1DGMA

Crystal structure of adenosine kinase from toxoplasma gondii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
354
structure length
346
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNAFEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adenosine kinase from Toxoplasma gondii at 1.8 A resolution.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Transferase
molecule keywords ADENOSINE KINASE
total genus 119
structure length 346
sequence length 354
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 1dgmA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1dgmA01
5B6AA 2AX3A 3RU2A 3PZSA 3RQ2A 2PKFA 2FV7A 4XCKA 1TZ3A 4E84A 3RO4A 1TZ6A 3B1QA 3NL3A 3W4SA 4WJMA 4K9CA 3LOOA 2YXUA 5F11A 2PKKA 3IH0A 3IBQA 3NCAA 3RPHA 3RT7A 2PKNA 4XDAA 4N09A 2ABSA 2R3EA 2V78A 4N08A 1U2XA 3BGKA 3KEUA 3NBWA 4O1GA 1RFVA 3Q1YA 5EYNA 5BYDA 3H49A 1ESJA 4LBXA 3HYOA 4EUMA 4JKSA 5CM5A 3RU3A 5CGEA 3I3YA 3IKHA 3K9EA 4K93A 2A9ZA 2DDWA 1V1BA 1TD2A 3LKIA 4JJPA 4K8CA 1LHRA 4KBEA 4C5NA 3GBUA 3KD6A 1L2LA 4KALA 4LCAA 4LBGA 1RFTA 1LIKA 1EKKA 3NL5A 4LC4A 3RT9A 2ABQA 3RQ6A 1UB0A 3LHXA 3B1NA 2F02A 4PVVA 3VAQA 3UQ9A 3N1CA 4KADA 3RS8A 4EBUA 3K5WA 3RRFA 4X8FA 3RSSA 5CGAA 2I5BA 3NC9A 3RQ8A 3RSFA 2DDOA 5BYCA 1RK2A 4B8RA 4E69A 4DC3A 3DZVA 3RTBA 2JG5A 3PL2A 3H74A 1C3QA 1ESQA 2YXTA 3IE7A 1VK4A 1VI9A 3DRWA 4KANA 3UQEA 3RQQA 3HICA 3EWMA 1V1AA 3FHYA 4JKUA 1GC5A 4K9IA 3RQXA 1BX4A 2AFBA 2HLZA 3NM1A 3QAIA 4K8PA 4EOHA 4KAHA 3NL6A 2R3BA 2HW1A 2JGVA 2DCNA 2NWHA 1DGMA 4UBEA 3RSQA 3IN1A 1GQTA 3NC2A 3UMOA 3RTGA 3HPDA 3GO7A 4YWRA 1YHJA 5C41A 1RKDA 1KYHA 1UA4A 3B1RA 2JG1A 3B3LA 3NL2A 2HQQA 2AWDA 4GM6A 1TYYA 4S1HA 4XF6A 5COJA 3BF5A 2I6BA 4XF7A 3FHXA 3B1PA 5BYFA 4S1MA 2Q5RA 3RTDA 3UQDA 2QHPA 3UMPA 5F0ZA 1EKQA 1V1SA 1LIJA 3CQDA 3QA2A 4K8TA 5C3YA 4DU5A 2DDMA 1WYEA 2AJPA 3RS9A 1V19A 4S1IB 3MBJA 2PKMA 3Q92A 4YL5A 3RM5A 4E8ZA 3LJSA 1YGKA 2C4EA 2F7KA 3RY7A 3RREA 1RFUA 3B1OA 4S1IA 2C49A 3RTEA 4EN4A 3KZHA 1VM7A 2RBCA 1RKSA 3RTAA 4K8KA 1JXHA 1LIOA 2A9YA 5C40A 1LIIA 5TRWA 3RQ5A 3KTNA 1JXIA 2XTBA 3IQ0A 3ZS7A 3VASA 2I6AA 1RKAA 3RQHA 2AA0A 3JULA 4E3AA 2AB8A 2AJRA 4C5JA 3RPZA 1LHPA 3MBHA 2QCVA 4E8WA 3RTCA 3OTXA 5C3ZA 4U7XA 3NBVA 5EY7A 3UBOA 3NM3A 3UQ6A 4C5KA 5BYEA 3RRBA 3RRJA 5TQIA 4B8SA 4E8YA 4O1LA 4C5MA 4C5LA 2VARA 3GO6A 3RSGA 1YGJA
chains in the Genus database with same CATH superfamily
5B6AA 2AX3A 1GQYA 3RU2A 3PZSA 3RQ2A 4HV4A 2PKFA 2FV7A 4XCKA 1TZ3A 5COJA 4E84A 3RO4A 2GC6A 1TZ6A 3B1QA 3NL3A 3W4SA 4WJMA 5C41A 4K9CA 3LOOA 2Y66A 2YXUA 5F11A 2PKKA 2XPCA 3IBQA 2UUPA 3IH0A 3NCAA 3RPHA 3RT7A 5A5EA 2PKNA 4XDAA 4N09A 2ABSA 2R3EA 2V78A 3NRSA 3ZL8A 1E0DA 1U2XA 4N08A 3BGKA 3KEUA 3NBWA 4O1GA 1RFVA 3Q1YA 5EYNA 5BYDA 3H49A 1ESJA 4LBXA 3HYOA 4EUMA 4JKSA 1FGSA 2JFHA 1W7KA 5CM5A 3RU3A 3I3YA 1P31A 3IKHA 3K9EA 4K93A 2A9ZA 4CVMA 2DDWA 1V1BA 1TD2A 3LKIA 4JJPA 4K8CA 1LHRA 4KBEA 3UMOA 3ZM6A 4C5NA 3GBUA 3KD6A 1L2LA 4KALA 4LCAA 4LBGA 1RFTA 1LIKA 1EKKA 3NL5A 4LC4A 3RT9A 2ABQA 3RQ6A 1UB0A 3LHXA 3B1NA 2F02A 4PVVA 3VAQA 3UQ9A 1O5ZA 3N1CA 4KADA 4EBUA 3K5WA 3RRFA 4X8FA 3RSSA 5CGAA 2I5BA 2Y68A 3NC9A 4QF5A 3RQ8A 3RSFA 4CVLA 2DDOA 4C12A 5BYCA 1RK2A 4B8RA 2WTZA 4E69A 2XJAA 4DC3A 3DZVA 3RTBA 4GM6A 1P3DA 5A5FA 2JG5A 3PL2A 1EEHA 3H74A 1C3QA 1ESQA 2GCAA 1GG4A 1VK4A 1VI9A 3DRWA 2JFGA 2YXTA 3IE7A 4KANA 3RQQA 3HICA 3EWMA 1V1AA 3FHYA 4JKUA 1GC5A 4K9IA 3RQXA 1BX4A 2AFBA 2HLZA 3NM1A 3QAIA 4K8PA 4EOHA 2GCBA 3NL6A 4KAHA 2R3BA 1JBVA 1DGMA 2DCNA 2HW1A 2JGVA 2NWHA 4QDIA 4UBEA 3IN1A 1GQTA 2Y67A 3NC2A 2UUOA 1JBWA 3RTGA 3HPDA 3GO7A 4YWRA 3HN7A 1YHJA 4C13A 1RKDA 2VTDA 1UA4A 1KYHA 2Y1OA 2JG1A 3B1RA 3B3LA 2HQQA 2AWDA 3HJ6A 1TYYA 2JFFA 3NL2A 4S1HA 4XF6A 3BF5A 2I6BA 2UAGA 4XF7A 3FHXA 4CVKA 3B1PA 5BYFA 4S1MA 2Q5RA 3RTDA 3UQDA 1E8CA 2QHPA 3QCZA 3UMPA 5F0ZA 1EKQA 1V1SA 1LIJA 3CQDA 1GQQA 3QA2A 4K8TA 5C3YA 4DU5A 2DDMA 1WYEA 4BUCA 2AJPA 3RS9A 1V19A 4S1IB 2AM2A 2PKMA 2WJPA 3MBJA 3LK7A 3Q92A 3LJSA 4YL5A 3RM5A 3RSQA 1YGKA 3N2AA 2C4EA 2F7KA 2VORA 3RY7A 4E8ZA 3RREA 1RFUA 2VTEA 3B1OA 4S1IA 4ZIYA 2C49A 3RTEA 4EN4A 3KZHA 1VM7A 2RBCA 1RKSA 3RTAA 4K8KA 1JXHA 1LIOA 2A9YA 5C40A 1LIIA 5TRWA 3RQ5A 3KTNA 1JXIA 3UQEA 2XTBA 2F00A 2X5OA 3IQ0A 1UAGA 3ZS7A 3VASA 2I6AA 3EAGA 1RKAA 4BUBA 3RQHA 4UAGA 3PYZA 3ZM5A 2AA0A 3JULA 4E3AA 2AB8A 5CGEA 2AJRA 4C5JA 3RPZA 4C5LA 1LHPA 3MBHA 2QCVA 1J6UA 3RTCA 3OTXA 4E8WA 5C3ZA 4U7XA 2GC5A 3NBVA 3RS8A 5EY7A 3UBOA 3NM3A 3UQ6A 4C5KA 2VOSA 5BYEA 3RRBA 3RRJA 5TQIA 4B8SA 1W78A 4E8YA 4O1LA 3UAGA 4C5MA 2VARA 3GO6A 2AM1A 3RSGA 1YGJA
chains in the Genus database with same CATH topology
5B6AA 2AX3A 3RU2A 3PZSA 3RQ2A 2PKFA 2FV7A 4XCKA 1TZ3A 4E84A 3RO4A 1TZ6A 3B1QA 3NL3A 3W4SA 4WJMA 4K9CA 3LOOA 2YXUA 5F11A 2PKKA 3IH0A 3IBQA 3NCAA 3RPHA 3RT7A 2PKNA 4XDAA 4N09A 2ABSA 2R3EA 2V78A 1U2XA 4N08A 3BGKA 3KEUA 3NBWA 4O1GA 1RFVA 3Q1YA 5EYNA 5BYDA 3H49A 1ESJA 4LBXA 3HYOA 4EUMA 4JKSA 5CM5A 3RU3A 5CGEA 3I3YA 3IKHA 3K9EA 4K93A 2A9ZA 2DDWA 1V1BA 1TD2A 3LKIA 4JJPA 4K8CA 1LHRA 4KBEA 4C5NA 3GBUA 3KD6A 1L2LA 4KALA 4LCAA 4LBGA 1RFTA 1LIKA 1EKKA 3NL5A 4LC4A 3RT9A 2ABQA 3RQ6A 1UB0A 3LHXA 3B1NA 2F02A 4PVVA 3VAQA 3UQ9A 3N1CA 4KADA 3RS8A 4EBUA 3K5WA 3RRFA 4X8FA 3RSSA 5CGAA 2I5BA 3NC9A 3RQ8A 3RSFA 2DDOA 5BYCA 1RK2A 4B8RA 4E69A 4DC3A 3DZVA 3RTBA 2JG5A 3PL2A 3H74A 1C3QA 1ESQA 2YXTA 3IE7A 1VK4A 1VI9A 3DRWA 4KANA 3UQEA 3RQQA 3HICA 3EWMA 1V1AA 3FHYA 4JKUA 1GC5A 4K9IA 3RQXA 1BX4A 2AFBA 2HLZA 3NM1A 3QAIA 4K8PA 4EOHA 4KAHA 3NL6A 2R3BA 2HW1A 2DCNA 1DGMA 2JGVA 2NWHA 4UBEA 3RSQA 3IN1A 1GQTA 3NC2A 3UMOA 3RTGA 3HPDA 3GO7A 4YWRA 1YHJA 5C41A 1RKDA 1UA4A 1KYHA 3B1RA 2JG1A 3B3LA 3HJ6A 2HQQA 2AWDA 3NL2A 1TYYA 4GM6A 4S1HA 4XF6A 5COJA 3BF5A 2I6BA 4XF7A 3FHXA 3B1PA 5BYFA 4S1MA 2Q5RA 3RTDA 3UQDA 2QHPA 3UMPA 5F0ZA 1EKQA 1V1SA 1LIJA 3CQDA 3QA2A 4K8TA 5C3YA 4DU5A 2DDMA 1WYEA 2AJPA 3RS9A 1V19A 4S1IB 3MBJA 2PKMA 3Q92A 4YL5A 3RM5A 4E8ZA 3LJSA 1YGKA 2C4EA 2F7KA 3RY7A 3RREA 1RFUA 3B1OA 4S1IA 2C49A 3RTEA 4EN4A 3KZHA 1VM7A 2RBCA 1RKSA 3RTAA 4K8KA 1JXHA 1LIOA 2A9YA 5C40A 1LIIA 5TRWA 3RQ5A 3KTNA 1JXIA 2XTBA 3IQ0A 3ZS7A 3VASA 2I6AA 1RKAA 3RQHA 2AA0A 3JULA 4E3AA 2AB8A 2AJRA 4C5JA 3RPZA 1LHPA 3MBHA 2QCVA 4E8WA 3RTCA 3OTXA 5C3ZA 4U7XA 3NBVA 5EY7A 3UBOA 3NM3A 3UQ6A 4C5KA 5BYEA 3RRBA 3RRJA 5TQIA 4B8SA 4E8YA 4O1LA 4C5MA 4C5LA 2VARA 3GO6A 3RSGA 1YGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6A A;  2AX3 A;  3RU2 A;  3PZS A;  3RQ2 A;  2PKF A;  2FV7 A;  4XCK A;  1TZ3 A;  4E84 A;  3RO4 A;  1TZ6 A;  3B1Q A;  3NL3 A;  3W4S A;  4WJM A;  4K9C A;  3LOO A;  2YXU A;  5F11 A;  2PKK A;  3IH0 A;  3IBQ A;  3NCA A;  3RPH A;  3RT7 A;  2PKN A;  4XDA A;  4N09 A;  2ABS A;  2R3E A;  2V78 A;  4N08 A;  1U2X A;  3BGK A;  3KEU A;  3NBW A;  4O1G A;  1RFV A;  3Q1Y A;  5EYN A;  5BYD A;  3H49 A;  1ESJ A;  4LBX A;  3HYO A;  4EUM A;  4JKS A;  5CM5 A;  3RU3 A;  5CGE A;  3I3Y A;  3IKH A;  3K9E A;  4K93 A;  2A9Z A;  2DDW A;  1V1B A;  1TD2 A;  3LKI A;  4JJP A;  4K8C A;  1LHR A;  4KBE A;  4C5N A;  3GBU A;  3KD6 A;  1L2L A;  4KAL A;  4LCA A;  4LBG A;  1RFT A;  1LIK A;  1EKK A;  3NL5 A;  4LC4 A;  3RT9 A;  2ABQ A;  3RQ6 A;  1UB0 A;  3LHX A;  3B1N A;  2F02 A;  4PVV A;  3VAQ A;  3UQ9 A;  3N1C A;  4KAD A;  3RS8 A;  4EBU A;  3K5W A;  3RRF A;  4X8F A;  3RSS A;  5CGA A;  2I5B A;  3NC9 A;  3RQ8 A;  3RSF A;  2DDO A;  5BYC A;  1RK2 A;  4B8R A;  4E69 A;  4DC3 A;  3DZV A;  3RTB A;  2JG5 A;  3PL2 A;  3H74 A;  1C3Q A;  1ESQ A;  2YXT A;  3IE7 A;  1VK4 A;  1VI9 A;  3DRW A;  4KAN A;  3UQE A;  3RQQ A;  3HIC A;  3EWM A;  1V1A A;  3FHY A;  4JKU A;  1GC5 A;  4K9I A;  3RQX A;  1BX4 A;  2AFB A;  2HLZ A;  3NM1 A;  3QAI A;  4K8P A;  4EOH A;  4KAH A;  3NL6 A;  2R3B A;  2HW1 A;  2JGV A;  2DCN A;  2NWH A;  1DGM A;  4UBE A;  3RSQ A;  3IN1 A;  1GQT A;  3NC2 A;  3UMO A;  3RTG A;  3HPD A;  3GO7 A;  4YWR A;  1YHJ A;  5C41 A;  1RKD A;  1KYH A;  1UA4 A;  3B1R A;  2JG1 A;  3B3L A;  3NL2 A;  2HQQ A;  2AWD A;  4GM6 A;  1TYY A;  4S1H A;  4XF6 A;  5COJ A;  3BF5 A;  2I6B A;  4XF7 A;  3FHX A;  3B1P A;  5BYF A;  4S1M A;  2Q5R A;  3RTD A;  3UQD A;  2QHP A;  3UMP A;  5F0Z A;  1EKQ A;  1V1S A;  1LIJ A;  3CQD A;  3QA2 A;  4K8T A;  5C3Y A;  4DU5 A;  2DDM A;  1WYE A;  2AJP A;  3RS9 A;  1V19 A;  4S1I B;  3MBJ A;  2PKM A;  3Q92 A;  4YL5 A;  3RM5 A;  4E8Z A;  3LJS A;  1YGK A;  2C4E A;  2F7K A;  3RY7 A;  3RRE A;  1RFU A;  3B1O A;  4S1I A;  2C49 A;  3RTE A;  4EN4 A;  3KZH A;  1VM7 A;  2RBC A;  1RKS A;  3RTA A;  4K8K A;  1JXH A;  1LIO A;  2A9Y A;  5C40 A;  1LII A;  5TRW A;  3RQ5 A;  3KTN A;  1JXI A;  2XTB A;  3IQ0 A;  3ZS7 A;  3VAS A;  2I6A A;  1RKA A;  3RQH A;  2AA0 A;  3JUL A;  4E3A A;  2AB8 A;  2AJR A;  4C5J A;  3RPZ A;  1LHP A;  3MBH A;  2QCV A;  4E8W A;  3RTC A;  3OTX A;  5C3Z A;  4U7X A;  3NBV A;  5EY7 A;  3UBO A;  3NM3 A;  3UQ6 A;  4C5K A;  5BYE A;  3RRB A;  3RRJ A;  5TQI A;  4B8S A;  4E8Y A;  4O1L A;  4C5M A;  4C5L A;  2VAR A;  3GO6 A;  3RSG A;  1YGJ A; 
#chains in the Genus database with same CATH topology
 5B6A A;  2AX3 A;  1GQY A;  3RU2 A;  3PZS A;  3RQ2 A;  4HV4 A;  2PKF A;  2FV7 A;  4XCK A;  1TZ3 A;  5COJ A;  4E84 A;  3RO4 A;  2GC6 A;  1TZ6 A;  3B1Q A;  3NL3 A;  3W4S A;  4WJM A;  5C41 A;  4K9C A;  3LOO A;  2Y66 A;  2YXU A;  5F11 A;  2PKK A;  2XPC A;  3IBQ A;  2UUP A;  3IH0 A;  3NCA A;  3RPH A;  3RT7 A;  5A5E A;  2PKN A;  4XDA A;  4N09 A;  2ABS A;  2R3E A;  2V78 A;  3NRS A;  3ZL8 A;  1E0D A;  1U2X A;  4N08 A;  3BGK A;  3KEU A;  3NBW A;  4O1G A;  1RFV A;  3Q1Y A;  5EYN A;  5BYD A;  3H49 A;  1ESJ A;  4LBX A;  3HYO A;  4EUM A;  4JKS A;  1FGS A;  2JFH A;  1W7K A;  5CM5 A;  3RU3 A;  3I3Y A;  1P31 A;  3IKH A;  3K9E A;  4K93 A;  2A9Z A;  4CVM A;  2DDW A;  1V1B A;  1TD2 A;  3LKI A;  4JJP A;  4K8C A;  1LHR A;  4KBE A;  3UMO A;  3ZM6 A;  4C5N A;  3GBU A;  3KD6 A;  1L2L A;  4KAL A;  4LCA A;  4LBG A;  1RFT A;  1LIK A;  1EKK A;  3NL5 A;  4LC4 A;  3RT9 A;  2ABQ A;  3RQ6 A;  1UB0 A;  3LHX A;  3B1N A;  2F02 A;  4PVV A;  3VAQ A;  3UQ9 A;  1O5Z A;  3N1C A;  4KAD A;  4EBU A;  3K5W A;  3RRF A;  4X8F A;  3RSS A;  5CGA A;  2I5B A;  2Y68 A;  3NC9 A;  4QF5 A;  3RQ8 A;  3RSF A;  4CVL A;  2DDO A;  4C12 A;  5BYC A;  1RK2 A;  4B8R A;  2WTZ A;  4E69 A;  2XJA A;  4DC3 A;  3DZV A;  3RTB A;  4GM6 A;  1P3D A;  5A5F A;  2JG5 A;  3PL2 A;  1EEH A;  3H74 A;  1C3Q A;  1ESQ A;  2GCA A;  1GG4 A;  1VK4 A;  1VI9 A;  3DRW A;  2JFG A;  2YXT A;  3IE7 A;  4KAN A;  3RQQ A;  3HIC A;  3EWM A;  1V1A A;  3FHY A;  4JKU A;  1GC5 A;  4K9I A;  3RQX A;  1BX4 A;  2AFB A;  2HLZ A;  3NM1 A;  3QAI A;  4K8P A;  4EOH A;  2GCB A;  3NL6 A;  4KAH A;  2R3B A;  1JBV A;  1DGM A;  2DCN A;  2HW1 A;  2JGV A;  2NWH A;  4QDI A;  4UBE A;  3IN1 A;  1GQT A;  2Y67 A;  3NC2 A;  2UUO A;  1JBW A;  3RTG A;  3HPD A;  3GO7 A;  4YWR A;  3HN7 A;  1YHJ A;  4C13 A;  1RKD A;  2VTD A;  1UA4 A;  1KYH A;  2Y1O A;  2JG1 A;  3B1R A;  3B3L A;  2HQQ A;  2AWD A;  3HJ6 A;  1TYY A;  2JFF A;  3NL2 A;  4S1H A;  4XF6 A;  3BF5 A;  2I6B A;  2UAG A;  4XF7 A;  3FHX A;  4CVK A;  3B1P A;  5BYF A;  4S1M A;  2Q5R A;  3RTD A;  3UQD A;  1E8C A;  2QHP A;  3QCZ A;  3UMP A;  5F0Z A;  1EKQ A;  1V1S A;  1LIJ A;  3CQD A;  1GQQ A;  3QA2 A;  4K8T A;  5C3Y A;  4DU5 A;  2DDM A;  1WYE A;  4BUC A;  2AJP A;  3RS9 A;  1V19 A;  4S1I B;  2AM2 A;  2PKM A;  2WJP A;  3MBJ A;  3LK7 A;  3Q92 A;  3LJS A;  4YL5 A;  3RM5 A;  3RSQ A;  1YGK A;  3N2A A;  2C4E A;  2F7K A;  2VOR A;  3RY7 A;  4E8Z A;  3RRE A;  1RFU A;  2VTE A;  3B1O A;  4S1I A;  4ZIY A;  2C49 A;  3RTE A;  4EN4 A;  3KZH A;  1VM7 A;  2RBC A;  1RKS A;  3RTA A;  4K8K A;  1JXH A;  1LIO A;  2A9Y A;  5C40 A;  1LII A;  5TRW A;  3RQ5 A;  3KTN A;  1JXI A;  3UQE A;  2XTB A;  2F00 A;  2X5O A;  3IQ0 A;  1UAG A;  3ZS7 A;  3VAS A;  2I6A A;  3EAG A;  1RKA A;  4BUB A;  3RQH A;  4UAG A;  3PYZ A;  3ZM5 A;  2AA0 A;  3JUL A;  4E3A A;  2AB8 A;  5CGE A;  2AJR A;  4C5J A;  3RPZ A;  4C5L A;  1LHP A;  3MBH A;  2QCV A;  1J6U A;  3RTC A;  3OTX A;  4E8W A;  5C3Z A;  4U7X A;  2GC5 A;  3NBV A;  3RS8 A;  5EY7 A;  3UBO A;  3NM3 A;  3UQ6 A;  4C5K A;  2VOS A;  5BYE A;  3RRB A;  3RRJ A;  5TQI A;  4B8S A;  1W78 A;  4E8Y A;  4O1L A;  3UAG A;  4C5M A;  2VAR A;  3GO6 A;  2AM1 A;  3RSG A;  1YGJ A; 
#chains in the Genus database with same CATH homology
 5B6A A;  2AX3 A;  3RU2 A;  3PZS A;  3RQ2 A;  2PKF A;  2FV7 A;  4XCK A;  1TZ3 A;  4E84 A;  3RO4 A;  1TZ6 A;  3B1Q A;  3NL3 A;  3W4S A;  4WJM A;  4K9C A;  3LOO A;  2YXU A;  5F11 A;  2PKK A;  3IH0 A;  3IBQ A;  3NCA A;  3RPH A;  3RT7 A;  2PKN A;  4XDA A;  4N09 A;  2ABS A;  2R3E A;  2V78 A;  1U2X A;  4N08 A;  3BGK A;  3KEU A;  3NBW A;  4O1G A;  1RFV A;  3Q1Y A;  5EYN A;  5BYD A;  3H49 A;  1ESJ A;  4LBX A;  3HYO A;  4EUM A;  4JKS A;  5CM5 A;  3RU3 A;  5CGE A;  3I3Y A;  3IKH A;  3K9E A;  4K93 A;  2A9Z A;  2DDW A;  1V1B A;  1TD2 A;  3LKI A;  4JJP A;  4K8C A;  1LHR A;  4KBE A;  4C5N A;  3GBU A;  3KD6 A;  1L2L A;  4KAL A;  4LCA A;  4LBG A;  1RFT A;  1LIK A;  1EKK A;  3NL5 A;  4LC4 A;  3RT9 A;  2ABQ A;  3RQ6 A;  1UB0 A;  3LHX A;  3B1N A;  2F02 A;  4PVV A;  3VAQ A;  3UQ9 A;  3N1C A;  4KAD A;  3RS8 A;  4EBU A;  3K5W A;  3RRF A;  4X8F A;  3RSS A;  5CGA A;  2I5B A;  3NC9 A;  3RQ8 A;  3RSF A;  2DDO A;  5BYC A;  1RK2 A;  4B8R A;  4E69 A;  4DC3 A;  3DZV A;  3RTB A;  2JG5 A;  3PL2 A;  3H74 A;  1C3Q A;  1ESQ A;  2YXT A;  3IE7 A;  1VK4 A;  1VI9 A;  3DRW A;  4KAN A;  3UQE A;  3RQQ A;  3HIC A;  3EWM A;  1V1A A;  3FHY A;  4JKU A;  1GC5 A;  4K9I A;  3RQX A;  1BX4 A;  2AFB A;  2HLZ A;  3NM1 A;  3QAI A;  4K8P A;  4EOH A;  4KAH A;  3NL6 A;  2R3B A;  2HW1 A;  2DCN A;  1DGM A;  2JGV A;  2NWH A;  4UBE A;  3RSQ A;  3IN1 A;  1GQT A;  3NC2 A;  3UMO A;  3RTG A;  3HPD A;  3GO7 A;  4YWR A;  1YHJ A;  5C41 A;  1RKD A;  1UA4 A;  1KYH A;  3B1R A;  2JG1 A;  3B3L A;  3HJ6 A;  2HQQ A;  2AWD A;  3NL2 A;  1TYY A;  4GM6 A;  4S1H A;  4XF6 A;  5COJ A;  3BF5 A;  2I6B A;  4XF7 A;  3FHX A;  3B1P A;  5BYF A;  4S1M A;  2Q5R A;  3RTD A;  3UQD A;  2QHP A;  3UMP A;  5F0Z A;  1EKQ A;  1V1S A;  1LIJ A;  3CQD A;  3QA2 A;  4K8T A;  5C3Y A;  4DU5 A;  2DDM A;  1WYE A;  2AJP A;  3RS9 A;  1V19 A;  4S1I B;  3MBJ A;  2PKM A;  3Q92 A;  4YL5 A;  3RM5 A;  4E8Z A;  3LJS A;  1YGK A;  2C4E A;  2F7K A;  3RY7 A;  3RRE A;  1RFU A;  3B1O A;  4S1I A;  2C49 A;  3RTE A;  4EN4 A;  3KZH A;  1VM7 A;  2RBC A;  1RKS A;  3RTA A;  4K8K A;  1JXH A;  1LIO A;  2A9Y A;  5C40 A;  1LII A;  5TRW A;  3RQ5 A;  3KTN A;  1JXI A;  2XTB A;  3IQ0 A;  3ZS7 A;  3VAS A;  2I6A A;  1RKA A;  3RQH A;  2AA0 A;  3JUL A;  4E3A A;  2AB8 A;  2AJR A;  4C5J A;  3RPZ A;  1LHP A;  3MBH A;  2QCV A;  4E8W A;  3RTC A;  3OTX A;  5C3Z A;  4U7X A;  3NBV A;  5EY7 A;  3UBO A;  3NM3 A;  3UQ6 A;  4C5K A;  5BYE A;  3RRB A;  3RRJ A;  5TQI A;  4B8S A;  4E8Y A;  4O1L A;  4C5M A;  4C5L A;  2VAR A;  3GO6 A;  3RSG A;  1YGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...