B69 A;  1BBG A;  1WRJ A;  3AUZ A;  4F2J C;  4RH8 A;  2EMY A;  1LLM C;  2JP9 A;  2V86 A;  5AE2 A;  1UBD C;  4LFC E;  2LUP B;  2EMC A;  1BB8 A;  4BHC A;  2V8Q B;  1N32 E;  2M9A A;  5KL6 A;  2L2K B;  4DR6 E;  1UIL A;  3C6M A;  3EPJ A;  2R1F A;  1YZ9 A;  5T6J A;  2B7T A;  4O24 A;  5IXM B;  2ENH A;  3IWD A;  2EOH A;  2EMG A;  3HPS A;  2JYA A;  1PKP A;  3MSW A;  2EMW A;  2EMZ A;  2UU9 E;  2N3H A;  3HXL A;  4JI7 E;  5LLQ A;  2L8T A;  5LL6 R;  5KL5 A;  2LJU A;  1ZR9 A;  4X65 E;  4M9V C;  2JWO A;  3F6H A;  2DRP A;  1I94 E;  1YYO A;  2V88 A;  1AH5 A;  2KOU A;  2K4V A;  2DSY A;  2EN3 A;  5A2Q C;  4BMJ A;  2ENC A;  2VE7 C;  5ADZ A;  2EM8 A;  3ZOQ B;  2L33 A;  1FKA E;  5KL4 A;  1WJP A;  4DKK A;  4F6M A;  1T4L B;  4DUY E;  1DGC A;  3OML A;  5KL7 A;  2WCC 3;  2MDR A;  2ODR C;  1T4O A;  2EN2 A;  4BC9 A;  3J80 C;  2WBT A;  4LF5 E;  2YTQ A;  4YHH E;  5IT9 C;  1X6H A;  2MC6 A;  5A6K A;  3KWR A;  4DV1 E;  4B3R E;  4NXN E;  2YT4 A;  2H36 X;  4R2R A;  3JU0 A;  2EM5 A;  4R2Q A;  2HJJ A;  2M7Q A;  5AAS A;  1X6E A;  4DR3 E;  3EPH A;  2ENA A;  2EN1 A;  2WZO A;  1A1I A;  2EQ3 A;  3LLH A;  2LV2 A;  4KWY A;  1X6F A;  2EM4 A;  1MGT A;  4O4K A;  4R03 A;  4TUG A;  1N34 E;  1UHZ A;  2EL6 A;  4HTG A;  4DUZ E;  5A6B A;  1X47 A;  2CPN A;  3F6G A;  2EPL X;  2MDG A;  2YRK A;  1O0W A;  5AE3 A;  4BHB A;  5KL2 A;  2EM9 A;  4KHP E;  4JI8 E;  2I13 A;  4M0V A;  1QU6 A;  2LJH A;  1SFE A;  5A6J A;  3THN A;  4Q28 A;  2LE2 A;  2EMX A;  2ODR D;  4P7D A;  1EKZ A;  2CSH A;  3C4B A;  2CTD A;  3KZZ A;  1A1L A;  3T1H E;  3BF2 A;  2EOX A;  1A1G A;  1TN9 A;  3EPK A;  2NUE A;  2HHH E;  2EMK A;  2B3T B;  1STU A;  4NHR A;  2HC5 A;  3FIG A;  1F2I G;  3RMP A;  3J7Y p;  2M1S A;  2EN6 A;  2YTN A;  2UXC E;  4JYA E;  2EL5 A;  2YTI A;  1YPN A;  3BID A;  2NUG A;  4WYQ B;  2YTF A;  3DJW A;  2EOS A;  4GZN C;  2YSP A;  2YTO A;  4R2E A;  4B3S E;  4LF9 E;  2EOE A;  2UXD E;  1PJS A;  1DI2 A;  4X64 E;  3T1Y E;  2FGG A;  1IBM E;  1XMQ E;  4DR5 E;  3IWC A;  2JOX A;  4OX9 E;  3AV0 A;  3HQ1 A;  4JI2 E;  4WXD A;  2DB2 A;  1X5W A;  4F9B B;  1JK1 A;  2RS6 A;  1X3C A;  2EOO A;  4F54 A;  2EOQ A;  1ZAA C;  2YZT A;  3VYY A;  2BBG A;  1AAY A;  2EM0 A;  2R76 A;  2EOF A;  2MC5 A;  5DNY A;  4WX9 A;  2WBU A;  1J26 A;  1G2F C;  3EPL A;  2V87 A;  3J7A G;  4DR7 E;  1N3G A;  2D9H A;  2EL4 A;  2F4V E;  2EZ6 A;  1A1H A;  4DV2 E;  2BB8 A;  2VQE E;  4YY3 E;  2YTJ A;  3BGH A;  4ZYD A;  4R2D A;  4LF4 E;  5LMN E;  2YU5 A;  3VK6 A;  2N8X A;  4WSP A;  4J8Z A;  2YTD A;  4L5N C;  2EPO A;  2V85 A;  4F9A B;  1SR9 A;  4ZYG A;  4WXC A;  5AC5 A;  2L92 A;  4WSG A;  3BBG A;  2K7I A;  4O43 A;  3VHT B;  2PRT A;  1RC7 A;  2EPC A;  4M30 A;  5A6B D;  4L8N A;  1DQ3 A;  1T38 A;  4ZYE A;  1BBO A;  4WPY A;  3L00 A;  2EPZ A;  4DV6 E;  2DLK A;  2L3C A;  2EPR A;  4DV3 E;  1GTK A;  1XMO E;  2G7H A;  4X9J A;  1ZU1 A;  2EML A;  2VQF E;  4F9C B;  1UN6 B;  4LU9 A;  3J81 C;  4DV0 E;  1HNZ E;  5TSE A;  5A69 A;  4JI3 E;  4BBY A;  4BS9 A;  2RPC A;  2EPK X;  2E72 A;  1ZBT A;  1YYW A;  4ZYH A;  2YTP A;  1NCS A;  4R2C A;  1IBK E;  4FK5 C;  2EMA A;  2EPX A;  2L3J A;  4JI4 E;  2LTR A;  4DR4 E;  4BCA A;  5IV8 B;  2M4I A;  2YU8 A;  4AQY E;  2JOB A;  2N3G A;  4JI5 E;  2JVA A;  4GKJ E;  2DIX A;  4N4R B;  1ZBQ A;  3EQ1 A;  2E1M A;  2EPA A;  1FJG E;  2JR1 A;  5BR8 E;  4JI1 E;  2EN8 A;  3K6Q A;  4LTY A;  2ELY A;  2LVH A;  4F6N A;  2NAB A;  2EOI A;  3QG5 C;  2LBS B;  5IWA E;  4TUI A;  1TF6 A;  1RMD A;  2A25 A;  2DMY A;  2MKN A;  2LT7 A;  1WHQ A;  5AE1 A;  5KL3 A;  3ADJ A;  2EMI A;  1XNQ E;  2EJ4 A;  1HNW E;  2RS7 A;  2UUC E;  2EM3 A;  3THO B;  1J5E E;  3KZY A;  2EQ1 A;  2YSO A;  1IBL E;  2KHX A;  1YYK A;  5CFF E;  2EOM A;  2RQL A;  2YPN A;  1A1F A;  2VF1 A;  1EH7 A;  2GLI A;  3HTX A;  2ADR A;  4X66 E;  1A1J A;  2LO3 A;  4O5G A;  4Q35 B;  2CT1 A;  2EP3 A;  2LRS A;  2L2M A;  2B9D A;  2V89 A;  2EWL A;  2LCE A;  2FTX B;  3UK3 C;  4JV5 E;  3ADL A;  1EH6 A;  4LFB E;  3TQM A;  1EH8 A;  3JAM C;  2EN7 A;  2KON A;  2LMZ A;  2DGC A;  4RHB B;  1X48 A;  4NXM E;  4R8O A;  2EPP A;  5LMU E;  3VYX A;  2L6M A;  3M99 B;  2EM6 A;  1YUJ A;  4R2P A;  2EOJ A;  2YTE A;  4IJD A;  1GQE A;  4GKK E;  4MLQ A;  4DV5 E;  3ECR A;  1L4S A;  4M2Z A;  1T4N A;  2NUF A;  4JI6 E;  1P47 A;  2EQ0 A;  2EM7 A;  1WXR A;  4HEI A;  2JPA A;  1MEY C;  4I8O A;  4MLV A;  4BC7 A;  3ADG A;  4DV7 E;  4DMI A;  3H09 A;  2EOY A;  2YRH A;  5A6A A;  2UUB E;  1XNR E;  3C4T A;  1PJT A;  1WHN A;  1X49 A;  2LTS A;  1RQ0 A;  2IHR 1;  3JTZ A;  3MHS C;  2YRM A;  2FV4 B;  1YSA C;  4LF8 E;  5AC4 A;  4LF6 E;  4P78 A;  4NZV A;  2JY9 A;  3P1X A;  4X8W A;  3ADI A;  2YWQ A;  3OTO E;  4LF7 E;  2EPM X;  2J7J A;  1YUI A;  1YFH A;  1IQO A;  2EOZ A;  4R2S A;  1N36 E;  1T39 A;  1IQS A;  1NEI A;  2MKD A;  1TF3 A;  1Z1B A;  1A1K A;  4JI0 E;  2EM2 A;  5F3W A;  4LFA E;  2RTX A;  3HPZ A;  4K0K E;  1IMU A;  2RSI A;  2NA2 A;  4GEQ B;  4OOG C;  1KYQ A;  1PJQ A;  2VRD A;  2YTG A;  2E5L E;  4X62 E;  1PDA A;  2DLQ A;  2UUA E;  2V83 A;  2WBS A;  2F8B A;  5FLX C;  2ZM6 E;  2Q8U A;  2HGH A;  1KJK A;  1QNT A;  2DMI A;  2GHF A;  1JK2 A;  2EMB A; 
#chains in the Genus database with same CATH homology
 2EQ1 A;  3EPH A;  2ENA A;  2YSO A;  2EN1 A;  2EMH A;  1A1I A;  4R2D A;  2EQ3 A;  2EMF A;  2EOM A;  2LV2 A;  2YU5 A;  1X6F A;  2EM4 A;  1A1F A;  2EN4 A;  2YTD A;  3MHH C;  2GLI A;  2ADR A;  2EL6 A;  1A1J A;  1G2D C;  2LO3 A;  4WSG A;  2EE8 A;  4IS1 C;  2ELZ A;  4R2A A;  2CT1 A;  2EP3 A;  2EOR A;  2YRK A;  2MDG A;  3VHT B;  2PRT A;  2EPC A;  2EPU A;  1B69 A;  5KL2 A;  2LCE A;  2EM9 A;  3UK3 C;  4F2J C;  2I13 A;  2EMY A;  1LLM C;  1BBO A;  2JP9 A;  2EN7 A;  2EPZ A;  1UBD C;  2DGC A;  2DLK A;  2EMC A;  2EPR A;  1BB8 A;  4X9J A;  1ZU1 A;  2EPP A;  2EML A;  3M99 B;  2EM6 A;  2EMX A;  1YUJ A;  1UN6 B;  4R2P A;  2EOJ A;  2M9A A;  5KL6 A;  2CSH A;  2YTE A;  4IJD A;  2CTD A;  1A1L A;  2RPC A;  2EOX A;  1A1G A;  3EPJ A;  2R1F A;  1TN9 A;  3EPK A;  2E72 A;  1P47 A;  2ENH A;  2EOH A;  2EMK A;  2EQ0 A;  2EM7 A;  2YTP A;  1NCS A;  4R2C A;  2JPA A;  1MEY C;  2EMA A;  4FK5 C;  2EMG A;  2EPX A;  2EMW A;  2EMZ A;  1F2I G;  2EOY A;  2YRH A;  2EN6 A;  2YTN A;  5KL5 A;  2YU8 A;  2EL5 A;  2YTI A;  1ZR9 A;  4M9V C;  2YTF A;  2DRP A;  2EOS A;  4GZN C;  3MHS C;  2EPA A;  2YRM A;  2YSP A;  2EN3 A;  2YTO A;  4R2E A;  1YSA C;  2ENC A;  2DMI A;  2EOE A;  2EM8 A;  5KL4 A;  1WJP A;  2EN8 A;  4F6M A;  2ELY A;  2J7J A;  1YUI A;  1DGC A;  2EOZ A;  4R2S A;  5KL7 A;  2WCC 3;  2LVH A;  2EN2 A;  2MKD A;  2WBT A;  1TF3 A;  4F6N A;  1X5W A;  1Z1B A;  1JK1 A;  1A1K A;  1X3C A;  2EM2 A;  2EOO A;  2EOQ A;  2NAB A;  2YTQ A;  1ZAA C;  1X6H A;  1AAY A;  2EM0 A;  2EOI A;  2RSI A;  2EOF A;  2WBU A;  2VRD A;  2YTG A;  1G2F C;  3EPL A;  2DLQ A;  1TF6 A;  1RMD A;  2A25 A;  2WBS A;  4R2R A;  2MKN A;  2LT7 A;  5KL3 A;  2D9H A;  2HGH A;  2EMI A;  2EL4 A;  2EJ4 A;  1A1H A;  2EM5 A;  4R2Q A;  2BB8 A;  1KJK A;  2YTJ A;  1X6E A;  2EM3 A;  2GHF A;  1JK2 A;  2EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...