1DHKA

Structure of porcine pancreatic alpha-amylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex.
pubmed doi rcsb
molecule tags Complex (hydrolase/inhibitor)
molecule keywords PORCINE PANCREATIC ALPHA-AMYLASE
total genus 154
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dhkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dhkA01
1SMDA 2V38A 2OWXA 4XZBA 3KEHA 1VENA 2WHLA 2OW7A 5FL1A 5I0DA 1E0WA 1J18A 3GXDA 1JF5A 3F5LA 5DO8A 2FGZA 1BYAA 1UR8A 3EDFA 4BCEA 4U33A 5CGMA 1E56A 2DQXA 4HZ8A 1FHDA 2J79A 3CZLA 2ZOXA 2GVYA 1J0IA 1V6YA 1UHVA 1TZ7A 2OWWA 3AIRA 3IGUA 2E9MA 4Z2LA 4C7DA 4FLSA 1MWOA 4X9YA 2VVNA 3ZO9A 1E4MM 4B16A 3VDCA 1E5JA 1E72M 3WUGA 2Y8VA 3RMEA 3A23A 4XUYA 1RPKA 1LL4A 3N18A 1W1PA 3CZGA 1J11A 3LMYA 3PZQA 2YL9A 2WCSA 3VNZA 1Q6DA 1AVAA 1QNPA 4W7UA 4PTXA 3OLGA 3CO4A 4ACZB 4DO5A 4AYSA 1WDQA 3N12A 1F4AA 5CPQA 2D73A 3BAKA 1JZ4A 1EQCA 4GKLA 3HG4A 1QBAA 2YLLA 4DM1A 4Q7NA 1HL9A 2F7RA 1H2JA 1CGXA 4MJ2A 4NI3A 1W32A 3BLBA 5AYIA 1BPLB 3POHA 1E1EA 3WUEA 1PZ2A 2XWEA 1WDPA 7CGTA 1BYDA 3VIJA 2DPEA 4CKQA 2ZUMA 4J3SA 5CPSA 2FH8A 3UESA 2UY3A 4F9DA 2IXVA 3EDEA 3LPFA 1J0JA 3ARUA 3VSTA 1OB0A 1W1VA 2ZUUA 2A3CA 3N1AA 3RM8A 4AYGA 3EJTA 3VINA 3MUAA 4GO9A 2D24A 3WF3A 1QHOA 2FHCA 1B2YA 4NXSA 4KMQA 3K1DA 4AEFA 5I6SA 3ALGA 4AMCA 1UA3A 2VZOA 1ISVA 2WZIA 3WH7A 3W38A 2A3BA 1NH6A 2DGAA 5E6ZA 1JZ3A 2B31A 3RPMA 2G3NA 1RP9A 2ZUNA 3CLWA 1XH0A 5D8ZA 2XM2A 2WC3A 3FHQA 4QLKA 1QHPA 1W1TA 1J01A 3VIHA 1G1YA 1JYNA 3MMUA 1XD0A 4E8CA 1CIUA 1V08A 1R7OA 3EBVA 1A3HA 1TE1A 1SR0A 4AZ6A 5BXRA 1RD6A 3D50A 1OIFA 3GXPA 4A4AA 3ARVA 1QW9A 4ZEPA 1WCGA 1B3VA 2YIHA 1LQ0A 4FNRA 2RGLA 1VIWA 3PN8A 3SCUA 1YHTA 3K8MA 4A3HA 3BCFA 3WDRA 2XIIA 3IAQA 1KXQA 1FOBA 1MW2A 1V3IA 3EJRA 3WMBA 1OGSA 4PSRA 2WZEA 4UR9A 2XN1A 2G41A 4H8UA 2X0HA 4PRWA 2V5CA 3PTQA 1CEOA 3DYOA 5BCAA 1J0YA 1JNEA 2WMIA 2BNJA 3MS8A 1PAMA 1W2PA 3AS0A 2XUCA 2VQTA 6A3HA 3SCOA 5A2BA 3M7SA 3WNMA 1HKKA 2V3GA 1KCKA 3BC9A 5BXTA 2ZUWA 5GNYA 3HU7A 3AS3A 3CHDA 3WSUA 1CWYA 4U2ZA 1MYRA 1MQRA 4WSKA 4AMWA 3U5YA 2CBUA 1G5AA 1QI3A 2W61A 2Z1KA 2XVKA 1IV8A 4KWUA 3OLIA 3AIWA 4Z2HA 3ARPA 4CD5A 2ZUTA 2CETA 2EPKX 1HJWA 5GPRA 1HKJA 5C70A 3DX2A 4EAMA 3VPLA 4D6IA 2CBIA 5I23A 3UG5A 2OYKA 1QPKA 4D1IA 1WNOA 3ZT5A 2WHJA 3LX9A 1XD1A 1MVYA 1CXFA 2WBKA 4X0VA 3ZSTA 1FH7A 4D6HA 3GXFA 3FAXA 3ARWA 4RE2A 2Y8KA 5CXPA 3UEQA 4F66A 1NP0A 3QHMA 4AMXA 4GI9A 2WMFA 4D6CA 1JXKA 1OGBA 1AMYA 2AMGA 1XYFA 2WMJA 1JZ6A 4JHZA 3SUUA 3DDFA 5JIWA 3WD1A 2ZX5A 1CPUA 2QPSA 5KEZA 3IK2A 1JL8A 3ARXA 3WUFA 4P8XA 3T08A 4F8XA 1TMQA 3PZMA 4PMNA 3DX4A 3PZ9A 3BH4A 1UWRA 3POCA 4LX4A 1CECA 3WDJA 3U7VA 1B1YA 1LLOA 3DHPA 4MTVA 4FK9A 5GNZA 1LJYA 4WIWA 2NW0A 3WD3A 4NZJA 4AD1A 3WFLA 4AZCB 2ZE0A 1R75A 3WMCA 2CEQA 1BQCA 4ATDA 4QLLA 5ABEA 1PIGA 4HTYA 3AMLA 1UKOA 1EH9A 1PX4A 2V3EA 5A6LA 3QHNA 4WKHA 1MW1A 3K4AA 1J9YA 2OWCA 2F7PA 4BZYA 2BXYA 3PZOA 4U2YA 2NT0A 5CZKA 5CSUA 4AEEA 4JKMA 2WVSA 3AXIA 2GJXA 4B9YA 1JI1A 1ITXA 4M80A 1QWNA 1OD8A 2BY2A 1QOXA 3GZAA 3SUVA 1R87A 4MB3A 1O7DC 1UWIA 5DEZA 3VIMA 1KXVA 3RM9A 3AIQA 3ZMRA 3BVUA 5F7UA 4TVCA 1EQPA 3MO4A 5IHSA 2GFTA 2E9BA 4J28A 1JG9A 1I1WA 5CQ1A 2WVVA 8CGTA 2RGMA 2PB1A 3IAPA 5A69A 4CU7A 1TVPA 2FH6A 3D52A 4X0NA 4P8UA 3KL3A 1KQYA 1TFVA 2PWFA 4FNSA 1PS3A 1ZJBA 2CNCA 4BS0A 4CVWA 4ZXOA 2DIEA 3TOPA 5E0FA 4QCEA 1E4LA 1D2KA 3NSNA 2XFYA 5D8WA 3D4YA 3UERA 1UH4A 1XC6A 1M01A 3TTSA 1KFWA 3W53A 4U3AA 2UWFA 3SCWA 4PUEA 5FOOA 4GI6A 3N13A 1G0CA 2J7HA 1VRXA 5A6BD 1K6AA 2J47A 4UFIA 4NZFA 5A6BA 1V0LA 2YBUA 3GBDA 3AISA 1JYVA 2GK1A 1KXHA 3L4WA 3AXXA 1E71M 1CXIA 4BQ5A 1E0XA 2PC8A 5D9MA 1K9EA 3CMJA 2PF0A 1K9FA 3GH4A 3NSMA 4P8WA 4TX8A 2GDUA 3CUIA 1HJUA 3TP4A 4C7FA 1R46A 1GQKA 5C8BB 2XTKA 3CH9A 3VDAA 1EDTA 2GJPA 5A2AA 1FA2A 4CD6A 5JBEA 1V3LA 1UKSA 5A8NA 3VD9A 1O7AA 4MAVA 4E4PA 5HPCA 4WJXA 1VJSA 2WPGA 1CENA 1WPCA 1BAGA 3K4DA 3M6DA 4GIAA 1J12A 3NYDA 4CUCA 3K8KA 5A2CA 1Q4NX 2XJ7A 3WH5A 4P7RA 4HMCA 3MANA 2J62A 3TTYA 1QNRA 3WNPA 4PCTA 3VO0A 4UFLA 2V5DA 3U5UA 2G3MA 1Q6GA 3SCSA 3ARTA 1V02E 2CPUA 2WKLA 3NDYA 3ZT7A 3CUGA 2V3FA 4ML4A 3WNKA 4Z2JA 3QOKA 3ARYA 3BMWA 2BVTA 1TR1A 4DWSA 1OINA 3F4VA 4PYSA 3F5JA 2VC9A 1AQHA 1C8YA 1BF2A 4P8VA 2DEPA 3F5KA 2XVPA 3WD0A 2X1IA 4MAZA 1BG4A 1E6SM 2XSBA 5AYBA 3G6LA 3SCPA 3UR7A 1X1NA 4NRRA 2D20A 4J3VA 2YJQA 1W9UA 3AYSA 1E1FA 3BXWA 1XSKA 1UR4A 5D9OA 4D6GA 1V0MA 2GSJA 5GQBA 2PWEA 3CBWA 3GH5A 4V27A 4GO8A 4PMYA 2VURA 2EEXA 3PZNA 1JZ5A 1WZKA 2VX4A 3W4RA 1XYZA 3VM7A 3W27A 4BF7A 1NM9A 3BVTA 1FH9A 4PMVA 1NP2A 4BA0A 4AD2A 2D0HA 3WY1A 1B90A 3VD4A 2CKSA 2PBOA 4PMXA 1LG2A 2VUYA 3L2LA 1B9ZA 1U2YA 2J8GA 1BLIA 4ATLA 4OBSA 2J7EA 3VD5A 1QNOA 1C90A 3O9NA 3VVGA 1H3GA 2NT1A 2BY1A 3VX0A 3BGAA 2E9LA 2QHAA 3AICA 1W9DM 3B8SA 1E4IA 3O6AA 3KLKA 1BSIA 3CTTA 2PI6A 5BYWA 1V6UA 1HT6A 1NARA 5FKYA 3E1F1 4MDOA 5HOSA 1CLVA 5E6YA 3WF2A 4WK9A 2CHOA 4JHOA 4EK7A 3WY2A 2XIBA 3VMNA 5ABFB 1ISYA 3KZSA 3TONA 1EHAA 3EJSA 5EB8A 1VFUA 4IISA 2DSWA 2DDXA 2WHKA 1V0NA 4HMEA 1ZU8A 1UZ4A 4HZ6A 3WQ4A 4U3CA 2BS9A 2CYGA 1CGUA 2DT1A 3QHOA 4HA3A 1C3FA 1OIMA 1QVBA 4JKLA 4FLOA 1JDAA 1WB0A 4GZJA 4MNMA 2W62A 4J3UA 1TA3A 1IZJA 3OZOA 2E8YA 1QI0A 4J3XA 1X6NA 4U5KA 2WB5A 3TTOA 3WDHA 1H41A 2G8ZA 3AXHA 1TQSA 2A3AA 3W26A 3J7HA 4GZIA 5CG0A 4NZCA 3BUBA 2X0YA 5JUVA 4UZSA 4HOXA 3EMCA 4W88A 5DF0A 3VGDA 1NOUA 3BUDA 4UQCA 1SYTA 4NX0A 1MQQA 3ZJ7A 1CGYA 2CKRA 5FCZA 1OT1A 1PIFA 1FFRA 3WQVA 5I2UA 3MSDA 3CMGA 1FP9A 5CGTA 3VIFA 1GONA 2X2YA 4NF7A 3L4ZA 4AISA 3AYRA 3FN9A 1XSIA 2CCRA 3MMWA 4QLJA 3OGVA 5GNXA 1I75A 2ZX6A 2F2HA 5AC5A 1CXEA 2BHZA 2X8RA 4OKDA 4QAWA 1OT2A 2IUZA 3T2OA 2JF7A 3W0KA 2FGLA 2W92A 4WKFA 3IJ8A 1OGGA 3AMGA 3SCTA 2DT0A 1UD8A 1EA9C 4OOZA 1JZ7A 4S3JA 1BHGA 1E3ZA 4JKKA 1E6ZA 4TUFA 1GJWA 4RL3A 4UOQA 2OLHA 5CPTA 2JIWA 3VD3A 4Z2KA 1UWTA 5I24A 4BQ4A 2J4GA 4AD3A 4LGXA 3D51A 1ZJAA 1A47A 1M53A 1BGGA 4M81A 1W2VA 2ZXBA 4HU0A 1N82A 1EOKA 2XN0A 2HISA 3AZRA 3DHUA 4JL2A 1XHGA 1ZL1A 1MXDA 1C8QA 1WO2A 4CU8A 4EE9A 4UFKA 4OIFA 4D72A 5BRPA 1Q6EA 2JIEA 1B0IA 4XB3A 4UQDA 4AD0A 2OYMA 4P7OA 2W66A 1TQUA 1VFOA 2FHFA 1HWWA 3VNYA 5A8MA 3N04A 3MUZ1 3WNLA 2IGTA 1KTBA 1NOWA 2VCCA 2GDVA 5A6JA 4LYQA 3RJYA 2JE8A 5A3HA 2BY0A 3BAYA 1TUXA 5LA0A 3WUBA 1UD6A 2IXUA 4TXEA 1V3MA 2VCAA 2VZSA 2XM1A 2WWDA 2WSPA 4W89A 3WDQA 1EOMA 4W93A 2WNWA 1Y7VA 3BVVA 2E40A 3WIJA 3S5YA 4RE4A 3W28A 2XWDA 5FIPA 2WXDM 4A3YA 2J7BA 2WVTA 1C7SA 4MNKA 1ZS2A 1PEZA 1FHLA 1HJSA 4W86A 2EPOA 1WP6A 3WF0A 1JF6A 4P7QA 1UH3A 3WF4A 4GQQA 1VEPA 3CHCA 4MNJA 3VIIA 3VGFA 1P6WA 5I78A 1BVNP 1JFXA 3EDKA 3UETA 3K8LA 3OA5A 3OLEA 1PX3A 3BVXA 1KWKA 3KL5A 1R34A 1GHRA 1B31A 3WENA 2BHYA 2AAAA 1H4PA 1UKPA 2J75A 1NWRA 1M04A 2NSXA 4CD7A 3CZJA 1HIZA 1H1NA 3W82A 2G3IA 1DP0A 5E09A 5A6AA 1GOWA 2VZTA 4PN2A 3T2PA 4LXFA 1GOIA 3NSXA 4TX6A 1TA3B 1R7AA 3AHVA 3VMOA 4FNQA 2ZXDA 3ZT6A 2X09A 1JI2A 1GORA 2DSKA 1NQ6A 2Y2WA 1C92A 1GOQA 5IFPA 3LPGA 3KL0A 4NRSA 2EQDA 2O9OA 4JFTA 4GPNA 2WSKA 2YLAA 1JZ2A 1ECEA 3WH9A 4PEEA 5M3WA 4D71A 4ZE4A 4UQEA 2DIJA 2F7OA 1TQWA 3NUKA 2UY2A 1UD3A 3ZIZA 4W5UA 5IDIA 3MUY1 1UKTA 3LPPA 3AI0A 2GJRA 4UFMA 5BXSA 1VB9A 1V3HA 4F9JA 3CV5A 3ZOAA 4ATWA 1Q6FA 1VF8A 3AHZA 1XSJA 1JDDA 1K9DA 1JDCA 1DWHM 4PSPA 4W5ZA 4AZ5A 4PTWA 3WDPP 4MB5A 4HPHA 4PMRA 3WD2A 1GNXA 3VDHA 3HG3A 1Q6CA 1KQZA 2D3LA 1Z32X 2G3JA 4AXNA 1GQIA 3B9EA 3FNDA 4AC1X 3GH7A 1B3WA 2EPMX 5DFAA 4YHGA 3L4UA 4FNPA 3BAJA 4KGLA 1E6PA 4JZ5A 3BLPX 2J7DA 1GQLA 4E8DA 2EABA 3AJ7A 4H8HA 5CLWA 3WBEA 3EJPA 1DWAM 1HNYA 4PMUA 2YA2A 3AMCA 4M29A 3OG2A 2EPNA 1GHSA 3CUJA 1UQYA 4MPKA 4IPLA 2YFNA 4AZIA 3VOCA 2VRKA 4JFUA 2D2OA 3H54A 2E0PA 2X05A 2DSZA 4AZHA 2YOCA 3UG4A 4FLRA 3T0BA 4LYPA 4PUDA 3EDDA 5I3DA 2ZXQA 3A4WA 1H0IA 4M1RA 1JXJA 4OGZA 2YDRA 4LQ1A 1E15A 5A6SA 1DWFM 2D3NA 2GK1B 1NWSA 1JYXA 4PMQA 4DM2A 5BXPA 4JIEA 3UCQA 5BWFA 2W67A 1OM0A 2WCAA 2EJ1A 2ESCA 1LF1A 5EFDA 4HZ7A 3WQ8A 3WF1A 2VI0A 3AHXA 4UZUA 2D0FA 2PWDA 3DYPA 4XZWA 1ZB5A 1NOFA 2VJXA 1HTYA 3WQ6A 4B3LA 1WZMA 2E8ZA 3NDZA 4Z2GA 1E9LA 5IHRA 1BG9A 3SURA 1H09A 3SCQA 1XCXA 3L4TA 3CHFA 4CGTA 1ODUA 3I3EA 3ALFA 4HOWA 2DH3A 2VT0A 1QBBA 3KLLA 3N17A 2D22A 5E0CA 4JAWA 3AFBA 1R86A 3ZSSA 2JALA 4AZ7A 1JIBA 3SIMA 3AHTA 1V0KA 3T0DA 4AIEA 1CZ1A 1BVZA 4UQ9A 1D3CA 2PWGA 3RIKA 4P7LA 1JGIA 2VRJA 2BY3A 1DHKA 2XYLA 1GOKA 1V6XA 1UR2A 4V2XA 4B15A 2X2HA 3BUIA 4F79A 3AROA 4UCFA 1XRVA 2VNCA 4WF7A 3D3AA 3G6MA 3SUTA 1UA7A 2QF8A 1W3JA 3IJ7A 2QLYA 3BUQA 4WKAA 1GOOA 2XG9A 4HMDA 1ZBWA 4IM4A 3MV11 3PTKA 3GXMA 4TTGA 5IXEA 1V6WA 1SFSA 3SUSA 2BHUA 3S5ZA 3S2CA 1LL6A 2HVMA 3AMDA 3GYCA 2J77A 1LWJA 1OCQA 3LRKA 3S6TA 3EMQA 3BAIA 4ZE5A 2CHNA 3JUGA 3VKKA 5JBFA 2J78A 5JBDA 2EACA 5D4YA 3ARRA 1K9TA 1UZ1A 1NWTA 3A4AA 4KRUA 5DT5A 3M07A 1QW8A 3AZTA 4URIA 3VUPA 1VFFA 3EMZA 4N42A 4CU6A 4U31A 2XVNA 1KWGA 4OUEA 1HKMA 3ZJ8A 3OB8A 4UTFA 3VMPA 4AZGA 3WQWA 1FP8A 4ZENA 3A3HA 2FE0A 4M24A 3CPUA 3OGSA 4OBRA 2VZUA 1W3KA 2VVSA 3VM5A 3AIBA 2GJXB 2CBVA 1CTNA 5ABHA 3VU2A 3U7BA 2YFOA 4GINA 2O9TA 1HKIA 4AY1A 3VIOA 1D7FA 3L2MA 3I3BA 2WWCA 2MANA 4MB4A 3CZ8A 1UD2A 4FNUA 3WEOA 1UH2A 2ZIDA 3NCOA 1EHNA 1HL8A 4W8LA 1VFMA 4W84A 2F7QA 4KGJA 3PZIA 1BTCA 2O9PA 3II1A 2WZHA 2QPUA 4IUGA 1QI5A 3RO8A 1W91A 3BAXA 1EDGA 5AY7A 5KZ6A 3L4VA 1UASA 3W81A 4D6DA 1J0ZA 1EXPA 1W9VA 4AW7A 1IT0A 3W6LA 1EDQA 2PWHA 4MB1A 3AHYA 5HPOA 4RE3A 4PTMA 3PBGA 3TA9A 3FW6A 1ITCA 3OIHA 5ABGA 1E73M 3A4XA 3OLDA 2JEPA 4W8AA 5IFTA 1GQJA 3AIUA 1MFUA 4JCLA 3CZEA 1FFQA 3D4ZA 2WHMA 2ZUSA 4PCSA 2BFGA 2VQUA 4DO4A 5LA2A 3LRMA 1LG1A 5I79A 1UWUA 4YPJA 3M46A 5E70A 4ZFMA 2X2IA 4CCCA 1PJ9A 5JIPA 2XVLA 5ABFA 2UY4A 2XVGA 2E3ZA 2YA1A 1EGZA 3CIVA 3MMDA 4MDPA 2DSVA 1IZKA 3PHAA 3GBEA 2Y4SA 1UG6A 3HG2A 3T0AA 1WZLA 3AIVA 1CYGA 3A22A 1C91A 2OSXA 3WQ5A 1U30A 1W9XA 2ZICA 4HA1A 1B3YA 3BAWA 1JFHA 9CGTA 3BUPA 4Q22A 4DUVA 2WC7A 3EYPA 3U57A 2DH2A 2A3HA 3BSGA 2F18A 4D6JA 3I3DA 4QDMA 1C93A 1WKYA 2QMJA 1CLXA 2YDQA 1PPIA 1UYQA 3LXCA 5A8PA 3AQUA 5BRQA 2F61A 2WM0A 3O2LA 2AOSA 3VTRA 1T0OA 1MW0A 3VIKA 2EADA 3H55A 1SMAA 1W1YA 4FMVA 1BFNA 3AS1A 3NIYA 5BROA 5A94A 4K68A 1JD7A 6CGTA 1KR1A 3RILA 4GXPA 3WL0A 1M03A 5LA1A 3CUHA 4AIOA 3BLKA 2QV4A 3HJEA 4WLCA 4MADA 3DDGA 1V02A 5M17A 1QI4A 5A8QA 1JZ8A 5DMYA 1WE5A 4HP5A 1H49A 1KR0A 2XSAA 3MV01 2WMGA 3A47A 2OSWA 1W3LA 1LWHA 1RP8A 1C7TA 1ISWA 3WNOA 1J0KA 4AWEA 4AIUA 3WL1A 1QX1A 2J8FA 2CERA 3APGA 2YDSA 1HJVA 4D1JA 3THDA 1GJUA 3HZ3A 6TAAA 4DO6A 2C0HA 1OD0A 3WY3A 2WC4A 4DWSB 4GI8A 4UQBA 4H8VA 1CGWA 3W25A 3FHAA 1HXKA 1XGZA 3KWXA 4U5IA 3VDBA 4UNIA 4UFJA 1GPFA 2WVUA 1R47A 3BCDA 1AQ0A 3WFZA 2F1BA 3GXIA 3OBAA 4C7GA 4QCFA 5EMYA 3QOMA 2D1ZA 1UR0A 4UOJA 3BSHA 3AS2A 4AD5A 4W85A 1MW3A 1KGXA 5A6MA 3HG5A 3A21A 4QFUA 3OGRA 4BQ3A 3B9DA 1ESWA 5HNNA 1W9PA 1B3ZA 2EO7A 4HPGA 3GTNA 1X6LA 3DECA 3RJXA 1HVXA 2GUYA 3GNPA 4Z2IA 2WKGA 3T2QA 3UR8A 3ZR5A 3SCVA 5E9AA 1XH1A 1HP4A 1ZBVA 4R27A 1WZAA 4W7VA 2Z1SA 1GVYA 4D6FA 2J7FA 4NXKA 5AC4A 5A6KA 1QNSA 3ZM8A 1S46A 4QP0A 3TV8A 1WDRA 4HOZA 4CD4A 4W7WA 3LXBA 2W63A 1BYBA 3BVWA 4KH2A 2XGIA 2QMKA 3PZTA 4CN4A 1GVIA 1TVNA 4JFSA 2WBGA 1QI2A 4FF5A 5D9NA 2WLZA 3FXYA 2XPKA 2O92A 3AMKA 2OSYA 3FY1A 1JNDA 4YN5A 3AZSA 3SEPA 2VR4A 5DT7A 2D0GA 2WYSA 2VO5A 3RDKA 4J3TA 2UY5A 1E0VA 4CVUA 1G9HA 1QNQA 4E2OA 3VGEA 3BMVA 7TAAA 3VGBA 3ARQA 4CCEA 1HP5A 5TD4A 1TQTA 2BXZA 3LXAA 1SZNA 3GM8A 4PMDA 4S3KA 5I77A 1US3A 4TVUA 4CD8A 2WVVB 4CN1A 2JFEX 1E55A 4J27A 1BGAA 1CBGA 4PMZA 1NWUA 1DTUA 3WELA 1CGTA 2J7GA 3ARSA 4P7NA 2VTFA 3AIEA 1F4HA 4LPCA 2EXOA 1LL7A 3VIGA 1V6VA 1XH2A 4JCMA 1E6RA 1FH8A 2CIPA 1L0PA 1CXHA 5EFFA 2WLYA 1HN1A 2W91A 4M82A 1E4NA 5CJ5A 3QGVA 3SCRA 5A1AA 2ZXAA 2DT3A 1E6NA 4TOQA 1CNVA 1XV8A 3WEZA 5A8OA 4D6EA 2C7FA 3VILA 1W3HA 1ISZA 3DX0A 1TCMA 4L4OA 2WW5A 3MI6A 2VOTA 3B9AA 1V03A 1UQZA 3WEMA 3VX1A 5E1QA 3N9KA 2WANA 3WH6A 1E3XA 1B30A 1CXKA 1KTCA 3W29A 4HU8A 1KB3A 2PBGA 3ZJKA 2A3EA 1GCYA 2XHYA 2E4TA 2J74A 3WN6A 1US2A 1PZ3A 3DYMA 4V28A 2VX6A 4DUWA 3N15A 1E6XM 3W24A 1E43A 1KXTA 3DC0A 3NJ3A 2F8QA 3CZSA 1HJXA 2DSUA 1ZBKA 3RM4A 4N0RA 2Y5EA 2O9RA 3GXTA 1G01A 4JL1A 2EAEA 1R33A 1QWUA 2J7CA 4HA4A 2XGBA 2BVDA 1R85A 5D9PA 3DX1A 2CESA 2VRQA 1TQVA 4CN6A 1G94A 4J3WA 1PX8A 3VD7A 1RH9A 4NSBA 1JAEA 1KBBA 3L4YA 3ZR6A 2YBTA 4PMOA 3WBAA 4FNTA 2W4XA 1UWSA 2EBNA 2JEQA 1B3XA 3L4XA 1O6IA 1CXLA 4GQRA 4LYRA 1EO7A 3MKKA 1U33A 1KGUA 4IPNB 1CGVA 2JF6A 3OZPA 1W9BM 2FDMA 5FD0A 1HF6A 1JD9A 5ECUA 1UWQA 3HN3A 3VIPA 3FAWA 3IJ9A 1PBGA 3GDBA 4L4PA 1ISXA 8A3HA 3A24A 4Y7EA 2CXGA 3CUFA 3EJUA 1DWIM 1AQMA 4OZOA 4UFHA 2FYVA 4EKJA 1C8XA 1H0GA 1OSEA 2Q8XA 1MFVA 4B3KA 4PBGA 4WSJA 1QHZA 3PZGA 1CDGA 1EO5A 3SUWA 3ARZA 4H7VA 1DWJM 5CLTA 1YQ2A 4J7RA 3WNNA 2YA0A 3LPOA 1TG7A 1UKQA 3VGHA 2Y24A 2ZX9A 4CCDA 3T09A 3VSUA 1GOMA 3WH8A 4JFVA 4W8BA 1GUVA 4YHEA 1JAKA 4KRTA 2CBJA 3EJQA 4OOUA 1DWGM 4FLQA 3W37A 1GZJA 3N11A 4R5EA 2YL8A 1MQPA 2X2JA 1HX0A 2WCGA 1UD5A 3KE0A 4TVDA 2F1AA 2BVYA 3D5HA 5C71A 1M7XA 2FHBA 1J0HA 3UG3A 4ZXLA 3CZNA 2ZX7A 1E5NA 4EANA 4ACZA 3LRLA 1V3KA 4PTVA 3CHEA 2WAGA 2VR5A 1VAHA 4AZCA 1VBRA 1BYCA 4ACYA 1JYWA 4BQ2A 3VSVA 1R8LA 4MNLA 2WK2A 3PZVA 5M5DA 2VCBA 1UR9A 4H2CA 2BV9A 2D23A 3THCA 3WDIA 3GXNA 2XFFA 4UOZA 3QR3A 3CGTA 3CC1A 3WY4A 1KCLA 4DWSD 2DT2A 4XX6A 2VX5A 1OBAA 2WMKA 2G4FA 3MSGA 1DEDA 2WMHA 1E70M 3A6OA 4TTUA 3RCNA 2EPLX 4DUXA 4M8UA 1E6QM 1V3JA 3PTMA 5A95A 2OYLA 2VMFA 1J10A 3K46A 1UR1A 3DX3A 2W5FA 4AD4A 2WMIB 2VZVA 1ODZA 2XN2A 2C8NA 3CZKA 3HMCA 4DWSC 1UOKA 3TTQA 1KBKA 3GNOA 1VJZA 5CSYA 1HJQA 5M03A 4OJYA 5HBFA 4M56A 3W6MA 3WD4A 5I5RA 3WKZA 1HVQA 3MU7A 3SCNA 7A3HA 2VL4A 3ZJ6A 1MXGA 4UQAA 2YL5A 5HDRA 4MJ4A 1VEOA 2OW6A 5HXMA 2TAAA 3H53A 3EDJA 2ZX8A 2J25A 1I1XA 2V3DA 3WMSA 3A5VA 2XFRA 2YKKA 3PZUA 5FL0A 2VX7A 3AOFA 3IANA 2ZWYA 1GW1A 5EBAA 4W87A 1HXJA 4B9ZA 1H11A 4GZEA 4H41A 3GNRA 2CITA 1XCWA 1VBUA 1UUQA 2YL6A 3ECQA 3VGGA 1WDSA 2ALWA 4AZBA 3MUIA 1E40A 4JFWA 1EIBA 1WAWA 3ZQ9A 1UD4A 4XV0A 4H04A 2ZWZA 1VEMA 5LYRA 1KGWA 1OWQA 1ZBCA 2ZUVA 1L8NA 1H5VA
chains in the Genus database with same CATH superfamily
2XC8A 2R1YB 4OV9A 2ADJA 2VXVL 4AT6A 4HCRH 1V7MH 1DCEA 2XTSA 4JN2B 5BRZA 3LI1A 3M88A 5TDOB 4XCYB 4XWOC 3KEHA 2WLJA 4RXFA 2OLDA 3TPKA 4B97A 3ZLHA 1E0WA 3GXDA 2VC2B 3UTQB 4BSVB 5LBVA 2FGZA 2WBJB 1GKOA 1TYJA 2CJUH 4FERA 3FK4A 2BDQA 4JHBA 1AIFB 4YHPA 3EDFA 2QSCL 4NCC1 2IDQA 2ZT9C 4QR7A 4MSSA 4JZJB 4PJ5E 1RAMA 4R4FL 3MYPA 3KJ4B 4AGNA 3UGRA 4HZ8A 3S3BB 1MCQA 3M1BA 1YY8A 2D3VA 2ZTKA 2ZNWA 1A6WL 5DLML 5AVTB 1EEPA 3TN6A 1KFGA 3T6ZA 4A3QA 2EF9A 4X98A 1TIWA 3CZLA 4PPTA 3DROA 1XIMA 4WJEA 1QSFE 1FWAC 4FQXA 2DWEB 2D03L 4ONHB 1SU5A 1UHVA 2IPFA 2IQTA 5TE6L 2OWWA 5E56A 4EP8C 4Z2LA 2Y7NA 2J8HA 4X99B 1SYVA 3GHRA 2FO4B 5JHLL 5TK2A 4I85A 2V5JA 4F80A 1JNHA 1SHMA 3QJRB 3RKPA 2I9TB 5ICXA 3WFBH 2OT1A 3H2OA 5J13B 1KYOJ 4KXZH 3REVB 2DWYA 2PFHA 3ENLA 2VR3A 5G4WA 3P8JA 5FO7B 1BZOA 4QHNA 4IU2A 3WUGA 3N40P 3QJVB 1KXQE 1I3GL 2B5IB 4P5SA 3A23A 3TO4B 4F7CA 1O60A 2BMBA 1I1CA 2G75B 4ORGB 2RFXA 4XVTL 3RBSA 3WMPA 1B0WA 4X6DB 1I1RA 1FFPA 1LK3H 1MLCB 4IU3B 2E6AA 2G4EA 3A4DA 3JWNG 1AXSA 5EU3A 2BBFA 2PDNA 4JFZH 1J11A 3NGJA 2IQ9L 5DMGC 1AY1H 4GW5A 1O12A 2YL9A 5HDBE 1DQLL 5FV2A 4M5ZH 5IESL 3VNZA 2O55A 1QNPA 3MRDA 2P3EA 2DKSA 4C8XA 4W7UA 2XIJA 2DTML 4KTGA 3QA3B 3FSVA 2D8KA 3M0HA 2L7QA 5FDWB 1OP5K 3OLGA 4YL4A 5L9DL 4NNAA 1K5NB 4LHQB 3NQ6A 1L9RA 1XF5B 5D1ZA 1PDYA 1WDQA 3V6ZA 1F4AA 1RK0B 3JV0A 4JRXE 4K94L 4WSGA 1QBAA 5HDBB 3FS2A 2YLLA 3P5ZA 2BP8A 1CU4L 2EG8A 3V95A 4DM1A 1D7BA 4ZUWB 2QQ6A 4ODHH 2IFGA 3BW9B 4ZOEA 3NN8B 1KCXA 3DPBB 4A2HA 5D32A 4X9BA 5CC3A 4WJ5A 1WJ3A 4L3EA 3C2AL 3EJCA 4WU5B 4IP4A 4JTCA 1A25A 1A53A 1W32A 4LP5A 3BLBA 2F58L 3D7PA 4KKAD 4U3SA 3X11B 5DWUL 1BPLB 2F74B 3WUEA 2R15A 5JA8B 3BZFB 2YC1B 3WQEA 3U4BL 1Q6QA 2QGEA 3FK3A 3DPDA 1OOWA 4RGOL 3KDOA 3QFJD 3QUGA 3RX9A 1CB2A 4RLDA 3W2DL 2A74C 4UI2A 4JFDE 5D7IB 4WV1C 4J3SA 3U1QA 1IYXA 1EYWA 1OEPA 4O2EB 4XNMB 4ZTXA 5GGRB 5SWSA 4QRRA 2UY3A 4NAEA 4RDYA 5DZPA 4C55A 4WU7B 3IBOA 3LPFA 4GFTB 5FUZL 3SDAB 3ARUA 1QSFB 1E28A 4LLQA 3EFDL 4WEEA 1ZANH 2QTVA 1YE4A 4FFYH 2V0AA 1EBPA 1P6BA 2WLIA 3BHBA 3E49A 2PMQA 2RFGA 1MI5D 2AJZB 3N1AA 2ANUA 4WCYL 2O61B 1MJUH 5GHWL 5IVZA 3VB9A 3GSOA 3WS3B 1PD6A 5GZOD 1OHZA 1W56A 3IUHA 2D24A 4AB4A 1QHOA 3UACA 5AOUA 2HT2D 1E5UI 3QFDA 1ZLUK 1B2YA 4DZ8B 1XQKA 2B7PA 1E0UA 5EU4A 3GIYA 2AQSA 4MHHG 4XO5A 1MJJA 4IIHA 3UNTA 3D9AL 2DWDA 1X5AA 2KZ1B 2SODB 1SM3L 1UA3A 3DRTA 1EJUC 1XZ0A 2WZIA 2NY4C 4XD6A 1UZ6E 2WXHA 1SNRA 3DOHA 2A3BA 1K4DA 1GC1H 3TO4D 1GW6A 1QNZL 1WYIA 2OJPA 4G6CA 3G04A 4JFEA 4OF6A 2MQCA 5D72H 3PNRB 2P5WB 1CD1A 4OLWH 2C9AA 3BP4A 3TCSA 2FT8A 2HRWA 3CLWA 1XH0A 3XINA 3P0YH 3ITVA 2APTA 4F2FA 3P11L 1E9ZB 5FHBL 2OMNA 5LNWA 2R39A 4QHKI 1XIFA 2JB6B 3W0WE 2H9AA 3NXFA 4V1XA 4PUUA 4ERSH 4NERA 1S7SB 1J01A 3VIHA 4FFZH 2WYHA 4FXLA 3S4SG 1KCRL 3EH1A 1W5QA 1XD0A 2YWYA 1OG6A 3R8RA 1DN2A 1CIUA 2WLIB 3WCYA 4RA3A 2PLJA 4IU3A 1I3UA 1DQTA 3EBVA 1H6UA 3QR1A 1PTAA 3FQ1A 5LIUX 4PS8A 2FZ3A 4R4NC 5FYJU 3L67A 3UY7A 3D50A 5JH2A 3NM1A 3CFCH 1YUHA 4A4AA 3GXPA 1L9MA 4A67A 4ZEPA 5C0JB 3J07A 2DI8A 2HLFC 3RWDA 1B3VA 1REQB 4JTIA 1NDGA 4PMFA 2F54E 4RGOH 3MP3A 5INCA 1NM4A 2OL3B 4KI5F 3SCUA 4A3HA 1A5FH 5E2UH 1ZEAH 2E74C 3D25A 3V0AC 3A9IA 1QZNA 1KG0A 2HLAB 2W9LA 4U1KB 3O8XC 4O2CB 5F8RC 4Q7BA 4NPYB 1X97A 2WO5A 3FULA 5EZJA 5HGAB 2YXGA 3EJRA 3ARDB 2NZ9D 1WKFA 1V5JA 2WQUA 5L0QB 4GUQA 4L6DA 2V7HA 2G41A 1ES0B 3L3KB 2X0HA 3TH3T 3O6DA 1A0QH 1ZGLM 5FF7A 2DQCH 5HJXA 1V7NL 4AJVA 1ZANL 4C1KA 1KRAC 2GSGB 2V17L 3HR5B 1J0YA 2W0KA 3SB3A 1NOAA 2H45A 3BPCB 3MS8A 1EP1A 1E9YB 4I7VA 1ACYH 3AS0A 3C2OA 4KUZH 2EDJA 2VQTA 1BWVA 2N59A 2HZGA 3QUZC 4PUNA 1OFPA 3SCOA 3UWVA 4Y1AA 3KYMB 5AC8A 5HHPB 4CVXA 3T40A 5B7YA 2Z34A 1XF5A 2OM5A 4MRCA 5D70L 4RDWA 5DD6B 1OVZA 4KK5D 2Y72A 3UH8A 3BC9A 3G6JA 2JCCE 2Q5BA 4PIRF 5BS0A 5KZMA 3VB8A 2ICWA 3I50L 2Z25A 1YUHB 4I0PC 3WTUA 2FECI 2ZUWA 3CQQA 5A40E 2DZPA 3VFLA 3MCLL 2G2RB 3EYOB 2BVOA 2YPKA 5HBBA 5LKNA 5IT2H 1J6OA 4UWMA 3CHDA 3QEHA 4U2ZA 5J6GA 3DKHA 4JNZA 5JW4Q 3W7PA 4XP6H 4AMWA 5D7JD 1FNEA 2CBUA 1BXXA 1G5AA 3LZFL 4NZ4A 3U5YA 1UIPA 2H32H 3Q2CA 2HLAA 3L3JB 1BAWA 3Q0HA 1Q2RA 5C9XA 4UUJB 4N2FA 3P11H 3LIZH 2TRHA 4PVNA 1FNSL 1OCRB 1XB3A 3OLIA 4ETQB 1VCVA 1ZAJA 3QZAA 1H6TA 2BO0A 1JWUB 1NSNH 2VABA 2IV9A 4JDVB 4GY4A 3SBWC 2IOMA 3OAUH 1ZLWH 5J6HB 3GG1A 1YEJL 1JBJA 4XAFA 4JDZA 1LUCA 2EPKX 3QEQB 1H0DA 4I9JA 2Q87A 3KG5A 3DX2A 4P2CG 4YK4C 1IMHC 4NKOA 2W27A 3UG5A 4LLQB 3AWEA 4U6XB 5EA9A 1GGBL 2TSBA 1TTPA 2WHJA 4QTGA 2CKNA 4JO5A 1FGNL 1NPUA 3Q8BA 4PTUA 5I71B 1A5AA 4KKZA 1EC7A 4QRPD 3GSXA 4N20A 2WBKA 1T7XA 4OLZL 3G6JB 4QEEA 1FH7A 4ODUA 4B5VA 1I9IH 3BAEH 1NLDL 1IAOA 4M48L 4MVBD 5C0AE 3V0JA 2Z31D 4O8AA 3PP7A 2CD0A 3FAXA 5IMMA 2EVJA 4Y2WA 2JCCF 1WGVA 1RZJL 2Y7MA 4V2BA 3QC6X 3OHXA 5KJ7E 1NP0A 5FA4A 5DJ6A 2ZVIA 4GJTB 1FNEB 3KCJA 3W2KA 2PTWA 4G1KA 3IPBA 2J4WL 3MFFA 1OGBA 2O4MA 1AMYA 1W72H 1AAJA 4MBOA 5DJZA 4OV5A 3N6JA 4GVHA 1ROCA 1WC7B 4JHZA 2WGNB 3VGAB 2FZ3B 4PGLA 2UZPA 5JIWA 1LEKB 1PKNA 3CBKB 1WDAA 4BXSV 5I0VA 4D0BB 5HD8C 4JJHA 4CMMB 3WUFA 4F8XA 1OFOA 2G9HA 2R23A 2HVBA 3VZZA 2NDGA 3LKQB 3FONA 1AIZA 3BO8B 3DX4A 3L3OB 1GTHA 4BV1A 3KBJA 5FSEC 2YBVA 3WIFB 3S0CA 3BH4A 3EHBD 4DW2H 5I5MA 3CVIL 1XVSA 1TSHA 2DJUA 3FTWA 4U1NB 1IO4C 2G60L 4M00A 3LKNA 4LY4A 4ZMGA 1Z9SA 1MRAA 4Y1SA 2ATPB 2FL5A 32C2A 4F7PA 4AHQA 1NEZG 3PV6B 1IGJB 4P2RD 1JOIA 5E6IB 4F27A 4V1YA 2P5EB 2ZCLL 3DHPA 3HZVB 5KN5A 1L7IH 1MSSA 1LJYA 2AI0H 2OTUB 4JN1H 2A77L 4ZUUB 3IJYA 4HJSA 2QADD 4YFDB 3RWDB 1VBHA 3TYBA 3S6OA 4PB9L 2OV0A 3ELQA 3HLAB 1OD9A 3CMOL 5F7FA 5AZUA 4AD1A 4L8CA 1O94A 1W1B1 5T9CE 3U79A 1AH4A 3H8NA 4YE4L 2FO1A 1EUNA 4PJBB 2DMCA 1XUZA 1MCDA 2XIQA 4WIQA 2VLLB 3HE6A 4CNPA 3L3DA 3IXTB 4AIZB 1AHWA 4NBZB 5ABEA 1KYDA 3SBPA 3AMLA 1NGQH 5DD0L 5INDB 5IROD 2WJZA 1EGJH 4HWUA 4JREC 2V3EA 3ISRA 2YSSB 4ODVL 3QXDA 1U5VA 2P1YA 3C5XA 4WI2A 1HCZA 2G95A 1A22B 1M71A 4Q0XH 4TO8A 9XIMA 1H3TA 3DG6A 2NT0A 3MGOA 2DWDB 4M6ML 4XPAL 3KMDA 3L3JA 2WVSA 4CC1A 3TS8A 4KDTC 4WI0B 1BZ8A 1CL7L 3GI8H 3IDYC 1ITXA 4JFDD 2JBMA 1QWKA 1QWNA 2CXEA 3FF8A 3QQ3A 1MZHA 1W15A 4NO0B 5SV3A 1EXHA 1QOXA 5CUSH 2FJFB 3UCDA 3GKWL 3WQDA 2C14A 3CN3A 2J4WH 1SEBB 4PJDA 5E5MB 1CW2A 1EJRC 3SUVA 4QHLB 4XKYA 1BZDA 1A9VA 1KPVA 1YLVA 2GAZA 5DEZA 3VIMA 4WCYH 4GY0A 2VFHA 3O6FB 2EVHA 3AIQA 3ZMRA 3LAFA 3ILDA 4PW9A 4GCXA 4B91A 5HGBB 2V69A 4FABL 3MJ7A 5BZWB 4A2GA 2BGNE 1EQPA 5FCSH 3EX4A 3W76A 2AQQA 2GFTA 1DIDA 3EYFA 1ECZA 4D9RE 4B0MM 3H4WA 1CMOA 2BVQA 4NKIL 1VERA 2EICA 2FWSA 1PBYA 4NT6B 1CN4A 3GC3A 3O4LD 5AVUB 3HF3A 4JTGA 1ME7A 1EEZB 2AQRA 5F1OB 1XKJA 5IMMB 3H70A 2PWFA 3L2NA 3RIFK 1DL7H 4ZR8A 5INCB 2HWZH 1EMTL 2CNCA 2A4ZA 4YGAB 5L6YL 4BS0A 2KUTA 2EE0A 3D0LA 3ZKXB 4RZBA 1KG0B 2IFFH 4NZ1A 4KKBD 1Z44A 1JF1B 5EG6C 3NQCA 4HUMB 5DJZB 5EEZA 1K3IA 4OV5B 1XEUA 1Y07A 4KK6D 4H3DA 3BZGA 1NDZA 3WIAA 2OP4H 4ZXOA 3RXZA 1G9ML 2DIEA 3TOPA 4GKSA 4P04A 3OF6D 4KVCL 3HN5A 5K9JL 3ULVC 3RI5K 1J5HA 4P9HC 2EDLA 4X3ZA 4O02H 2GIYA 3I9PA 4MS8D 4H6RA 3NSNA 4PB0L 1XWYA 4C4UA 5D8WA 4AEIL 1FVCB 3MA9H 4OSUH 3TTSA 5JHDE 1DN0B 2UWFA 4OGQC 4PUEA 4S3AA 3NVQA 4JEGB 2IAND 1BLNB 4XBEH 5D38A 5CILH 3RUGA 4D8PB 1MCOL 4WNSA 2Q6WA 1VRXA 2WAQA 1OQOA 4X6DE 2ROYA 3IJSB 2NQHA 5D03A 4FQLH 4TF4A 4N9OB 3U0PA 3QUXB 4QR6A 2PXYA 2J47A 3P7YA 4AKPA 5AECA 1TRDA 3QK0A 2LHAA 2Z28A 2GJ6E 2WWMC 1V0LA 2XFGB 2BVOB 2RR3A 3MLWH 3BG3A 2BRQA 2WUBH 4PRWA 4L05A 4X5QA 3RPKA 2GK1A 5ENWA 4EKXA 2XN9D 1FYTE 1L4IA 1IB5A 4JB9H 3LS4H 2LFEA 3VJ6B 4PJ8B 1RZGB 2QKIC 2PTDA 3Q58A 4BQ5A 1YEDA 2WKJA 4S1RH 4DZAA 3GI9H 1A9BA 3DCPA 2R9RA 3STCA 4KX9A 4K8EA 5DRXB 2ATPA 2K4AA 32C2B 3GH4A 4P8WA 4MQ7A 3FOMB 3SKMA 2PLCA 4CNOA 3MRIA 4JE0A 3UXKA 3WQOA 5D2XA 1MQKL 2GDUA 3CUIA 3RRQA 5IBTL 4JQIH 4TQPA 4QJ5B 5L88L 4PJ7F 2DD8L 2ZYRA 5C8BB 1BZ9B 5EC1B 2EYSA 2CHRA 2ISWA 5IJKA 1TPB1 1GK8A 1A7OH 4NAMA 1NGPH 3CH9A 3PBMA 2IBZY 2ZCZA 1E5ZA 1UZ8B 3ECBB 1FGVL 1MCFA 4H8WH 2CLMA 4U6VL 3MU3A 3PBVA 3U4AA 1UKSA 2HJLA 1WZ1H 5A8NA 1Z5LB 2LVEA 3R79A 4E4PA 2I9LB 3FQRB 3KAAA 2NTFA 4MNQB 2JI2A 4KITB 4APQA 2I07A 1WAEA 1YNKH 4Y5XA 1VJSA 5C7VA 2VERN 3MDUA 1I7RA 2R0KH 1YPFA 4NHVA 1GKPA 4QOKB 1RZ8A 3K8KA 2GAZB 4OLVL 1CBVH 4C6MA 4HS8L 5EC2A 5KVFE 4WRHA 1S6NA 3BPOC 1Y0LB 5BZWA 3WBYA 4ZGYA 5K2ZA 1UXWA 4O02L 3TW7A 1AI1L 2ERJB 3VJ6A 4DK5A 3D33A 4UMSA 1NCWL 2D3JA 3WNPA 5G2WA 3W22A 2OMAA 3MXWL 5EBLA 3VO0A 2VAAB 1AYRA 4DJFA 3CU2A 5FF4A 2G3MA 4WWKA 1Q6GA 3LDBC 4TUOA 5FYLE 5T8IA 5E2VH 1IC4H 3GB7B 3SPHA 1P7KA 4IKJA 2J9YA 1LO0L 3VVVA 4IOIB 3QB7C 5KW9L 5C0JA 5D8JL 3MA7B 2V3FA 4ML4A 3WK2A 3ARYA 4FXJA 3FTYA 1I4FA 4JCWA 5EU7C 3QNZA 4PJXB 4D9LH 4EN3B 5KJRH 4ZAKA 1TR1A 3UABA 2DZWA 3NJFA 1YEGL 3MUJA 1LLZA 4XMWA 3F5JA 4Y88A 1J9SA 3ZQWA 4KEMA 1MWAH 2ZDSA 4O16A 3CFEA 5ILTL 1JUFA 4M4RB 3U9PH 1AQHA 2C71A 3VXTB 3R11A 4DI8A 5ALCH 1KJVA 4K5LA 1BF2A 4TLUA 3Q9QA 4KNQA 1C8YA 1T1XA 4P8VA 1NMBL 1FHGA 1UXLA 2X1XR 4L29A 1UBSA 1WK0A 4GNKB 5JW4N 4BZ1A 4DZ8A 1RJRA 1E6SM 1R0MA 5B22A 1RA0A 2XSBA 4GYPC 3R58A 2RQ8A 1A4MA 1E4KC 2R9HC 2ZYSA 3NEOA 2R14A 3RUGB 5AW9B 1KNWA 1W9UA 1ADSA 1V05A 1Q38A 3OZ9H 4Y9EA 5JHLA 1A49A 3BXWA 1XSKA 1UR4A 2DYRB 3FUMA 4J2PA 2WXRA 5IK3B 5IBXA 1EV2E 3RLVA 4M7SA 5GQBA 1A2YA 1E7VA 4IGBD 3IM1A 3DG7A 2IH1A 3QZWB 4PI2A 4N0FA 4PMYA 4O58L 2WNNA 3PZNA 3SDCA 3W9EA 3MRHA 5D2YA 3W4RA 1XYZA 3QRHA 4QD2E 4BF7A 5JMRA 2VSMB 1NEUA 4ZDHB 5DHDA 1GT8A 4F20A 3WGVB 3SYQA 1XF4A 4IRSA 1VBJA 2G3XA 1NMAH 4XX1G 1A80A 3GSNB 1HSBB 4OJDH 1SW0A 4L9LC 4AD2A 3MRIB 5H1WA 2Z65C 3QIUB 4H88H 3FCTB 5E94A 1NPNA 3VD4A 5T9BG 4JZJA 4QOKE 3GZQA 1ZLVK 1NC2D 4JM2D 4Q8TA 1SPDA 2VUYA 3L2LA 2YX0A 4MFDA 4NP4H 4L65A 4X2PA 2BIOA 3BW9A 1BLIA 3EUDA 2XQYG 1Q94B 2XU9A 3P4OA 3I7SA 5D96C 1YY8B 1RXLA 2R1YA 1QNOA 2Y6SC 2YXFA 2Z1WA 3C0SA 4X6BB 2DM3A 3GMLA 1IBBA 3COTA 4LGSB 1EF3A 4RBPH 1T22A 3BN9D 3CYVA 5EZOH 3CVHA 5J1AA 4AKOA 2BOCA 1HH9B 3VX0A 3BZFA 3UL4A 4YHYC 1I9CB 5KSAC 3NO5A 3BIBX 5L0QC 3CJPA 5CZSA 3B8SA 1W9DM 3W73A 1VZGA 3SDDA 3GB6A 2FEEI 3O6AA 3KLKA 1A4CA 4ZXBB 1GGTA 4TUJA 5HA7A 3AZUA 5BYWA 1HT6A 1DJGA 5FJPA 4HUVA 5E9DB 3QEQD 4P2QB 3BWUC 5K9KB 3E1F1 2A0LD 3SDCB 1KLUA 5E6YA 4FG0A 4BRVA 4CC4A 1A9EA 4WK9A 2NY1D 4FQXD 3V2AR 2QCGA 2ITFA 2MH4A 3VYLA 4JHOA 2Q7YB 5B3NA 3H0TB 5ECGA 4A38A 1ONQA 2V2TA 1P0KA 4MNGE 5D1ZD 2C34A 1R3IL 5H37H 3S3CB 2W38A 2XIBA 3JTSB 4GSQA 5DK2A 3IMSA 4LCQA 2EKJA 1AXSB 4KI5C 5EU3B 5CBEB 1VFHA 3JR2A 5J1SC 3C2VA 1PU0A 1OLLA 3AACA 3F85A 5IBXC 2AQPA 5I17B 3EJSA 2ESVA 3OZ9L 4IISA 4AY7A 3ZHKA 4XUGA 4M1CC 1D8WA 4J35A 1TPDA 4OFVA 2PPEA 4RISL 3U7YH 5L2KB 4K2UL 4HDIB 4ELDA 2J27A 5BVPH 4ESKA 5EZLB 5E51A 4U3CA 3QP3A 3UP1A 1TTFA 2BS9A 1CGUA 4XP4L 5K9QG 1FBIH 1SVCP 4OZ4A 1QVBA 1QO5A 4APXB 5MEOB 3MRRA 1RV8A 2PTTB 1JZHA 3K2MC 4WY0B 4KOBA 3SGUA 3ILPA 4JQ3A 1HDMB 5JIKA 4FXGB 2A6LA 3ZFHA 4A2RA 4EI6A 3B4NA 3CH0A 3RWHB 4OBTA 4DBDA 1D9KC 2VFDA 2HP4A 4N8VB 4Y5YA 4KU1A 4F0SA 1FIGH 1NELA 4YK4B 1R5WB 1UP3A 1WAAF 1X6NA 4U05A 1UZHA 4QNEA 4U5KA 2ATSA 3VE0A 3WDHA 3HFTA 2Z4TA 2G8ZA 4B90A 2APWA 2D7TL 2VKXA 3FFDB 3P4LA 3OYXA 3C60C 3KXFA 4UOW1 3SY8A 3GD1C 3H3PH 3RGVA 1QABA 2C7UA 4CQCA 3AXHA 3T5WA 5KSAA 3BT2H 2E7LA 3R5EA 4LEQA 5EL1A 4G80A 3EZJB 5EZOL 3IE4A 3J7HA 2IH1B 4K23L 1FE8L 1IZCA 2HXTA 1DQDL 2EYSB 1BVKA 2BFVL 4FQLL 4K94C 4WJ5B 1WBHA 3UGEA 5JUVA 5AKQA 3NSDA 4NPKA 5IW6A 2VEFA 4UTBH 3EMCA 2Q01A 3MWAA 1Z3GL 4H2HA 1SW3A 4DJDD 3VGDA 3VFCA 5LCVL 4XBJA 3BKYH 3MV7B 2YAFA 2ICWJ 3U2CA 4PY8J 1W6WA 3PWPA 4GMEA 4WI0A 4MNQA 4OB5H 4P9MH 3PULA 3DI2B 3PUOA 5BOPA 4XQ6A 3NFPA 4GH1A 5GSRA 4Y4KC 1CGYA 2WBJC 2CKRA 4NT0A 4UXDA 3WQVA 2Q1EA 2UVFA 3O45B 3V0WH 3CMGA 2OX5B 3GI9L 3FB5B 4KQ4H 3FVDA 5E1GA 3MSDA 2F68X 1G6RB 2GITA 4H9VA 3QUZD 3W0WD 1Z0MA 5I8KH 3FT2B 1F8IA 3W71A 1OADA 4ZMYA 4NF7A 3L4ZA 4AISA 3FN9A 4CLMA 1XSIA 2CCRA 4XO4A 3CC5A 3MMWA 4K3ZA 3SKNB 4JQIL 4LARL 1YYML 4K7PL 4QXGL 1ASQA 1I75A 4UNTA 1M7OA 3VAVA 2YKLH 4Q9QL 1IR2A 3L9RA 2BHZA 4GAJL 4OKDA 4W9KC 2CDGA 3AT0A 3QFJE 5E6IA 4QXIA 2IUZA 3N5AA 2QELA 2JF7A 4P9HH 1LE9B 3DSFH 1FIEA 4PG9B 5A2LH 4WKFA 3MO1A 3IFLL 3IJ8A 4TQIA 3G1XA 5LNDA 4BI7A 4H2AA 2A9CA 4BDVB 4OIIH 3OQEA 4G56A 4IMGA 6TIMA 3CVDA 3U30B 1MSPA 3FNKA 3S4SA 4G5AA 2GUBA 4MHHI 3RZCC 1JZ7A 3DESA 3GSWA 4R4ND 1JGDA 5IEHA 4HKJB 2ZWSA 4JFYB 5D5MF 1BHGA 1MCHA 3P0WA 3BFOA 5GSRB 3BG9A 2HLFD 3OVPA 1E6ZA 1PLCA 2EJAA 3BVNA 4CQ9A 4BFNA 4CSZA 3R8HA 4YJZL 3TJXA 3NQMA 2W0UA 5DZJA 3MXVH 2XBDA 3VD3A 1KFEA 2JIWA 4LC8A 2OMYB 4Z2KA 3P3RA 4G7YL 6FABH 1FCQA 1E65A 3DVFA 4EUPA 2ZRWA 1LO0H 3TF7C 1LLWA 4LGXA 2D4FA 1ZJAA 3NP4A 1JHTA 1FE8H 2XV2A 4R90H 4X6EA 3NL3A 2WBJA 3H2NA 4OQVA 3SFWA 2QYGA 4WEBH 3CXDL 4AITA 2G0WA 1U3YA 4RMTA 4LF3A 1G7IA 5IUSA 4NM4H 1JUEA 2ENYA 3QJTB 4XXDA 5AYXA 4PMEA 3W1NA 1EOKA 3QQWA 1G9EA 2NY0C 1RJCA 4NNPH 5EWIL 4D8AA 2Q02A 4XR8C 4HAFA 2FQDA 3QGKC 4PRPE 4F93B 3GJEA 1KELH 2AJXL 2F53E 4TSCH 1J93A 1TZGL 1MFCH 2FLIA 4EE9A 3D25B 3MLXL 3L1OL 2NDFA 4IJTA 1F3RB 4MXQC 4UQDA 5D7JA 2P49B 2QJNA 2OYMA 4JLRB 2HJPA 3O4LE 3RGVC 3MRRB 1FRBA 2AFNA 1TQUA 1VFOA 3UZ5A 4Y4FB 1KRMA 2X7LB 5A8MA 5DWPA 2P80D 3COOA 3N04A 3WNLA 1E4XH 2X41A 4IDJL 3GFXA 3VOJA 4WV1B 1TPWA 5I28A 3EGXA 3MCNA 4B9IA 4Y19D 5EMLA 1PDZA 1TQXA 3FQ4A 1B54A 5IFHL 5A3HA 2BY0A 3HBGA 3GTVA 1TUXA 4X9SA 4AWTA 5H2BB 3EBHA 3ARFB 4AGPA 4KRPC 1GWJA 3DSFL 4XVJL 3JV6B 4YHLL 3ZMEA 3VFPA 5L8JB 3OP2A 1KC7A 2R6OA 1Z9SB 4PP1C 5C0BE 2VR9A 2QW5A 2RDWA 3STGA 2VABB 1K4GA 1A7NH 1QO2A 4H9ZA 3OXRB 1BEYH 4LCVA 4DGIH 1VACA 4H26B 4NN6B 5CG7A 4RGMC 1O68A 3FTGB 5MHBA 5CP7A 2F6XA 2IBBA 2WNWA 5IRPA 1DSYA 2WN2A 2DLHA 3QUYD 5CLXA 5LBSA 5J0BA 1G84A 3M0JA 5J06A 2B2XL 2EAWA 5FHAH 3C8FA 3C5SB 3W28A 5I1LB 2XWDA 4DBUA 2P53A 5FIPA 1MHPH 4A3YA 4NP4L 3SJVA 2J7BA 4EXBA 2QDVA 1JZIA 1C7SA 1MREL 4D8PA 2YZ5A 2ZZ6A 3N85H 1FHLA 1TZHB 1YO4A 1AXIB 5J57B 1JVNA 2ACQA 2EPOA 4PGCB 1XRFA 3WF0A 2TODA 4TULL 2L0DA 4XPBL 5IW3A 3UC0H 4JM4H 2JKPA 3BOVA 5FLUA 3ZS4A 1ICSA 1P4IH 4MNJA 2GT9A 4YLQT 4FX7A 3VIIA 1EP3A 4ZD3L 2PKDA 1KOAA 1JFXA 3ZWTA 1HI6B 3TYAA 4P99A 4A6GA 3UAAA 5BUAA 5FAGA 5K59E 3R0DA 5EZJB 4F4RA 3BVXA 1KWKA 3LBOA 3TN5A 4HHWA 1H7RA 4PTUB 1UACH 2YQ2A 4YDVA 4AJWA 1HAWA 1GA2A 4U49A 2BHYA 5JMOC 2CUAA 3EWYA 1H4PA 1UKPA 1R1CA 1KIPB 1NWRA 4N2MA 4OVVA 1JUKA 2A6JB 2LU3A 3MGAA 4I5BA 4K4KA 3V52H 5BMFH 4JN6A 5I6KA 3OC8A 5T33H 4YQXL 4WDTA 1HHGA 4DQOH 3IU3B 3EO9H 4QE4A 1IEWA 3SPCA 3B0YA 2G3IA 3RKDC 3E2VA 3GR4A 1L7TL 2Z9TA 3VXRE 3QQ4B 1USQA 4U6TA 4PB0H 2ICEA 4X6EB 5I1CL 3T2PA 3C2AH 4PN2A 3NSXA 1GOIA 3F7PC 1R9FA 3WJMB 2B20A 5IJDC 3AXLB 4NWUL 5HI3C 3IIPA 3OKOB 1AQKH 4O02A 4XIAA 1FAIL 4GW5B 3QW3A 3ES6A 3D0VA 4FJ6A 1XCTA 3O4OB 1I7RB 3OF6A 4FQ1L 4HJ0C 4JX4A 4P2QE 2AV7A 4JY6B 2GQ9A 2WJ5A 5BUPA 2R0LL 3QEHB 5HNRA 1Q63A 5CJBA 1NFDE 3M0KA 1FG2A 4HKZB 1GJPA 3I6GA 1BJ8A 3LTSA 5GJTH 1JPHA 2RH9A 3SJVD 1K5NA 4MTMA 4MDIB 1BYPA 4DGWC 2GGIA 2E7MA 4H0GA 3SSJA 1QPXA 1QXLA 1K4DB 1ORSB 4U6YA 3F5WB 3T77A 1X4XA 4QY8B 4ZPVA 4W9EC 3ZTEA 3REQB 1JPSH 3DOSA 3OR6B 4JFTA 4ZFFB 4H6EA 4H1LA 5I5IA 4J5NA 3CHXA 2WSKA 1KA9F 1DUYB 1X9UA 4GKOA 4YL9A 4IMKC 3S2JA 1ECEA 4PEEA 3HS9A 3OSVA 1HESA 5D5MA 4PRHA 1OF6A 3VUSA 2ITCA 5D2NA 1RPQA 3IGFA 4MMXC 3M0XA 2F7OA 4PJEF 1C08A 1TQWA 1S7SA 3C6SA 5B38A 3P8IA 1UD3A 4GYFA 4GUGA 1NGXA 2BRRL 1UKTA 2KS0A 1NWPA 2FPYA 4CILA 2GC7C 3LPPA 4UM8B 3UC0L 1UPPA 3W7GA 4RK8A 5CO1A 4ZAKB 2P47B 5KVDL 1KCVH 3HMXL 5EO1B 3OPZL 4K73A 3IF1B 4PRAB 2ZCHL 1V3HA 3YPIA 1HKFA 4FFZA 4M61A 3R7RA 4MOZA 4M4RA 4ZTEA 3X1FA 3LERA 3FA3A 3VACA 3H2EA 4MNQD 1XH3A 4WO4B 1UCWA 1S3HA 2FZ8A 1GC1L 2KKQA 1Q6OA 3M0MA 4FB7A 2VM4A 15C8L 4HFUL 1XSJA 4L3EE 2MNWA 2OJ1A 1K9DA 2HKFL 3R0UA 4PSPA 5K9KA 4N2OA 4E9WA 4AZ5A 2QQQA 1LQSR 5CN2A 43CAB 3WDPP 1HNGA 4JAMB 4TQHA 4G43B 4HPHA 3MI2A 4IMCA 4JN8A 4PMRA 3WD2A 2CLRB 3CPLA 3B7YA 3N40F 4XCYA 3HG3A 4OCLC 3C0LA 1G7LA 4HSHA 2IWKA 4GRWH 1FSKB 5I8KL 4I7ZC 2WLMA 1CBVL 3EJYD 5I07A 1Q0XH 2HTLC 4CL7A 1X7SA 1F3DH 3G1DA 4K1GA 2Z31B 1SXNA 3F7VB 4OV4A 3U1PA 5CZXC 2ISSA 2Z1BA 4WHYG 3UBXI 2H90A 5HHMB 4X8GA 2EPMX 1BX2A 2YD2A 3ULUE 4F2EA 5KOMC 2AZAA 2V5MA 4OFYA 5I15L 1AHWC 1U1HA 4M7TA 1NGZB 2BGQA 1XT5A 1FUYA 2J7DA 1EJFA 3FB8B 3QHFL 5SWQA 2V0TA 1N4XH 1NBVL 3EWBX 3AJ7A 5CLWA 1GQNA 3S35X 2OMWA 3WBEA 3GSNA 4IM8A 5FJOA 4M5SA 3SDDC 1NUDA 3BDYH 3QWRA 4OZ4B 5E03A 5I1IH 1DWAM 1ME8A 1XF0A 1J5DA 2XICA 1HNYA 3C52A 3AMCA 1BVWA 2DW6A 2NPLX 2AXWA 4NQXB 2FMNA 4MPKA 3PK7A 1IBHA 4ZSOA 5HANA 3IMRA 1RSYA 3HV9A 3SPVB 3I6TA 4O2FB 2QT6A 3HR6A 4DWDA 3JWOC 3M9YA 1HZLA 2OX4A 4AV5A 3DX7A 2CNYA 5G4NA 5C8JB 4FLRA 4PRID 2W0FA 2B9BA 3KBPA 3B2UD 3QUXA 3U83A 4L7ZA 4XZMX 1XCTB 1Q9OB 3QXDB 5ACLA 5FO9A 3SHSA 2WP3O 3LQLA 1MHHA 2ZXQA 3A4WA 1H0IA 5FS5A 1X5GA 2UBPC 1P1VA 1JXJA 4OGZA 2F5BL 3QEQE 1FG2B 4HKZA 3V0VA 2YDRA 2ODOA 1BBDH 4JTFA 3LVEA 4OLYL 1S78C 6ALDA 2IMNA 2OJEB 3HA1A 2D3NA 4WFHD 3MZGB 3P5YA 4J9JA 5AVSB 2Y7EA 3AG2B 3GSRA 5IBUB 1IWPA 3G1RA 2CK2A 1REIA 2Z7GA 3CL8A 3JV6A 4FG6D 1CR9H 3UCQA 2W67A 1EERB 3C8HA 4E41D 5JOPD 3EJZD 2QVNA 3PWPB 4MYAA 2EJ1A 3T07A 1AZCA 4S3DA 2YAHA 4BWLC 4ECLA 5FUOH 2EVIA 4LB4A 1LP9E 5IOPB 1EFXA 2H41A 2HN7A 4OQTH 1OY0A 2G5WA 4WUIA 5D2LB 2EC8A 2VI0A 2G9KA 1JCTA 4UZUA 3QZWG 3AHXA 3FCUB 2D0FA 4BD4A 1NFDA 1WOBA 3QLLA 4LAUA 4K9JA 4N28A 4YHNA 1AQDB 1VFBB 1GYMA 3MCMA 3SPVA 1I8MA 4JPGA 2XWJA 2PU0A 1G6CA 3JUYA 3MFFB 3H2AA 4Z3EA 1ZB5A 3KYOA 1NOFA 3N3EA 4XP5H 2VJXA 2R91A 1NIDA 3HCVA 2DQGH 4P4KB 5IHZA 1VKXB 1HTYA 1KMGA 3FQRA 1GS6X 1YE6A 4YBLC 3K72A 2NQZA 3AGWA 3NFSH 1XEDA 1CJYA 1EEZA 1ZK5A 2E8ZA 3K6DA 4G3YH 4IJBA 2CKBH 3WIIL 2R2EA 5HHVH 4BFFA 2ZRVA 1OZQA 4GQBA 3P82A 5F89B 4PQXA 3QXBA 1BG9A 4BK5C 4H5SA 1W72B 5KSVB 1H09A 3MC0A 3LCYA 1XLDA 3DRQA 4ZS6D 2B15A 1OFAA 1TR9A 4YZWA 2IV8A 1HQRB 2QGBA 4K7VA 4RNRB 5LXGL 2HPOA 3C60B 4UC5A 4MASA 4IRSB 3UYIA 1QUPA 2NY2D 2WKOF 5DX7A 3UY8A 5AYQA 3ESUF 1BGXH 3ZTJG 3KXFB 4AQEB 3K6SB 3N17A 1U8JA 2VFGA 5KG9A 4C83B 1EC9A 2OTDA 5IF0B 3ONCA 3PWNA 5J6HA 4RR4A 2JALA 5E4OA 1CT5A 5BQ7B 1BQLH 2VLKD 4ODWB 1FVEB 3D69A 1TJGH 4HCGA 3UXLA 4U0QB 1GCFA 2Y88A 2QUMA 3HPLA 5IHLB 4LVNC 4QBXA 4ZMNA 1E8ZA 1ZE3H 4XNYL 1LD9A 1D3CA 2VGBA 4L61A 2PWGA 4D94A 5G4HC 5FUCE 1I3RB 1JGIA 1P4IL 1CIDA 2QGDA 4JFFD 3ZKXC 5ITBL 1TJ2A 5CSZB 3T4AC 2KAUC 4HBCL 3KHDA 2BY3A 3FSAA 3FBKA 4EI5C 3OKOA 4O02B 1M9SA 1E5YA 5DGRA 3ULSA 1M7DA 3ZYZA 1V6XA 1JJUA 4LU5H 3WEXA 3FO2B 3QXVA 3KOXA 4JIQA 4JTLA 1DPMA 1CR9L 5IM51 4S3FA 4F79A 3AROA 2B1AL 2QL1A 3BE1H 3O11B 3GSQA 5E5RB 1FNHA 2VNCA 4POYA 4WF7A 1XRVA 3G6MA 3NZGA 3SUTA 4UTHA 1UA7A 2QF8A 1OD7A 4OCSH 3BRGC 3OJ2C 3VE9A 3MX0B 4JFXB 4DPRA 1MLBB 2QLYA 3A3YB 4KI5D 1WXJA 3ZN6A 3BWUF 4K3HA 4GJ1A 4KAQL 4P8QA 2PP0A 4TMCA 2XWCA 3KOYA 3QYQA 4IPJA 1XX1A 5SWZD 2L3BA 1GEQA 3HGRA 3W3OA 2DBLH 4HMDA 1ZBWA 5JLZB 3MHUA 4NJAL 4G8GD 2C3XA 4N2HA 1FAKT 1TLKA 1DBKL 3TAOA 4GUFA 4ES4A 4ZFZA 4ZQKA 1FVEA 3D69B 1V27A 2BVWA 5F2LA 2BHUA 4R2GC 1LL6A 3VFUA 2GBVA 1BWKA 2YW4A 2ZOUA 5DMMA 1NGQL 4ATTA 3H7RA 3MCKB 3GYCA 4H9XA 1YMMB 2F9BT 5C09A 4DT2A 1OCQA 2PDFA 5HHVL 1Z5HA 2FJGA 5GGTL 2YCIX 5ESQB 4B9KC 3GLAA 3KRZA 4NYUA 3FJ6A 3EMQA 1J8VA 3IF1A 5LUMA 2OLSA 4KROC 1AJ2A 3OGCA 1JXGA 1L9OA 1T1YB 4BWUA 5KN5B 4Y5XB 2OCCB 1T03H 1JPFB 1TV3A 3LDVA 2EACA 2QPEB 4BWLA 1WCBB 3IK4A 4D8OA 4EZLA 1N8FA 4RBPK 2DDQH 3E2SA 3OODA 5IB3A 5LNGA 1UZ1A 4GG6E 1EFZA 3LJ3A 1NWTA 3A4AA 3NK3A 3PRZA 4IQHA 4O2EA 4Q2ZA 5CP3A 4ZMQA 4FOJA 5TQLA 2IKIA 1S9XB 3ZUNC 4BZ1H 1QW8A 3A6BH 3HTLX 4URIA 3LH9A 2NUTB 3IDGA 5CCKL 3EMZA 4EUPB 5LWYL 2LW3A 1BQLL 3I02B 3RHGA 3B43A 3B9KB 1DUZB 3BSZL 4GRWE 1UWXH 2ZP0T 3EFFA 3BW3A 2PCPA 3ZJ8A 2VN7A 1QLRA 1PS9A 4QX4A 3IIZA 3TK7A 2X70B 3UAFA 3VFTB 2Z6IA 5EY5A 4AEOA 2W60A 2YARA 3D3VB 3IE9A 3OX8A 4FHBD 3F7KA 4LLVB 2P9RA 4YBQD 4I2XA 1HILA 4QXGH 4QRPE 4GGBA 2J71A 1TEYA 1IC5H 3V4VH 5IWLA 3OGSA 1U8IA 2DN7A 3CVBA 4PCNA 2NXYD 3L1FA 1BOYA 4WX2A 1W3KA 2VVSA 3TYZA 1OCJA 2Q3AA 1GZHA 1ZHKB 5I2IA 2HFGH 1T99A 2CBVA 1I4FB 2ZQKA 3HPFA 4N2LA 3RAJL 2Y6TE 3OW1A 5E8PA 2X4OA 1I31A 3AT8A 4XZ9A 3QMSA 1A3ZA 1FLRL 5CBEA 3LM3A 4AY1A 3L2MA 2MANA 3VD2A 2YLHA 3IMTA 1LMKA 1HIML 5DMKB 4NQXA 3MHZA 3B06A 4NQ1A 3O6FD 3IS0X 5EZIH 4Z7NE 3RRXA 1F45A 3HFFA 1F3WA 3EOLA 2F8OA 1KFAH 5C09D 2GUOA 1RCYA 2GI0A 4JO4H 5DEJA 2PP1A 1IM9B 3EWXA 1HL8A 2NW3A 3LZNA 2Y2TA 1VFMA 1DIEA 1DBKH 5E1AA 4R83A 2GIMA 4W8LA 2ZZ4A 3DX7B 1GVEA 3S2AA 1TMHA 2CLLA 1JEZA 4XBPA 1JRBA 3V8OA 1Z2KA 4IT1A 1MHCA 5TTRA 1A4BA 3MZTA 4PJDE 1HYSC 3FO2A 3GMOA 3I2CL 5CILL 4HHPA 3RO8A 3EOAA 1EEYA 4GLRH 1KNOB 5LLIC 2EG7A 2X42A 3BAXA 3KNBB 4I2XB 2H26A 2SEBA 1RCOB 1MQ8A 2DQDL 4NC2B 1J5OL 4LVBA 2Y9RT 1MNUL 2CAKA 3D47A 1W1IE 1L6ZA 2R0ZH 4JMNA 2OL3A 1UASA 1UZ8A 3BL3A 2CA3A 3CHPA 3CBJB 1J0ZA 1N2RB 1EXPA 2MKLC 1NAL1 1ACXA 3MLZH 4NAQA 3TH2T 4AW7A 1EWEA 1VD6A 2M1KA 4IEFB 3W6LA 1NBCA 4O0KA 5G4OA 2REQB 3PV7A 1EEUA 2XRAH 3FCTA 3AHYA 3IDXH 3DXAA 4I77L 3RVXC 3W39B 5H4ZA 5HPOA 1ZVHA 3WLOA 5BOEA 1J2BA 3FYPA 4LFYA 1HINH 3PB2A 4PTMA 4ZB2A 1HWGB 3WBDA 1L6PA 4LALA 5DJ8A 3NPXA 5FEZA 2VIRA 3A4XA 3OLDA 4HSOA 2QADC 2JEPA 2ATKA 4HYTB 4LHJB 4RCAA 3PF3A 3VTTA 5IFTA 5GGUA 2CZVA 5F7KC 1RD5A 5ES4B 2OXHB 1RAKA 1E9PB 4XAKD 1RHCA 3GYEA 1MFUA 2GSMB 5TQ2L 5I3FA 1BBDL 2IC2A 1S7RB 3CZEA 3PAUA 4XBGA 5J3HC 3H4GA 5DFVC 1BVNT 4ELMB 3L65A 2YSTA 1A3RH 1U8CB 5EU6E 1KJ2H 3ZDXB 2ZUSA 1DBBH 5IQ9B 1UWXK 2SFPA 5F89A 3GMOB 3UW6A 4XN5A 1AQFA 4EUPG 3PCYA 4ZFZB 5CHNB 1RURL 5I79A 1P5VB 1MI5B 1XH3B 1EDHA 4WO4A 4GSDL 2HTMA 3IJIA 2GQHA 2OJZL 3B56A 4KWVA 3N06B 4LOUD 3LGDA 3N42B 2ZAIA 5AB0A 4GEJA 4CCCA 2QVFB 3RNQB 2EUZA 3IV3A 1IQDB 5DZNA 1AKPA 1PJ9A 1F1GA 4KKLD 5JIPA 5F1NB 2Y5JA 4PV1C 3UZQB 5MP6H 2UY4A 2XVGA 3BWAA 3JWDL 4XN9A 1XLAA 4RESB 3PQYB 2VMEA 4J6IA 2AITA 2CLVB 3FN0L 3INOA 4RIRB 1EGZA 3CIVA 3VABA 2JXMB 4BI6A 1PLGL 2XBZA 1A1MB 1IZKA 3NQFA 4MX7A 4OCYL 2Z35A 3V3WA 3VRIA 3GBEA 4DNHA 4ZFCA 4GAYA 4NS0A 1TJXA 1WZLA 2PTXA 1ZLEA 2EH7H 1QSFD 3IXAA 1RLWA 4YO0A 3WQGA 4UMAA 4RFNC 3V5KA 5EUOF 5EO9B 1DJSA 3G1SA 2OSXA 3DETD 2XFXA 4DERA 1L2UA 3W56A 2VKZG 4GY7A 3PQYE 4PJCF 1S5TA 4NEHB 4K8RL 2ZICA 3EFFB 5C0BA 2XZCL 1KB5H 2Z6JA 3GVWA 1H7XA 2CDGB 2P5PA 4PLKC 3CFTA 4GUJA 1DQLH 2CM5A 2W0LA 4H20L 1YEFH 4QXWA 2X4SA 2EDRA 5TDPA 1SFJA 3QZMA 4JMXA 3G3LA 3RWFB 3GAYA 5EEUA 2WC7A 1LCOA 2NY3C 2P50A 1O5XA 2DTMH 1U8IB 2EEBA 3ABMB 3BPCA 5CNHA 4HGKC 1P7HL 2AJSL 3LTYA 2VZ3A 3PNUA 3FDWA 4XZHA 3MODL 5I30H 1XDMA 1TUPA 4D6JA 3I3DA 5JVLA 1Z3RA 3BI9X 2JELH 1TTGA 1VHPA 1IEXA 4QDMA 3H2MA 4FTDA 4UTWC 4XPTL 3BK0A 2ZOLB 1P4LB 4XVOA 2BVQB 5CCZA 3SBWA 1DZ0A 4AM0A 2FPTA 3V4PA 2PDPA 1MRDL 3GSOB 2GDQA 2ZJSL 2CWNA 1JNLL 2F61A 2H3XC 3EX2A 3WN5A 2AK4D 5TQ2H 3VTRA 3GO1H 2QHLA 4B95C 2EGZA 2VXTH 1MW0A 4L3ED 4MKTA 2HE5A 3E2QA 4R3UA 2NSOA 3H55A 1SMAA 1W1YA 3QA3A 3MJ9H 5F7MC 3B7UX 1YNLH 4M1DL 5BROA 1I1FB 5A94A 1CLYH 3DA0A 3G5VA 1YTEA 4K68A 1JD7A 4LKCB 4UM9D 3ERXA 1QQDB 5CZRA 4GXPA 3MYJA 3TTEA 1WISA 1OF8A 3EYQC 2KYIA 1Y18A 3CUHA 3CU1A 2BOEX 1I8LA 1DJIA 5FOBB 3CB3A 4H9YA 3MY9A 5GGSA 5TF1L 2GBUA 5LB1A 4KAQH 4ZO9A 1V02A 4MADA 3NN8A 3UC2A 1NMAL 4ES9A 1QVOA 2QCFA 4BH8A 5ETUA 1TTCA 4X80L 5C0RH 2XXMB 4ACPA 5SV4A 1OLZA 1P53A 1LWHA 2JLLA 1M68A 4RX0A 1JGVH 2Y07H 2HFEA 4PJBA 4CGUB 2PTYA 1UWYA 5MKGA 2CFFA 2UZIH 1V55B 4O17A 5D1QA 3PNZA 2YOAA 1Y6KR 3EAUA 4LV4A 3V5CA 4B3ZA 4F9LC 4IIBA 2VLMD 3APGA 5DXXA 4QHPA 1HKLH 3P2TA 4LANA 2AJYH 2J8UB 4MA8L 4Y0GA 3THDA 1GJUA 4Z8FH 1ET5A 3PXJA 4O0QA 5DY3A 4M1GH 2UV8G 3UA3A 2X7VA 1BQSA 3D9AH 1T40A 2WUCL 1E9OA 3INUH 2BOFX 4K71C 3UXIA 4WXZA 4DWSB 3FU7A 4UILL 4GI8A 4UQBA 1BRLB 4AC7C 1M1BA 3N44F 1SJVA 3OKNB 1GGIL 4H8VA 1CGWA 3C5QA 2EDNA 3LCWA 3IGAA 3VDBA 2ETWA 1QA9A 1IKNA 1N0XL 1SXBA 2AEQH 4C56A 1KZQA 1K1DA 5E8NA 2HXUA 3VXME 3L23A 4X4ZA 3CUXA 3P4OB 4US6A 4A2FA 3WFCH 3QNYB 4PGEB 1R3IH 4PRHE 2QJIA 2M26A 4HK5A 2MQ3A 5BVJA 2NXHA 2OMXA 1C12A 1ZT7B 4PM1A 4QHNB 2D1ZA 3B9OA 3B5GA 3K2GA 3BSHA 4KDTA 4QDPA 3QEGH 2PD9A 1LEIB 1VKFA 1QSFA 5AG9A 2NV9A 4W85A 4MS6A 3V9EA 4BJHA 1MW3A 2POZA 5JIMA 1KGXA 3V4VL 3LV5A 1UMLA 3HG5A 4I5XA 4Z7QE 3FCSB 3U30C 2B0SH 5HR7A 1JRHL 4MJ6B 4L0ZA 4FXKA 4OGYL 3MDJA 4MZRA 1ESWA 3SOBL 3P3BA 3H3BC 1KIPA 4Z18A 3DJRA 4K5PA 5GRYA 4WFED 1F2XK 3UR2A 4NAJA 5I7GA 1HVXA 2HX7A 3UP8A 1RHFA 3AG3B 4UT9L 3B2VL 5AHNA 4ZFGH 3HE6C 1I60A 4S0TD 3ZR5A 4WUKL 3WJXA 2AEIT 3AREC 3DJSA 3I85A 3F2LA 3FPXA 3MLYH 2XFXB 4PRNA 3SCVA 4JNMA 3RMEA 4OD1L 1MLBA 4KXAA 1WZAA 4W7VA 5DQJA 2VN6A 2VO8A 1UWEL 4CCZA 4LPUA 4KY2A 1A0QL 3KPMB 2Z31A 2CBQA 4NXKA 4H40A 5E8NB 3CB8A 3KYNA 2IADA 1D7KA 5DMJB 4NKQB 4RRPA 1FZOB 1UWGL 3BDXA 3O81A 4FI8A 5DJXB 4QP0A 4GY1A 3UYOD 4Z77B 2BTMA 4NQVA 4LSBA 3L1EA 5LVEA 3MUGB 4JOMA 4CD4A 3HUJE 4W7WA 4K23H 4NNBA 3N55A 3R4DA 3E2RA 4KH2A 2XGIA 1DANU 4M1GL 2VC6A 4FF9A 4JFPB 1CQKA 5DUPL 1LP9B 2QQKL 3AXLA 4PCKA 4CJ0A 4XTRD 2NX3A 4JIIX 2W9MA 5T5NG 3MLZL 1M9WA 5T1LA 3TA3B 1TVNA 2OQLA 2VDKH 1J1PH 4ZK8A 2QV5A 5DCEA 4KKBC 2HRHA 2I9UA 2D7OA 3QW4B 5EMKA 1YAIA 2CO6A 2VQ4A 4DQAA 1IC1A 5AYZA 4JEQA 3I6GB 4P3CL 5HDWA 1E8YA 2Q71A 2OFQA 2APFA 5E4EB 1H6FA 3LB0A 5EPDA 3RY6A 3BHBB 4Z7WB 4Z0SA 2I5QA 4HCIA 3AXKA 4YN5A 3AZSA 1QP1A 5ACZA 4LLAA 1LDCA 3RPIA 3WS3A 1MY7A 4G7VL 2YXMA 2VO5A 3VA6A 3DHDA 4L5FL 3W1ZA 1MAKA 2WWNA 4PY8I 4JZJC 3FJTA 2BNRD 4ZPTA 1G9HA 4CVUA 5IB2B 4CMMA 4NN6C 4MQSB 7TAAA 2XWXA 1GHFH 1AG6A 3VGBA 3QZWA 1LORA 4ODXB 3MRPA 1OCBA 3NZHH 1HP5A 1QPNA 4I18A 3T0EA 1SZNA 3QS3A 5JA9A 3DKJA 3FV9A 1ONRA 4OF3A 2AXHA 4PJIE 3SJVE 2OYPA 3UYPA 2FK9A 2UVEA 1IEHA 1WRFA 1ID2A 3LV6A 3THAA 4CD8A 4FNLH 4IBZA 4AVJA 1K6WA 4EZKA 3TH4T 3C6CA 1G4TA 3GTFA 4K8RC 2DB8A 2HRPL 1KPUB 4M48H 3KDNA 1YEKL 2NY2C 4J27A 2EDWA 4PJ9B 3N0PB 1UWFA 1YQVH 3DMMC 3I75A 1NWUA 1U8QB 2EO9A 3FQUB 2J73A 4OD1H 4ZG1A 3WELA 5I66A 2CO1A 3QO1A 5C08D 1QYGH 2NUPB 4IMFA 1CGTA 3MTWA 4O28A 1GOFA 4R85A 5DUJA 3HG1A 5LO7A 2DZEA 4YHNB 1ZGLA 5F9JB 4Y8FA 5DRCA 3SBFA 3GNPA 2R29L 4ZL1A 3W9DB 3FSUA 3UJRA 3TO4C 1LL7A 4OCYH 2K78A 2K6YA 5DEFB 3IDIA 3M5XA 1O0VA 1XH2A 2AV1B 5E1AB 4F7MB 5SWZA 1E6RA 2BVUA 2OKOA 3CXFA 2LT9A 4N87A 4O4YH 1CXHA 1NC2B 3GJFB 1HOCA 4JM2B 5EFFA 3HKZA 4C56B 4PUMA 1NF7A 2BMKA 4GFSA 1MHCB 2I60H 4FL4B 1THFD 5CJ5A 3NT0A 4X9FA 3LKSA 4HIXL 5F7WC 4ELMF 3OBEA 4WWKD 2YAOA 3T2LA 3VU1A 5A1AA 1EEYB 5MENE 2ZXAA 4K7FA 1TQBC 3F83A 1KSRA 4D6EA 4XPFH 2Q86B 2Q09A 1SHSA 1N59A 5ENWB 1IAII 3MQTA 4NM4L 5LG6A 3S3JA 4BKTC 4FJZA 1MJ7L 2VDKL 4PR5B 3B9KC 5IHHA 4LAMA 2V2TB 4XNDA 1CZ8L 4L4OA 2ZCLH 3EO0A 1V03A 4MQ7B 3SKMB 1WTGT 1JDFA 5E1QA 1NSJA 5I1EL 4PIBA 1JNJA 3C56A 3AWFA 2QEJA 4KKQA 3ABOA 2OMBA 3VNMA 5B1JA 1CX9A 2Z92B 2X1RA 4O15A 2PW2A 2KZBA 3FYIB 4N8UA 3ECUA 5C54A 1KB3A 1HZHH 2NY5C 2ACUA 4Y8DC 2OQJB 2IH9A 4HVBA 2HT3C 1UUSA 3II3A 3D39A 4XTDA 2FMOA 1T7ZA 5DVNA 4WVXA 4IDJH 4Z3JA 4HSNA 3NOYA 1AKJA 1FWFC 1TX0A 1ESOA 1EXGA 1AQ8A 5DT7A 1US2A 1PZ3A 1Z5LA 1Z42A 4KQNA 4NQCD 1MCKA 3NQDA 4H9TA 3E9UA 2WNGA 5AVRB 5BS0B 2A6IB 4M7ZC 1XTMA 4YDKL 2GIXA 4R96A 4DUWA 1DJZA 4LIQE 5GS0C 2VX6A 3N15A 4JTEA 1R3JB 1VGKB 4L8BA 2NV2A 2XX1A 2X1SA 3W24A 4R7VA 1KGCD 4FNLL 4WQOA 2QQNL 5DJXA 4J3BA 2BIPA 2Y36L 2D31B 3ET9F 3OMNB 4FJYA 1FC1A 1KFJA 4Z76B 3APDA 1CFMA 2D7QA 3CNYA 3KRSA 3WLRA 1B4RA 2XGBA 2DTSA 1PKOA 2XYBA 3H9SB 3D85B 4M5YH 5DYFA 2CK0L 5JQ6H 5D9PA 4P2YA 1EHKB 1CDIA 3SW6A