1DGMA

Crystal structure of adenosine kinase from toxoplasma gondii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
354
structure length
346
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNAFEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adenosine kinase from Toxoplasma gondii at 1.8 A resolution.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Transferase
molecule keywords ADENOSINE KINASE
total genus 119
structure length 346
sequence length 354
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 1dgmA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1dgmA01
1TD2A 3UQ6A 2F7KA 3RSFA 4EN4A 4EOHA 3KZHA 5C40A 4U7XA 4KALA 3RO4A 3NM1A 2HQQA 2R3BA 2DDWA 3QA2A 4E69A 5F11A 4UBEA 4LBXA 1GQTA 3Q92A 4C5LA 3NBWA 1KYHA 1UA4A 4K9CA 3RQ2A 3Q1YA 1TYYA 2DDMA 1C3QA 1L2LA 3HYOA 2DDOA 3UMOA 3IN1A 4K9IA 2DCNA 1LIIA 1TZ3A 5BYDA 1V19A 4KAHA 1LHPA 2A9YA 4E8WA 4O1GA 4C5NA 5C3YA 3RT7A 3NL6A 3RU3A 2ABSA 1ESJA 1RKAA 1JXHA 4JKSA 3H49A 2PKNA 3NC2A 4YWRA 3OTXA 4DU5A 3JULA 3K9EA 4JKUA 3RT9A 4DC3A 4S1IB 1YHJA 2V78A 4PVVA 5CM5A 1DGMA 1VI9A 3B1PA 3BGKA 3RPZA 4GM6A 3RTAA 2AB8A 2YXTA 4K93A 2PKFA 3N1CA 4C5JA 5EYNA 3NBVA 4LCAA 2Q5RA 4XF7A 3RRJA 3RU2A 5TQIA 4XDAA 3FHXA 3VAQA 5BYFA 3PZSA 4KADA 1U2XA 2JGVA 3QAIA 3RM5A 2YXUA 2PKMA 3K5WA 3UQEA 3B1RA 3NL2A 4K8CA 1RFUA 1EKKA 2QHPA 4XF6A 3PL2A 4S1MA 4XCKA 1YGJA 4EUMA 3UBOA 4C5MA 2PKKA 2RBCA 3I3YA 5BYEA 2FV7A 3GO6A 1RKDA 5C3ZA 3FHYA 4K8PA 4K8KA 4E3AA 3BF5A 2AFBA 1V1BA 3B3LA 1LIOA 3UQDA 1LHRA 5EY7A 2QCVA 4KANA 5CGAA 3RQXA 3LOOA 5BYCA 5C41A 2AJPA 1GC5A 1RFTA 1RKSA 2AWDA 1V1AA 3ZS7A 4O1LA 3RSSA 1RFVA 1YGKA 1VK4A 3RREA 2AX3A 3IBQA 4LC4A 3RTGA 2AA0A 3MBHA 4K8TA 5F0ZA 3B1OA 3RQHA 3DZVA 1ESQA 1VM7A 3IQ0A 4S1HA 1TZ6A 4B8RA 3RRFA 2AJRA 4EBUA 4JJPA 2JG1A 2HW1A 3IKHA 5TRWA 3RTEA 3RTBA 3CQDA 3KEUA 3NC9A 3RSGA 3RRBA 3EWMA 3IE7A 1LIJA 5CGEA 1BX4A 3VASA 2C49A 3W4SA 2I5BA 2F02A 3HICA 3RTCA 2I6AA 1WYEA 3LKIA 3RQ8A 3RQQA 1RK2A 4KBEA 4LBGA 2R3EA 3RS8A 3LJSA 3IH0A 3RSQA 1JXIA 3GBUA 3RQ6A 3RPHA 3RTDA 4E8ZA 1UB0A 2I6BA 2C4EA 3B1QA 3LHXA 4WJMA 2XTBA 3UMPA 2HLZA 3NL5A 4B8SA 4C5KA 3MBJA 4X8FA 2VARA 5B6AA 3UQ9A 2ABQA 3RS9A 5COJA 3HPDA 4N09A 1V1SA 3KTNA 3RY7A 3NCAA 2NWHA 1LIKA 3DRWA 3KD6A 4N08A 3NM3A 4YL5A 3RQ5A 4E8YA 2JG5A 3H74A 4S1IA 3GO7A 4E84A 2A9ZA 1EKQA 3B1NA 3NL3A
chains in the Genus database with same CATH superfamily
1TD2A 3UQ6A 2F7KA 3GO7A 3RSFA 4EN4A 4EOHA 3KZHA 2JFGA 5C40A 4U7XA 4KALA 3RO4A 3NM1A 2VTDA 2HQQA 2R3BA 2DDWA 3QA2A 4E69A 2GC5A 5F11A 4UBEA 4LBXA 1GQTA 1EEHA 3Q92A 4C5LA 3NBWA 1KYHA 1UA4A 2UUOA 4K9CA 3Q1YA 3RQ2A 1TYYA 2DDMA 1C3QA 1L2LA 3HYOA 5F0ZA 2DDOA 3UMOA 1W7KA 3IN1A 4K9IA 4EBUA 2DCNA 1LIIA 1TZ3A 3UAGA 5BYDA 1V19A 4KAHA 1LHPA 2A9YA 4E8WA 4O1GA 4C5NA 2JFHA 1P31A 3ZM5A 2JFFA 5C3YA 1J6UA 3RT7A 5A5EA 3NL6A 3RU3A 2ABSA 1ESJA 1GQQA 1JXHA 1RKAA 2UAGA 2PKNA 3H49A 3NC2A 3OTXA 4JKSA 4UAGA 4YWRA 4DU5A 3JULA 3K9EA 4JKUA 3RT9A 1O5ZA 5A5FA 4DC3A 2WTZA 4S1IB 1YHJA 2V78A 4PVVA 5CM5A 1DGMA 1VI9A 3B1PA 3BGKA 3RPZA 4GM6A 3RTAA 4CVLA 2AB8A 2YXTA 4K93A 2PKFA 3N1CA 4C5JA 5EYNA 3NBVA 4LCAA 2Q5RA 4XF7A 3RRJA 3RU2A 5TQIA 4XDAA 4CVKA 2AM2A 3FHXA 3VAQA 4C13A 2AM1A 2GCAA 3PZSA 1U2XA 2JGVA 3QAIA 4KADA 3RM5A 2YXUA 2PKMA 3HN7A 3K5WA 3UQEA 2XPCA 3B1RA 3NL2A 1RFUA 1EKKA 2QHPA 4K8CA 4XF6A 3ZM6A 3PL2A 4S1MA 2VORA 4XCKA 2GCBA 1YGJA 3HJ6A 4HV4A 4EUMA 3UBOA 4C5MA 2PKKA 2RBCA 3I3YA 2F00A 1P3DA 2FV7A 3GO6A 1RKDA 5BYEA 3FHYA 5C3ZA 2VOSA 4K8PA 4K8KA 3PYZA 4E3AA 3BF5A 2AFBA 1V1BA 3B3LA 1LIOA 3UQDA 4QF5A 3ZL8A 1LHRA 5EY7A 2QCVA 4KANA 5CGAA 3RQXA 3LOOA 5BYCA 5C41A 2AJPA 1GC5A 1RFTA 1RKSA 2AWDA 1V1AA 1UAGA 3ZS7A 4O1LA 3RSSA 1RFVA 1YGKA 1VK4A 3RREA 1GQYA 2AX3A 3IBQA 4LC4A 3RTGA 2AA0A 3MBHA 4K8TA 4E84A 3B1OA 3RQHA 3DZVA 1ESQA 1VM7A 2Y67A 3IQ0A 4S1HA 1TZ6A 4B8RA 3RRFA 2AJRA 4CVMA 4JJPA 2JG1A 2HW1A 1W78A 2VTEA 3IKHA 5TRWA 3CQDA 3KEUA 1GG4A 3NC9A 3RTEA 3RTBA 3RSGA 3RRBA 3EWMA 3IE7A 1LIJA 3NRSA 1BX4A 3VASA 5CGEA 2C49A 3W4SA 5BYFA 2I5BA 2F02A 3HICA 3RTCA 2I6AA 1JBWA 1WYEA 2Y66A 3LKIA 3RQ8A 2GC6A 1RK2A 4KBEA 4LBGA 4ZIYA 3RQQA 1E0DA 2R3EA 3RS8A 3LJSA 1JBVA 3IH0A 4QDIA 3RSQA 1JXIA 3GBUA 3QCZA 3RQ6A 3RPHA 3RTDA 4E8ZA 3N2AA 1E8CA 1UB0A 2I6BA 2C4EA 3B1QA 3LHXA 4WJMA 2XTBA 3UMPA 2HLZA 1FGSA 3NL5A 4B8SA 4C5KA 2XJAA 3MBJA 4X8FA 2VARA 2Y1OA 2Y68A 4BUBA 5B6AA 3UQ9A 2ABQA 3RS9A 5COJA 2WJPA 3HPDA 4N09A 1V1SA 3EAGA 3KTNA 3LK7A 3RY7A 3NCAA 1LIKA 3DRWA 2NWHA 3KD6A 4N08A 2UUPA 3NM3A 4YL5A 3RQ5A 4C12A 4E8YA 2JG5A 3H74A 4S1IA 2X5OA 4BUCA 2A9ZA 1EKQA 3B1NA 3NL3A
chains in the Genus database with same CATH topology
1TD2A 3UQ6A 2F7KA 3RSFA 4EN4A 4EOHA 3KZHA 5C40A 4U7XA 4KALA 3RO4A 3NM1A 2HQQA 2R3BA 2DDWA 3QA2A 4E69A 5F11A 4UBEA 4LBXA 1GQTA 3Q92A 4C5LA 3NBWA 1KYHA 1UA4A 4K9CA 3RQ2A 3Q1YA 1TYYA 2DDMA 1C3QA 1L2LA 3HYOA 2DDOA 3UMOA 3IN1A 4K9IA 2DCNA 1LIIA 1TZ3A 5BYDA 1V19A 4KAHA 1LHPA 2A9YA 4E8WA 4O1GA 4C5NA 5C3YA 3RT7A 3NL6A 3RU3A 2ABSA 1ESJA 1RKAA 1JXHA 4JKSA 3H49A 2PKNA 3NC2A 4YWRA 3OTXA 4DU5A 3JULA 3K9EA 4JKUA 3RT9A 4DC3A 4S1IB 1YHJA 2V78A 4PVVA 5CM5A 1DGMA 1VI9A 3B1PA 3BGKA 3RPZA 4GM6A 3RTAA 2AB8A 2YXTA 4K93A 2PKFA 3N1CA 4C5JA 5EYNA 3NBVA 4LCAA 2Q5RA 4XF7A 3RRJA 3RU2A 5TQIA 4XDAA 3FHXA 3VAQA 5BYFA 3PZSA 4KADA 1U2XA 2JGVA 3QAIA 3RM5A 2YXUA 2PKMA 3K5WA 3UQEA 3B1RA 3NL2A 4K8CA 1RFUA 1EKKA 2QHPA 4XF6A 3PL2A 4S1MA 4XCKA 1YGJA 3HJ6A 4EUMA 3UBOA 4C5MA 2PKKA 2RBCA 3I3YA 5BYEA 2FV7A 3GO6A 1RKDA 5C3ZA 3FHYA 4K8PA 4K8KA 4E3AA 3BF5A 2AFBA 1V1BA 3B3LA 1LIOA 3UQDA 1LHRA 5EY7A 2QCVA 4KANA 5CGAA 3RQXA 3LOOA 5BYCA 5C41A 2AJPA 1GC5A 1RFTA 1RKSA 2AWDA 1V1AA 3ZS7A 4O1LA 3RSSA 1RFVA 1YGKA 1VK4A 3RREA 2AX3A 3IBQA 4LC4A 3RTGA 2AA0A 3MBHA 4K8TA 5F0ZA 3B1OA 3RQHA 3DZVA 1ESQA 1VM7A 3IQ0A 4S1HA 1TZ6A 4B8RA 3RRFA 2AJRA 4EBUA 4JJPA 2JG1A 2HW1A 3IKHA 5TRWA 3RTEA 3RTBA 3CQDA 3KEUA 3NC9A 3RSGA 3RRBA 3EWMA 3IE7A 1LIJA 5CGEA 1BX4A 3VASA 2C49A 3W4SA 2I5BA 2F02A 3HICA 3RTCA 2I6AA 1WYEA 3LKIA 3RQ8A 3RQQA 1RK2A 4KBEA 4LBGA 2R3EA 3RS8A 3LJSA 3IH0A 3RSQA 1JXIA 3GBUA 3RQ6A 3RPHA 3RTDA 4E8ZA 1UB0A 2I6BA 2C4EA 3B1QA 3LHXA 4WJMA 2XTBA 3UMPA 2HLZA 3NL5A 4B8SA 4C5KA 3MBJA 4X8FA 2VARA 5B6AA 3UQ9A 2ABQA 3RS9A 5COJA 3HPDA 4N09A 1V1SA 3KTNA 3RY7A 3NCAA 1LIKA 3DRWA 2NWHA 3KD6A 4N08A 3NM3A 4YL5A 3RQ5A 4E8YA 2JG5A 3H74A 4S1IA 3GO7A 4E84A 2A9ZA 1EKQA 3B1NA 3NL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TD2 A;  3UQ6 A;  2F7K A;  3RSF A;  4EN4 A;  4EOH A;  3KZH A;  5C40 A;  4U7X A;  4KAL A;  3RO4 A;  3NM1 A;  2HQQ A;  2R3B A;  2DDW A;  3QA2 A;  4E69 A;  5F11 A;  4UBE A;  4LBX A;  1GQT A;  3Q92 A;  4C5L A;  3NBW A;  1KYH A;  1UA4 A;  4K9C A;  3RQ2 A;  3Q1Y A;  1TYY A;  2DDM A;  1C3Q A;  1L2L A;  3HYO A;  2DDO A;  3UMO A;  3IN1 A;  4K9I A;  2DCN A;  1LII A;  1TZ3 A;  5BYD A;  1V19 A;  4KAH A;  1LHP A;  2A9Y A;  4E8W A;  4O1G A;  4C5N A;  5C3Y A;  3RT7 A;  3NL6 A;  3RU3 A;  2ABS A;  1ESJ A;  1RKA A;  1JXH A;  4JKS A;  3H49 A;  2PKN A;  3NC2 A;  4YWR A;  3OTX A;  4DU5 A;  3JUL A;  3K9E A;  4JKU A;  3RT9 A;  4DC3 A;  4S1I B;  1YHJ A;  2V78 A;  4PVV A;  5CM5 A;  1DGM A;  1VI9 A;  3B1P A;  3BGK A;  3RPZ A;  4GM6 A;  3RTA A;  2AB8 A;  2YXT A;  4K93 A;  2PKF A;  3N1C A;  4C5J A;  5EYN A;  3NBV A;  4LCA A;  2Q5R A;  4XF7 A;  3RRJ A;  3RU2 A;  5TQI A;  4XDA A;  3FHX A;  3VAQ A;  5BYF A;  3PZS A;  4KAD A;  1U2X A;  2JGV A;  3QAI A;  3RM5 A;  2YXU A;  2PKM A;  3K5W A;  3UQE A;  3B1R A;  3NL2 A;  4K8C A;  1RFU A;  1EKK A;  2QHP A;  4XF6 A;  3PL2 A;  4S1M A;  4XCK A;  1YGJ A;  4EUM A;  3UBO A;  4C5M A;  2PKK A;  2RBC A;  3I3Y A;  5BYE A;  2FV7 A;  3GO6 A;  1RKD A;  5C3Z A;  3FHY A;  4K8P A;  4K8K A;  4E3A A;  3BF5 A;  2AFB A;  1V1B A;  3B3L A;  1LIO A;  3UQD A;  1LHR A;  5EY7 A;  2QCV A;  4KAN A;  5CGA A;  3RQX A;  3LOO A;  5BYC A;  5C41 A;  2AJP A;  1GC5 A;  1RFT A;  1RKS A;  2AWD A;  1V1A A;  3ZS7 A;  4O1L A;  3RSS A;  1RFV A;  1YGK A;  1VK4 A;  3RRE A;  2AX3 A;  3IBQ A;  4LC4 A;  3RTG A;  2AA0 A;  3MBH A;  4K8T A;  5F0Z A;  3B1O A;  3RQH A;  3DZV A;  1ESQ A;  1VM7 A;  3IQ0 A;  4S1H A;  1TZ6 A;  4B8R A;  3RRF A;  2AJR A;  4EBU A;  4JJP A;  2JG1 A;  2HW1 A;  3IKH A;  5TRW A;  3RTE A;  3RTB A;  3CQD A;  3KEU A;  3NC9 A;  3RSG A;  3RRB A;  3EWM A;  3IE7 A;  1LIJ A;  5CGE A;  1BX4 A;  3VAS A;  2C49 A;  3W4S A;  2I5B A;  2F02 A;  3HIC A;  3RTC A;  2I6A A;  1WYE A;  3LKI A;  3RQ8 A;  3RQQ A;  1RK2 A;  4KBE A;  4LBG A;  2R3E A;  3RS8 A;  3LJS A;  3IH0 A;  3RSQ A;  1JXI A;  3GBU A;  3RQ6 A;  3RPH A;  3RTD A;  4E8Z A;  1UB0 A;  2I6B A;  2C4E A;  3B1Q A;  3LHX A;  4WJM A;  2XTB A;  3UMP A;  2HLZ A;  3NL5 A;  4B8S A;  4C5K A;  3MBJ A;  4X8F A;  2VAR A;  5B6A A;  3UQ9 A;  2ABQ A;  3RS9 A;  5COJ A;  3HPD A;  4N09 A;  1V1S A;  3KTN A;  3RY7 A;  3NCA A;  2NWH A;  1LIK A;  3DRW A;  3KD6 A;  4N08 A;  3NM3 A;  4YL5 A;  3RQ5 A;  4E8Y A;  2JG5 A;  3H74 A;  4S1I A;  3GO7 A;  4E84 A;  2A9Z A;  1EKQ A;  3B1N A;  3NL3 A; 
#chains in the Genus database with same CATH topology
 1TD2 A;  3UQ6 A;  2F7K A;  3GO7 A;  3RSF A;  4EN4 A;  4EOH A;  3KZH A;  2JFG A;  5C40 A;  4U7X A;  4KAL A;  3RO4 A;  3NM1 A;  2VTD A;  2HQQ A;  2R3B A;  2DDW A;  3QA2 A;  4E69 A;  2GC5 A;  5F11 A;  4UBE A;  4LBX A;  1GQT A;  1EEH A;  3Q92 A;  4C5L A;  3NBW A;  1KYH A;  1UA4 A;  2UUO A;  4K9C A;  3Q1Y A;  3RQ2 A;  1TYY A;  2DDM A;  1C3Q A;  1L2L A;  3HYO A;  5F0Z A;  2DDO A;  3UMO A;  1W7K A;  3IN1 A;  4K9I A;  4EBU A;  2DCN A;  1LII A;  1TZ3 A;  3UAG A;  5BYD A;  1V19 A;  4KAH A;  1LHP A;  2A9Y A;  4E8W A;  4O1G A;  4C5N A;  2JFH A;  1P31 A;  3ZM5 A;  2JFF A;  5C3Y A;  1J6U A;  3RT7 A;  5A5E A;  3NL6 A;  3RU3 A;  2ABS A;  1ESJ A;  1GQQ A;  1JXH A;  1RKA A;  2UAG A;  2PKN A;  3H49 A;  3NC2 A;  3OTX A;  4JKS A;  4UAG A;  4YWR A;  4DU5 A;  3JUL A;  3K9E A;  4JKU A;  3RT9 A;  1O5Z A;  5A5F A;  4DC3 A;  2WTZ A;  4S1I B;  1YHJ A;  2V78 A;  4PVV A;  5CM5 A;  1DGM A;  1VI9 A;  3B1P A;  3BGK A;  3RPZ A;  4GM6 A;  3RTA A;  4CVL A;  2AB8 A;  2YXT A;  4K93 A;  2PKF A;  3N1C A;  4C5J A;  5EYN A;  3NBV A;  4LCA A;  2Q5R A;  4XF7 A;  3RRJ A;  3RU2 A;  5TQI A;  4XDA A;  4CVK A;  2AM2 A;  3FHX A;  3VAQ A;  4C13 A;  2AM1 A;  2GCA A;  3PZS A;  1U2X A;  2JGV A;  3QAI A;  4KAD A;  3RM5 A;  2YXU A;  2PKM A;  3HN7 A;  3K5W A;  3UQE A;  2XPC A;  3B1R A;  3NL2 A;  1RFU A;  1EKK A;  2QHP A;  4K8C A;  4XF6 A;  3ZM6 A;  3PL2 A;  4S1M A;  2VOR A;  4XCK A;  2GCB A;  1YGJ A;  3HJ6 A;  4HV4 A;  4EUM A;  3UBO A;  4C5M A;  2PKK A;  2RBC A;  3I3Y A;  2F00 A;  1P3D A;  2FV7 A;  3GO6 A;  1RKD A;  5BYE A;  3FHY A;  5C3Z A;  2VOS A;  4K8P A;  4K8K A;  3PYZ A;  4E3A A;  3BF5 A;  2AFB A;  1V1B A;  3B3L A;  1LIO A;  3UQD A;  4QF5 A;  3ZL8 A;  1LHR A;  5EY7 A;  2QCV A;  4KAN A;  5CGA A;  3RQX A;  3LOO A;  5BYC A;  5C41 A;  2AJP A;  1GC5 A;  1RFT A;  1RKS A;  2AWD A;  1V1A A;  1UAG A;  3ZS7 A;  4O1L A;  3RSS A;  1RFV A;  1YGK A;  1VK4 A;  3RRE A;  1GQY A;  2AX3 A;  3IBQ A;  4LC4 A;  3RTG A;  2AA0 A;  3MBH A;  4K8T A;  4E84 A;  3B1O A;  3RQH A;  3DZV A;  1ESQ A;  1VM7 A;  2Y67 A;  3IQ0 A;  4S1H A;  1TZ6 A;  4B8R A;  3RRF A;  2AJR A;  4CVM A;  4JJP A;  2JG1 A;  2HW1 A;  1W78 A;  2VTE A;  3IKH A;  5TRW A;  3CQD A;  3KEU A;  1GG4 A;  3NC9 A;  3RTE A;  3RTB A;  3RSG A;  3RRB A;  3EWM A;  3IE7 A;  1LIJ A;  3NRS A;  1BX4 A;  3VAS A;  5CGE A;  2C49 A;  3W4S A;  5BYF A;  2I5B A;  2F02 A;  3HIC A;  3RTC A;  2I6A A;  1JBW A;  1WYE A;  2Y66 A;  3LKI A;  3RQ8 A;  2GC6 A;  1RK2 A;  4KBE A;  4LBG A;  4ZIY A;  3RQQ A;  1E0D A;  2R3E A;  3RS8 A;  3LJS A;  1JBV A;  3IH0 A;  4QDI A;  3RSQ A;  1JXI A;  3GBU A;  3QCZ A;  3RQ6 A;  3RPH A;  3RTD A;  4E8Z A;  3N2A A;  1E8C A;  1UB0 A;  2I6B A;  2C4E A;  3B1Q A;  3LHX A;  4WJM A;  2XTB A;  3UMP A;  2HLZ A;  1FGS A;  3NL5 A;  4B8S A;  4C5K A;  2XJA A;  3MBJ A;  4X8F A;  2VAR A;  2Y1O A;  2Y68 A;  4BUB A;  5B6A A;  3UQ9 A;  2ABQ A;  3RS9 A;  5COJ A;  2WJP A;  3HPD A;  4N09 A;  1V1S A;  3EAG A;  3KTN A;  3LK7 A;  3RY7 A;  3NCA A;  1LIK A;  3DRW A;  2NWH A;  3KD6 A;  4N08 A;  2UUP A;  3NM3 A;  4YL5 A;  3RQ5 A;  4C12 A;  4E8Y A;  2JG5 A;  3H74 A;  4S1I A;  2X5O A;  4BUC A;  2A9Z A;  1EKQ A;  3B1N A;  3NL3 A; 
#chains in the Genus database with same CATH homology
 1TD2 A;  3UQ6 A;  2F7K A;  3RSF A;  4EN4 A;  4EOH A;  3KZH A;  5C40 A;  4U7X A;  4KAL A;  3RO4 A;  3NM1 A;  2HQQ A;  2R3B A;  2DDW A;  3QA2 A;  4E69 A;  5F11 A;  4UBE A;  4LBX A;  1GQT A;  3Q92 A;  4C5L A;  3NBW A;  1KYH A;  1UA4 A;  4K9C A;  3RQ2 A;  3Q1Y A;  1TYY A;  2DDM A;  1C3Q A;  1L2L A;  3HYO A;  2DDO A;  3UMO A;  3IN1 A;  4K9I A;  2DCN A;  1LII A;  1TZ3 A;  5BYD A;  1V19 A;  4KAH A;  1LHP A;  2A9Y A;  4E8W A;  4O1G A;  4C5N A;  5C3Y A;  3RT7 A;  3NL6 A;  3RU3 A;  2ABS A;  1ESJ A;  1RKA A;  1JXH A;  4JKS A;  3H49 A;  2PKN A;  3NC2 A;  4YWR A;  3OTX A;  4DU5 A;  3JUL A;  3K9E A;  4JKU A;  3RT9 A;  4DC3 A;  4S1I B;  1YHJ A;  2V78 A;  4PVV A;  5CM5 A;  1DGM A;  1VI9 A;  3B1P A;  3BGK A;  3RPZ A;  4GM6 A;  3RTA A;  2AB8 A;  2YXT A;  4K93 A;  2PKF A;  3N1C A;  4C5J A;  5EYN A;  3NBV A;  4LCA A;  2Q5R A;  4XF7 A;  3RRJ A;  3RU2 A;  5TQI A;  4XDA A;  3FHX A;  3VAQ A;  5BYF A;  3PZS A;  4KAD A;  1U2X A;  2JGV A;  3QAI A;  3RM5 A;  2YXU A;  2PKM A;  3K5W A;  3UQE A;  3B1R A;  3NL2 A;  4K8C A;  1RFU A;  1EKK A;  2QHP A;  4XF6 A;  3PL2 A;  4S1M A;  4XCK A;  1YGJ A;  3HJ6 A;  4EUM A;  3UBO A;  4C5M A;  2PKK A;  2RBC A;  3I3Y A;  5BYE A;  2FV7 A;  3GO6 A;  1RKD A;  5C3Z A;  3FHY A;  4K8P A;  4K8K A;  4E3A A;  3BF5 A;  2AFB A;  1V1B A;  3B3L A;  1LIO A;  3UQD A;  1LHR A;  5EY7 A;  2QCV A;  4KAN A;  5CGA A;  3RQX A;  3LOO A;  5BYC A;  5C41 A;  2AJP A;  1GC5 A;  1RFT A;  1RKS A;  2AWD A;  1V1A A;  3ZS7 A;  4O1L A;  3RSS A;  1RFV A;  1YGK A;  1VK4 A;  3RRE A;  2AX3 A;  3IBQ A;  4LC4 A;  3RTG A;  2AA0 A;  3MBH A;  4K8T A;  5F0Z A;  3B1O A;  3RQH A;  3DZV A;  1ESQ A;  1VM7 A;  3IQ0 A;  4S1H A;  1TZ6 A;  4B8R A;  3RRF A;  2AJR A;  4EBU A;  4JJP A;  2JG1 A;  2HW1 A;  3IKH A;  5TRW A;  3RTE A;  3RTB A;  3CQD A;  3KEU A;  3NC9 A;  3RSG A;  3RRB A;  3EWM A;  3IE7 A;  1LIJ A;  5CGE A;  1BX4 A;  3VAS A;  2C49 A;  3W4S A;  2I5B A;  2F02 A;  3HIC A;  3RTC A;  2I6A A;  1WYE A;  3LKI A;  3RQ8 A;  3RQQ A;  1RK2 A;  4KBE A;  4LBG A;  2R3E A;  3RS8 A;  3LJS A;  3IH0 A;  3RSQ A;  1JXI A;  3GBU A;  3RQ6 A;  3RPH A;  3RTD A;  4E8Z A;  1UB0 A;  2I6B A;  2C4E A;  3B1Q A;  3LHX A;  4WJM A;  2XTB A;  3UMP A;  2HLZ A;  3NL5 A;  4B8S A;  4C5K A;  3MBJ A;  4X8F A;  2VAR A;  5B6A A;  3UQ9 A;  2ABQ A;  3RS9 A;  5COJ A;  3HPD A;  4N09 A;  1V1S A;  3KTN A;  3RY7 A;  3NCA A;  1LIK A;  3DRW A;  2NWH A;  3KD6 A;  4N08 A;  3NM3 A;  4YL5 A;  3RQ5 A;  4E8Y A;  2JG5 A;  3H74 A;  4S1I A;  3GO7 A;  4E84 A;  2A9Z A;  1EKQ A;  3B1N A;  3NL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...