1DHKA

Structure of porcine pancreatic alpha-amylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PORCINE PANCREATIC ALPHA-AMYLASE
publication title Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex.
pubmed doi rcsb
molecule tags Complex (hydrolase/inhibitor)
total genus 154
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dhkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dhkA01
4GI6A 3PZ9A 1G94A 2V3EA 3D5HA 3VTRA 3VMPA 2D23A 4NSBA 1PIFA 3M46A 1GCYA 2W62A 3WY3A 1V0MA 3S6TA 4CD4A 5A2CA 3BAIA 1J9YA 5BROA 2YFOA 3IJ7A 2J4GA 2PI6A 1NWRA 4D1IA 1XYZA 3ARYA 2VC9A 1KBKA 1R87A 1UA7A 3E1F1 1NWTA 3RIKA 3HU7A 4QLKA 3FAWA 1GNXA 2WZHA 4PTVA 4WLCA 1UA3A 4B3LA 5D4YA 1E73M 4GI9A 3BVXA 3CGTA 2D24A 3ZT5A 1KTCA 1DWIM 5ABFB 3VO0A 1ECEA 1G01A 3AIUA 3BCDA 2CITA 1ITXA 1CXLA 4W8BA 6A3HA 4J3XA 1VFFA 1VRXA 2WANA 1GVYA 4FNTA 3RM8A 4P8XA 4RE3A 3UG5A 2XN1A 3IK2A 3N17A 4UFKA 3VPLA 3UESA 3EJPA 1BYAA 1V3JA 1GOWA 1UR4A 2CPUA 5CLTA 1NH6A 2BXZA 2AAAA 3WF0A 3PBGA 1E6SM 5A2BA 2E9BA 4CD5A 2OYKA 1FFRA 2ZUMA 4CU6A 2BVYA 4J28A 2BHYA 3VMOA 1QNSA 2XTKA 3WD4A 2YFNA 1H49A 1U33A 1E3XA 5BXSA 4UCFA 1OINA 4TTUA 3CH9A 3B9DA 4X0NA 5C70A 4AEFA 1OGSA 4UQCA 3BMVA 2ZUNA 4AZIA 1V0LA 1NWSA 4W93A 3T09A 3W6MA 3WMBA 4U3AA 4B9ZA 1E6NA 2O9OA 1B2YA 1KTBA 1LG2A 1ZBCA 5IDIA 4DUXA 4J27A 1XSJA 2A3EA 1EO5A 3ZM8A 2Z1KA 4GI8A 2XHYA 1HKKA 1UD5A 1UUQA 1OD8A 3W53A 3GXNA 4FMVA 3AIWA 1BFNA 2DSWA 3ARUA 3AZTA 1QNRA 1W9VA 3GH5A 4UFHA 2X0HA 3VSUA 1EQCA 3AQUA 4CN6A 3VKKA 3CMGA 1GJWA 2C0HA 4W87A 3GXTA 3SUSA 3OZOA 2AMGA 4OZOA 2X0YA 1CIUA 1HN1A 3KLKA 1E70M 1JD7A 1C3FA 1E9LA 4W84A 2J7DA 1PAMA 4NZCA 3A22A 1OM0A 2XFRA 2WLYA 3MANA 1EIBA 5AYIA 2VRKA 3KL3A 3RJXA 3UR7A 2PBGA 2CHNA 3WUFA 4AYGA 4PMXA 4HP5A 4ML4A 2VCAA 4P7RA 1V3IA 3U57A 3AYSA 3WF1A 3L4WA 1HJSA 4CD6A 3NSXA 1VEMA 2VRQA 2YOCA 3UERA 1MXGA 3WH6A 4BF7A 1WO2A 3VUPA 1FH8A 5CLWA 4HPHA 1GPFA 1JXJA 4U5KA 4PMVA 1ISVA 1I1XA 1R34A 1OWQA 1KFWA 2IXVA 2GK1B 3SUUA 3GZAA 3OGVA 3WMSA 1UWRA 3VDHA 1HVQA 4XZBA 2WHMA 4D6GA 1J0JA 1SMAA 4QLLA 3WNOA 4M29A 4AY1A 4EE9A 3BVVA 1GOQA 5I24A 3D50A 2G3JA 3WDHA 1PJ9A 4XB3A 1E3ZA 5JIPA 4PYSA 2EO7A 2EABA 1PX8A 1WDSA 1PPIA 2WVVA 2ZUTA 2PWFA 2EPNA 5DF0A 2FHBA 3AOFA 5D9NA 2ZXBA 1GQIA 4AWEA 1PS3A 1C92A 4P7NA 1O7DC 4FNPA 3UETA 1NP2A 5A6SA 2WMIB 1XYFA 1FH7A 2DSUA 4H8HA 1V03A 1JFHA 3THDA 4TX8A 2V3FA 4UFMA 4TX6A 4M81A 1TVNA 2D20A 3PHAA 3HG4A 5A6BD 1W1PA 1BYBA 1H2JA 2F1BA 2EPOA 5E6ZA 6TAAA 1JZ5A 5A69A 2ZX6A 2CKRA 1G1YA 5C71A 4U2YA 1B0IA 2WHLA 2RGLA 3OLGA 4ZXOA 3BVWA 1VF8A 3NSMA 5ABGA 2X09A 2GVYA 3W38A 2ZUVA 4UFLA 5A8QA 1SFSA 3WY1A 1JZ2A 4EAMA 5BWFA 2WBGA 5TD4A 2Y8VA 2J7GA 4GKLA 3CMJA 2YL9A 3VGFA 3EJUA 4Z2IA 4F66A 4MNLA 3SCWA 4IM4A 1JYNA 1BAGA 2GJRA 2Y2WA 1E6ZA 2EADA 2GJXB 3PZMA 4B3KA 2YBUA 2BV9A 3ARVA 1E5NA 3EDEA 3WH9A 3WN6A 2F7OA 1VEOA 1EGZA 4E4PA 3L2MA 1X6NA 3BAXA 3BVUA 4D71A 4AMWA 5E1QA 3K1DA 4LPCA 2D1ZA 4JFWA 3F5JA 3W28A 2NSXA 4TVCA 3B9EA 1C8YA 3S5ZA 5LA1A 5BYWA 2WLZA 2F2HA 2QV4A 2YDRA 3LPGA 4M8UA 1XH2A 2WSPA 2CEQA 1U30A 1CENA 3AHYA 4QCEA 3L2LA 4LX4A 3LPOA 2WC3A 4ATLA 1JAKA 1C91A 4HMEA 1B3ZA 4Z2GA 3FXYA 3B9AA 2A3BA 3J7HA 4H41A 1CTNA 4BZYA 2JIWA 4BQ4A 4ZENA 2FH6A 2PWDA 2CIPA 3AIBA 4N0RA 3WQ4A 1XD1A 1EA9C 1M01A 1L0PA 5JIWA 4CCDA 1E4NA 1H3GA 4JZ5A 4D6DA 3LXAA 1UASA 4H8VA 3ZR5A 1BTCA 1LJYA 2VX7A 2VURA 5D8WA 1NOUA 3GNRA 3QOKA 4F9JA 1EHNA 4OIFA 2VX5A 2V5CA 1UWQA 1IZKA 1CWYA 4PMRA 3CIVA 5JBEA 2XG9A 1UKQA 4JFSA 1WZKA 4MB1A 2G3MA 1QX1A 2F8QA 4FNQA 3BH4A 5ABEA 3WQVA 3A6OA 3SCTA 3LPPA 1JGIA 3QHOA 1XSKA 1QNQA 2J77A 2WWDA 3WFLA 4B9YA 1HL8A 4UQBA 3AMKA 1QHZA 1PX4A 1JYVA 1H09A 4ACZA 4QAWA 1TVPA 4MB4A 1B3XA 1CXIA 4R27A 2WMJA 3UR8A 3BLKA 4D6HA 3MUIA 1EOKA 1JZ6A 2XFYA 5EB8A 1GQLA 2VOTA 1UHVA 3WH7A 2UY2A 1PZ2A 3CV5A 5JUVA 4UFJA 1HJUA 1MW0A 3AHZA 3VU2A 1B1YA 1KXTA 4FLSA 5FD0A 4D6JA 4BCEA 1BQCA 4PTMA 1FP8A 4JCMA 2J25A 1W3KA 1HL9A 3LMYA 3EYPA 1QI2A 1DWJM 4DO5A 3ARPA 3AROA 3K4AA 3DX1A 2BNJA 3WL1A 3TA9A 1OGBA 2WKGA 3D3AA 3S5YA 1PEZA 3VINA 4AEEA 2WK2A 2GFTA 1DWFM 2YDSA 2XM2A 1TQTA 2QMJA 3VD7A 2BFGA 3VIOA 1GOOA 4AZHA 2EPKX 2OYLA 4JCLA 4JKLA 4PCSA 1WDQA 4JIEA 3U5UA 4NI3A 3O2LA 3DX4A 4AD0A 1GQKA 4CKQA 5FOOA 2J62A 4AIOA 4AZGA 4PMDA 1VB9A 1MW1A 1DEDA 3KLLA 1EDGA 4PTWA 3BSHA 3AIEA 1J0HA 2ESCA 1W91A 3AIQA 4MAVA 1ZJAA 5FCZA 4AZCB 2WB5A 3AXIA 1XHGA 3SCQA 2FGZA 1M7XA 1UD6A 1B90A 2OW7A 1C8XA 3WL0A 3CHEA 2WMKA 3WKZA 1VJSA 1H11A 4B16A 3LX9A 2BY0A 1C90A 4W8LA 3OLDA 2VQUA 1C93A 4WKFA 2A3CA 4W85A 2WZEA 4UTFA 4M82A 5CJ5A 1KXVA 3TTSA 1FH9A 1JNEA 4GZEA 1GVIA 2ZE0A 2DPEA 3RM9A 1E0WA 3H53A 1TG7A 5AY7A 2DIJA 1KCLA 5A6AA 5AC4A 2EEXA 2F18A 3CUJA 1JFXA 1TFVA 4JL2A 3CHDA 3W37A 3ARZA 3KZSA 3CUHA 1W1YA 2G4FA 1JAEA 2ZUWA 4GIAA 4NZFA 5JBFA 4PSRA 2O92A 4E2OA 1BGGA 3AXHA 1X6LA 3VD5A 2EQDA 3F5KA 4HU8A 2YLLA 2WSKA 1L8NA 2WMFA 4TXEA 3ZSSA 4DO4A 2XSBA 4D1JA 1SMDA 1UD3A 3M7SA 4JL1A 4W7UA 1MW2A 3U7VA 3VIKA 3W29A 2DDXA 4DWSB 2J75A 3NSNA 1EQPA 3BC9A 3FAXA 5HOSA 3KEHA 3U7BA 1UH4A 4ZFMA 5CG0A 2WMHA 3MUZ1 3ZT6A 1V6UA 2D3LA 3GBDA 1EH9A 2YLAA 2AOSA 1US3A 2D22A 3ECQA 9CGTA 4X9YA 3CC1A 2W66A 3MKKA 3GDBA 4KH2A 1B30A 2ZXQA 3W6LA 2WVUA 1RP9A 2Y4SA 1R85A 3AS2A 1QHOA 2PWGA 1GOMA 4UQEA 3AMGA 3OB8A 1ZBKA 1E4LA 1XD0A 4ZEPA 5HNNA 1R7OA 3NCOA 5HDRA 4AIEA 1QNOA 2VZVA 3SURA 3BUPA 2FHFA 3SCPA 2VO5A 3VGHA 3W24A 5I5RA 2ZX7A 2YDQA 4OGZA 3CZNA 3GM8A 5ABHA 5CGMA 4CD7A 1NOWA 3TTQA 3GNPA 4ZXLA 3VIIA 3D4ZA 1PIGA 1NWUA 1Q6GA 3D52A 1J10A 2ZX9A 3ZOAA 2BY1A 2TAAA 3EMCA 3N04A 4AYSA 3IAPA 2G3IA 2CBJA 3ZSTA 3ARSA 2WYSA 2QMKA 2GDUA 2E8YA 5IFTA 3WUGA 3GTNA 1NOFA 4UQDA 3WF2A 2WCAA 3BCFA 1LLOA 4H7VA 1J0KA 2XWDA 3VM7A 3GH4A 3WQ5A 4U33A 2BVDA 4CUCA 3AIVA 4QCFA 1WZLA 5DT7A 2ZXDA 3PZUA 2QF8A 1D7FA 3WF3A 3WEZA 4J3VA 3VILA 3CUGA 3MSDA 3CZJA 5EBAA 2PF0A 3BMWA 3O9NA 3GXMA 3S2CA 2UY5A 5E09A 3MSGA 4ZE4A 3ZT7A 1SR0A 4V27A 2DT0A 3N15A 3CUIA 2JE8A 3QGVA 4JFVA 2XVLA 2FYVA 4J3UA 2NT0A 4CD8A 2X2HA 1E6PA 2ZICA 2BS9A 2VCCA 3L4VA 3VGBA 3L4TA 3HZ3A 3I3DA 4D6FA 1K9FA 4PCTA 4J7RA 4HOWA 1AMYA 3NYDA 3BAKA 1C7SA 2HVMA 3DHPA 4GQRA 4TOQA 3WEMA 5A8NA 1CLVA 2OSXA 4JHOA 5E0CA 2WC7A 4TTGA 4W86A 3FY1A 5I77A 1V3LA 5CSUA 3EDJA 3RJYA 1OGGA 3VX1A 1OIMA 4LYQA 4PBGA 5BRPA 2YL6A 1AQ0A 3N11A 3VVGA 3ARXA 1SYTA 5GQBA 4UZSA 4IUGA 1MFUA 1Q4NX 3K8KA 5DT5A 3EJSA 4UOJA 4MB3A 3VGDA 1UR2A 2WMIA 1B3YA 4W7VA 1HTYA 1VEPA 4P8VA 1BSIA 1CDGA 4MADA 3O6AA 2DEPA 2WC4A 3T0BA 1JIBA 3VIHA 1JZ3A 1ZB5A 1UG6A 4MNJA 4PMQA 1CNVA 2A3HA 3L4XA 2X8RA 5LA0A 5A6JA 3AI0A 2W61A 4KGJA 2YBTA 1O7AA 1AQHA 2XGBA 1FOBA 3WBEA 4OBSA 4UOZA 4UNIA 1GOIA 1D3CA 4HZ8A 2DH3A 2F61A 1VAHA 3WNNA 1OT2A 2OYMA 3AHVA 3VD4A 1XV8A 3DECA 3ALGA 3EDKA 1SZNA 1UD4A 4PMNA 1GJUA 3IJ9A 3MU7A 1LF1A 2VT0A 1QW8A 1UKOA 4DUVA 1UKPA 2DSKA 1KB3A 1M04A 3KL5A 1GORA 2F7RA 1EXPA 5EFDA 2WVVB 1E6QM 5DMYA 1BGAA 2GJXA 4WK9A 3IAQA 1MWOA 3RPMA 1US2A 3W0KA 1V3HA 3NDYA 4N42A 4TVUA 3AJ7A 1GHRA 4FLQA 5HXMA 4B15A 1WB0A 5D9MA 4C7DA 3N13A 3QHMA 5A95A 4X0VA 3HJEA 3AICA 1V3MA 1GUVA 1B31A 4URIA 3AISA 3D51A 1HXJA 2CHOA 3HG2A 5EMYA 5GPRA 5A8PA 3BLBA 1QNPA 4PTXA 2JEPA 1XRVA 5A94A 4Y7EA 1WNOA 2J7FA 3BXWA 3EBVA 1DWHM 4IPNB 7TAAA 5D8ZA 2CESA 3EDFA 4YN5A 2O9PA 4AZ6A 4EKJA 2E3ZA 1W3JA 3APGA 3DYPA 1TZ7A 3OG2A 1YQ2A 4HZ7A 2XVKA 3CUFA 1JF6A 1HKIA 1O6IA 3ZIZA 2QHAA 4H8UA 2W91A 2D2OA 3AYRA 3AS3A 3GYCA 1UZ4A 2YIHA 1MXDA 2YKKA 1F4HA 1R8LA 2OLHA 2XJ7A 3N18A 3W4RA 1B9ZA 4PMZA 4CU7A 3WD2A 3VIFA 2DSZA 3RM4A 2WNWA 3TONA 2VX6A 3QR3A 4F9DA 1W9UA 2FH8A 2PC8A 3ARTA 4XV0A 5BRQA 1JZ4A 1IV8A 3VDBA 2YJQA 4PRWA 2J7CA 1W3LA 3W25A 4DWSD 1WE5A 4CN4A 1PZ3A 2WVTA 2G8ZA 2OWXA 3VIJA 5D9OA 3UCQA 2JEQA 3U5YA 4JAWA 5BXRA 4MB5A 4MNKA 2XIBA 3SCNA 5A3HA 2WKLA 1LWJA 4S3KA 1H1NA 4DO6A 1KGXA 1E1EA 4MNMA 1IZJA 2CBUA 3BAWA 1DWGM 3II1A 5E6YA 1HNYA 1E40A 1A47A 2DIEA 2VMFA 2XUCA 1JYXA 2WBKA 3SCOA 3SCVA 3A21A 1KXQA 3LXBA 4AD2A 2X2IA 3IGUA 1MQPA 1UKTA 4U31A 3I3BA 1Z32X 3BUDA 4K68A 3GBEA 3BLPX 3SUWA 1ODUA 3GH7A 3FN9A 3LRMA 2UWFA 3OIHA 1RP8A 4BA0A 2B31A 4KMQA 1NM9A 1RPKA 2WZIA 5GNXA 2C8NA 2VTFA 2A3AA 2J47A 1CZ1A 5A6BA 5M5DA 1NARA 5E9AA 3HG3A 4WSKA 1RH9A 4CN1A 2CBVA 1TA3B 4AISA 1JYWA 3WQ6A 1AVAA 1JNDA 1UWTA 3UEQA 8CGTA 1GW1A 4A3HA 4P8UA 4CVUA 1UOKA 2GSJA 1CXKA 2NW0A 1E55A 5LA2A 1BLIA 2V3DA 3SIMA 1FHLA 3KL0A 3WNPA 1JD9A 1Q6CA 1I1WA 4TVDA 1MQQA 4PMUA 3L4UA 1V02A 4MDOA 5CQ1A 4AXNA 1K9DA 2D0GA 4YHEA 3I3EA 2F7QA 1HJQA 2XVGA 4ACZB 3WY2A 5EFFA 4D72A 4P7OA 2RGMA 4PSPA 3RILA 3PZGA 1FP9A 2YL8A 3A4AA 2XN0A 2J8GA 5GNZA 2Q8XA 1HJWA 2OW6A 3ZJ7A 2ZIDA 4W8AA 1TQVA 3CZ8A 2QPUA 2O9RA 3MUY1 4AZCA 5ECUA 6CGTA 2PWHA 1W9DM 3VGEA 1V0KA 2DH2A 2DT2A 5HBFA 2WCGA 2IXUA 1MYRA 1QW9A 5IHSA 3H55A 5D9PA 2CETA 2ZXAA 1JDDA 3FW6A 4UFIA 4R5EA 3L4ZA 2ZUSA 4UR9A 3UG4A 3ZJ8A 1EDTA 3D4YA 1V6YA 1V02E 3SCRA 1E4IA 3EMZA 3TP4A 1LQ0A 4YPJA 3WDIA 4MJ2A 4ACYA 1W9PA 2D73A 3AXXA 1QBBA 2VVSA 2W5FA 3HG5A 2V5DA 1CXEA 3GXDA 1ESWA 1ZU8A 4UQAA 3HMCA 2XPKA 1LWHA 3G6LA 3WENA 1OD0A 1KR0A 5M3WA 2WCSA 1CYGA 3AS1A 3BUBA 4CCEA 1WDPA 1C8QA 2J79A 4V28A 1CXFA 4NRSA 1J01A 3W82A 2XVNA 4FNUA 4EANA 1LG1A 2E4TA 4J3SA 3WELA 1FFQA 1NQ6A 1XCXA 2G41A 4HZ6A 4L4OA 3T2OA 2XYLA 3VGGA 4AZ7A 1BYCA 1NP0A 1W1TA 3WQ8A 2J78A 1HF6A 1UH2A 1KQYA 2QLYA 3SUVA 1ITCA 3BGAA 5ABFA 1TQWA 5CXPA 3TV8A 1HKMA 4GINA 4W5UA 4F79A 1HKJA 1HT6A 3BUIA 3PTQA 2VJXA 4PMYA 1QHPA 4AIUA 2VZSA 1D2KA 2VQTA 1G5AA 1YHTA 4OJYA 2CYGA 1BVZA 3G6MA 2CKSA 3WD1A 1DHKA 1R33A 3WY4A 1EOMA 1A3HA 4U5IA 2DGAA 1V6VA 4PUEA 3CO4A 2F7PA 5FIPA 2VCBA 1VFUA 1U2YA 2WHKA 1UR0A 2VNCA 1BPLB 3JUGA 1CGVA 1WZAA 4HPGA 4J3TA 3CHCA 1M53A 4M56A 3WDPP 4D6CA 3ZJ6A 5A6KA 1V0NA 1E15A 2ZWYA 2WVSA 2X1IA 1V6XA 2XGIA 4D6EA 3ALFA 3PZTA 2E9LA 3QHNA 1AQMA 5I79A 4PN2A 1BVNP 4WF7A 5A8OA 1DP0A 4UQ9A 2VL4A 3CZSA 3WNMA 3WNLA 3OZPA 3VIGA 2ZWZA 5A1AA 2VR4A 5CPSA 1BG4A 2VZOA 1V3KA 5E0FA 2EJ1A 1QWUA 4V2XA 1UKSA 1OT1A 3QOMA 2PB1A 2VX4A 3UG3A 4HU0A 1G0CA 5GNYA 1OB0A 2JF6A 1HIZA 3B8SA 1K9EA 3WH8A 4NRRA 1W2VA 1QI4A 5FL1A 3A4WA 2WXDM 4AZ5A 2W67A 5I3DA 2ZX8A 2E9MA 3CZGA 4OOUA 4AD3A 4WKAA 1MW3A 3RCNA 3POHA 2CXGA 2J8FA 3KE0A 3LXCA 3VMNA 2WHJA 1E56A 1UWIA 5HPCA 1R86A 2BHZA 4JFUA 2Y24A 2BVTA 2WMGA 1HX0A 2XSAA 2YA0A 1UQYA 1H41A 3AMLA 1P6WA 3WH5A 1E6RA 4KRTA 1KXHA 2EPMX 3PZVA 3CZLA 2W4XA 4MPKA 3EMQA 4Z2KA 1PBGA 2WW5A 1WAWA 4AC1X 1EHAA 1QPKA 1S46A 4M1RA 2XVPA 5AYBA 4YHGA 1HWWA 4HOXA 3M6DA 1Y7VA 4GQQA 1X1NA 3GNOA 5IHRA 2GK1A 1F4AA 1ISWA 3VD9A 3KWXA 4KWUA 1ZBVA 2D0HA 2C7FA 3VDAA 1CLXA 2IGTA 3CZEA 1HJXA 3MV01 3A23A 3VD3A 5A6LA 2JF7A 2ALWA 3PTKA 1MQRA 2YL5A 1OIFA 3LRLA 1UR8A 3N1AA 2DSVA 7CGTA 1Q6FA 1J11A 4NX0A 1VBRA 4E8CA 1W2PA 2VUYA 4XUYA 4NZJA 2WM0A 2X2JA 4ATDA 1GHSA 5BXPA 4LXFA 3WFZA 3MI6A 1GOKA 2EXOA 1K9TA 3POCA 1JDAA 4QFUA 4IISA 1E5JA 4AZBA 2VI0A 4GO9A 3WBAA 3NIYA 2XFFA 1HXKA 4GPNA 5BCAA 3BVTA 1E71M 4FNSA 1T0OA 1BF2A 3OA5A 4FK9A 4AD5A 1WDRA 3PZNA 1QI0A 5I0DA 1WZMA 3WEOA 4FF5A 4W5ZA 5FKYA 1JXKA 4W7WA 4DWSC 1R47A 4NXSA 3MUAA 4S3JA 4MDPA 5IXEA 2ZUUA 4C7GA 3IANA 1EO7A 2CCRA 2OWCA 4A3YA 1E72M 5CZKA 3WDRA 2DT1A 3HN3A 4HOZA 5KEZA 1CGWA 1Q6DA 4ATWA 4LGXA 4KRUA 1QI3A 2JIEA 4U2ZA 2ZOXA 4FNRA 3AMDA 4HA3A 3AIRA 3PTMA 3PZQA 4RE2A 2J7EA 4NF7A 3EJTA 4KGLA 4Z2LA 2VVNA 3NJ3A 3EJQA 4PMOA 1KWGA 5I23A 4Z2JA 2VR5A 1CGXA 2QPSA 1VIWA 3OBAA 3WDJA 4CGTA 1W3HA 5I6SA 1UD8A 3CTTA 1G9HA 1ODZA 1VFOA 1TE1A 5KZ6A 1XCWA 3CLWA 2DQXA 1Q6EA 1H0IA 2PBOA 4M80A 4WSJA 3WSUA 3MS8A 1ZJBA 1ZBWA 1QOXA 1E1FA 3SEPA 3MMWA 5I78A 4W89A 4QDMA 1J18A 3W27A 1HVXA 3ARWA 3T08A 1H0GA 1E4MM 3WQWA 1KCKA 4GXPA 5FL0A 3LPFA 4HMCA 1JG9A 4RE4A 1JI2A 3LRKA 1JZ8A 1ZL1A 4WIWA 4DM1A 1B3WA 3F5LA 5IFPA 5DFAA 2J7HA 1J0ZA 3DYMA 1QI5A 3W26A 4FLOA 5LYRA 3AMCA 4BQ3A 3DHUA 3A47A 2XN2A 2V38A 3CBWA 1B3VA 3K46A 4AMCA 4MTVA 4A4AA 4QP0A 4P7QA 5CPQA 1R7AA 5BXTA 1TUXA 5JBDA 2EAEA 1VFMA 1OCQA 2W92A 1I75A 1XH1A 4JFTA 1JF5A 3DX2A 3A3HA 2G3NA 1VBUA 1MVYA 3AHXA 1H5VA 1CBGA 1UZ1A 2EPLX 4BQ5A 3GXFA 4BS0A 4AD1A 1JZ7A 4OKDA 2D0FA 3VIPA 1CGYA 4HA1A 4XX6A 3GXPA 4QLJA 1JDCA 3DYOA 3WIJA 3T2PA 1W9XA 1W1VA 3OGRA 3A5VA 7A3HA 3N9KA 3VDCA 2E0PA 4GZIA 3W81A 2CERA 3VM5A 1EDQA 1UR1A 1DWAM 4U3CA 2FHCA 4FLRA 1M03A 2HISA 4LQ1A 3NDZA 1CGUA 1CPUA 3H54A 3TTYA 1TMQA 2OSYA 4Z2HA 3MMDA 8A3HA 3ZQ9A 1CGTA 3OGSA 4JHZA 1KR1A 1KGUA 3ARQA 3BSGA 3EJRA 1KGWA 3TTOA 1E6XM 4HA4A 4CU8A 2VZUA 4GO8A 1UYQA 4C7FA 4EK7A 3T0AA 2V3GA 3AS0A 3RDKA 1OSEA 1UR9A 4AMXA 3VNZA 5A8MA 3PZOA 5DEZA 1W9BM 4W88A 1WKYA 4H04A 3SUTA 3CHFA 3A4XA 3AZSA 2Z1SA 2J74A 1JL8A 4OUEA 3DX0A 3WF4A 1JI1A 2CNCA 4D6IA 3WUBA 2E40A 2GUYA 1WCGA 1CXHA 3DC0A 1J12A 1TQSA 1RD6A 1ISXA 3DDGA 3FHAA 4MJ4A 2FDMA 1R46A 1TA3A 3WD3A 1HP4A 2WAGA 3BAJA 1FA2A 4JKKA 1XH0A 3CPUA 5AC5A 3ZO9A 2WPGA 3VSVA 3THCA 5I2UA 3AFBA 3T0DA 5CGTA 2UY4A 1LL6A 3BAYA 5M17A 3SCUA 1R75A 4F8XA 1TCMA 1XC6A 2MANA 1V6WA 2VZTA 1HP5A 4JKMA 4Q7NA 2BXYA 3VIMA 5C8BB 1DTUA 1VENA 1WPCA 5M03A 3F4VA 5A6MA 3OLEA 4UZUA 4GZJA 3ARRA 3ZMRA 1MFVA 2X05A 4BQ2A 3GXIA 1E0VA 1E0XA 2PWEA 3FHQA 2OWWA 3CZKA 1KQZA 2EBNA 4CCCA 4CVWA 4P7LA 1J0IA 3VOCA 1BHGA 1GONA 3FNDA 2BHUA 4PUDA 3OLIA 1V08A 1UWUA 1ZS2A 2XM1A 3ZR6A 1XSIA 5A2AA 1CEOA 4NXKA 4Q22A 3EDDA 3K8MA 4P8WA 2E8ZA 1UQZA 2GJPA 2DT3A 2X2YA 2JFEX 2Y5EA 1ISZA 3SCSA 1H4PA 3N12A 3PZIA 1LL4A 2XWEA 3TOPA 3WD0A 1E43A 1LL7A 2EACA 4M24A 3L4YA 1C7TA 1HJVA 2NT1A 1TQUA 3T2QA 3ZJKA 3M07A 2Y8KA 4ZE5A 4AD4A 2F1AA 1UH3A 1OBAA 2OSWA 1TR1A 4L4PA 3MMUA 1BG9A 1IT0A 2D3NA 3DX3A 5CPTA 3WDQA 4PEEA 5E70A 4E8DA 4AW7A 2XIIA 4HMDA 1UWSA 3NUKA 4DUWA 4RL3A 3WUEA 4WJXA 4UOQA 1BYDA 3RMEA 1KBBA 3VNYA 2UY3A 4OOZA 3WMCA 2FE0A 1QWNA 1XGZA 1ISYA 1W32A 2W63A 2WWCA 2JALA 2VRJA 3MO4A 4LYRA 2GDVA 1K6AA 3A24A 1KWKA 2J7BA 2O9TA 4XZWA 4H2CA 1PX3A 1VJZA 4WKHA 1QVBA 1J0YA 1UD2A 4OBRA 4TUFA 2FGLA 1QBAA 1GZJA 2YA1A 3VX0A 5F7UA 3K4DA 3VSTA 3IJ8A 2IUZA 5HPOA 5DO8A 3WNKA 3RO8A 1WP6A 4HTYA 2BY2A 3BUQA 3PN8A 3K8LA 4DWSA 2ZX5A 4LYPA 3AZRA 4DM2A 5CSYA 4IPLA 3MV11 1N82A 1GQJA 1CECA 4MAZA 3AHTA 4J3WA 2YA2A 3DDFA 1FHDA 2BY3A 2CBIA
chains in the Genus database with same CATH superfamily
4Z3JA 4A2FA 1INDL 5JIHA 3BDXA 3FKUS 3IMTA 1IBYA 1E5YA 4UQIM 4N20A 4L23A 4KKQA 5F9JB 4PJ6A 4M8VA 2XSXA 4HHWA 3UF9A 2VFGA 4IK6A 3BGGA 5ANME 4DTGH 2Q8BH 1S7QB 5E5RB 4UTAA 1E73M 5IFHL 4OLXL 3AWOA 4KX8A 3BVXA 3N2MA 2ZP8A 4B5WA 4FTDA 2WZTA 2RDWA 1G01A 3IMRA 4B50A 1ITXA 5KSVB 6A3HA 4YUEH 3UTTD 1VRXA 2QKIB 2B0SL 1OTTC 4FS9A 1J5HA 3GSQA 1JGEB 1OP4A 1F4XL 3QWQB 3ALXA 2X70B 3T3ME 3ULUF 1JPST 4JM2B 4AEFA 1NCBL 3NQIA 3HVDA 5GRUL 3VJ6B 2PTTA 4HEPA 3W6MA 3BGMA 3LCYA 2O9OA 3SE4A 5IDIA 4KKBD 1IAOA 4JYDA 3TS8A 3BP5B 1ZZMA 3GIVB 1EO5A 4XBGB 4XXCC 4DCQB 1HKKA 4RAVB 4N0UB 3ES6A 2UWEB 3ABSA 2IMNA 3QJQB 1BJ1J 3AZTA 4GCAA 4B2DA 1OTSC 4UFHA 3VSUA 1U8NB 2CRYA 4JTFA 3NTCL 4HCIA 2PCQA 3QH3B 2FL5B 2J7DA 1DDHA 3EG9B 3MANA 3SN6N 2DQEH 1DDTA 2PGEA 2CCVA 1XLAA 5KVFH 4UMAA 1UWEL 4G6JH 4HP5A 2KDYA 4P7RA 4K9JA 2AXFB 4QHRA 4AGPA 3AADB 2B81A 1QK2A 3QXDB 5AC6A 4BF7A 3TIMA 3NRFA 3OXSB 3MFGB 4N0FB 5LIUX 2Q8ZA 1E3FA 5LIYX 1YDVA 2GZXA 2D31A 2YB1A 1GOQA 1MHEA 2NX9A 3CIWA 3JZUA 4Z7NE 1FWTA 2CDGA 5JIPA 5ID0B 1HHHA 2PAJA 4DOHB 3MPGA 4LF2A 1AO7D 2PETA 4IKIA 4DZ5A 2P7TB 3A6CH 4JTQA 1MFAH 2FHBA 5ABZA 4P0DA 4AVFA 5FA4A 3H2NA 8XIMA 1YN7A 4X6DA 1W0VB 1OCZB 2F58L 3L7FA 1XYFA 2Y6SD 4ODTH 4GRWE 3QDHA 3QDMB 5D30A 3HFTA 3G0SA 2H3XC 2WLHA 2X4TA 1KJ3H 2XIOA 1NCDH 5J11C 1F5WA 2MIZA 4ZXOA 1ZOXA 3A4FA 1X8CA 1UYWL 2ZTJA 4JTGA 5TH2A 1NBYB 5LXXA 2YX0A 2XG5A 1E4KA 4OT7A 4JY5H 3OV6A 4KRMB 3SQMA 5IUCA 2XQBL 2IWKA 4Q6YA 4EX4A 3D4CA 4YXHL 1I1CA 1Y0LA 2O5YL 5C6TL 5EC2A 1T21B 5C9KA 2NV2A 3V1PA 5LA1A 2H0FA 1A65A 5E8NA 3KDNA 2D7MA 3RVWD 1C5BL 1S7SB 4PGBB 1I2OA 4G8FB 3UTSE 1OZMA 4LX4A 2UZXA 1Z3GH 1HXYA 3KLHC 3NIFB 3C3UA 3WQ4A 1TE6A 3PWNA 2QKSA 1GH7A 4PGCA 3LQLA 4ZFFA 4E5TA 1ZDQA 2PR4H 1XF0A 3G3MA 3GNRA 3QOKA 4F9JA 4WHTA 4Y8EA 4WGVB 3QY8A 4FD0A 5SWZD 3QC0A 1MZRA 2R83A 2GVEA 2F8QA 4XC3H 1EPFA 3S9DB 5EU5A 2V2WB 4AQAA 3SY0B 4TQEL 2W9DH 6ALDA 3CU7A 2FRGP 2D2HA 5KVMC 4NS0A 1DXFA 4PYHA 4CVXA 2OOFA 4QAIA 4K2SA 4Q9QL 1YRKA 4JKPL 3BLKA 2H1XA 2X42A 4GKSB 4DZHA 3UGUA 1UHVA 1Y1DA 3WH7A 3MLYH 2PDJA 4OVXA 3O3BA 5AAWC 7ODCA 4N1EA 3HIJA 4YX2L 4MA8H 1ZTXL 2YKLH 4NDMB 4YMZA 1XKYA 4AX6A 1W0YT 2AP2A 4QRFA 1M2OA 1O6TA 2V2XB 1BXXA 1F13A 1TTJA 1KLUB 2ZA3A 2YAPA 3T2NL 3EAUA 4DP0X 3OGOE 2LFEA 1HZYA 3WV0A 3QV6A 2VCOA 3MLVL 1YY9C 3PJSA 1E9YB 3KAAA 3VIOA 2NLYA 2OYLA 1ORSA 2EO1A 1NPUA 25C8H 4J1UB 1D6EB 1QLEB 1RL1A 3FFCA 4I9JA 4CKQA 4LNCA 1BQLL 5H2BA 2ON3A 3X1NA 2HKHH 4LKCA 5FO8A 1GTNA 1Q8AA 5LB1A 4LCSA 1JPFB 1ZJAA 3E80A 4WFED 3CFDA 5F1IA 4AZCB 3TMLA 5BUAA 4OQVA 3S9IA 5JHLH 4JFOA 3CMOL 2AXHA 1IILE 1MJUL 3UOAB 2NQJA 2A3CA 4Q0XH 1KXVA 3TTSA 1P0DA 2N3JA 4AKPA 2G2NA 4FXJA 1JNEA 5I1KH 4WFGE 5JDSA 2ADJB 3F7QA 4ZB0A 5HI3C 2VMJA 4HUVB 3S48A 2CHDA 1S1RA 1IEVA 3CUHA 1ZHLA 5L8LB 1LNUA 4PSRA 3VUSA 3BO9A 3ULVH 3LCFA 1WVZA 4PGEB 2JFCA 4TXEA 5TNVA 1G7HB 4CMMB 3IS0X 3ZHNA 1RZ8A 2WMHA 5EUKB 2K9UA 2QVMA 1JPTH 4XNZC 2OX5B 2GOUA 4YGAB 2JJSC 2D22A 2OTDA 4AUYA 2LLEA 3V52H 3GDBA 4C59B 5HGAB 2DUAA 4PGDB 5D4HA 5FYJD 1MZHA 2VC2H 4PJXE 5FAJA 3QLLA 2BK8A 3W75A 3QQ9D 1FWXA 3E2QA 4G56A 3WTXA 1OWRM 3CDZB 4HGWA 4X4ZA 4BZ1H 3HC0B 1G7PB 2ENSA 3WE6B 3GTHA 5JHMA 3WMLA 2DTMH 1P7TB 1IMHC 3B8VA 1P43A 2Y3AA 1EUNA 2WYIA 1QLEL 4LFHG 1C9SA 4F1ZA 2VDPH 4GIPD 3SDDA 3V4VA 3B43A 4QAMB 3S3SA 1MO0A 4PJDB 1L6FA 4JFYA 4ANXA 4M5ZH 3VFPA 3PZUA 4HIEB 1A5KC 4FSAA 1BWWA 1H60A 3MLPA 3VWJC 4JFVA 2X2HA 2IDUA 2VCCA 1AS8A 5DHMC 3B9VA 4GMEA 2CU0A 3HZ3A 4N25A 3IV3A 3M1OA 3VOFA 4E68A 1F3JA 4JR9H 5A2JH 2HLFC 4W86A 3MACH 4PJGF 1O68A 1H8NA 4C6NA 4O28A 4XP5L 5GQBA 1Q6OA 4IUGA 2VZ3A 1ORQA 3MRJA 1JZEA 4RISH 4AE1A 1O5PA 1N12A 1TQCB 3SO3C 2DLEA 1BZ9A 1EGJL 1I1AB 5G2HA 3FU0A 3QUYA 3T0BA 1N9PA 3KTCA 1UG6A 4JQVA 4A6YH 1FV1A 4LVFA 1XLBA 4RMVA 1XIGA 4YHNB 4M1DL 1S7VA 1V51A 4LQFH 1UC6A 1EUTA 1ZXQA 3M43A 2FGWH 1JGUH 1JK9A 4IRSA 2BOBB 2BSSA 5HYQA 1ADWA 1ZENA 4EAEA 3IJ9A 2J5LB 4IGBD 3DO7B 4AGMA 3G6AB 3BQUD 3T1GA 1K7EA 3P6LA 1GK8A 3QJUB 2HT4D 2QIWA 1U5HA 2NY6B 4W9EC 5DU7A 1F02I 4D8ZA 4WK9A 1IHIA 1TU2A 3F7YB 2DAVA 3AJ7A 4HEMA 3W7PA 3L8QA 3HG1D 3UZEC 5D9MA 5A95A 4E5XG 5I07A 2L7JA 4NC2B 3D39D 3W70A 4O0KA 2A4EA 1EERB 2XCMC 4N0YH 1JCLA 1IIHA 5H2ZA 1LORA 2J6EH 1GAFL 4W6XB 3FSAA 4A66A 5HJ3B 3W1UA 2DIBA 4TTDC 7TAAA 1I0BA 4DBDA 3GSXA 1I9RH 4I0KA 3GDTA 4IHBA 4AZ6A 4UXDA 4JFQA 1OAYH 1A7PL 4WKXA 1TVDA 5F7EL 1S9YB 1JUFB 1YQ2A 2B7NA 1WWWX 1DEEA 2AFNA 3RUGF 3MV7B 3DBNA 3E8UL 4NKDB 5B8CC 2XIQA 4O00A 1E27B 9XIAA 3DETC 2HSIA 3MBWB 4FQXB 2XKNB 3N42B 1WT5C 1W3LA 4LSRL 3RVTD 4XMPH 4M3HA 3S5SA 1XYAA 4Y1AE 4JQ4A 7FABL 3RTQD 2XIBA 3MRIA 1KZYA 2OSLB 3PFUA 4WGWB 1KBJA 5A3HA 3CDYA 1MEWA 3DFSA 4APQB 3HA1A 4M3PA 2VMFA 5DZ9A 2CBMA 1KFAL 1J5DA 3G6JA 4YHPA 2X2IA 4QF1A 2NVAA 4FTVB 4ENEC 4E2DA 4W70A 3LIZA 1EX1A 2EHHA 3DEQA 4Y2DA 4M7ZC 1GC1L 3GSMA 4PTUA 3MUCA 4LUSB 1KBLA 3LN4A 3KM2A 5ELIA 1XGTB 2V3DA 2EIBA 4HHMA 4B27A 3ZZLA 3O0RL 1Q6CA 5KYUB 2O6PA 3G2GA 4AXNA 5G5DA 3Q2DA 4V1DA 3CFMA 4BUGA 1TNNA 3DC8A 2J8GA 4FQPA 1I8MA 4JQIA 1HINH 3CZ8A 4FZEL 4QYOB 2Q6ZA 1JHLL 2EDJA 4A3UA 3VGEA 3GFZA 3MCKA 2FIKA 3BSMA 3ZTJH 4DPRA 4NQEB 3DGDA 4O2FA 2NX5A 2FJUB 2X40A 1SN5A 3PGCB 4LBAA 3NL6A 4XD6A 4FADA 2Z31A 3B9OA 2H47C 1ZU8A 1XTLA 6FABL 3GVRA 1FWJC 4NI8A 5I6OA 1UXLA 1V7NH 3C6LC 4YL4A 4B5SA 2F8XC 2DY2A 4FNUA 2QJIA 3CVHH 3ZU8A 3RWJB 1XCXA 2DQCL 1NC4B 3ENLA 1E5CA 5AENA 2X4PA 3KPLA 2OX1A 4C6EA 4UTCA 4QTHA 2UZIH 3CFUA 1JQVA 2W0FA 1AYOA 4KIRA 3OG3A 3B5HA 4MAUH 3FT3A 1MI3A 3BUIA 4CNOA 5E6IA 5DJZB 2REQA 3GI8L 4PG2A 3AQDA 2PTYA 1QSEA 4IQEA 2QF7A 1MSSA 3BH8B 5D8JH 2EG8A 5CEXA 2XPYA 2CD0A 3K5SA 3M1CA 4ZW3A 4PTDA 4Z1CA 1P1MA 3IK4A 2M8XA 3ZTCC 4EI5D 1JJUA 5GRJL 3B8TA 4M1GL 4LEOB 2BHFA 1V0NA 3AUVA 3VKDA 2HZGA 3NH7H 4GAGL 2IAAC 1AQMA 5I79A 1JSYA 2QFRA 4W9FC 4OB5L 4LAOA 5CFHA 4Q74A 1MREH 5FEXA 5GJPA 5JHDA 2EJ1A 3FO2A 2GVGA 3WO8A 3GUWA 1JV2A 2O5XL 1TNMA 1XGUA 2WXDM 1H5BC 2EUZA 15C8H 4QT5A 1R86A 3QQDA 1L7TH 2VGIA 1DZBA 2J72A 1H41A 1DIEA 2VDKB 4X6BB 1DQJB 3GMOA 4HCRA 4KK9C 2J8UB 3I74A 5LGHL 2VERN 4DN3L 3UTPE 4HOXA 3ULUC 3VFOA 1X1NA 3MI3A 3N6YA 2D0HA 4E0RA 1S3KH 2YARA 3PTKA 5TGBB 5AWNL 4BK9A 1IR2A 3VC6A 5GGRA 4AK1A 4PJ9B 2BSTA 3BZ4B 3IDMB 1DQDH 4QFUA 4QRPE 1HXMB 4C4KO 3JV6A 3QNZB 2GK0B 4QPEA 2C9VA 4FF5A 5FF0A 3FUNA 1AQFA 4A3YA 1FZJA 3ISWA 2GSGA 1F07A 1E0UA 2AJYL 5FKAB 4GG8A 5KEZA 1I1YA 4L9YA 4IIHA 2PGFA 3NGFA 4QYAA 5DURD 1GZ1A 3M17A 4JZJB 5CD3A 2FMOA 5IB4A 2FJGA 4GVIA 3RDTD 1MCJA 1RI8A 4JCWA 3IRSA 4X6CB 4YHOH 4W9ZA 1G7IB 2HWZH 4GLRI 1KPUB 2JIXA 3BT2H 5HYEA 3NQDA 3ZX1A 1QNZH 1CTMA 3DHUA 2VWEE 2P4AB 3A47A 3V0DA 4H20L 3GRWA 3B2DC 2C3GA 3N9GL 4M7LL 2VDKL 2Z6FA 4LWWA 5BXTA 1TUXA 4PS8A 1FQ9C 1P1ZA 2EDOA 1KACB 2UVEA 2MPAL 3GXFA 4DIXA 3D12B 4D0CA 3AYTA 3WFBH 1MFDL 5D1XA 1RUMH 4ZTOL 4LHUA 4AB4A 3N6QA 3JWOL 1K77A 2DJMA 1OAXL 3KJ6L 4DBSA 1DBJL 3NDZA 2X12A 3IDNB 4XPFH 4KERA 2OSYA 4FHAA 3OVGA 4MQ7B 2Z8WC 3OGSA 4MNQA 3OBEA 3TTOA 3SBWA 2HRGA 4EK7A 4RMUA 1UR9A 1IF2A 3QEGH 3PZOA 1CG9B 3CHFA 5DCEA 1KTLA 3GSNH 4WTXA 2J74A 2OK0L 1JL8A 3PE9A 1IUZA 4EIBA 4O2CA 1T0NB 2GUYA 5SX5K 5JLZA 4HV8A 4JTEA 3Q1EA 4MJ4A 4NWTH 4LANA 4FOKA 4X7EC 5D7JB 4RVBA 2Q87A 4JUSA 3CPUA 4F37F 2IFFL 5CHNA 3OXRA 3WU1A 4J8RA 2Q7YB 3KPNA 3BAYA 3GTXA 4F3FA 1PG7X 4F8XA 3QO0B 4GXVH 4NCC1 1E4WL 3WD5H 4XPBL 4WU7A 3GXIA 4OGXL 3GUFA 1E0VA 4N5EC 1DL3A 4OW6A 1A7NL 3KYNA 5IMKA 4O10A 4X2PA 5JTWA 3OLIA 2J9YA 2E8ZA 5KSAC 2BFVL 4L8SC 4PRHA 1UZ8A 2R9RA 2E1DA 3X1EA 4P2OB 4XNMA 4QNPF 1NUFA 1O5XA 3ZJKA 4FERA 4DK3A 1CLCA 4GABA 4M19A 4JFEB 1ETB1 2XWCA 4PUBH 1SO3A 3ZBMA 3NUKA 4W4QA 3NZPA 3IB4A 4YS1A 3Q2VA 3WUEA 2IXQB 4AMKL 1FNGA 4OGQC 2YBGA 1MWAB 2HCVA 1BWLA 5TAOA 2RA1A 3VABA 2JV6A 4PUJA 4AQ8A 2CHWA 5H8UA 1GTHA 2IMMA 2W60A 2ICEC 3A24A 4BKNA 1PX3A 2CK0L 3FNKA 3IGLA 1CDBA 2P44B 4LOUC 4PJEF 2F8VA 5F7UA 1QCWA 4KXZI 5DO8A 3BZGA 1B4TA 3RVXC 1YEHH 4ODVH 1FNHA 5E5LA 3LQAL 4WY0A 2DDQH 4OZIA 4POCA 3N2XA 3PL6B 1MQ8A 1EWDA 1JPGB 4NO3A 4Z1BA 5U7SA 5J12C 1GS7A 2BODX 4LPWA 1PMYA 1VGEH 2WJ7A 3GBNH 3RL2A 5E8PA 4WWPA 2NSQA 4RIRA 3C0SA 1H6UA 3E1F1 2G2RB 4HH9B 1I6NA 3CPLB 3HU7A 3TQ0A 4L4LA 2WJDA 3KWTA 4Z7AA 3CX5K 5EWIH 4YFLF 3KPSD 3ZRFC 4B3LA 3QIBD 4N28A 4ALAL 3CHRA 1EJ8A 4PLJD 4YBQC 1OB1A 3FJ6A 1KTCA 3W5NA 4PRTA 4DW2L 4UT6H 1IJ9A 3FONA 5T5NG 5ITFB 4AG4H 2DMKA 3W7DA 2WANA 1GVYA 3RM8A 4FG4A 1EMTL 5FGSA 4UFKA 3VPLA 3U4AA 5EOCL 3UA4A 3DSNB 5KBKA 4CNIB 1UUMA 1E6SM 1EP2A 4WCYL 2E9BA 2BVYA 2ABBA 3VA6A 1O9ZA 4LKXB 1P4IH 2PTXA 2YFNA 1U33A 1S9WA 1X5IA 1M7UA 4YNYA 5AVVB 1F4WL 5KANG 1SEBB 2AXJA 2QSCH 4H0HB 1LG2A 2Z3FA 3GD6A 4BWWA 3EWUA 2A4AA 5I17A 3V79C 2Z1KA 1MCFA 1MWAL 3S88H 1OD8A 3R8QA 4JPIB 3UPMA 3ARUA 1W9VA 1E65A 4QLRA 5HI4D 1EQCA 3VKKA 1IEHA 4MWAC 1IGFL 4OZOA 8RUCA 3THUA 1AQKL 3NIGB 1K6WA 3IJEB 3NA8A 1PZBA 3SSGA 4B92A 4MUPA 1ME7A 3RWGB 3ASNB 4EBQL 4ZD3L 3S5LG 4R4FL 5MKGA 2NSOA 4PS3A 1R34A 1ID5I 3QS2A 5AOKA 2ZDSA 1OAKL 4NQDD 3D0LA 4WI6A 3VDHA 4XZBA 2ZZ1A 4D6GA 1J0JA 1TCRB 3W1QA 3GMPA 1MJ8L 1A1NA 6TIMA 1HHIB 3D50A 4NQVB 2WOYA 2Q86A 3IIZA 4KBXA 1ZSXA 2V33A 4HYVA 1PPIA 5E7FA 2ZYRA 5EEXA 3NZ8B 4LU5L 1FX6A 1NIUA 3GVQA 1U2CA 3NSYA 4FNPA 2E9WA 3KOXA 1SOSA 1B4KA 1KOAA 5D6DA 4RMBA 1FVPA 4I89A 2DYPD 4UB0H 3K91A 3HG4A 4QUOA 3C6CA 4LEQA 4K73A 5C0EA 1HAWA 1DCEA 1SOQA 4U6HB 2ZRYA 5C71A 3KCJA 2B9BA 4MJ6A 2VEKA 2ZUVA 1S7RB 5J8OA 5BRZD 3D47A 1DJNA 2IDSA 5ESVA 3EJUA 3S34L 3WIHH 4Z2IA 1L3WA 5CBAA 5JOEA 3WSQH 2C3WA 2EADA 3PZMA 3DX6B 1T1ZA 4R97C 1T03H 5HHVH 3KRZA 3T42A 2YBUA 2LTQC 3IMUA 1QR1B 3O4LD 4HSCX 2WQXA 4EI6A 2IOMA 4JMNA 2V2DA 3HF3A 5DD1H 3K1DA 3KW8A 3Q2WA 3ZDXF 3TCLB 5H6HA 1REQB 3ZPDA 3MZNA 3ILPA 1GZQA 4MYPA 4IHCA 2CEQA 1XBYA 3U2EA 3AHYA 2OA9A 1K72A 1LO0L 4QCEA 2A21A 3ETTA 1JAKA 3QG6B 1AD9B 1SVBA 4P4KC 2AEWA 3OQRA 3HTLX 1P5UB 4BZYA 4XMZA 2PP0A 4PRID 1CI5A 4N0RA 3PJXA 3D3VE 4NVTA 4MXWH 4MA7H 2TYSA 4LNRA 2EDQA 4H8VA 5DY3A 2DQUL 5DVMA 1UWQA 5KUKA 2I5QA 4TUOA 3LB6D 2ERJC 4UTUA 3WKQA 1EP3A 1L9PA 4NUGH 1IGIH 4E41B 4BA8A 2QGBA 2AJVH 5CSGA 1XGRA 3CO8A 4FIRA 3ZR4A 1LEKB 3WFLA 5FF6B 4B9YA 4BQCA 1PX4A 5G4WA 1XIWB 3VKJA 5TDPA 3K0WA 3UR8A 5I03A 2IV8A 2QEJA 5I3HA 3EKCA 3ETBF 3OZ9L 4GSUA 5JUVA 4OF5A 3KXFD 5AB3A 3HN8A 2Y5QA 1X4YA 1RA5A 5JIQA 1XW8A 3AXKA 3G1AA 2V30A 3HC4H 4AEHH 4OBTA 2ACRA 3FRUA 4NNXB 2BBFA 5DANA 3UIYA 3MRDB 1PAZA 5IROC 4TQPA 4FXTA 1R4XA 1OGBA 3DJZA 2X7WA 4Z3EA 4PJFE 2NV1A 1DWFM 4N8VG 1TQTA 2BP8A 5E94A 2BFGA 3T0EC 3W83A 3P3UA 2BNRD 4JKLA 4X2RA 3U5UA 5J8LA 1M4KA 4NQCD 1OK6A 4ANKA 2WWOA 2XQ0A 5CKGA 4UTAH 5DVKA 5J6HB 2J9ZA 4CDHA 1HQ4A 1W91A 2PDPA 2V4LA 5LXGL 3T4WA 3BPNB 1XHGA 1EFQA 5L88H 4RGMB 1CICD 1QBML 2WMKA 3FUMA 2P24B 4ONGL 4ZQTA 1NEZB 4UV7H 2NQ5A 5LQBL 3FN3A 2H8ZA 5B21A 4HUWB 5HWNA 3RZCB 1X7QA 1DLFL 4GZEA 1Q9LA 3OPSA 1Q85A 5AY7A 4OD3H 4JL2A 3CHDA 3BDKA 1II4E 1GQNA 3LEVH 3DRTB 4N6FA 1P0BA 1BGGA 3KOFA 2ZSVA 4HU8A 3K30A 2O0TA 5FF3A 5HJLA 3ZGIA 1AHWB 5FESA 2DDXA 3GTTA 4XOCA 1XAKA 2P80D 1RBOB 3WFCH 3V0WH 5CSRA 4Z7QE 3NR0A 3CSYA 4M5YL 4WXYA 3MKKA 4X9BA 2NUPB 1SJEA 2R6OA 3MGTB 3RX8A 5L2KE 2YPVL 5DD0L 1MCOH 3IJ6A 3R0MA 3U6RB 3ES7A 3PG8A 3UROR 1MHPH 4Q7IA 4Q6KA 4XAKE 4XNUH 1YPZF 4F0SA 3SDXB 2XBDA 4OGZA 5AZEL 3OHMB 4YS4A 3VQ1C 5FGBC 2MTPA 1FXPA 3SFKA 4MTMA 1HGWA 2INZA 4DKDC 3MRMB 1AJ7H 5DI8B 2R1WB 4MBRA 4LCWB 4HD5A 3LKQB 2I17A 4OZGE 5CEZL 2H8PA 3PPFA 4YBLC 1NAKL 3BH9B 2VLJB 2NMSA 1NMAL 3O9NA 5GZOC 2V9DA 3UJSA 2Y6TE 1I31A 2RH9A 3UTZB 2R1PA 1U8CB 4IU2A 2C13A 1T1YA 3H1ZA 3ZRCC 4P49A 5CSUA 4PJ5E 4LYQA 3BWAA 1OPGH 2J20A 5CPLA 4LF3B 4M03A 4OJAA 4NNYA 3CFIC 4XE5B 3O9WB 1HIML 3L3OA 2PXYC 3DMMB 3FN0H 4MB3A 3VGDA 5DK3A 4Q4OA 1FBAA 4H40A 1J5IA 1P2CB 4MADA 2P8LA 4EF3A 5ACZA 1I8KA 4MKTA 4G1EB 1YJDH 4X6EB 1XBRA 5DLLA 4R8WL 1S5TA 1SVZA 4X5RA 4KGJA 3WBEA 3QWNA 1VSCA 4EZLA 4RFEA 3OMIB 1W1IE 1CS6A 4K55A 1IGJB 3MJ7A 3T05A 4JJ5A 4OV6F 3NZGA 2J6VA 4WW2A 3MSPA 2QPDB 4Z0BL 2E75C 4PW9A 3APFA 3DBPA 4L3FA 2MRYA 1X44A 1M04A 3GQFA 5H35A 2WVVB 5F3BB 1E6QM 2H1PH 2DEXX 1J4EA 3REVA 5E2WL 3NQ6A 4LZKA 2WXKA 3LEPA 1U3HA 5JHAA 4ZUUA 3ZXAC 4URIA 2DZVA 4EOUA 3W87A 3LKPB 2J71A 1QNPA 3S4SG 2PPGA 1ZWIB 3DIVA 1A6TA 2APBA 1FLTX 1UM4H 1SY6L 2NNAA 4RLIA 2CHZA 2Y8UA 4PRDB 2EYRB 4K23L 4Z8FH 4G8AC 5GS0D 5IR1B 2FB3A 4HZ7A 4GRMA 3PUEA 3IJYA 4LFHD 5MI0B 2Z34A 4H8UA 1BYPA 3ZHDA 2CIIA 4OLYL 3AYRA 5EORL 4KHXH 3C61A 3WKNA 3WD2A 2O6FA 4TQTA 5M2FX 3TONA 2W6RA 2Y7FA 2N59A 5F4SA 5BZZA 1AGCB 2YJQA 5KSBE 1MJJB 1Z9PA 1T7ZA 3MLRH 3QZMA 3C60C 4NJAH 3THML 4PJ7A 5FCSH 4M62L 1BF5A 3K71B 3D6NA 3FO0L 1FO0A 4UUIA 3DOPA 2DQDL 4K3EH 3II1A 2Y88A 3T0CA 5E9DB 4I7VA 1WX0A 4IMAA 3FB7A 4PCNA 1MRQA 2PMZA 3O45A 3SCVA 3KM1A 1A5FL 1F2JA 3FVMA 1UKTA 2XG4B 3I3BA 2IQAA 3SUWA 1GZPA 2BASA 3MX0A 2LVEA 3SQLA 4PJCA 4LVAA 1XKJA 3TA3B 3WS3A 4IGSA 3V0AC 2A3AA 2EE6A 1Q8MA 5CLZA 2ETWA 1RK5A 4EEEA 5D09A 2FATH 2ATKB 2IDCA 4QXVA 2HK1A 1UOKA 3BW9B 3WEXB 4PUKA 1OFEA 2BGQA 5FC9A 2E1WA 3C4UA 3WIFB 1KN2H 3JWDC 2F7QA 1DVFC 4GJTB 4XZNX 2F74B 3VWKB 5D7SL 2CO7B 2B4GA 3UTPD 2OW6A 2Y07L 2ZIDA 1AJ0A 5FUCC 1J2WA 3S37H 2O9RA 3Q06A 1W9DM 5AOLA 4P5TD 4DH2A 4UAOC 4NJIA 5D9PA 3OAUH 1JDDA 1F6FB 1A66A 3EA1A 1T2JA 5F7WC 3IMSA 3NM3A 43CAB 2XC8A 3P1VA 3L5WA 4KNSA 2B59A 4MJ2A 4CADB 3IJDA 4Q56A 1LP9F 5IVXB 3HG5A 2V2TA 1ESWA 2KI6A 5D1ZI 3QFJD 5F8QC 1OD0A 2E7LC 3JVGC 1H1YA 1H7OA 5D38A 2GSEA 2WLIB 1RJYB 3CLFH 3Q37A 1HAUA 4C1NB 4U6YA 2VXVH 1FFQA 3T40A 5AYTA 3ABQA 1F61A 1WZ1L 3LS5L 4WW1B 4BI5A 3MZGB 2WINB 2CDFB 4G8GB 4FOMA 4R9OA 4MA1C 2XQYG 2XPGB 3UJTL 4A2LA 1D2KA 2VQTA 3D05A 4OM1L 3C5QA 4OJYA 4ODHL 3OJGA 2B1HL 3T9WA 1NGQL 3V4VH 1JRHI 1DHKA 1TJXA 3B7TA 3EOYG 3WY4A 3BOLA 4M61A 5FIPA 2VUOA 2CGRH 4G3YH 4KZCA 5KJ7E 1RLDA 3UYOD 1QZ1A 1WZAA 5E8EA 4KK6C 2Y0SA 2AL2B 1FCUA 4DZBB 3M5XA 3MAWA 3L48A 3GPEA 3QG7L 3H2EA 2PLCA 3IAGC 4XE0A 2YCIX 5I8EB 3RAJL 1WUZA 1FDJA 1IBFA 2KZHA 2JH2A 5IQMA 5EU6E 3CZSA 4DP9X 3EWBX 4UINL 2ZWZA 1MDTA 3SFWA 4ZXBD 4K7PX 1H15A 1BGXL 1DFBH 1TETH 4FFZL 3V4UL 1D7BA 4OJDH 3WH8A 1W2VA 1QI4A 2W67A 3EAKA 3CC5A 4AD3A 3D09A 3H2WA 4LEBA 2ADAA 3EWYA 4KAQL 2J1KA 3C8NA 3LXCA 4A1RA 2AANA 3KYOA 3RPIB 4BFAA 1MEXL 3V5DA 1BF6A 4LBEB 4ZJ9A 2A6NA 3WH5A 4LSBA 3GD1C 5DQJA 3LGDA 4P46D 3AM8A 4HZMA 3M9YA 2K0RA 1XJBA 1FNSH 2X4OB 2OR7A 1JTTA 3BXNA 2WUCH 4KWUA 2SEBA 3RP1A 1XCTB 5I1CL 3BD5A 5I1AA 3VD3A 1IGTA 2VLRE 2WNNA 1MQRA 1QTWA 3RLHA 5KVGL 1YYMH 4HA0A 4XCYB 1WTLA 3W7IA 3FX4A 1VBRA 1W2PA 1SPDA 2J55A 4HFWA 2IKJA 1PCXA 4LXFA 1NOAA 3MI6A 4XGZB 3IGHX 3WJLC 3GS7A 1E5JA 1RULH 3N34A 3WUWA 2VLKA 2XFFA 3L66A 4MMYB 2Q71A 3W1NA 3SPGA 4UTTC 1MCCA 5T1LD 2L5HA 3D85A 1UWGH 5DMLA 1IKFH 1OG6A 2DLIA 2Z7UA 4Y1SA 4LB3A 3RGTA 4EUPB 1K85A 4K3JH 4MX7A 4A6GA 5AZ2H 4HA3A 1MLCB 3VH8G 4Z76B 1IGML 3V18A 1PKMA 5I23A 2OO6A 5CR1A 1MAJA 5I66B 1VFOA 3UNTA 3QUXB 1JNHB 4LAKA 1ETZA 2QUVA 1D5ZB 1TMCB 3MRGA 1X38A 1J18A 4IQLA 3WQWA 4P06A 1JG9A 1BVWA 3V5OA 3N4EA 1TZ9A 4L64A 4YSOA 2FX9L 3N40P 2CGYA 3UWQA 4G6CA 1PE1A 4ABVA 1SZRA 2PO6A 5MENB 5K9KA 4YHIB 1S7TB 4XP6H 3FRPB 1RHHB 4DGVL 1ZLDA 6PCYA 5IKCA 1FDZA 1CBVH 3CHPA 1AGBA 4J2PA 3GB7A 1VBUA 3AHXA 4NP4L 2H3NA 5CZVL 2OULB 4OF3A 3LIZH 4GYBA 1BQHG 1JZ7A 1DQWA 1CD1B 5HDQL 5D1QC 2A9CA 1TZAA 1LO2L 4OUOA 7A3HA 3JWNH 4XSMA 3ZZSA 4JRYD 2O61A 3QO1A 1IT8A 4JFDE 3UFIA 3B0UX 2H4EA 3OKEA 5KS9E 3HR5B 4HD9A 2YUZA 1CPUA 1W72L 4P2RD 4J3ZA 2NDFA 1YMMB 5T1DH 3AUJA 3VXSB 3J2PA 4K38A 1O75A 2IADA 4WUUA 2ZYIA 4W88A 4JQIH 4MY9A 2VXUH 1VD6A 1JI1A 5F4WA 2X16A 5I1LA 4HIXH 4RWYL 1ISXA 4FO4A 1EJ6A 3MRCB 3TO4A 1ZAHA 1T66D 1BOGB 4FXKC 2X7LA 3T0DA 1HHGA 2UY4A 4U10A 2NY3B 3SDAD 1AH3A 3ARRA 1MFVA 4MD4B 1FL5B 5D6CB 5XIMA 4Z7UB 2JKLA 1IL1A 3AXMA 1E9ZB 4HIBA 3D30A 4I2XB 4K71C 2PMQA 2K78A 1H9VA 3MV9A 4MMZC 4H9YA 2ZOLA 4XMVA 1SOKA 4Q22A 3BZ5A 5T1KD 1F11A 1LO5B 3SCSA 1H4PA 3N12A 5IOPB 2NW2A 4RDQF 3WD0A 1E43A 4MQXC 1GIGH 3XINA 5ESAA 3TVAA 3AT9A 1DBBL 4PJAF 3FU6A 4WFFD 4RL3A 3GK0A 1ML0A 2IPUG 3N1FC 1BQUA 4ZOAA 4LCCA 4U1NA 3MRRB 5GS2H 1QWNA 2R69L 3W7RA 4X50A 4QHMA 2EVFA 1UWXK 4OI8A 4PB9H 1M7DA 5ISZA 3ETBJ 2CNZA 2WPBA 4KVNH 1MSPA 1JV5A 1OY0A 4XMKL 3BQ6A 1BYOA 2XFWA 2A77H 1Q65A 4PA8A 1OCRB 4DF2A 4P5UA 1W8EA 2X28A 3QYNA 2YK1H 5EIIG 2WMPB 4I90A 2NY4D 5XIAA 3HNSH 4WJ5A 3RIKA 3TWAA 4PR5A 1NDMA 4U1SA 2RTTA 5FX3A 3R13A 2TODA 3QXVA 5AOZA 4XN4A 4HCRH 5F6HI 1HKFA 3D18A 3H4HA 5I3GA 5MERB 4HPNA 1ECEA 1A6WL 2ZAHA 3VI4B 4KV5E 3T4AC 2ODIA 4J3XA 3VFSA 1SFJA 1IAMA 4TUJA 3HE7A 1K8CA 3N9SA 3RN6A 5CLTA 3L9BA 5J11B 2R2BB 1E6JL 5I8OL 4UT7L 1TVBA 3G6DH 1H49A 4GRLC 4BE5A 2ZWKA 2J88L 3MJ6A 1QPNA 1UR3M 4YN3A 4GY4A 2ZUNA 4GUIA 4MQSB 4PLNC 3T09A 4IRJC 4HB7A 3S8GB 3URQA 1HZLA 3MFFB 2GSIB 1FDLH 4IS6B 2LVCA 4O8RA 5CGYD 3BP7A 1Z9SA 3B1UA 3NTYA 2LOEA 1O7VA 5D1ZC 3GH5A 4EI0A 4LC8A 2PCXA 3WTVA 5DQ9B 2JELH 3QV7A 2DL2A 4HAGA 3P4NA 1EIBA 3KL3A 2PBGA 4MYWB 2W94A 2QVIA 3MRKB 4LASL 5ANHA 4RFNC 4MJZA 3KS0J 1OAZL 1Z0MA 4AYGA 1LK3H 3EUDA 5SWQB 3U57A 3HAEA 4QNEA 4M3JA 2VKZG 2YOCA 2IWEA 3KCPA 2L8AA 2V7HB 1I7UA 2VDQB 1FH8A 3WO3B 2VIRB 4I18A 2X4NB 3ROLB 4X2UA 2IXVA 4O11A 3OGVA 3WMSA 2YXWA 2YDAA 4Z7VE 3LKSA 4EE9A 4KMTL 3GRWH 4X5PA 3WDHA 2R1MA 1XGDA 1ZGLA 3NGBB 2CSPA 2GJ6D 4P7NA 5CSBA 3UETA 4YEEA 2OGJA 3E0IA 3EJJX 2OPCA 1MCPH 2OOGA 3SKOB 3TYCA 3JXAA 3QIWA 2V5BA 4Z23A 3EYSL 3GJFA 3LN3A 2QT6A 1AAJA 1BJ8A 1DBKH 2VRAA 1MRDL 4YL2A 5EOTA 1U3NA 2D9CA 1FHUA 9PCYA 1VF8A 5C0QA 1JNNL 3W38A 5A8QA 3NO5A 3ZZ1A 1IEAA 4GG6F 3W7CA 2WBGA 4DT2A 1PWMA 2JTYA 2FVLA 2HE5A 2BOCB 4XBKA 4ZQNA 5C2UB 4UIKH 3EYVA 4WO4A 3I02A 5K9OA 4LPCA 2D1ZA 3W28A 2CXKA 4TVCA 4C56E 1XISA 5ENWA 1OGTA 4QX4A 4BI7A 4XP4L 3V9EA 3UXIA 1XF2B 3OC5A 4YHZH 1HKLH 1P6BA 3NJJA 1A1OB 3QJFB 5AVYB 2VDQL 4Z2GA 4BQ4A 1L9SA 3KTXA 3OTTA 5DBUA 3E2HB 5C0ND 2DVUA 1I3RB 3BGFC 4D6DA 4PPTA 3FCSA 3C5ZB 5DRXA 3BKJH 2V5CA 5K93A 5F21B 2EIDA 5EZIL 5TE4L 3USZA 2OTWA 5D04C 5DJAB 4P9HL 1DIDA 1KYAA 3A6OA 3SCTA 5D5ME 3V2AR 3EOBA 5A3IC 4G7VL 5EKYA 2WZAA 1ZE3H 3UPWA 1SJHB 2ED8A 1EOKA 3GG0A 2YC1A 5K39A 2Q3OA 2R15A 2UY2A 4K1WA 3F58L 3CV5A 4S38A 2HT2D 3CL7A 3TNOA 5DRNB 3AHZA 4L61A 3W2DL 4RRPG 1ZIBA 2WLLB 4G42A 1E8XA 3IWVA 3BRDA 4LVHC 2AQVA 2IH1B 3U25A 5E1HB 4AHQA 1DWJM 3P9LB 3D5OF 3TEWA 3BFOA 3T4YA 5EU4A 3IXAA 3VI3A 1GGOA 1OFBA 1SFTA 3SJVB 1VADB 3SBPA 4AEEA 3B7YA 2WBJC 3QHZL 1ZVNA 3C2EA 4H1LB 4QOKB 2IPWA 5LIKX 3KPPA 1M1XB 4MAYC 5F7BA 5FOOA 1Q2RA 3TPUA 4AZGA 1DEDA 4KX9A 5AFDA 2Y3NA 3L95A 4PJHB 4GISA 4M48L 1A1MB 1PY4A 1CIDA 3QCUL 3SCQA 2F7IA 3H7BA 1XDJA 1HNFA 1D2OA 1EO8L 4D2NA 3OLDA 5J1AA 4JG0L 3H9HA 2VO8A 2ZE0A 3KBVA 1E0WA 1OW0A 2F18A 1BXAA 3VFGH 3W37A 1RK7A 5AHEA 4W6WB 2XZCH 3RTLA 4MSSA 2R1XA 2QSQA 4C83B 5JPMC 5KAQF 3F5KA 2D9QB 3UP1A 4U1JA 1U8PB 3KYMB 4BIKA 4FA3A 3DFNA 1UH4A 5CG0A 3LOTA 3DIDA 4Q4RA 5IJKA 4HHHA 4L4TD 1GYUA 3RLVA 3RWDA 5IREA 4UQ2B 4Q9BA 2WVUA 1OFQA 2PDWA 4L9XA 2E7MA 3OB8A 3AC0A 1XD0A 4GBXA 4O02A 5E00A 4XXWC 4GXUN 2Y5SA 5BVPL 3BUPA 5AFAA 4JIQA 1E0OB 3LHYA 1IAIL 4G9FD 3ZN6A 1Q0XL 1WFMA 1PIGA 1NWUA 1SM9A 4IMEA 1RHCA 3D52A 3MUHL 3QIUA 1XH3B 4H2HA 3IAPA 4O16A 1BVLB 4A2MA 3T07A 3VRIB 1P4UA 3T7VA 5I74C 4WY7L 4HKPA 4CSPA 4HC1A 3EYQD 3LNFA 5KZMA 2GGIA 3P4OA 1DJYA 2C7UB 1WZLA 2PPDA 4YSRA 3MJ8B 1OEZW 5ILTH 3LA4A 2BVPB 2HWGA 1WIPA 4FQ2L 4OSUH 2A4ZA 3IVKB 1ES0A 3CUIA 1R3LB 4GXWA 2FD6L 4CD8A 3C2FA 2BS9A 5IEHB 5KZCB 1IVTA 3G08A 3TVMA 2APFA 2OI9C 3O3RA 3CN2A 4QTFA 5IB5A 4B3EA 3IYLW 4NRZB 1B3IA 5D2NC 3UBXG 4AIZA 4XBPB 2VXSL 1YUHB 2CIKA 4PBGA 2DQWA 3FQTB 1XLCA 3NQFA 4QY8B 3UPRB 1L6PA 4EVZA 2BNUA 3M7WA 2Y1ZA 1JPEA 2EXYC 3R79A 5EY5A 1IGYA 1VEPA 3NOEA 1TWDA 4KHTL 5EO9B 1V93A 5L9DL 3R89A 4HH8A 2YGPA 3NPVA 3W7JA 3O3AA 4AQ1A 1MI5D 4KXDA 1GW9A 2AQ2A 3MNWA 2X9WA 3UTTA 3LMJL 1AGFB 3PTDA 1AS7A 3MP4A 1D3CA 3EDKA 4KKXA 1KCVL 3LS9A 1KIRA 4MSWA 1FHNA 5EMJA 3X11A 2XY2A 2DN7A 3QEQB 1BGAA 5FKPA 3FQ2A 3TK7A 2GJXA 2HP4A 3OPZH 2IAMC 3BWUF 5CP7A 1WICA 4N42A 2R9HD 2WAQA 4PWGA 3FK3A 4DNMA 1A14L 5EL1A 1AD0B 4Q6IC 2APSA 3G5VB 4L7ZA 5EMYA 5DJ0B 1OHQA 5I1JH 4I77L 2O56A 4XMLL 3PQYD 1QFUL 1HUVA 3UWEA 2GEEA 1XEDA 1LQ2A 2ZJSH 4Y7EA 2GUBA 1ZIAA 1K4GA 3IRCA 4LBRA 1Y6KR 5EA0L 3CQKA 4D8PB 2O9PA 2PPFA 3OJDA 1QFWH 4PRPA 4OFQA 4DI8A 4WX2A 2QQKH 1JF6A 1BKSA 3EO1A 1EYEA 3UJFA 1S9KC 5I6LA 3VB8A 5CO1A 1AOZA 4KNUA 3S46A 2YKKA 2X10A 1IGCL 4BHYA 3P3RA 1B9ZA 2GSMB 5F3HB 1UXWB 4POUB 5D7IF 1GOFA 5IQOA 1WE5A 1PZ3A 4ISVA 5TE7H 3LH9A 2FZ3B 5HYJE 1MIML 3PV7A 1KJMB 1TJMA 4MNMA 4A68A 1AO7A 5E6YA 4PEKA 4RQQA 1W8SA 2BOLA 5A16A 1PSKL 4AX7A 4DVRL 1ODUA 2R4RL 1QSFE 4YAQA 3S6CA 3H6OA 2C8NA 3GKFA 1P7QB 4N85A 4Q2ZB 1OM3L 3OW1A 2DQGL 1UWTA 4A3HA 4YK4B 1RR2A 3IJSA 3UP6A 5DFVD 4KKNA 1ZFJA 1MQQA 4PMUA 1LOLA 3NQAA 2AMXA 4GXUM 1VCVA 4UBDC 5IQNA 4BGLA 4L9DA 3WXWL 3T6QC 2RGMA 3HB9A 1EK3A 3O2DA 4YIWA 2BC4B 5T3ZH 3TIEB 3N4AA 4L1TA 3ECBA 4L5ZA 3VZXA 4L37B 5ECUA 3UD6A 5MEOA 1UBSA 4XHQA 5I8CB 1T89C 4S1DD 3H55A 3HI5H 2Z7KA 3T1FB 4KCWA 4HUCA 3SGEI 1CD0A 4V11A 5GZNC 4KRPC 1ITUA 1KTJA 3QDJB 1YNQA 3TP4A 3ZY7A 4MJIE 2BNQE 4XWGH 1EJOH 3NVTA 1O9VA 4N3UA 1IQWL 4ELMB 5HY9B 2WCSA 3TQPA 2Y25A 2DWEA 5FSEC 4HCLA 4PRAA 4NRSA 5E1AB 1TVHA 4NO5A 4YDLC 1XYCA 4PJBF 2EYSA 4FQLL 1XLEA 2DV6A 4C57C 4X7TA 1BYCA 1G84A 1F00I 1UP0A 4UR8A 1BFVH 1YE6A 1MQKL 3EB2A 1N5AB 3TV8A 4W5UA 4ETQB 1RIHL 2Q01A 3KBEA 5DHEA 3JV4A 1H9DA 3ZMEA 3UCRA 5EEWA 2BP0A 1FVDA 1FBIH 3ECUA 3BESR 4KXBA 3MROA 2GJJA 4GY7A 5TK2A 1PU0A 3G5ZB 1M6OA 1KD0A 2VITB 1CGVA 5FI8A 1S5IL 3OVRA 4I85A 4X8JA 2DTSA 4PV9A 4QEGA 4M8QA 3A67H 4R90L 4YDNA 5HR7A 1ZAGA 1DP0A 5EF0A 2VL4A 1Z9OA 1I2PA 4XNQA 3OZPA 4Q8UA 4DJEA 3U36A 1E4HA 1EAPA 4P48A 5CPSA 3MRQB 4XN1A 2NXYD 1ED3A 3ZKMD 1JXGA 4HNLA 2CZ5A 3F05A 5I8KL 2VX4A 2PW1A 4YR6A 4PY7B 3SBQA 3K2KA 4LPYA 4L3CB 3POHA 2WV8A 4JFDD 3GEWB 3TSMA 3RGVC 3UTSD 4BE6A 4Q8VA 1XF3A 2CKBA 3QARA 4JK0D 4AG0A 3HZYB 5C0AA 4LC6A 1NFPA 3T77B 2XN9A 4XXDA 2F19H 4YSPA 2UY7B 5DMIL 3CX5J 4PI0A 5DYFA 5FEBA 4N0UE 3GW3A 2UWEE 4D8LA 1PCWA 1UVQB 4L9LB 1D5MB 5K9JH 2AV7B 3ULUL 3CUPB 4A38A 4KKAD 1ISWA 3KWXA 3VXRA 1JPSL 5FFGA 4G6KH 1SW0A 4ZMPA 3C0JA 1DIOA 3GNMH 4G2AA 4PGLA 2WJ5A 3JW7A 3CB8A 3U9PH 1BFSA 5KMYA 4NX0A 3TZVD 1TZHB 3HRZB 1K03A 1OGAA 1R3JA 2FVNA 4CC4A 4EPDC 4OZHA 2X1OA 4IISA 5FYKH 2HRHA 1I9IL 1HXKA 3MLUH 3GDKA 5SV3A 2QADD 4HQQH 1WZMA 4GXFA 2FLMA 4HAKA 4MJ5B 1SXBA 1NL0H 4KVCL 5IXEA 2XLLA 2HLEB 4KZEL 3D25B 3H2AA 3CDGA 1UJPA 3WDRA 2FJHB 3HPJA 4GFIA 5E4IA 1F6PA 3VSQA 3GWJA 3AWNA 3E6HB 4PU2A 3ET9F 1U8HA 2VUKA 4HZLA 4C65A 1N8FA 2WKOA 4AVKA 1CQYA 3M0XA 4EF9A 1W3HA 5DQDH 3ANUA 3NJIA 1LMKA 1KRAC 3ZDYF 1W1B1 1PD0A 3F2CA 4A22A 4TYUA 4DAGH 3QDME 4XZIA 5C07E 3GMLB 1R9XA 2BZNA 4IYKA 5LGKA 4L8SB 3RWIA 2QCNA 2G95A 4UILL 4Z3TA 3W26A 3DOIA 3CAQA 5CUSL 3AACA 1G7QB 4O53A 4LSVL 1UEYA 1FO0H 2V38A 1G7LB 3PFRA 4RMTA 1YMHB 2AI0L 4UOW1 2C9AA 1R7AA 1M6JA 2OQYA 4WFGD 5FEZA 3O6FC 1NPNA 3KVKA 3TN0B 4P9MH 4K4KA 4X4YB 1WGOA 5AALA 4BS0A 4AD1A 3DFQA 3P3YA 3M0IA 4XX6A 2ICEB 3TN4A 4HWBA 4YSAA 1AODA 3R94A 1A7OL 5EPMB 3F12A 3VM5A 3B0XA 4MD0B 1TMQA 4DN1A 1DL7L 4RZCA 4JO1L 3BSGA 3ENEA 4LRIA 1E6XM 3B3BA 5GGUB 4B5UA 2VZUA 3AT0A 5HJXA 4K8EA 1AE6H 3TEXA 3NIFE 1LD9A 2Q2LA 5J12B 1FFPB 5DJDA 1I7RA 4D6IA 2VE6A 4EACA 2UYLB 4JE4B 2NPLX 3QFDA 4HPYH 3RK8A 5IHBA 4JRXB 3KHQA 2G4EA 1F58H 2VSKB 5DZVA 4P2VA 4MCZA 4LP8A 3ZLHA 5ICXB 1HO4A 1NC2A 4Q6XA 2N0KA 1GPWA 1NFDF 5E2VL 5C8BB 1DTUA 12E8L 1FAIH 2XKSA 2R1YB 4IGBA 5FM5M 4AWJC 1D3GA 2P5EE 5K4XA 3LY6A 1PLCA 1EB3A 1F90H 1W54A 1F3RB 1KN4L 4B9KC 2YHGA 4EDWL 2YQBA 3WHE1 4Z95L 5D2LA 1QNIA 3EDDA 2V8MA 4P8WA 3T78A 1SFHA 4Z78A 5TDNA 3D39A 1HH6B 2ZKYA 1X5MA 3SODB 4GMSH 3BT0A 1B0RB 4F9LA 5CCJA 4AD4A 3DGBA 5D71L 2A6IB 1EXUA 1VHPA 4ONHA 1UUSA 4CQ8A 1EEUA 3ARED 5L7XL 4MZ8A 3FQNB 1UWSA 2GUOB 1XRSA 4CL7A 1DQXA 2TMDA 5H8MA 3S3CB 2A2QT 1ISYA 1F45A 3ZLQC 3FU7B 4AITA 4UT9L 4MWAB 4IU3B 3VZZA 4KXAA 4ZSOB 1OSPL 3ARFC 4X4ME 4KJPD 1RUKH 4O13A 1PD6A 5DBTA 3GSWA 2WXQA 3FO9A 4Z5RA 5I16B 1LOSA 4M6PA 3TJEH 1PFCA 5IP4A 2ZX5A 3TX9A 4CNSA 1ME8A 2F5AL 5F1VA 1BECA 4J3WA 5LAXB 2CUHA 1NFKA 3WFAA 2B1OA 4M4PA 2W62A 3B06A 4QRBA 3S6TA 1KCSL 5IW6A 1TUFA 1TUPA 1I3GH 4I1NB 1H3XA 3UIZA 5I26A 2X53A 2GDQA 3UZYA 3G1YA 2ZOOA 1F5ZA 2WZHA 4GQ9H 1T99A 3HLKA 1TJIL 4P23C 3M86A 5D4YA 3TF4A 1NF0A 1SF5A 2A9ML 4PJGB 1ROWA 3GZQA 1MY5A 3SO5A 1MCLA 1CXLA 3CN0A 4V2BA 4JFFE 5L4JA 4OAWA 3DUSA 1JK8B 2XN1A 1ZY9A 3N17A 1ADOA 3MV8B 1FVCB 2P43B 3BEWB 1EDYA 3WF0A 2OAAA 4JPVL 3N50A 2CWRA 3WQCA 2FQFA 3X3GL 3HCVB 3U0TB 4RGNC 1I7ZB 1BDYA 1LE5A 3KDMA 3CH9A 1P5BA 1AMXA 3X1BA 3BUVA 3BV7A 4HALA 2PYFA 4MZYA 5DELA 3WLOA 4Q3MA 4U28A 4DUXA 3L5IA 4R2GC 4F7TA 4TUKL 1PZSA 4GI8A 5L4IA 3E3QC 3RWCA 1UD5A 2LTQB 3PHQB 1NCCL 3SIKA 2DSWA 4I7ZC 4JN6A 4AF0B 5DJ8A 2W65B 5B38A 4XNBA 1GJWA 3EXRA 4L5FL 1P7KB 3STZA 3MJ9A 4FQJL 4Y1AD 2KLSA 1B2WH 4TVPE 4WSGA 1IU1A 5IHHA 2EVGA 3W1XA 2CHNA 1XG4A 4PMXA 1WGVA 3N55A 1WWCA 2DP3A 3Q2LA 4GH1A 3L4WA 4ZFZB 4P4KB 4D9LL 2X3BA 5CLWA 1S7XA 4Z7WF 1JXJA 1ZA3A 4KO6A 1OWQA 5ABTA 1TJHH 1KFWA 3URAA 3ZL2A 3SDYL 2GK1B 4EDXB 2YD0A 1K2DB 4KZDL 4WDWA 2JCCF 1RZJC 1U8LA 3C5JA 1PJ9A 1QACA 2ERJB 5L0QC 1DUYA 2AJ3A 4JMXA 4KDWA 1DSFH 4X7DC 5AVZB 2PWFA 4MA3B 1FZMB 4EI5A 4RNIA 1RZ7L 4JQ2A 2GFBA 1NP2A 2ZNWA 1NIAA 1QFHA 2WMIB 1V03A 4FYQA 2YAEA 4ZAKB 4M51A 5IQ7L 1G4PA 1QEWB 1RK1B 4TX6A 3SOBL 1TSIA 3NCJH 1X5KA 5LNWA 1WEJL 2VXQL 3FUFA 4X4XB 1ACZA 5T1MA 3ULVF 4FX7A 4CKVX 1CO1A 3QE5A 2YZ1A 3Q6GH 2JB5L 1JP5A 4M4RA 2AQPA 3DIPA 4WI5A 4GUHA 4XZMX 3AW5A 1M05A 5F0MB 3RFZA 3PB0A 5DUMH 1TENA 2EIZA 2J7GA 5E08L 2COVD 5EBMB 4B3KA 4CMHB 3O11A 3GF8A 4D3CL 2PFHA 4K1GA 4LV4A 1F05A 2V2HA 2CAKA 2MNJB 2YD8A 3HQNA 1ROCA 5EN2A 1XCFA 1VGKA 2A74B 3BWUC 1HL5A 4U1HB 1EJ7L 3S5ZA 4F33B 1IXQA 3MXVL 4KQ4H 1XH2A 5CBEB 5I1DB 5ICZA 3LS4H 1KMGA 1SQ7A 2VQ1B 4IJRA 5BUPA 4P4RB 3SDCD 4FGMA 4TNGA 3MV7E 4AWUA 3FCTB 4OLZH 4FFVC 1A80A 4HIQA 3OU8A 4L3EB 2R14A 5JIWA 1ZSHA 1YNTB 2WNXA 3VFWB 2ZZ3A 2C0AA 4RZKA 2YYTA 3STLA 2G3FA 4GPVA 4B5NA 1CWYA 4QRQA 1H0DB 4H3DA 4DPQA 2KBGA 3U4FA 3IN0A 3FQXA 1WBXB 3CCHA 2CLHA 4B6ZA 3RCYA 1X8FA 4A7VA 2Y89A 1E6OL 4P5MB 4QXUH 1TVPA 4U49A 3WQPA 2JGYA 3LB0A 4FTVE 4QHLA 5AHLA 4ZMOA 3OZKA 4RLDA 4ZSTA 3EBIA 5IT2H 1NSNL 3R1GH 1I8AA 4ZUWB 5IMLB 3SZ8A 4JFXB 3TFKD 4N2IA 5EBLB 4JTHA 3GYEA 2G50A 3NEHA 5DR5L 2BTMA 2WK2A 1N8WA 4WDXA 4NFCA 3PIQA 4WTWA 5EUOB 1T40A 3F65A 3B2PA 3DJSA 3GSOA 5KZDA 1Q45A 4QGCA 3APDA 3IKCB 4XOAA 1BBDH 5FLVA 2V0AA 4JQ1A 1KB9K 2ESCA 3FQWB 3I75B 4QRPD 1YTKA 3H22A 4NQEE 2OS7A 1QKZH 1RSYA 4NHCH 2BY0A 1F6AA 2K6ZA 4E4UA 4HGXA 4NNPH 4MXQC 3UYPB 5TTRA 3H9SA 5IBLC 2ZXWB 3ARGB 3UXKA 1RQHA 5AC4A 3UMTA 3COTA 4OZFG 5HYSG 1NGYB 3LTPA 3GC3A 1SJXA 3R5EA 4GIAA 4IL2A 3HE6C 1XIIA 2O92A 2N1TE 4QRRE 2X3AA 4AM0Q 2PXYB 1P69B 3VD5A 4AYFA 2IJ0C 4D1JA 3PDGA 4JLRB 4NILA 3PGDA 4JL1A 2G9HA 1HW6A 3L5JA 5I18H 3FSZA 3P9MA 4BFIA 1KB9J 3GBDA 4MKNA 2ZONA 2NY2D 4BI6A 3QZOA 5D96B 4KH2A 2AK1H 4C60A 2A4CA 1R85A 3MYZA 3IMBA 1SSGA 4DP4X 5F71A 3QR2A 2YMXH 2QDDA 1DQKA 1LHZA 4ADSA 3HAEH 3SCPA 2CFFA 4OV5A 3VE9A 2HG5A 2R94A 1S9XA 5LGJA 3BLFA 3D4ZA 4RBPH 2TSYA 4DNLA 4N4YB 2PU0A 4NPJA 3TNMB 1XDLA 3QRLA 5D4QA 4GOSA 3ARSA 1A3ZA 4ODSH 2VXNA 2WLNA 1DBML 1LLOA 4CQDA 2W59A 3BE7A 5I1GL