1DHKA

Structure of porcine pancreatic alpha-amylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PORCINE PANCREATIC ALPHA-AMYLASE
publication title Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex.
pubmed doi rcsb
molecule tags Complex (hydrolase/inhibitor)
total genus 154
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dhkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dhkA01
1MFVA 2OWCA 1QBAA 4PTMA 2DH2A 5KEZA 1KQYA 2X2YA 3JUGA 3SCRA 1EA9C 4J3SA 4D6DA 1CGVA 2OYMA 2VX5A 3ZOAA 2JEPA 2D24A 3EMQA 3ZO9A 3BAJA 3BLPX 4PMYA 1JD7A 3W27A 1W1PA 2DT3A 1GOOA 4RE2A 2EPNA 3MKKA 1VB9A 1J10A 4UNIA 4AZCA 2UY5A 1DEDA 5CLTA 3WELA 4J3XA 2W92A 5CPQA 1HIZA 3A4AA 3WF0A 4PMQA 1HJQA 1ISYA 1E1FA 4A3YA 5ABEA 1G0CA 1M7XA 3UR7A 2RGMA 1CGTA 1US3A 5FL0A 4FNQA 5A1AA 3T09A 1E4NA 4PUEA 2AOSA 3UERA 3ARQA 3GBDA 3PZVA 4W84A 3ARZA 2DDXA 3AHVA 8A3HA 1LQ0A 4P8WA 3ARVA 1HX0A 1WZMA 1E55A 3PZOA 4M81A 3EJUA 2VZTA 3GXIA 2QMJA 4LPCA 1XGZA 2UY2A 3PHAA 1FH8A 1NOWA 2XVNA 1W9BM 4F79A 4LYRA 4GZEA 3F5JA 5ABHA 2FHBA 3HG5A 3VPLA 2ZIDA 2D73A 2BS9A 1OD8A 4P8VA 2J7DA 4C7FA 4NZJA 2GJXB 2WC7A 3A3HA 1BVNP 3VGDA 4PTWA 3VX1A 3MU7A 1TA3B 3CUJA 1UQYA 4JFWA 1ZU8A 1W3KA 2WSPA 1FHDA 4JCLA 3MI6A 2BXZA 4J28A 4GQQA 3UETA 4D71A 4PMDA 1GJWA 3QHMA 3THDA 4EE9A 2CYGA 4GXPA 4UFKA 4XZWA 1NP2A 2YLLA 2ZOXA 4CCEA 4PMUA 1BYCA 4D6GA 2VZUA 3T08A 8CGTA 5A2AA 2XPKA 5E70A 3AHTA 2DQXA 5HBFA 5I77A 2J7HA 1NWUA 5I23A 2ZXQA 2E8ZA 5I3DA 1VF8A 2PBGA 2YL8A 2XVGA 5ABFA 3MMWA 3UG4A 2WZEA 3BGAA 3PZ9A 4QDMA 2NT0A 4UTFA 1MXDA 3VDBA 1LWHA 4AZ5A 1H2JA 2WWDA 3U5YA 3BAYA 1ODUA 1B9ZA 1H09A 1XCWA 4NSBA 3AMKA 1UD3A 1V6WA 5JUVA 3WEMA 3W6MA 3L2LA 4AD2A 1V02E 1HT6A 3SCQA 5CJ5A 3PTKA 3K8KA 5CLWA 5JBDA 1IZJA 4CN4A 2ZXBA 5AC5A 1Q6DA 3ZJ6A 2V3DA 3AISA 2EPLX 1FP9A 3ARSA 2CETA 1A3HA 4UOJA 3LPGA 4JL1A 1KXVA 4WF7A 2JALA 3WN6A 1HP4A 3WQ6A 1WP6A 3CUIA 5A2BA 1KXHA 2WMKA 4MB3A 2VNCA 3GNRA 2J25A 1LWJA 1E5JA 1J12A 1EGZA 2WVTA 1CNVA 5C70A 2DSZA 1B1YA 4MJ2A 1HN1A 3AMDA 1E9LA 3CZJA 5A6BA 3W29A 4ATWA 3ZR6A 3VD5A 5M17A 1MXGA 1MWOA 3T2PA 3OGSA 3H55A 4W89A 2WCGA 3ZT5A 3VILA 1KTCA 3BXWA 1J01A 3NUKA 4R5EA 5BRQA 1FH9A 4U3CA 3SURA 2UWFA 2YDRA 5IXEA 2XSAA 4XZBA 2XWDA 2D2OA 2W5FA 2F18A 5D9PA 1E3XA 3N1AA 1JF5A 3TONA 5A95A 3TV8A 5A3HA 3WUFA 5IFPA 4UQ9A 4QCEA 3CHFA 3LPFA 2G3NA 3T0BA 1JZ3A 1MFUA 5M5DA 4FNUA 4B15A 3WDHA 2GJRA 3S5YA 2EABA 5BRPA 4BS0A 1FH7A 1NWSA 1LL4A 1L0PA 4PMOA 3BVWA 1QNPA 2G3MA 1OCQA 5E6YA 2WHJA 1H1NA 1E4IA 4MJ4A 1QX1A 4CU8A 1UH3A 1TE1A 3WFZA 4UOZA 1BYAA 3UCQA 4LX4A 1PIGA 4OKDA 3BUBA 4V2XA 1D7FA 3IAQA 4JKLA 1ZJAA 1E6SM 3VD7A 1JYNA 4AIOA 2WLYA 3N13A 2BVDA 3MO4A 1EH9A 1R7AA 3ARUA 3FN9A 1Z32X 3VDCA 3BUQA 2A3AA 4AMXA 3SUTA 1V6YA 2XWEA 5D9MA 1AQMA 1QI5A 4MTVA 3W26A 2QLYA 2ZX6A 1CXLA 3HJEA 1E0VA 4N42A 1M03A 2JFEX 1JFXA 2X1IA 3LPOA 1C7SA 2FDMA 3CV5A 1W1YA 1QI0A 4AZIA 1VJZA 2E4TA 2VRQA 4HOZA 4KMQA 3M46A 2G8ZA 3DYPA 2DT0A 2WYSA 5HXMA 2F7PA 1KCLA 2F2HA 4LQ1A 2NSXA 1CXHA 2ZX7A 3AHXA 5KZ6A 3NSXA 2EEXA 1T0OA 1XC6A 1J0JA 2EACA 3L4YA 1V6XA 2GJPA 2YFNA 1CBGA 3OGRA 1JZ4A 5A6LA 4FMVA 1B3XA 1PJ9A 1BF2A 3LXAA 3LX9A 4HMEA 2WZHA 3B9AA 1BAGA 4NXSA 4URIA 3D4YA 3NDZA 4AY1A 2WKLA 3AQUA 3SCOA 1QOXA 3EDFA 1XCXA 4HOXA 1V3KA 2VCAA 2VQTA 3FXYA 1EO7A 4PEEA 3CUFA 3WENA 1VEPA 2J4GA 2QMKA 1W9DM 4KH2A 3AXHA 4OBRA 4GO8A 1CXIA 5A8NA 3A24A 2VZSA 3E1F1 1C8YA 2E9BA 2GK1B 1NOFA 4F9DA 2FHFA 2XYLA 2VZOA 4PCSA 3KWXA 3WFLA 3H54A 2FE0A 2PF0A 4EK7A 3WH5A 4KGJA 1X6LA 2BV9A 2XN1A 1GVIA 4ACYA 1XH1A 5CGMA 2ALWA 1DWIM 2XFRA 3AIRA 3DYOA 1J0HA 4L4PA 5A69A 3WD0A 3D50A 3WNNA 3WUBA 1H41A 3KZSA 1VFFA 4GIAA 2CCRA 3WDJA 4AISA 3CPUA 1W1VA 2ZUWA 1X6NA 4HU0A 1NH6A 4W7VA 2D0HA 3N17A 3GBEA 3ARPA 2J7BA 3SCUA 5D9OA 4FLOA 3PZUA 4AIEA 5E0FA 1SYTA 2OLHA 1JGIA 4WSKA 2VJXA 4A4AA 1CXEA 3GYCA 2BY0A 1R8LA 1BFNA 1JI1A 5CZKA 2XUCA 3GNOA 4DWSA 4AD5A 1UKSA 2O9PA 1QWUA 1Y7VA 4BA0A 1GW1A 1E3ZA 3K1DA 3ARTA 2OSWA 1ITCA 3UEQA 3CZLA 3WUGA 2WMJA 4BCEA 5A6AA 5HOSA 3AYRA 4LGXA 2V3GA 1M01A 1E0WA 1NOUA 3VMOA 1ZJBA 3LRKA 4H7VA 1ISXA 1JYWA 5EB8A 4OIFA 2VI0A 3BAXA 1LL7A 1MW2A 4AD1A 2BHYA 4Q22A 4W87A 1TQWA 1UWUA 3PZNA 3CMGA 3II1A 2ZE0A 1BQCA 1WPCA 1I1WA 3W53A 3CZEA 3AIUA 2F61A 2IXVA 1QNRA 3CO4A 4U5KA 3WH7A 1UKPA 4WK9A 1C91A 2YA1A 1DWJM 2WK2A 3VIJA 5EFFA 4U2YA 3PN8A 2OWWA 5JIPA 2XHYA 2J8GA 5I5RA 2D0GA 4OZOA 4X0VA 1C92A 1HVXA 2BHZA 1BPLB 1HL9A 3CZGA 2XFYA 4MNKA 4ML4A 2EXOA 3A22A 1CPUA 1J0YA 3H53A 2BVTA 2BY3A 3NSMA 1JYVA 2YL6A 2XM1A 3NYDA 1B2YA 2X2JA 2O9TA 2WAGA 1E43A 5CG0A 5M03A 2CIPA 4YHGA 4CCCA 4TUFA 2X0YA 2UY4A 1MQQA 1B3VA 4KRUA 2F7QA 2BNJA 1JYXA 3RCNA 4QLKA 2GFTA 1JZ8A 5I6SA 4L4OA 2WM0A 1KQZA 3EJSA 4J3UA 2YL9A 4J3TA 5IFTA 2DH3A 1JDAA 1JZ2A 1HKMA 4WKFA 2BY1A 4H8UA 4LYPA 3G6MA 4Y7EA 1ZB5A 3TA9A 4J27A 3GH7A 5FD0A 1E4MM 3FHAA 5M3WA 2FYVA 4D6HA 1GQKA 5F7UA 3ZJKA 1V6VA 1JFHA 1UD5A 3U57A 4Z2JA 4AZCB 1V3MA 2ZUVA 3ZQ9A 1HXJA 1YHTA 2ZUSA 5A8QA 3LXBA 2VRKA 4C7DA 2PWFA 2GUYA 3ZMRA 1HJSA 4JFVA 2X8RA 2XGIA 2DT1A 2DGAA 2ZUTA 5EBAA 3W82A 1PPIA 3M07A 1UOKA 4CD6A 3ZM8A 2VVNA 2EADA 1V0MA 3BUPA 4JIEA 1VFUA 5I24A 1VBUA 4QLJA 3AHYA 4JKKA 1H0IA 5A8PA 4MB1A 4UQAA 3ECQA 3OLDA 2EPOA 2CPUA 1HXKA 1E6RA 7TAAA 3WF2A 3CZKA 3TOPA 1W2PA 5IDIA 4ACZB 4UZUA 3WD3A 3OZPA 3AXXA 3DDGA 1GPFA 1UKQA 1BYDA 1J0IA 4BQ2A 4NX0A 3WF1A 1G01A 5JIWA 3DHPA 1JD9A 4BQ5A 2ZX5A 2YFOA 1AMYA 3CIVA 4TX6A 1C8XA 4A3HA 1U33A 4RE3A 3AXIA 1H11A 4U31A 5DEZA 4DWSD 1VENA 1HJWA 1KGWA 2VOTA 2BXYA 2V3EA 3BMWA 5BWFA 4M56A 1E6ZA 5DT7A 3SUWA 3PZGA 3VIHA 1C93A 1BG9A 3SCPA 4WKHA 4AEEA 1UD6A 1EDQA 2VL4A 1BGGA 2WMIB 4QLLA 3DC0A 1FFQA 3FW6A 4FNTA 4CVWA 3SCNA 1W9PA 4PMRA 3GXNA 4P8UA 9CGTA 3J7HA 3VM5A 1XSJA 4W93A 3A21A 1CEOA 3VO0A 1LJYA 2J7GA 1GOIA 3WMBA 3DX4A 4H41A 1G1YA 4QP0A 3D52A 3EBVA 2GJXA 3WDPP 3DDFA 4PSPA 3AHZA 2ZX8A 5ABFB 1TA3A 4W8BA 1F4HA 3OZOA 2WMGA 3I3EA 1LG1A 4OUEA 1OBAA 1WDPA 3M6DA 2DEPA 1WCGA 3CUHA 1K9EA 1BSIA 1OM0A 2VURA 3FAWA 3ZT7A 1E73M 1R7OA 4GI6A 1GHSA 1HJUA 3W6LA 5ECUA 2XVPA 4HZ8A 4TVCA 2YKKA 3M7SA 3WDRA 1Q4NX 4S3KA 3O9NA 3RJYA 3EJQA 4BZYA 4P7RA 4UR9A 1PX8A 2G4FA 1FHLA 2YJQA 3RDKA 3GXPA 5FL1A 5GNZA 2O9OA 2FH6A 1K6AA 1ZBKA 3PZQA 1QNQA 3CUGA 1JI2A 2VC9A 4UQBA 3HU7A 2D3LA 4J7RA 4V27A 4NF7A 4E8CA 4Z2GA 5HDRA 3EDEA 1HVQA 3AMCA 1PIFA 4PMVA 4W5UA 3DECA 3GXMA 1B31A 3RM4A 1UZ1A 3ARYA 1UKTA 2WLZA 5AY7A 2E9MA 4PUDA 4U3AA 4D1JA 2EAEA 1P6WA 4PBGA 2QV4A 4Z2KA 1GQIA 1E71M 3MV01 1FP8A 1E0XA 3A5VA 2EJ1A 3W24A 3VGGA 3EMZA 2PWHA 2J78A 3RO8A 5BXSA 2YDSA 1JL8A 2PWDA 4AD0A 1ZS2A 3ZSSA 1W1TA 2QPSA 1MVYA 1WZLA 1HJXA 4V28A 4C7GA 4CN6A 1V6UA 3MUAA 4JCMA 2XTKA 2QPUA 4W8LA 4D6FA 1ZBCA 4E8DA 1BG4A 4CD7A 4QFUA 3HMCA 3AIEA 4CD8A 2WHLA 1EQPA 1MQPA 4MB4A 1Q6GA 2TAAA 2CEQA 3BCFA 1CTNA 1B30A 3WBEA 3AZTA 4F66A 4UOQA 1V0LA 2Y2WA 1IV8A 4CGTA 1AQHA 4P7OA 3W4RA 1LL6A 4AYGA 3UR8A 1C8QA 2JE8A 4ATDA 3FHQA 4OOZA 3AS1A 1UA7A 2WNWA 1CYGA 2J7CA 2F7RA 4BQ3A 3W38A 2J62A 3PBGA 3AFBA 4TOQA 3T0AA 3OBAA 4TXEA 3K8MA 2DIEA 1WB0A 3RM8A 5CPTA 3O2LA 3CTTA 3GH4A 4HPGA 3OLIA 4DWSC 1O7AA 3VD3A 3WMCA 3IGUA 4GKLA 1CLVA 1IT0A 1FOBA 1GJUA 1MW3A 3KL5A 2XN0A 2W67A 1HP5A 1UWSA 2F8QA 3ZJ8A 4DO4A 3K8LA 5A94A 3AS2A 2J79A 2W4XA 4LXFA 1ISVA 2Z1KA 2WVUA 1GZJA 3OIHA 4HZ6A 1UR1A 2O9RA 2PB1A 3WQ8A 4PMNA 1KWKA 3ZIZA 2VX6A 3VIPA 3N18A 4CVUA 4ZEPA 5EMYA 1G5AA 2Y5EA 3EJTA 1E72M 1YQ2A 1KBBA 4P7NA 4KGLA 3W28A 3SCWA 4UQEA 2VR4A 1EDTA 3L4XA 3B9EA 2EPKX 1ECEA 3MUIA 4MNLA 1KXTA 3PZTA 2X09A 5D8WA 3L4ZA 1MYRA 4DUXA 2D1ZA 3QOMA 4CUCA 4PTXA 1NP0A 1JNDA 5IHSA 1KCKA 3VGBA 1DHKA 3IANA 4NI3A 3WF4A 4FLQA 3WIJA 4D72A 2DSUA 4CU7A 1OIFA 1CDGA 1C7TA 5CSUA 1R86A 2ZUUA 1TG7A 5HPCA 4AZGA 3AS0A 2CNCA 2DSWA 4WLCA 2BVYA 4D6CA 4EANA 2PWEA 1D2KA 1O7DC 1QW8A 3EJPA 3WL0A 1TQVA 3DX0A 1PZ2A 1US2A 5A6JA 4U33A 3IAPA 3IJ9A 1NWTA 3CZSA 1UR2A 1RPKA 1LF1A 2CBJA 1QVBA 3POHA 2E40A 3DHUA 1ESWA 5GPRA 3BLBA 1J0ZA 3TTYA 1TFVA 1V3JA 1E5NA 2J74A 5A8OA 3N11A 1G9HA 5C71A 3KLKA 1TQTA 2C0HA 1E6PA 3U7BA 1VRXA 1WZAA 2FH8A 3EYPA 3PZIA 2MANA 1UH2A 1J11A 3WBAA 3UESA 1VJSA 2YBTA 4M29A 1QNSA 1GCYA 3BSGA 4PSRA 4AXNA 1CIUA 4CU6A 2J75A 2YOCA 1UHVA 2WCSA 3VMNA 2G3IA 2BHUA 4WIWA 5HPOA 2WCAA 1AVAA 1DP0A 4ZE5A 2GVYA 1EQCA 3VGEA 1QW9A 4U2ZA 1R34A 1JNEA 1SMAA 3MS8A 3OLGA 1UYQA 1WDQA 4X0NA 4M1RA 3RILA 2GK1A 2CBUA 2F1AA 1VAHA 2D3NA 2ZUNA 1IZKA 4XV0A 2VCCA 4ZXLA 1UD8A 2G3JA 3GXTA 2CESA 3AIQA 2CHNA 3BCDA 3W25A 2W61A 1CGWA 1TVNA 2PWGA 3L4TA 1ZBWA 4PRWA 3BAWA 1E15A 3D4ZA 2XG9A 1JAKA 3QHNA 1VBRA 1JF6A 2YL5A 3N9KA 3DX3A 2PBOA 1K9DA 1I1XA 2CKSA 1E70M 5BXRA 2PC8A 1ITXA 1E56A 2JF6A 4HZ7A 4UQCA 3A47A 2YLAA 3QR3A 2D0FA 1GQLA 4PCTA 4NZFA 4IUGA 2A3EA 3I3BA 1PAMA 2Y8KA 4HOWA 1KXQA 3WY2A 4DO5A 4U5IA 4IISA 4HMDA 4J3WA 4UCFA 1CECA 4UFLA 5BXTA 1B3WA 1F4AA 1RH9A 4AC1X 2VT0A 3QGVA 3FNDA 1XH0A 3UG3A 2IXUA 1LG2A 1E1EA 5HNNA 2EQDA 4KWUA 4DUWA 6CGTA 5JBFA 1H5VA 2IUZA 2NW0A 2YA0A 2FGZA 1WAWA 3RIKA 4YHEA 4HP5A 2WVVB 2CXGA 3AOFA 2WHKA 4MNMA 3OG2A 4AEFA 3MSGA 3EDKA 1SZNA 3VNYA 3QOKA 4D6IA 5GQBA 5A6SA 1WO2A 1LLOA 3F5LA 4UQDA 1V08A 3HZ3A 3WY4A 4UFMA 3A4WA 4AZHA 4B3KA 3WQ5A 2W66A 3WQ4A 4FNPA 2XVKA 2XN2A 1XYZA 1UD2A 4B9ZA 3GXFA 3VKKA 3WD4A 4JHOA 3ZR5A 3CLWA 1XD0A 3U7VA 2EPMX 4QAWA 3FAXA 1HNYA 1R46A 2C8NA 1N82A 2C7FA 3GDBA 2AMGA 1JXKA 3W37A 3VIOA 1ZL1A 3F5KA 3EDJA 2J7FA 1MW0A 3IK2A 1BLIA 2Y8VA 4NRSA 5BROA 5I78A 4W88A 2XVLA 3RPMA 3VIIA 2OSYA 3BVTA 2F7OA 3LXCA 3WQWA 4D6EA 1E6XM 3BH4A 4YPJA 1B0IA 2A3HA 1DWFM 4BF7A 4D6JA 1NARA 4MNJA 2FGLA 3L4UA 2WZIA 1KWGA 4MADA 3VGHA 3ZT6A 3B8SA 3ZSTA 5DMYA 3MMUA 3VUPA 3VIFA 1GOQA 2RGLA 3SIMA 3TTSA 1DWGM 4PTVA 3WDQA 2ESCA 3VIMA 2ZUMA 3WNMA 1G94A 2DIJA 1WZKA 2OW7A 4TX8A 1W3HA 1VFOA 2NT1A 2VZVA 3PZMA 3VSVA 2WBGA 2X05A 1OT2A 3VU2A 1PEZA 2GDVA 4M80A 1EHAA 3BAIA 1M04A 3OA5A 5BXPA 2EO7A 3VVGA 1QI3A 5TD4A 3T2QA 3VSUA 3DX2A 5LYRA 1BVZA 3WUEA 1B3ZA 3SEPA 2VX4A 3RMEA 4WJXA 3TTOA 2XGBA 5CPSA 2YA2A 1TZ7A 1GORA 1J9YA 4IPNB 1HTYA 4WSJA 4CD4A 4MAVA 3VX0A 4PYSA 5CSYA 3POCA 1QHZA 4AZ6A 3GZAA 1CLXA 5LA1A 1UASA 1XYFA 4JFUA 1JDDA 3WKZA 5FIPA 4HTYA 4WKAA 4HA3A 2QHAA 5LA2A 4DUVA 3WH6A 1HJVA 3CZ8A 1UR9A 4H2CA 4ACZA 3AI0A 4AD4A 1CXFA 3HN3A 1E6NA 3WH9A 4NZCA 2Z1SA 1UR0A 1TMQA 1C3FA 3ARXA 5BYWA 1TQUA 1Q6EA 3KLLA 4AZBA 4KRTA 3KEHA 3K46A 3AIWA 4JL2A 3WNLA 4M82A 3WMSA 1ZBVA 1BHGA 1WDSA 3BMVA 4AIUA 1GHRA 4AMCA 4IPLA 3WNPA 4FF5A 3SCTA 4BQ4A 1R33A 1J18A 2J47A 1A47A 5E6ZA 4H8VA 1W3JA 4EKJA 3D5HA 1UA3A 1TVPA 2WMIA 3WEZA 2E3ZA 3CH9A 2EBNA 3L4VA 5FOOA 3BLKA 7A3HA 4GI8A 1NQ6A 3QHOA 3WQVA 4QCFA 4HPHA 3APGA 3AZRA 3CBWA 2JIWA 2PI6A 4MB5A 3SCSA 2HISA 3WL1A 1ISWA 1CGUA 1R87A 2CERA 2VVSA 3WH8A 1CZ1A 2ZX9A 3PTQA 4RE4A 1SR0A 4GPNA 3S2CA 2VTFA 2DT2A 2DSVA 3HG2A 4GI9A 2OSXA 1OWQA 1WE5A 4F8XA 1PX4A 3A6OA 2D22A 3BUIA 6A3HA 1OSEA 1SFSA 4NRRA 1EIBA 5AYIA 1CGYA 3IJ8A 2XM2A 3WNKA 2WKGA 5BCAA 3CHEA 5DFAA 2WANA 3TTQA 4CKQA 2WXDM 3OGVA 4B9YA 2WVSA 3NSNA 3ARRA 3VTRA 1W32A 3OB8A 4GO9A 5E9AA 1QI2A 4CN1A 1GQJA 1VEOA 2OYKA 1QPKA 4FNRA 3L4WA 1E6QM 4TTUA 2X0HA 3LMYA 4UZSA 2OW6A 2FHCA 4P7QA 3LRLA 2CKRA 2AAAA 1QBBA 4AWEA 2VO5A 1JZ5A 1V02A 1I75A 3KE0A 3W0KA 2CITA 4AD3A 2YIHA 4W85A 1E4LA 1K9TA 2VCBA 4UFIA 1TR1A 5D8ZA 1ODZA 1TCMA 3N04A 2WWCA 1GVYA 1UWRA 3FY1A 3EDDA 3SUVA 3LPPA 1GOWA 1HF6A 1JIBA 1XD1A 4P8XA 3BSHA 5GNYA 4TVDA 3SCVA 3GTNA 3N12A 4N0RA 1XRVA 4W5ZA 1Q6FA 3PTMA 5I2UA 4W7WA 5GNXA 3VMPA 2DPEA 3BAKA 5I0DA 3NIYA 1QWNA 1H49A 3RM9A 4UFJA 4Z2HA 2E8YA 2WC3A 3ALFA 4E2OA 3AMGA 4AW7A 3DX1A 4UFHA 1JDCA 3UG5A 3WF3A 1C90A 3LRMA 3U5UA 2W63A 1V3IA 4MPKA 1UH4A 2HVMA 3KL3A 1HWWA 2IGTA 5A2CA 4R27A 1EXPA 1TQSA 4YN5A 4XUYA 2WW5A 1OB0A 1R75A 3MUZ1 1VIWA 2D23A 2XSBA 3B9DA 2OYLA 4OJYA 1UG6A 4HA4A 2UY3A 4ZE4A 3MMDA 4M24A 1W3LA 2YBUA 1DWAM 3GH5A 1CGXA 2OWXA 4MDPA 3VD4A 3VM7A 4FK9A 5AC4A 6TAAA 1K9FA 5CQ1A 2WMFA 1GOKA 1VFMA 1EOKA 4H04A 2JEQA 2E9LA 4MDOA 2O92A 1E40A 2W91A 2Y24A 4CCDA 3WDIA 3AJ7A 1OINA 2ZXDA 1UUQA 2GSJA 2J77A 2DSKA 3THCA 2ZXAA 2V5CA 2VRJA 1WKYA 5JBEA 4P7LA 5E1QA 2BFGA 2F1BA 3WY1A 3AS3A 2WBKA 5ABGA 3T2OA 1KBKA 1EDGA 3AZSA 4F9JA 5DT5A 2Q8XA 1V03A 2XJ7A 1H4PA 1GUVA 1FFRA 3HG3A 4W86A 1V0KA 4M8UA 3VIGA 1RD6A 1W9UA 1W2VA 2GDUA 1KGUA 3VIKA 1B3YA 1KR0A 1WDRA 1JXJA 3T0DA 4TTGA 4B3LA 1PS3A 1HKJA 4XX6A 1CWYA 3GXDA 4PMZA 3A23A 2V5DA 2ZICA 2WSKA 5FKYA 3N15A 4AMWA 4LYQA 3NCOA 4JAWA 1XHGA 1UR8A 1V3HA 4K68A 1MW1A 1H3GA 3VD9A 3VOCA 1QI4A 5D9NA 1OGBA 3WD2A 2CHOA 3AROA 4JZ5A 1BYBA 1U30A 4AZ7A 3G6LA 1JZ6A 3SUUA 1KR1A 3OLEA 3MSDA 1QNOA 1OGGA 5E0CA 3AYSA 2VMFA 2WPGA 1UQZA 4JHZA 5A6KA 3S5ZA 3NDYA 1O6IA 3NJ3A 1JZ7A 1W91A 3AICA 2J7EA 3AIBA 3O6AA 2G41A 3VGFA 2CBIA 2JIEA 1XH2A 3VDAA 2VUYA 4OOUA 2X2HA 3BVXA 4PN2A 1XSIA 1GNXA 3ZJ7A 1MQRA 2WB5A 1HKIA 4MAZA 3GNPA 4AYSA 1PZ3A 5A6BD 3VNZA 4HU8A 5I79A 3IJ7A 1W9XA 2VX7A 4JKMA 1FA2A 4OGZA 1BTCA 1UR4A 4W7UA 3K4DA 1S46A 1V0NA 1W9VA 1XSKA 2XIBA 1KFWA 3MANA 3MUY1 4DWSB 2WC4A 3ALGA 4DM2A 3CGTA 4FLRA 4Z2LA 2WHMA 3DYMA 3CHCA 1J0KA 1NM9A 2CBVA 2J8FA 3AIVA 1QHPA 4ZENA 4ZFMA 3SUSA 2YDQA 4ZXOA 3HG4A 5FCZA 5LA0A 5A8MA 3K4AA 3WEOA 4EAMA 3BVVA 4XB3A 1BGAA 2VR5A 3VINA 3TP4A 3A4XA 7CGTA 2B31A 4DM1A 5CGTA 2A3BA 2ZWYA 3GM8A 4HMCA 1JG9A 1RP8A 1OD0A 4B16A 1WNOA 1JAEA 4ATLA 1RP9A 4X9YA 3L2MA 1KTBA 5A6MA 1UZ4A 2XIIA 4E4PA 2BY2A 4NXKA 3CC1A 4GINA 3CMJA 1OGSA 1SMDA 4J3VA 1X1NA 4RL3A 4JFSA 1HKKA 2ZWZA 5DF0A 3BVUA 1PX3A 5DO8A 5EFDA 4FLSA 2V3FA 3W81A 1KB3A 1TUXA 1UD4A 1L8NA 4Z2IA 2QF8A 3D3AA 5AYBA 1PBGA 1D3CA 2WVVA 4PMXA 3CZNA 4CD5A 3CHDA 1EHNA 1GONA 1AQ0A 5E09A 3VSTA 1GOMA 1UWTA 4IM4A 1U2YA 4GZJA 3KL0A 1V3LA 3EJRA 2WMHA 4JFTA 1UWQA 1EOMA 2XFFA 2V38A 3S6TA 3WY3A 1R85A 4DO6A 1QHOA 3F4VA 2X2IA 2Y4SA 2W62A 5IHRA 2D20A 1ISZA 4Q7NA 3BC9A 1HL8A 3WSUA 5D4YA 3I3DA 1NWRA 3AMLA 3RJXA 4HA1A 4D1IA 1EO5A 1CXKA 1M53A 3ARWA 1CENA 1B90A 1DTUA 4FNSA 3VDHA 1H0GA 5C8BB 2E0PA 1DWHM 4TVUA 4S3JA 1Q6CA 3EMCA 4W8AA 1R47A 3WD1A 1UKOA 2A3CA 2VQUA 5CXPA 1UWIA 1VEMA 3MV11 4OBSA 1OT1A 3D51A 4H8HA 1KGXA 1XV8A 3WNOA 1OIMA 2JF7A 4GQRA 3BUDA 4GZIA
chains in the Genus database with same CATH superfamily
3H6JA 5E08L 3ZYOA 1BRLA 3JUGA 1W15A 4D6DA 3TV3L 2R24A 3EX2A 1MQ8A 2WKOA 4H9VA 2EDWA 1RK5A 3BX7C 3C09C 4JM2A 5ALCL 3G1HA 4C1LA 1AJ2A 5I6NA 3QEQA 4PRAA 1S1RA 3T1FA 2EINB 2I5IA 3NPXA 3UG8A 1NCTA 5AHLA 3UTTA 1E4NA 2VGLM 3ELAT 2KLSA 3RNKB 3LHYA 4PE8A 3KHQA 5K59E 4UDTB 1ZLUK 5IW6A 3QFDA 5D1XC 5EEVA 1ZY9A 1HX0A 4XPAL 5KSAC 3B7TA 3KJ6L 3UVAA 3VXSB 5FYJD 1B5TA 2XXFA 4IIGA 2ZUQB 2IAMD 5IREA 4JIRA 1S7WA 3GG8A 4TLUA 5D03A 3DPDA 3ZE1F 2XZQL 2FO1A 5EU4A 1A4KA 4PP2B 1UT9A 2JVUA 1J1PH 4LOFA 2NUPB 2BPBA 1INEL 4FNLH 5CINL 2PW1A 1QO3A 3VNLA 4GNJA 2UXVA 4D71A 4LL4A 1KYFA 3OWRA 3D46A 3VFVA 5L2KE 1Z7JA 2HT4D 1JTTA 8CGTA 2XPKA 2HVJB 2YQBA 5C9XA 4YYCA 2NY7H 1WG3A 4EIBA 3EJYD 2YDAA 3VRIA 4HUCA 4FZEL 1OHLA 4ODVH 2BGQA 4HJGA 5LBSH 4Q6KA 4LKCB 2HNHA 4LUYA 4ZAKC 3HMWL 2QHRH 4BJLA 1NFAA 4UTAA 2PMZA 3L6FA 3LCLA 4WGVB 3CSYB 3K8KA 5ITFB 4PRIA 4BSJA 1IZJA 1DR9A 2YPLA 1BM3L 2JKPA 2BSCA 4RESB 1VR6A 3LCIA 5JHDD 3HO8A 5IB1A 1KBPA 5EKYA 3T0ED 5D1XE 1XR9B 1E9LA 3SJNA 2X1PA 3T2PA 5F93C 3JTSA 1UVQA 4U1JA 4BBWA 1O5DT 4U3SB 1X6UA 2J24A 3WFDH 2F18A 1PY4A 3WE6B 3EKLA 3TO4C 3LPFA 4QRSA 2NUXA 2OJZH 4EPDC 1Q3NA 3HB3C 2DM4A 2B4CL 3X13B 1L3NA 3WDHA 4ZQCA 3IJDA 4RDWA 1AAJA 3BVWA 4DEWA 1W5PA 3AT8A 1W17A 3ETBJ 5I3KA 3HPLB 3TN5A 1RL1A 1F00I 4CU8A 4MA3A 4Z7UF 3DSFH 3WBWA 5CIPB 1PKQE 1VYPX 3QFJA 3GZKA 4QRQB 3SYAA 1EH9A 3ARUA 3SYQA 3VZYA 4DYJA 3G3LA 2ZYFA 5DK0A 3CM4A 3DBXB 5TTRA 5D9MA 2H4EA 1AQMA 1A6VL 3DUGA 3G04B 3BANA 1C7SA 3TUUA 2BSSA 5F0LB 2YAMA 4XAZA 3VACA 3RYSA 4N3UA 1XGEA 4JN1H 4M8RA 5EH1A 4A67A 1BQSA 1TYEB 5CSZB 1XB6A 4F7PB 4ZZKA 4LHQB 2HRLA 1B3XA 2O7SA 3EYUL 2F19H 4G80B 5BRZD 4QRPA 2VR7A 2EE2A 3V0VB 2JCWA 1QOXA 2V2WA 4Y1SA 4PREA 5E51A 2QSQA 5CHNB 3GEWB 2J4GA 1W9DM 2A3LA 1YN7A 5F7YC 4HHHA 1O95A 1C8YA 2GK1B 3WTTA 2BCMA 4ZPTA 2ADJA 5D8JL 3DFYA 5HMDA 4R4FH 1DJXA 2OA9A 4TUOA 3PP3H 3WNNA 2NXZD 3CB3A 2C6QA 2KYIA 5F7LB 2BWGA 1KA9F 2QF7A 3N2BA 4N2FA 4NUJA 5IG7A 1TTRA 1WAEA 1G7HB 3CFNA 5KSBE 1CXEA 5C9JB 2IAMA 2TRSA 5C6TH 4EZJA 4G5ZH 2L7JA 3RI5K 1XLBA 4FA8A 5HHMD 2C9UA 4F8OA 2MRYA 4WNSA 5E5UB 4LEFA 2YAFA 3MBEC 4X5LA 4L1SA 5CBEB 4WTXA 2F9RA 1ITCA 2QGDA 3UXDA 1UFGA 5I6LA 3FUHA 3KZ8A 3TC7A 1LLWA 4X6EB 3PQYA 1KM4A 3QI9D 1FC1A 1QFWH 2BDQA 1QWKA 1JZFA 3VMOA 2IEPA 1QOKA 5EZJB 2PLCA 1LO5A 4J2XA 2ICEB 3J8F7 1Q7ZA 5GGTL 3CMGA 4RDQG 3MODL 1I1WA 4DGYL 5L4MA 1OM9A 3EH4B 2QQKH 3N1MC 2PW2B 2HJKB 4ZFGH 3VIJA 4CQ8A 4KK6C 1IQDA 4DNMA 2D03L 4X9SA 2C4FT 4LCWB 2EUZA 3UPAA 3EOYG 3EWUA 2RDTA 1J0YA 2FCBA 3M7FB 2CUIA 3NYDA 4N1CA 2APFA 1N10A 1IGTA 3IU3B 5DHVH 4ZYKB 4TQIA 5BO1H 4YHGA 1A7OH 3IARA 3PPEA 2BODX 3FVDA 1YEGL 1POKA 3V10A 2DYPD 2W0FB 4P5SA 4OFYA 4Z76A 4M1DH 1EQWA 3TC3A 2VKZG 1TJMA 3JVGC 4Y7EA 1LEKA 1G9ML 2P5EE 2MNWA 1V3MA 3VFTA 4PLKC 2GKIA 4K3JL 2OKOA 4MKTA 3ZQ9A 1PTAA 1CS6A 1ZD6A 2ATMA 1IBGL 1ACCA 4EUPH 2D7PA 4GI4A 2WQAA 3ZKXC 4NYUA 1PQZA 5EMKA 4P23B 4K8RH 4AFYA 3ZHDA 5J6HA 3CMOH 3NA9H 1KM1A 5IKCB 3KBFA 3H3PH 1CFSA 4ACZB 4J35A 3I7SA 2K4WA 1KJ3L 5E8OA 4QNPE 1FZJB 1YPZA 3A3WA 1DQQA 3L5XH 5JIWA 4AYEC 3DX6A 2VXQA 2YFOA 2Y06L 1KJMA 2PA6A 1FNAA 3DIVA 3D25A 2EKGA 4E2DA 2G5BA 4DJFC 1QO5A 3FSWA 1C93A 1WZ1L 4QNWA 2A4EA 4DTGH 1W9PA 4Y9AA 5CBJA 1XSJA 1CEOA 4LBSA 4AVJA 5D7JA 3WMBA 1R5WA 4JJ5A 3I74A 4EX4A 2YUXA 3DMMC 1FL6A 4ZJ9A 3BZ4A 4R9HA 4KRPD 3C12A 2VW7A 2A4AA 1N19A 3AITA 3FAWA 4H01A 1BP3B 4CC1A 2J4WH 3W71A 4FFVD 5C54A 3RTQC 3T6WA 2C3XA 5GNZA 5C9RA 4PV9B 2FH6A 4AI7A 2PTTA 3B9KB 1ZBKA 1KGYE 3CUGA 4GRMA 1WTGT 5K9JL 4Z2GA 3BK0A 3EDEA 1F02I 3NEHA 4Q2ZB 4F2EA 1DFXA 3THMH 4BFJA 4GBDA 4PBGA 1PZCA 5E9XA 4KNUA 1E71M 5JHLL 3TBVB 3ULVF 4MY9A 3MRNB 4G11A 3G22A 3EZ4A 5FAGA 2PWHA 1U3HC 1K2DA 4E9SA 4AD0A 5H4ZA 3MJWA 3GMLA 2YAHA 4JCMA 4OLUL 5I71C 5I1KL 4L3ED 4J3OG 3T6VA 5C0AE 2VDIA 4EOUA 3VXTB 3R25A 4YX2L 5C9WA 4XMKL 2O26U 3VKCA 3ET9F 5B39G 3W4RA 2OP4H 2NXIA 4JTKA 4ZI8A 1MEHA 4ATDA 43CAA 4BFBD 5I2IA 1FVEA 5MI0B 4Y16B 1LP9F 1T5XB 5CPTA 4N90E 4DAGH 3C5ZD 2XX0A 3IGUA 3QI9A 2PXYD 4GG8A 4Z0XA 5HGDB 4BIKA 5K9DA 5D70H 2HXTA 3RVTD 1ZXKA 4KX8A 4YFDB 4PJBA 5GGSB 1S8DB 5JDSA 3LH2H 5KJ4A 4PGLA 3AS2A 3VI3E 2E6JA 2RDWA 4LXFA 4PJAF 5J04A 2H9GA 1UOWA 1J8KA 2O9RA 2IDCA 4M7ZC 3U1PA 1WFOA 2IDFA 3VIPA 3PXLA 3UWVA 2R29H 4ZG1A 3UPRB 5DXXA 3B9EA 2EPKX 1ECEA 3LEPA 3KBWA 2H8XA 3PZTA 2EG8A 4YU1A 4OGYH 3QV8A 1N2RB 1Z9OA 3KLDA 4L4TA 4ODUB 1HK6A 3WIJA 3NOIA 3DOSB 4DVRH 2NR6C 4JM2F 3QHTC 1XF2B 3M1ZA 3S3SA 1R3SA 2PP7A 1RCOB 2I07A 3G6JA 4PV8B 3SY8A 3D0AA 3OAZK 1XQKA 4NC2B 3FB5A 4G8GB 3KTXA 4FTVA 4ZD3L 4YHLH 2AJSH 3BLBA 3RJQB 5HA7A 4HCIA 1E5NA 5BMFL 3TR9A 4OQTL 1NFPA 3SJ3A 1FIGH 4CSZA 3P69A 2BP8A 3LYEA 2O93L 4CU6A 4C1NB 2BB0A 2QIIA 4NILA 1P0NA 1DCLA 2QPDB 4RFNB 2NY6C 3TH2T 1XF5A 3EBGA 2O5ZH 1A3LL 5J9PA 1NVMA 3WFAA 5KANI 1SFTA 2VCCA 2EECA 2P80A 3ZIMA 2EEFA 3TVAA 3BCDA 2Q8LA 2PWGA 4K3EH 1JF1B 1E15A 1P7QA 1N5AB 2VERA 5D1XD 1IJ9A 2EXYD 1SYVA 4UQCA 1YYAA 3A47A 4Q74A 5D2LA 1EP2A 3K13A 2OFJA 4HOWA 4DKDC 2RCSL 1A7BA 4QRTB 1T6MA 3T44A 3A64A 2XG4B 5HNNA 3MV8B 2YN3A 2J1XA 2YA0A 2WZMA 5I3IA 3ZRSA 3ATAA 2WHKA 2DLFH 4GXFA 4MNHA 3NPZB 5A6SA 1J9SA 3Q9QA 3MY9A 4KCVA 4PRPA 2XN2A 3QPQD 1T5KA 4EUPB 3TH4T 1R2SA 4IS6B 3UJTL 3W37A 2AABH 5DJCB 3K71A 2HZGA 3GSMA 5FEXA 4N2IA 1S78D 1F3JB 3MMEA 2B3RA 1MW0A 2X7VA 3P7YA 2MOVA 1X9UA 1E5CA 1RY8A 4NEHB 4PWJA 2IWFA 1NARA 3V3WA 4TUUA 3RVWC 2BNUA 4AVHA 1UWFA 4GJIA 5I1AA 3QJTB 3WDQA 2HRHA 1IC7H 3ZU8A 3PWPE 3LEVH 2DS4A 4XB7A 4OQTA 2VZVA 2WBGA 3VQ2C 4B91A 1M68A 4HU2A 3KS0H 1BQLH 1U5VA 3VOHA 4GW1B 3EJJX 1QP1A 4FQXC 3GX9A 2AJVH 4OVXA 4IGBB 3V6OC 4ZX3A 1LK2A 4HPOH 2INZA 3RR1A 4YO0B 1AGCA 3MJ9A 4ZUVA 3NACL 3QCVL 4HZ1A 5HGHB 4Q8VA 4LY4A 3FCBA 3FCTB 2GOKA 1Z5HA 4GKNA 4B5WA 1HZLA 1XYFA 6FABH 1YQVH 3DHDA 1SXCA 3C5ZA 3PIQB 5LA2A 3N29A 1UWYA 3LLDA 5M94B 1U5JA 2AQTA 4IBTA 1DQDL 5FYJU 4NZCA 4P3DB 3LHAA 3L9RA 4KRMB 3WAJA 3MHUA 3K72A 4QR6A 3WNLA 4IFKB 3B5GA 2X7WA 2DMBA 1MEIA 3WMSA 3HVNA 3CPGA 1GYCA 3JWOC 1U2CA 2DVUA 4WK2B 5SV3A 4WO4C 3EYOA 1TVPA 2NX3A 4LVNB 3EXJA 4OFKA 4GI8A 1V5XA 3GMQB 5I30H 3BJFA 3R11A 2PI6A 1KOAA 4MVBD 1OC6A 1X38A 4G6AD 4NT0A 2UZIH 2R1MA 1B54A 5BV7C 3H2MA 1SOSA 3IXAA 4YXKL 1IWAA 2FYMA 1G7PA 5L2KA 3WNKA 5KSWA 4Y5YC 3ITXA 3TTQA 1XIBA 2F54E 3BH9A 4FG4A 1NEUA 1REQA 4CN1A 5BZDB 1VYRA 3Q8BA 1QPKA 2OFQA 4TTUA 3S4SA 1LLZA 2V7HB 4AQAB 1ZDSA 4FXSA 2ZKMX 4HQQL 1J8HD 1SW0A 1TR1A 1GR7A 2P76A 1JIBA 2QQNL 4P57B 4M7JH 4X2UA 1O7VA 1VCVA 4URTB 5LCVL 3C2AH 1G6RL 4RIRB 1RQEA 4YL2A 5D1XA 1RJZB 4NN5B 2K70A 3AMGA 5KSAA 2P5ED 5D7LE 1Y5WA 2MKLC 1ITUA 1BMWA 1WBJA 2IGTA 5LJYH 2CR3A 5AVQB 5E4EB 2AGTA 4HNCA 3HOJA 3ULVC 4G8TA 1NTHA 1QNZH 2W1NA 1K9FA 4AT6B 4AF0A 1ZSHA 4LF3B 1WITA 3CHSA 4PJ6A 2XLLA 4BH8B 2W27A 3MYJA 5KBLA 5LVEA 3M0YA 5CMAB 5B8CC 4M93B 1N6QH 5JQIB 5IMLB 2DUZA 2V2CA 1XRFA 3WY1A 1IBYA 5ESVA 3SGDI 3AZSA 3GFYA 3QZLA 1TPC1 4M8UA 3GHRA 1N8ZB 1TJ0A 1PKQA 3IN0A 2ADFH 4RMTA 4B3LA 3TSMA 1NMCC 3ULAB 2MHAA 4ZMTA 4K1WA 2A73A 4NNPH 1XHGA 1UR8A 3U0PA 3VYLA 3AWGA 2XY1A 1OGBA 3IETA 2AEQL 3UJEA 3MUGB 1RUML 3OD3A 2BC4A 5CILH 1YPZF 3BN9C 5F2GA 5HGBA 4NQVA 3ECVA 2PCFA 3V5DB 4JJOA 5DHDA 1PY0A 1S9VA 5LNVA 3IJ6A 2F15A 3H2QA 4TV3A 1UGNA 3WEBA 2VX7A 4R7DA 1F8TL 2IKJA 4NASA 4Z0SA 1RXLA 4JM2C 3BWZA 5BZAA 4C57C 3TO4A 1XSKA 3WXWL 1KFWA 2C7UB 2PLTA 4KPHH 3EYQD 2Y1YA 5KVEE 3LDBC 3C52A 4XTDA 1NIBA 3SUSA 2YDQA 1LEIA 3S42A 3ZO0A 1IEHA 1D5BA 2QUVA 1JG9A 1OD0A 5AHNA 2Q01A 4ATLA 5LWYL 1RP9A 3E49A 2LFGA 4U6TA 3MRQB 3TT1H 5A6MA 5C0AD 1SZEA 4NXKA 2FBOJ 3I6RA 2QQQA 1P6FA 1OWRM 3FF7A 5KSBA 1HKKA 1WD8A 1KCZA 4AYID 3QG6B 4GX9A 4AMKL 3FU7A 3NA8A 4OF3A 3CT2A 5C97A 1KFAL 3QQ9C 3VA8A 4AYDC 3DJZA 4JG0L 5KN5B 4FCHA 4N90D 4G7YH 3VSTA 3LKPB 4DEPB 4PJ5E 1MDLA 5CSBA 2GSGB 2GFBA 3HFTA 4GAFB 5E4IA 3HZKB 4X8XA 4IHOB 2VWEC 4ICXA 1CXKA 1GG1A 1FO0L 4O53A 1KB9K 3DDMA 4HGWA 5IJBC 4ZMQA 2RR3A 1PD0A 1ZTXH 3WD1A 3MO1B 5AVYB 1GJPA 4Z8FH 1NGPH 5CN2A 1R3HB 3BUDA 4Y19D 1YEEL 4AG4H 4CSSA 2OWCA 2OVLA 4UB0L 5DFWH 1ZEAL 3RVUD 2D24A 3H21A 1CBVL 3VI2A 3N1QC 4LAZA 5AENA 4LLDA 2BNRD 3P5ZA 5CLTA 5D1ZC 4PJBF 3BEVA 2RDXA 5EZIL 1GC1L 1M7XA 3GHTA 4UTWA 5HY9A 5FL0A 4KMLB 3TFCA 4JN2B 1MHPH 1EHLH 2P5EA 4IIQB 2YBGA 3VE7A 1BCIA 4X7SH 2N0MA 2OXGB 2JJSC 2G2PA 2YAEA 2CCWA 4JFQA 4YOKA 1FH8A 5JR1H 3MBEA 1MHCB 2P8PB 1WQ5A 3TL5A 3FOLB 3LKSB 5CN1A 5D1QC 1VFAA 3R12A 3QQWA 2GLKA 4TSCH 2VM9A 4NP4L 5HJYA 4Z77B 3G6JF 3NL2A 1MRDL 3D48R 2JNZA 1KV5A 2BXZA 2VWEE 2GGEA 4PMDA 1YG9A 3BKJL 3QHMA 1S5IH 3VYPA 3WLBB 4YDZA 2Y7OA 2DQJH 1OC7A 4MUZA 2C19A 3VOIA 4I5BA 2J7HA 2HPOA 4H88H 1HSAB 5FESA 3NEOA 3ORJA 3PZ9A 5DR5H 1MXDA 3VDBA 2KUTA 1KELH 3ENLA 3DERA 3G5WA 4RX4A 4NC0B 1V6WA 5EO9B 4AD2A 4LNVA 4PPTA 2OK0L 4FQ2L 3CBRA 3PTKA 1OAKL 3KBEA 1KULA 1DEEA 1FCCA 1L0YA 5IQLA 3AISA 3R8QA 4JO3L 3JVGA 3V4PL 4F8PA 1J5SA 4WF7A 2QKIC 2WNKA 4RXGA 3TEXA 3WO3B 3VCRA 4JPVH 1PXGA 2YQ3A 1R3VA 4FXFA 2PZNA 1TB3A 4H5SB 1PL3A 1HN1A 3AMDA 2ZD0A 4DP4X 5D2LF 1YNTB 1ED3B 3B8YA 3LKOA 3ZE0B 3PWLB 1PO9A 3L5IA 3H55A 4AE1A 1CDYA 5D1QE 3UBXG 4XX5A 3TBSB 4PB3A 1HESA 3QG7H 1PCSA 2UWFA 2YCJA 1CG9B 2VLLB 1E3XA 4XMLH 1RY7B 5C2XA 1GGIH 4L9ZA 4JIPA 4H8WH 4EKXA 5EBLA 4IG2B 3GWQA 4BUGA 2DQTH 1GY2A 3PWPD 2Y69B 4GCXA 2DVTA 4AGLA 4DJFA 3B9OA 3K2KA 2IAMC 1KEGH 4XP9L 5C9KA 2J7LA 5C0AA 4POYA 4JRFA 5I73C 4LX4A 4OKDA 1D7FA 4P5TD 5GGRA 4QPEA 3GDMA 1R7AA 1FE8L 2GTWB 2W60B 1YC8A 2XWEA 3H0TB 2EYTB 1NAMB 3VQ1C 2Y88A 2HT4C 4N42A 5K93A 2RGSA 3GMOA 5TH2A 3M46A 4IMLA 3FUKA 3OC8A 4LH8A 4AWUA 3EJYC 1KCLA 1CXHA 1O9VA 1N8FA 4QXTB 4N9GB 4TSAL 3VI3A 5CD3A 3L4YA 3RTQA 1DVJA 2XQYK 3BGFC 5A6LA 3KM8A 1VCGA 1W1A1 5IBTL 1MQKL 3I6KA 3MZGB 1T0NA 2RJMA 4F0SA 4FEZA 4ISVA 3PS6A 4LSTL 4C5YA 1FVCB 4Y19A 3F05A 4PEEA 3RIAF 4QROA 4R0LB 3TIDB 3WENA 4XCYB 3T0EC 5J8LA 2ZP9A 1A5FH 5F7DB 4J6RH 1WKFA 3D18A 3NIDB 4XXDB 4K39A 4DAIA 2P5WB 4U6HB 2YCEA 1T1ZA 1P1XA 15C8H 3AIRA 1J0HA 5CM1A 1TVHA 3GZOA 5K59F 2NVCA 5FEZA 3DX8B 3U0TA 4XGZA 2CCRA 5AG9A 1QG3A 4DKEL 4OCWL 1NH6A 4ZO8A 3WMLA 2AMUA 3O9WB 2CLRA 1WGOA 4WW1A 3CH1B 3QJUB 1EGVA 4HAKA 2VFFA 3BFQG 3HR5A 4YWIA 5KYXB 3WJLC 2QCCA 2O9PA 2VLKB 1TQXA 2UZYB 2X9YA 2XXMB 3AW5A 4FOUA 1QUNB 2BVOA 4ONGL 1AS8A 1E5YA 2AXGA 2AI0H 2EXTA 2HE5A 4WK9A 1BQHB 3T4YA 1BZ8A 1NCNA 5B3NA 4GKOA 5JHDE 1TV5A 1JGDA 3T0EE 4DZ8B 1TJPA 4PRNB 2AEIT 1BPLB 5CAHA 2Q87A 4XAWL 2NR6A 3UYPA 4HU3A 3EX1A 3NQEA 3BGGA 1SN5A 4RWHA 2BVTA 4JNYA 1M4KA 3NH7H 4X2RA 3VXRB 4XNXL 1E43A 4RNIA 2NW2A 2R69A 4PB9H 1MH5A 4N2EA 1GZPA 1RUKL 4J3UA 1ZA6B 1EVUA 4XVTL 1RFDH 2CM5A 5C0IB 4UNUA 4IJBA 1MF2L 2YZ1A 3EFFB 3LKQB 2AJXH 3MWAA 5HYQA 1JFHA 5I03A 3NCJH 3EGXB 3ZKMD 1QBMH 3QNYA 3A13A 2A1WL 2XGIA 1NF7A 2V2DA 2DQWA 3W82A 1MNUH 3ZM8A 2DLEA 1G9MC 2H7WA 3H9SB 3ISYA 4UAHA 4BCZA 1AR1D 4GXVL 2NXZC 4U1IB 2DEWX 4YHYC 3HVDA 5FW7A 3VGAC 1EANA 2R56L 5KVFH 1W2PA 3V55A 2Z7YA 3PWPA 3DDGA 2QTEA 2HTMA 4GOSA 2VW6A 4OF8A 4MX7A 1JD9A 4X5WA 4C6LA 2DKMA 3WUZA 1ZHKB 3V0IA 3AXIA 3Q6GL 4FFYA 3DHFA 4DWSD 3ZBMA 2Z00A 4GRWH 2VOTA 3KPMB 1M7JA 5J89A 2WZPD 5EU9A 3DXAD 1NELA 4RNRB 1UW9A 1R3IH 2TRHA 1X8FA 4QLLA 5F2IA 1QPQA 4CVWA 1WA2X 3QA3A 3VNDA 1B2WH 5KBNC 2JV6A 5AW5B 2XOTA 1GOIA 1NAKH 3WKMH 3II2A 5BRZE 4H19A 4MJHA 4GVIA 2JKIS 4N86A 3N4EA 5EIIB 1IGYB 7PTDA 4FJYA 1TX2A 5DUML 3WJSA 1OHZA 4M1GL 1R2TA 4NKMB 4H4NA 3O8AA 3FYYA 1DQXA 1UPPA 3P9LA 1N7MH 4H6QA 3O6YX 1WEJH 4W9DC 1Q4NX 3O9NA 4ZBJA 5C2UB 1PZ5A 1ZJIA 1FHLA 3QRLA 3Q4DA 1WRFA 4OD2B 4RGNC 3BUVA 3CWGA 1SDAB 5I6XC 1E6JL 3JR2A 1MFMA 3H9HB 4ODTL 4OI7A 3V5KA 2DY3A 3GXMA 5HGAB 1EHKB 1IB5A 1I2PA 4LCRA 2VR8A 1T22A 5E00B 4F8TA 4PJ5D 5PTDA 3E3QC 4YEFA 1CFNA 1D6EB 1M6OB 4JMXA 1ZS2A 2ZPKH 3GG1A 1HJXA 2V5TA 2NVDA 4MYPA 4D6FA 2F54A 3GDKA 3VFOA 1A6ZA 1FWHC 2VCOA 5KSBF 2IPTL 5L0QC 5H2BA 3S6OA 3O2VL 2QCFA 4HLEA 1EL3A 2Y2WA 1IV8A 1ELSA 1H7WA 1OOAA 2DLHA 4IJTA 1JPSL 4OF7A 4APXB 3QQDB 2VM3A 4YHOL 4MDRA 3BE1H 2NCMA 3AWEA 4BQ3A 2W38A 1NCWL 5T33L 3PG8A 3GH4A 3QZWA 4S1SH 3WFBH 3IJLA 1JV2B 3L0GA 3P8JA 4AX7A 1IT0A 2HG5B 1XGQB 2W67A 4JFPA 4W9KC 1OP5H 4P9ML 2BBFA 5DEFB 2W4XA 3W23A 1YDOA 5D7LA 1HILB 3W9EA 4NUGL 4RGNE 4M6AA 4JDVA 1G5AA 1EDTA 2VE6B 4A6YH 4KRPC 5D8WA 3Q67A 1MYRA 4U1SA 3FJTA 5TAOA 1JNDA 3NPVA 3SE6A 1LEGB 3E3QE 2Z92A 3OJ2C 1F1AA 2LU7A 1CDGA 3MC0A 2VM8A 1U1JA 2DSWA 2BVYA 1R19A 4RDBA 1K7EA 4Y5YA 4N2GA 1FWJC 3S2NA 2CKBH 3CXOA 4JRLA 4ZTPL 1N70A 4XVJL 1OAZL 1PGRB 2HVNA 3U0WH 3TTYA 4KJQD 2CIIB 1TQTA 2C0HA 3MCG1 1WZAA 2OULB 3V52H 5HMFA 1DXEA 3ERPA 3BDKA 2MANA 5INCB 4Z3IA 2WZ5A 1NCAH 3GC3A 3S6CA 1O5QA 3CYVA 1ZLVK 1A6AB 2J75A 3HNTL 4HS8H 3IGLA 3VMNA 4L5FE 3JBG7 4UT9L 4Z7OB 1QYGL 1HKWA 4HCRH 3MS8A 1XGPB 3GM0A 1I2NA 4JDBA 3FO1B 4TOYL 1CDBA 4X80H 3B0XA 1MLCB 4NNYB 3OHXB 3W0WB 1ZGDA 1X4ZA 4QNPF 2GT9A 2QHLA 5DRNA 2FTYA 5JLZA 3BEWA 3GBMH 2BJML 1EXUA 3U9PL 3VJ6B 2PC8A 4M62H 3PHOA 3ZKSD 4Y5VB 3BLIA 3KPPB 2NUWA 2WZPA 5F7FA 4IUGA 4Y88A 4MWAB 4YGAB 4I87A 2PXYC 1U0QA 4Z7NB 1ACXA 2Q09A 4FSAA 3H4FA 1BD2B 3KW7A 1XR2A 1MVUA 4S3FA 1IIHA 1MCOH 4HKZB 5B8CA 4AQLA 2L8AA 1NKOA 1SZNA 4BK4A 5HYJB 5IMOB 5LN4A 2ZCKH 1XDTT 1EPFA 4JB9L 5K39B 3MRJB 2X4UA 2Z0IA 2XVKA 3V4UL 3L3IB 4JVPA 3L95B 4JHOA 2H41A 5T5NG 2VJ8A 2IBBA 4YDVB 4FFWC 1R46A 3A67H 3GDBA 1M42A 1LMKA 4OCSH 1FRGH 1SM9A 3FKRA 1LWRA 3QRFM 4IKLA 2LU3A 1CDJA 2AK1H 4ONFL 5BROA 3TEZA 2ZRYA 1OCJA 4L3EE 4BDVB 1R0AL 1T7WA 4GVFA 4D6EA 1E6XM 4BF7A 4D6JA 4RMBA 1DJSA 3P4MB 1W6TA 3EX4A 3TEUA 4PJ5A 4ABVA 2QPEB 2WW8A 5JH1A 4GRWB 1DQJA 1G94A 2DIJA 4N9CA 2IMMA 1RJCA 1H3WM 4O00A 3B0YA 3BZ5A 1NCUA 4X6FA 3OAYH 4HALA 3JTTB 4U1LA 5BXPA 1TEGA 3OKNA 1QI3A 3F84A 4HX1A 4KEZA 2DTMH 5LYRA 1XM3A 2O5YL 3KM2A 3JWNG 1A9EA 3USZA 3IMSA 5CPSA 2WO2B 2VR3A 4YVNA 4GIRA 3CQ0A 4WSJA 2Z8VC 3SQMA 5LNDA 4MAVA 4HUVB 4AZ6A 1NBVH 2KT6A 4A7UA 1QA9B 4AU0A 3RBGA 2EDNA 4CA4A 2EXYC 3H2NA 1W2KT 4DWDA 4PS8A 3NZHL 1FLRH 5B4MD 1HEZB 1YTKA 3L4CA 3VI3F 4PJFB 5GSVB 1K5WA 4OLZH 4M6MH 4CVXA 3QUXD 1DN0B 1OT4A 3BG5A 4WJG3 1K7FA 1R33A 2XTLA 2J72A 5E6ZA 2DFAA 1ZVSB 3GPEA 4GKZA 1BF8A 2QJJA 5LGXA 4Z0BH 2O6CA 4QCFA 2JXMB 1XWYA 4TLSA 4JUSA 1BJ1J 3HBLA 2ASHA 2MCPH 1DUZA 5LGYA 3DVGB 4G71B 3QPQC 2ADGA 3S2CA 2GIMA 4FS9A 5C0GA 3S2JA 1FCUA 1OLZA 4BZ2L 1TJIH 3QQ0A 2DWEA 1S78C 3GYEA 3G6AA 4PMFA 4LCIH 3MCOA 2WANA 4CKQA 2VDQL 3CX5J 2NX5B 5MEND 1M05A 1K02A 2JKNA 5KAQG 4QD2E 3WEXA 5FKAB 3CSBA 1BGXL 1GQJA 4DP8X 4LAOA 1E6QM 2J20A 5BNKA 2R39A 1F3RB 4KTEH 5JXAH 4W85A 2WY3B 2HVBA 1X5LA 5D1ZA 2CK2A 5EMLA 4G7EA 1P0KA 4PD4K 3CSGA 1MSSA 2C9AA 1Y07A 5HYFA 1TTCA 1F1GA 1XGTA 4QRFA 1H49A 4MCYB 1XGRA 3BYTA 5H37H 3SPHA 2JJSA 5FUOL 1SY6L 5I1EL 1W8SA 4A6YB 2FBJL 3GAYA 4WUUB 3L67A 3U5UA 1S1PA 1Y18B 5D4IA 1KBJA 4GGBA 1EXPA 3D6NA 1GH7A 5D1QA 3KBPA 1UG6A 1D5RA 3TWCH 2J56A 1OSPH 4R7NA 3W7IA 3BUYA 4NI6A 1CI1A 5I1LB 3GH5A 4JGDA 1VZGA 4XPBH 3M17A 5KS9F 2CKBB 1EAQA 1A7NH 1VFMA 5FYLH 1LNUA 3HE7B 3W7PA 2YK1H 4MDOA 5F7WC 2GQ8A 3ITYA 1EJVC 3DOHA 4DN1A 4NI8A 5I9QC 4YHKH 1KTDA 3FUFA 5K9CA 2POZA 5IFAL 2DOCA 3THCA 4P7LA 5JPNB 3GJFH 5E1QA 4N0UB 3NRQA 3HE6D 2WBKA 4K2UH 1KO0A 1KBKA 4MCNA 1PKMA 4MVBC 5LIXX 4G6AC 3BPCB 3RRXA 1FFNA 1B3YA 1KR0A 1YMHA 2HMCA 4XX6A 3GXDA 3T1GA 1P2CB 5HJ3B 5DD6B 4LYQA 1JRBA 4M6OL 2NUTB 3BH8A 4A66A 5ID0B 1PCXA 4K68A 5FOBB 4GE8A 4CCZA 2QKIA 4OZHE 4XZIA 5GJTL 5E2TL 2PPEA 3OLEA 4KQ4H 4FDWA 4FX8A 3UD6A 4KOCA 1UQZA 4JHZA 2NZ1A 1ZCCA 3L3JB 4I5XA 4XZLX 5FHAL 4GUPA 4PJIB 2RUSA 4MKNA 5CEXA 1ZHNB 2G96A 3WLIA 2GYSA 4OJFL 3PWJB 4HU8A 5IHBA 3BJSA 4HC1L 1H3XA 1W9XA 4JZNB 3K6FA 3OYXA 2WOQA 4ZMZA 3VA2C 3B8DA 4X60A 2Y7SA 2OMXA 1IO4C 3BCJA 3U30C 5F96L 4UTWC 1RHFA 3HAEH 1OM3L 1G9NL 2EC9U 2Y6SD 7PCYA 3K4AA 5AB1A 5F9WB 3WEOA 4HT1L 1OP3K 2MJWA 2GVGA 1KCRL 1O6SA 2HS6A 4DZIA 5AYUH 5EPDA 1KM3A 2CLIA 3D4GA 1S9YB 4X9YA 2QXWA 2H6RA 1I0DA 3KJ4C 3LSOA 1K4DA 3G0XA 1QTYT 1GGBH 1OPGL 3I6EA 1KBIA 1AGEA 4H44C 5DO8A 5EFDA 3L65A 2B5IB 3D0VA 3EB4A 4HPYL 5T1MB 1L8NA 5I15H 2UYLB 3QE5A 2Y62A 5KITA 2FEEI 1CGSH 3UZEC 4KKCD 3TLQA 1RJLB 1LRTA 5E09A 3BV7A 3B3IB 2KC0A 4MYWB 4OR1A 4IYKA 3G2GA 4PB0L 3BE7A 4X4XB 1XGUB 4Y4KC 4IK6A 3D87B 1J8HE 5LO7A 1AKPA 1HL8A 3FTWA 3B2VH 3UAFA 4RGND 3CLFH 1AZNA 5JHDA 3REQA 1DBKH 4RLIA 4MMZB 3T0EA 2J8TA 5CXPA 2H3NB 4BINA 1KGXA 3C8HA 1BZ9B 1ZRQA 3EEZA 12E8H 1BZQK 1JERA 3NFNA 1OFBA 1ZSDA 4WX2A 5DJ0A 4M7KL 3CXDH 2I69A 5JO5A 2FL5B 4JAMB 4X8CA 1PBYA 4L8SB 5ERWA 4M19A 1W54A 4EOWL 4MJIE 1EMTL 3DFTA 2ACSA 3GPSA 2HT2D 4WEVX 1Q9OB 4BQ8A 3AU6A 2ODOA 4L8DA 3F04A 4WTZA 1INQB 8A3HA 1TPXB 4MNQD 3EYQC 3UBPC 1WZMA 3BZFB 3WJLA 1QK2A 3EJUA 3FKUS 1BXCA 4UMBA 1GC1C 2VXSH 1XGZA 1NOWA 1OAUH 5I18H 4QY8A 5ABHA 2VFGA 3VPLA 3QRHA 2D73A 3HG1D 2BGNE 4NZJA 2ALRA 3FU6A 3IXTB 4DY1A 3VGDA 4APQB 4YDJA 1JHLL 3ALWA 1WKEA 1MFAL 2JKTM 5IW1A 1CD8A 3FTXA 1UOZA 4QXUL 5EY5A 2W9DL 1SM3L 3ULUD 1IT7A 4LDEB 5JNYA 3WD5H 2F53D 2Z1XA 3K6OA 5GGTA 5T3ZH 2JKXA 3IJYA 3ZVHB 3GU9A 3QUKA 4FG6D 2H6PA 4Q97A 1L9PA 1L9OA 1JCTA 4IP4A 4JN8A 4OT1H 5EO1A 5BRZA 5M95B 5L9DH 5DTFB 2OOFA 5F4SA 2W65B 5E6ID 5CLWA 2AS5M 2ZXBA 4Y2NA 5BQ7A 1FNLA 4GMSL 1YCSA 2NQ5A 2J6EH 5D2NB 3ARSA 2JMRA 4UOJA 4C58B 4I7UA 4LLAA 2PU0A 3WQ6A 1NCOA 2A6LA 1NSNL 2C9RA 3QSRA 1B1YA 3UXAA 2BSED 3RVUC 1P7TB 4G1EB 3WQFA 1DDHA 3D7PA 3SKJL 4IU3B 3TN6A 4HDIB 3K5XA 3OKKA 4FXKB 1JZDC 2VJ0A 5HPMB 2R59A 3NSDA 1G67A 1J5DA 5A95A 4L5FL 5IFPA 3GJFB 1JCLA 3K0YA 3W7NA 3WLTA 1AG6A 2HFEB 3WTWA 2E27L 4TV5A 4TUKL 3F7YB 1NDMA 1HWGB 1A7QH 5B3SB 4DELA 4HSNA 5AN7A 2JKLA 5B7MA 4KNSA 3ULUL 4HPNA 1KC5L 3AZUA 1OQOA 4NDMB 2P5NA 1WWCA 3TBWA 4Y9BA 1T7LA 1TKWA 4NC1C 5IY5B 4MD4A 4YK4B 3E2QA 3PWUA 1RURH 3LCGA 3ICJA 4WO0A 4IXXA 3ZE1B 1BKSA 1MCHA 1R5IB 1Z3GH 3UTSB 1QI0A 1RVFH 4Y19E 4OSUL 3PGCA 2OMTB 4FFWD 4ACTA 5DT1L 3FYIB 1V6XA 2GJPA 1A0EA 1IWBA 4Z7VB 2CQVA 2BNRE 2DYPA 2JK2A 4JNMA 4XCEB 1I7RA 1U92B 1FQ0A 4MLSA 3AAZB 3ES8A 4Q4QA 1R3LA 2FLBT 3HAEB 4L1DA 1ZMYA 3VE0B 2C9XA 3H7VA 4FQ1H 2DQUL 1FYTB 1IZCA 2CZEA 3EAUA 3N2JA 2QVNA 4L1HA 3D9AH 5AWNL 2V6AA 4QSHA 2EVJA 3RX9A 4DERA 3U9IA 4ZO7A 3ZW3A 2X1WL 2JJUA 5CGMA 4NQCD 2P28B 1GYUA 5JHLA 3WUBA 5I76A 5AYZA 4G7VL 2QW5A 3DU0A 3RY4A 4HU0A 3VVWA 2XI9A 4E0RB 4D0CB 5HK4A 4NO0D 4Q8MA 1BQRA 4NC1E 1PG7H 1PFCA 2J13A 4WDIA 5HVFB 4P46D 1FP5A 2BSTB 5JORA 3WLQA 3GNOA 3L5HA 5I75B 2FGWH 4ENLA 4BA0A 4LUTA 3BPWA 1KACB 1HHIA 1RAKA 4MXWH 3W22A 3WUGA 3GSNL 3BFWA 1GYNA 4XWGL 1NOUA 3BPLB 3FQRA 2PU1A 4DXVA 4P5TC 3P93A 1RBLA 1LL7A 4I18B 2AV1B 4W87A 3S0PA 2IQAB 1URLA 2VC6A 4RGMB 1J7VR 1KKRA 5KS9E 3WH7A 5IM7A 3BDYL 1TQBB 3W9ZA 2TSAA 3N3EA 4NKCA 2HZHA 1MIMH 3QWRD 3H2WA 2JGYA 2IOMA 1HL9A 1ZT7B 2DMKA 1JWUA 2OMYA 3S1VA 1I7UB 2R2EB 4U1GB 1KFLA 1IFRA 4HWNA 3LIUA 1ILSA 4M48L 1TPUA 1TPFA 2YCLA 4Z95H 3UBXI 1KCXA 2OKMA 3ZTJH 5A2FA 5M03A 1VBGA 4F2FA 2Y0FA 1F41A 5J5DA 1U8IB 1BFVH 4OUUB 2K6YA 4U3XA 4TN9A 2NQDA 1P48A 2ZRUA 3RXZA 1A6WH 1CL7L 3EG9A 1VKFA 3JV6A 1DQIA 3CN0A 4D9QD 3PWIA 5F7MC 4PJDB 1QAWA 4Q4EA 4XN7A 2KZBA 1YHTA 2EZ0D 3WXVL 3SO3B 1HJSA 4HKJA 5EYWA 4L3EA 2VGFA 2PCYA 4EEEA 2XQBH 3P02A 1QTWA 1J2BA 2APTA 1UA6L 3IKCA 4MB1A 1FBIL 2IOIA 2OM5A 3QQ4B 3NXLA 3FVMA 2YQ2A 1JUFA 5DHEA 4JY4B 5HDQL 3GU1A 1YNYA 3NJHA 2ATPB 2SEBB 2ENYA 4KZEH 3ITGA 4ZCWA 1U33A 4RE3A 5DU7A 2PXYA 1KLGB 1YEKH 5DT7A 4C6BA 4QNEA 3OXRA 5C2BL 3NOYA 3EB2A 1Y0EA 4G1MB 3AU0A 1OKEA 3CUPA 2ZFAA 3T9PA 3VO0A 3BV4A 2ISDA 2ZX8A 5C0CB 5TBOA 2WJFA 3TF7C 1ETJA 3SN0A 3AG4B 4G7QB 2X4NB 3HTWA 4B50A 4W8BA 3STLB 4BM7A 5AZ2L 4LMQI 3C0LA 2HDJA 5TGBB 2VURA 4WI5A 4XBMA 4GI6A 3I65A 3ISIX 3W6LA 3X17A 4YDIH 3H8AA 4HXBL 3E9AA 4GPVA 1TSIA 3CDGB 3KPQA 4P7RA 4MS6A 2IPWA 3TXAA 2I85A 3PGFH 2VAJA 4FL4C 4FQQA 3OZYA 4PGBA 4QQUA 4TPRH 4QE1A 4R97B 5I07A 4IBSA 1NJ9B 3MV01 3QZOA 1HQTA 5KVMC 3S3BB 4Z3HA 5EC1B 2FZ3A 3VGGA 4UTAH 4WV1C 3ZKMC 3H2CA 3SPJA 3ZSSA 3RWDA 5HJXA 3TXVA 3Q3GB 5I1GL 1S3TC 2D9QB 1CCWB 5FA4B 3BKMH 4RLDA 1Q6GA 3ECUA 5DMMA 2CO6B 1AR1C 3F7VB 1XYCA 3HOGA 3FOMA 2X1QA 3FFDA 4AYGA 5DQPA 3FTVA 1IAIH 5BOZG 3MVSA 4LHUD 4OCNC 3DURA 3T0AA 4S10A 2DQCH 1JJKA 2GI0A 4DWSC 2VDOH 1V7NL 3UY8A 1I60A 4MJID 3BVJA 2AXWA 1AZCA 1QMLA 3N4AA 2GUOB 4WKZB 3TN3A 3GIVA 4C4BA 3NZQA 3NSJA 5DUPH 3EJTA 3Q5OA 2HTLD 3NDZE 3QWRA 1EJOL 4A2FA 3Q05A 2CJUL 3MUIA 3GMPB 2R9RA 3L4ZA 3VXQB 3QOMA 1E5AA 1ACZA 4XPHH 2CUMA 1NP0A 2EH8L 2ZJSL 4GY1A 3CQIA 3A6BL 4FLQA 2DSUA 2WNZA 5IDZA 2IQ9H 3TA3B 4Y4KD 4QRUA 1A9BB 4K23L 3O6LL 3F7RA 3U9UB 4UM9D 1AG0A 2DJ4A 4DFIA 1SBBA 1E4XI 3U7YL 4V33A 2HH0H 1NTDA 4RA3A 4I9WE 4G72B 1UCBH 3GB7B 1NAMH 2CJTA 4K94H 1LE9A 3XINA 3OODA 3H24A 4JRXB 1DPMA 3VOJA 5T5FL 2I5YL 2PMQA 1EQCA 3FA4A 3RILA 3DXAE 4OZHA 2FDSA 5E5MA 1F05A 3G9AB 3AIQA 4YSDA 4UNKA 4EUPG 1KM5A 5CBAA 1H9DA 3P1VA 1IVLA 4F20A 1E8WA 3NT0A 1HCVA 3C61A 1E70M 5LCVA 4U7KA 1LO2H 5D4JA 1G6RA 1EBPA 1RMFL 4UU9B 1VACA 5GSRA 2YLKA 4HIXH 2YD7A 3I6GA 2ITCB 2VAAA 4JHWL 1XTLA 4GAGH 4XQ6A 2IUZA 1RJYA 1EEQA 3AOFA 4WY7L 1LP9B 4AEFA 4WZ9A 2ZRZA 3NBNA 4DPCX 4BYHA 1V08A 1YVLA 4DP9X 3LHUA 4DB7A 3D39D 3RG6A 2DU2A 5I1CL 2EYRB 4F3FA 1XYZA 2XISA 2BW4A 4L48A 3K3QA 6REQA 4PJAB 4WCJA 1YPFA 2VQ1B 1CYWA 4IBVA 4LBRA 5AECA 3F5KA 2XSXA 4YXLL 2UVFA 3Q65A 5E8DL 1I9JL 5DQ9A 1EEYA 3FTGA 3EO9L 5G5DA 1EWEA 1BRLB 3E1ZA 2PPDA 4E0CA 1OX5A 3HF3A 1A50A 4MADA 2GABA 4KJQC 2WXIA 5H2ZA 1IMHC 2OXHB 1HYRC 4G82A 5FHBH 1J8HA 3QEQB 4PRAB 1VFOA 3F7QA 2R1LA 4NGHH 1U3ZA 1B4JH 2DZUA 1PEZA 2GCYA 3UYOD 3UTTB 4F58L 5IW6B 3QFDB 4TSBH 1GIGH 3FDGA 3B0VC 5C9UA 2BWDA 5T5FA 1DFBH 2OR9H 2Z8SA 1NQBA 1D6VL 5AW4B 1GKOA 1F42A 2EDLA 1SHXA 4XNMB 1KY7A 1S7WB 3G6DL 3C2SA 4L0YA 4LO9A 1F90H 5EU4B 1A4KB 4RAHA 2ONEA 1NZRA 1MFDL 4HA3A 1JVOA 5EOCL 1MEXH 2FD6H 1C1EL 2FUQA 4ELME 4MJIA 3NEVA 2Y22A 2MKWA 2PSNA 1HINH 4O54A 2EEDA 4XE5B 3ZLQC 2OEJA 3KLLA 3VFRA 1S3HA 2JELL 3AIWA 3VFVB 3UJJH 1BHGA 3UPBA 4JDYA 3R18A 2YXMA 3F2DA 3VRIB 3BP7A 3UZEA 3QEGL 4HJGB 2G0WA 4NZ8A 1TZOA 4NX5A 1NQ6A 1ONXA 2Z7WA 1KDJA 1SBSL 1GGCL 3QHFH 1AE6L 4LS1A 4KKBD 2VVSA 3L6FB 3ITVA 4GPNA 4Y4KA 3KWTA 4P59L 4C60A 4PRIB 2YPLB 2OSXA 4JKWA 4LBUA 1M5WA 3B7SA 5IB1B 2XHNA 3QXWA 4UM9A 3LY6A 1MI5D 1I8JA 5HHXL 4KTYA 1CFQA 5DY3A 1GZGA 4QXGH 2XBTA 3QJXA 3FBKA 2IPUK 2Y63A 5CZRA 1G43A 4HF5L 1FO0A 4P7QA 3JTSB 1UVQB 2VDOB 4U1JB 1U8LA 2CLPA 3MX0A 3QZEA 1HF6A 2AL2A 5LN8A 4JQ3A 4QRSB 3FQNA 3PTMA 2O5XL 2ZRVA 2DPEA 1P4LA 5AW1B 3H7UA 2YJLA 3ULUF 3R4DA 1L2QA 2VM4A 2CC0A 4HIHA 2XGZA 1LDPL 3BT2H 3WF3A 1OB1A 4MA3B 1EBAA 5A2CA 2XPZA 2VN3A 1TZGH 2WW5A 3QFJB 2FZ8A 3W70A 3N43F 1QOPA 5DK0B 4LVOC 4M24A 5ITBH 2YBUA 2DQ6A 5B4MC 4ENED 3WK0A 5AC4A 4ONOA 1L6XA 3ZDZE 5L8LB 2J8HA 3QUXC 4S1DD 3CK0H 2BSSB 2VC2L 1E40A 1IEWA 3CPRA 3RWEA 1GOGA 2B2XL 3DBPA 1PSCA 2J77A 4GEJA 5JW4Q 2Q8BL 3NRFA 3N25A 2XJ7A 4XO7A 3D0LA 4QRPB 5F88A 4EPEC 4ROQA 2V2WB 5AOKA 3FT4A 1DTNA 4PREB 3N15A 4AMWA 3NCOA 1YN7B 4YIQA 2AVGA 1AJ7L 3TNOA 3OKMA 3KDOA 4FOKA 2GHWB 4ZPTB 2ADJB 3TZVD 1QNOA 2K3HA 3MYZA 2R0KL 2VMFA 3MBFA 2WBJD 4TUOB 3V4PA 3LHPH 2VUYA 3VB8A 4G6FD 1U4EA 3UYRH 2BNRA 4Q4KA 8TIMA 3S4TA 4OQVA 4U0RC 3MJYA 4NUJB 5IG7B 3S2LA 2IAMB 4XC3H 1S46A 4UTUA 1XYAA 1GMIA 2XWBA 3E2HC 3JUYA 4NJ9H 1RZQA 1FZMA 3UC2A 5LA0A 4QIRA 5A8MA 1ALDA 3X12A 1S7VA 4QRAA 4E4UA 3PQYB 4LAUA 2HLAA 1VFTA 3AGWA 3WKQA 1OX4A 4BKSC 1LO5B 4I9JA 1WNOA 4MLJA 2OZNA 2R23A 1NY1A 4UT6L 4IQDA 4RK8A 1G9NC 4OV4A 1DQMH 2ITDA 3HFFA 3O3EA 1JZEA 3E8UH 3GIZL 1IQDB 3LZ3A 4L1GA 1A7RL 3LOTA 2G5UA 4DQOH 3FB6A 5AYYA 5MENE 4B5UA 1S3KH 2WVVA 1IGTB 1INDL 3HE6C 2ZWNA 4CD5A 2VDMH 1GONA 3PF2A 3R0KA 3L5WA 3CK5A 5MP6L 3TYFA 4DQWA 2I9LA 5JIKA 4L9YA 4D2JA 4NP7A 2C9VA 1NMAL 2B20A 1QD0A 3LI0A 1XPYA 5EO0A 1LEKB 5C8JA 5KS9A 5KYNA 2E0PA 2A6DA 4O4YL 3VFTB 1R47A 1XG3A 4NHVA 3WK2A 2E7FA 3R0NA 3ARED 4L3CA 5DMKB 1MFVA 2DH2A 1PQZB 1KQYA 1GHFL 3SCRA 2CPCA 2OYMA 3EMQA 5DJYA 3VFPA 4AM0A 5IWLC 5J6HB 1J1XL 3UJ2A 1CFSB 2VXTL 2UY5A 3WELA 1BVNT 3W57A 5GJSH 4ZUSA 1OFEA 5T1LD 1N4XL 4PMQA 1URZA 3O3DB 1YPZB 1DQQB 1TPWA 4OCXL 2AQ2A 3DFNA 3DX6B 4ERSL 4ODSL 1KJMB 1TO3A 4I9WD 3BDXA 2FEJA 4JEJA 2G5BB 3LNGA 3VWKD 2Y7GA 2CLHA 4TKWA 1JUEA 1S2WA 3FB7A 2Y6SC 1ECQA 3IBOA 1W9BM 4GY0A 3F5JA 4DGWC 1L9TA 2IQDA 4E42A 1KM6A 5D7JB 1OD8A 3LBMA 1TJHH 4JJ5B 4AIBA 3ZWTA 1DL7H 4P5TA 1UQYA 4GYFA 1ZU8A 2QADD 1FL6B 3MJ9H 3H70A 3GZPA 3BZ4B 4UT6A 3CNKA 3IVKB 3RLHA 2YLLA 3OZKA 1MCQA 4NM8L 5C0QA 4Q3MA 3R19A 4JUTA 4WGXA 3IFOA 3CH0A 4KKCC 3QYQA 1LWHA 3KCLA 1O94A 5HJGA 2PTTB 3TJEL 5GZNC 2V2HA 3GT6A 4XVSH 4GRMB 1FGNL 5JUVA 1E8XA 5IHLB 1NIEA 2YB1A 4IBLT 4OZHF 3HI1A 4X8JA 2P10A 4XKYA 2PP9A 3TZVA 5DXYA 4LVEA 3GRBA 5JQ6H 1TUPA 2R1WB 3W83A 4QHNA 1K2DB 1MNZA 3GMLB 3VNMA 4PVBA 5DURD 4JTJA 4E2VA 1AZRA 4LARH 3VFUA 1MFCH 1Y1DA 1KTCA 3FIGA 1HNFA 3O8XD 1XF1A 3X3FH 3Q48A 43CAB 4JM4H 5HHMB 4L4MA 5I2IB 1J86A 1FVEB 2HT2C 4HFUH 1BFTA 2E6FA 4JTUA 2F8VA 4NO2A 4H6KA 3CFKA 2GEQA 4UTCA 5FCUL 4GG8B 3QI9B 4Z0XB 4PJBB 5JDSB 4I5RA 2ZCLH 1LL4A 3V8OA 3CLEL 2YZRA 4AC7C 4RFOL 3SQOH 3NQGA 2WYZA 2H9GB 5C3LD 4JREB 1ADDA 4V2XA 4F91B 1IGFL 1MUMA 1M2OA 4OVUA 3VDCA 1JVLA 5FA3A 2XXGA 2XVBA 2P8MA 1BTMA 4BR1A 4L4TB 5DZVA 3ULUC 5CSGA 1CXLA 4RBPK 4HJEA 2AKRA 2ZBTA 4AX6A 2KAUC 4QHLA 2VRQA 5FGBC 3FU0A 5AC7A 2WYSA 2F7PA 5LAXA 2I07B 3G6JB 1J0JA 3K6DA 4FTVB 4FG6C 1OYAA 2F0CA 2NNAA 4LS2A 1X5GA 5L8KB 3GK8H 3UAJD 4IEFA 5AEAA 3D4YA 5B1BB 3W88A 3NDZA 3MRRA 3TJHC 1NDGA 3TQ0A 4PA8A 5E6IC 5ID1A 3HFYA 3A4EA 2BP8B 2VH5H 3FXYA 3SRKA 4H20L 1VZIA 1VEPA 2QMKA 4UOW1 1ZA3A 4Z5RA 1CXIA 4ANKA 1XF5B 1RCQA 2A74C 4MNQE 4OI8A 3TZFA 2IGFH 4WV1A 3EWZA 4L29A 4RZBA 5J9PB 4QTHB 1HE8A 3FPXA 4OV6F 3UGVA 1LOLA 5T1LA 4ERAA 2XN1A 1PYWA 1XF0A 4AE0A 1BQHG 1P7QB 4IMKC 3HG1E 1MIEL 1IAOA 1IGJA 1SYVB 3CPUA 4PGJA 2YWYA 1W1VA 5D2LB 1DYZA 3PL6D 5DFVD 4X6CF 5JMRA 1KCUH 1SYTA 1FHVA 2ISWA 4A4AA 2VDMB 5F2FA 3ULUE 4DWSA 2XX1A 2GQAA 1UKSA 2FTWA 2F53E 3SRFA 3DXAA 1OGTA 1WXYA 1IFHH 1W8EA 4MZ8A 3CZLA 4TVPL 4ODWA 3PREA 5D93C 5GRJH 3WLNA 3FH5A 2E7HA 3Q9PA 3NO5A 4PRPB 4R3UA 4PH6A 4DWHA 1DO5A 1NLBH 4FOMA 1ETB1 3X1GA 2ZG2A 4GP5B 1RAMA 1BJMA 4N1HB 5JIPA 5DEJA 1P5VA 2XA8L 3MMEB 4QYOA 1VQTA 1ZPUA 4CEUC 5F7EL 4YTTA 4DT2A 5TE4L 4FQJL 4Q9BA 3H53A 3ULSA 2Z7GA 1SFHA 1U8NA 1U41A 3JV4B 2X0YA 3CV1A 5I1AB 1QFWM 4F40A 3T8QA 5I6SA 1AHMA 1JNLL 1UT1A 4OLYL 1RBOB 5IFTA 5L2JA 5CEZH 1UC6A 1X5JA 1KXVC 3FHAA 2XYBA 1T1YA 3ISRA 3TSDA 4XPFH 3IJEA 3LS5L 4BK8A 3O11A 2O1AA 3FSVA 1A6PA 1PTDA 2OR8A 2HWZL 4BFAA 4AZ8A 4TX9A 3ZMRA 5PCYA 1ZFJA 3UZ5A 1LK2B 3U2SA 1AGCB 1JDFA 3GXUB 4ZUVB 4YLCA 4KHTH 3H9ZA 4FQHA 1F6LL 1JS4A 4NZUH 4GKNB 1H0IA 2NTFA 4REQA 2YMXL 5EIIG 4UT9A 1GZHC 3RLVA 2NZIA 4M02A 2ZZ7A 3C5ZB 3Q5YA 4IP5A 3GZ3A 4MA1C 3L9RB 2UUDH 2YPVL 5FEWA 3K72B 3M9YA 1C8XA 4P46C 2R8SL 2X4OA 3BPOC 2V3EA 5BWFA 3VRLE 2ED6A 4OF5A 3MTRA 2PRLA 4WKHA 1Y65A 2AFNA 3JRKA 3J7HA 3L9CA 4KZDL 3W6YA 1F4YH 5ACMA 3H7LA 3P0GB 4G8FA 4OF0A 5MHBA 3IVSA 2V9DA 4ELMA 1OBAA 4C54A 3IXAB 1K9EA 4MGGA 3LN3A 4EF8A 2E75C 4YXHL 1BBJA 1RH8A 1B4KA 1G7PB 1FNHA 4HWEH 5L2KB 5LHFA 1ECYA 3WDRA 4S3KA 3AGVA 3BH9B 1VPQA 4BZYA 2ZG3A 4JQIL 1REQB 4DO7A 3S4SB 4NQCE 2C13A 1BD0A 4J7RA 5FOJA 3RRAA 2QGCA 1EF2A 3C09B 1A25A 4JGMA 1Q72H 3SZKC 4WENB 4G2AA 5TNVA 5DD1H 1RPUA 1YRKA 3I2CH 5JW3L 4ZW7A 4ZFFA 3UVIA 5BXSA 2NSMA 4XP1L 4JZJC 2EZ0C 4NLHA 5D1XB 1E27A 5KSAB 2QPUA 1ZBCA 3S5SA 4UTHA 3T3MB