1DHKA

Structure of porcine pancreatic alpha-amylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PORCINE PANCREATIC ALPHA-AMYLASE
molecule tags Complex (hydrolase/inhibitor)
publication title Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex.
pubmed doi rcsb
total genus 154
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dhkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dhkA01
1G94A 4ATWA 1UH2A 4M24A 2GJXA 1V0NA 3A4WA 4WKHA 3WNKA 1U30A 3AZRA 3GDBA 5IHRA 1JNEA 2XIBA 4Z2IA 1KBBA 2YLAA 4UQ9A 2RGLA 2G41A 2HISA 1MXDA 2YKKA 3WH5A 1C8YA 1E6ZA 3VUPA 3SCRA 1HF6A 1CENA 4JFSA 2WHJA 2D24A 2V3EA 1CIUA 2OSWA 3RIKA 3ARZA 4JKMA 1G9HA 2VZOA 2UWFA 2WMFA 2J25A 1JYVA 3LPOA 5M5DA 1VEOA 1B3XA 4DUXA 2OW7A 3BLBA 3RJXA 5KEZA 2V38A 1EDGA 3VIKA 3APGA 1TCMA 2FHFA 3WL0A 4U5IA 1X6LA 2VRJA 3BVWA 2W63A 2VQTA 2QMJA 2FDMA 2J77A 3AISA 2E9MA 3M07A 3CHEA 3F5LA 3W0KA 1AQHA 3ARSA 2J7EA 4OJYA 3AHTA 3RJYA 1NOUA 4HPHA 2CHOA 2WAGA 3NCOA 3BCDA 3PN8A 1KGWA 3W6MA 2G3JA 3ZR6A 1JF6A 1HJVA 1GHRA 2FH8A 1V6VA 4AZCA 2PI6A 4R5EA 4J3WA 4UQAA 1QVBA 2VVNA 3F5JA 3VIPA 5KZ6A 1O6IA 4KMQA 2XWDA 4N42A 3FHQA 1NQ6A 4W5UA 2XN1A 2YIHA 2VCCA 5FOOA 4BQ4A 2ZX6A 3BAXA 3ZSTA 3K8KA 3THDA 4E8DA 1NWUA 2XFFA 4HTYA 3L2LA 4EANA 2QHAA 3POHA 4P8UA 3CHDA 1B2YA 2VNCA 3WH7A 4GI9A 5A6JA 4GIAA 3MV11 5I24A 2EPMX 3I3EA 4Z2JA 1UD2A 2CERA 1G1YA 4LYRA 4AD5A 1V3MA 1GVYA 3K8LA 4BQ3A 3VD3A 1VENA 2IXVA 1QI5A 3SCPA 1GZJA 3WQWA 3LRLA 4PMNA 1VJZA 2ESCA 2XN2A 1OBAA 2CBVA 4HMEA 4CD8A 4C7FA 3ZR5A 1WDSA 1UKQA 2JEPA 1ZJBA 1KR0A 2DQXA 1BAGA 4TXEA 2W62A 2O9OA 3NDYA 2XVGA 2VL4A 1F4AA 4MADA 2QMKA 4OOUA 3EJPA 3VX1A 1JZ2A 4JFWA 5D9MA 2X2YA 3WD3A 4D6FA 4AXNA 5A6LA 1ODUA 3ARYA 3W81A 1TE1A 4L4PA 1WZKA 4AZCB 3BLPX 2WMKA 4DO6A 4A3YA 3FAWA 2GVYA 1E72M 7TAAA 1SYTA 1H0GA 3ZT6A 5EFFA 4H8VA 2VOTA 4HA3A 3GNPA 2XVPA 2O9RA 1DTUA 1EOMA 1J10A 5A69A 1CYGA 2VR5A 4PYSA 3ZSSA 1H11A 1HJXA 4HZ8A 1NH6A 2F7RA 1OWQA 3VDBA 2VZUA 2Z1KA 5A8MA 1WE5A 4KRUA 3WUGA 5BRQA 5BWFA 1B30A 4GO8A 3WD4A 3UG4A 5CLWA 1FHDA 1WKYA 2FE0A 4GXPA 2BNJA 2ZUMA 3BSGA 2EXOA 4P8VA 1KBKA 1ZBVA 3AMCA 3SUSA 3N17A 3OG2A 2J47A 2V3DA 1QPKA 3AIBA 4HZ6A 1BG4A 1CDGA 2J4GA 2XFYA 4NSBA 3NUKA 4QDMA 2YA0A 5HNNA 2VZTA 1GPFA 1CGTA 1ZS2A 3A22A 1BGAA 5ABGA 1JL8A 1CNVA 1MW0A 1JZ5A 1NARA 3T0BA 2XSAA 4E8CA 3B9AA 3MANA 5JIPA 1K9FA 2E3ZA 5LA0A 1E4MM 3WD0A 1B3ZA 5I79A 4HOXA 2DPEA 5JBDA 4Z2GA 1D7FA 3BVUA 1BFNA 2BVYA 4AZ7A 3VMPA 2F2HA 3LPPA 4D71A 3AS2A 3L4ZA 2D1ZA 3FW6A 5IFTA 1XV8A 1FH9A 1EA9C 3WY4A 1ZBCA 2J7FA 3VPLA 1HL8A 4FNRA 3CLWA 2GDVA 3KL3A 3LRKA 2V3GA 4M1RA 1KFWA 1ISYA 1JYNA 1E3ZA 1SZNA 1V3KA 2IXUA 2PWGA 1DP0A 1LF1A 3W82A 1J01A 1HN1A 3OLGA 3AIQA 4U2ZA 2Y24A 7CGTA 3EDEA 4NRSA 2DIEA 5CZKA 2BFGA 3WNPA 4M81A 2D0GA 4MB3A 4IPNB 2A3BA 1NP2A 3ARUA 1JNDA 4JFUA 3WNLA 1E40A 3MUY1 4CN6A 1MXGA 1W1PA 2VX5A 2WC4A 1VBUA 2BHZA 4D6GA 1UR4A 2W91A 3MKKA 4J3UA 5HPCA 2GFTA 1OD8A 4JL2A 2WBKA 2HVMA 1DWAM 2NSXA 4QFUA 3W37A 3VDAA 1SFSA 4W86A 3PBGA 4FNPA 3GXTA 1KGUA 2XHYA 4CD7A 2ZUTA 3POCA 1MQPA 2GDUA 3WN6A 2CHNA 2ZUSA 2W61A 2OYLA 1MQQA 1J0IA 3AJ7A 3GXMA 2V5DA 2DSVA 1BLIA 2CXGA 1V3LA 3VX0A 1HVQA 4OBRA 2ZXAA 1EDTA 3HN3A 1VIWA 5IHSA 4ACZA 4GKLA 3VILA 3FAXA 3AYRA 5EBAA 3UEQA 3CPUA 4UZUA 2X0HA 4UCFA 3EDKA 1YQ2A 1KCLA 4GI8A 2JALA 4DWSC 5BCAA 5CGMA 5JUVA 3T0DA 6TAAA 2PB1A 5C8BB 2VVSA 4H8HA 3VIIA 1DWHM 3ZJ8A 1XCXA 1TVNA 1KXHA 5IDIA 5A8OA 3OB8A 3VM7A 1NOFA 4KGLA 3VVGA 1W1VA 1R75A 4X0VA 3ZT7A 2VX6A 4PMZA 2CPUA 1PZ2A 2XYLA 3CUHA 3AICA 3B8SA 3WY2A 4PMVA 1C92A 3SUTA 4Q22A 3VO0A 3VSUA 4UFMA 3BCFA 4ZFMA 1LLOA 1R46A 4NXKA 3CTTA 1ZL1A 3TV8A 1RH9A 2J7GA 2E0PA 4IPLA 3AHVA 5EB8A 4TVCA 4CVWA 4D6IA 1PX8A 3N04A 2E40A 1MWOA 3D4YA 1CPUA 1B1YA 3CMJA 5D8WA 2YDQA 4AEEA 1I1WA 1QWNA 4J28A 3MMUA 4HU8A 4CU8A 1CXFA 5CJ5A 2CITA 4AC1X 3MS8A 1HVXA 3TP4A 1JF5A 1E3XA 3WF1A 2IGTA 2O9TA 5HBFA 2OWCA 1DEDA 1UD3A 2BY1A 3VGBA 3AIWA 3AS0A 3WKZA 3CHCA 2AOSA 3UR7A 1XCWA 3A21A 3OGRA 3G6LA 3PZNA 4PEEA 1EHNA 1QW8A 1J11A 1I1XA 4PTMA 4BA0A 3WY3A 1OGSA 3B9EA 4AD1A 4EK7A 2FHCA 1FA2A 1AQ0A 1R7OA 3EDFA 3GNOA 1TVPA 5D9OA 3DX4A 2ALWA 3RILA 2B31A 1LL6A 4PMOA 4XB3A 3PZ9A 2WCSA 2C0HA 4W8LA 1GQIA 2WMHA 3AMLA 3WEZA 4P8WA 2ZUUA 4MJ4A 1E9LA 1XSKA 1PZ3A 4PMDA 2PWEA 2AMGA 4CUCA 1PX4A 1EOKA 2J78A 4F9JA 3VGEA 1XH0A 3VGFA 1QI0A 4XV0A 2XVKA 1R87A 1JI1A 1L8NA 2PBGA 1Q6DA 2F7QA 4BQ5A 4JZ5A 3BVTA 1VAHA 4ZENA 4ZXLA 3GH4A 1XC6A 2BXYA 1UR8A 3KLKA 1UA7A 1M04A 5I5RA 1KWGA 1PS3A 4U5KA 1V0KA 3SUVA 3ECQA 1FH8A 1GQJA 4AD3A 2W66A 4Z2KA 1HL9A 2WCAA 1GORA 3SIMA 3AHXA 1C8QA 3LPGA 3CUGA 1PEZA 3CV5A 4XUYA 4B9ZA 3CZJA 4XX6A 8CGTA 2G8ZA 2ZOXA 3BH4A 4AWEA 1JDAA 2WANA 2QPUA 2CBIA 1R7AA 1IT0A 3HG2A 4JKLA 2BV9A 5AYIA 1HKKA 2J7DA 1UKTA 4HA1A 3GZAA 2DT1A 1QI4A 4OZOA 1J0KA 3DYPA 3WL1A 1HNYA 3CZSA 1LG1A 1BVNP 2GK1A 4X9YA 2JF6A 4UFJA 5ABEA 3BLKA 3PZGA 2XIIA 1QNPA 3VMNA 4P7RA 3WF3A 3QGVA 5A2AA 4TTUA 2FGLA 4NXSA 2GJXB 3W28A 5A95A 8A3HA 2V5CA 3VDHA 3WH9A 1KXVA 5DFAA 4B16A 2EJ1A 4CD6A 4W8AA 4BQ2A 1V0MA 4UFLA 2J79A 9CGTA 1TFVA 2GJPA 3AXXA 1KXQA 1KQZA 1V3IA 1JZ7A 4ZE5A 5M3WA 3OBAA 2CNCA 3WEMA 4P7QA 4UFKA 4PSPA 4HPGA 5I6SA 2F7OA 2XJ7A 2XM2A 1W9VA 3UG5A 1UZ1A 3KL0A 1R8LA 3BUIA 3S2CA 2DSZA 2F7PA 5IFPA 1GJWA 1T0OA 1EQCA 2CCRA 1OGGA 3MU7A 5I3DA 3CUIA 4FLOA 3M6DA 3QHNA 1RP8A 4W85A 3KZSA 3AXIA 4BCEA 2QV4A 3THCA 5EFDA 2WHLA 1XSIA 2PBOA 3FXYA 2J7BA 2BHUA 3M46A 4FLSA 4WKFA 2C7FA 1BYDA 3GH5A 4CCCA 1R85A 5D8ZA 4ATLA 3BMWA 4CN4A 1NWTA 3L4XA 2WSKA 3PZIA 1KTBA 3AFBA 1CGXA 4NZJA 1EQPA 4HP5A 1VEMA 1BQCA 1HJQA 1B3WA 5CGTA 4OKDA 1GOQA 4L4OA 1R47A 3ARPA 3A3HA 4PTVA 1D2KA 4AY1A 1QBBA 1E6SM 4PTXA 1CGWA 1V0LA 3T09A 4M56A 4H04A 5ECUA 1KWKA 3WQ6A 1U33A 4QCFA 1IZKA 1J0YA 2JFEX 2EPOA 1M53A 4EKJA 5A6BA 1LL7A 3EDDA 3D5HA 5C71A 3TTQA 1E43A 1H4PA 5DT5A 2X0YA 1WZLA 3O6AA 3WNMA 3VKKA 2ZUWA 1RD6A 4YN5A 3HU7A 1CBGA 4PTWA 3L4UA 3BUPA 4V27A 3IANA 3UESA 2PWHA 1UR2A 3SCTA 3L4TA 1TQVA 4UQEA 3MUIA 5A1AA 2E8YA 1QNOA 5AY7A 4B9YA 3RO8A 2YA1A 1E73M 3NSNA 5E09A 2WVVA 2JIEA 4OBSA 4UQDA 4TUFA 1G0CA 4FK9A 3L4WA 3WSUA 1GNXA 3PZUA 5CPQA 3AZTA 2XPKA 4FLQA 3DX2A 1BYBA 2WNWA 1X1NA 3DECA 4MNMA 3DDFA 3BMVA 3I3BA 4KH2A 2WBGA 1KQYA 4PUEA 1I75A 1V3JA 3AOFA 1HIZA 4J27A 1QI3A 2EO7A 5FIPA 2GJRA 5FL1A 1UKSA 1NM9A 1VFUA 3ALFA 2CBUA 1BHGA 3VD4A 5FL0A 1WP6A 1C93A 3D50A 4MPKA 4CD5A 2WMIA 1GUVA 3AZSA 5LA1A 3AHYA 1LWHA 3FNDA 3DX0A 5CG0A 1JYXA 4R27A 1WZMA 3GTNA 3N12A 1TQWA 1H0IA 4C7GA 1HX0A 1EGZA 3VINA 3UETA 3KE0A 3CMGA 2BVDA 2E8ZA 1WO2A 1HJSA 3VGDA 4D1JA 3WY1A 4A3HA 1E56A 3MI6A 1IV8A 2OWXA 5A6MA 1OT1A 2BY3A 1UASA 5CSYA 2FHBA 4GI6A 2XG9A 3MSGA 3MMDA 4P7NA 4D6EA 1KR1A 4AIEA 4WSKA 1KTCA 1G5AA 4JCLA 1OCQA 1FHLA 1E0VA 4AISA 2FGZA 3QHOA 2OYKA 4B15A 4FF5A 4HOZA 4LYPA 3WUBA 5GNXA 2UY3A 1EHAA 1CXLA 4D6DA 2OSYA 2X2JA 1KGXA 1CLXA 3BAIA 1W9BM 3CUFA 2WVUA 3VMOA 4AZHA 4D6CA 4ML4A 3ZJKA 5F7UA 3UG3A 1E6NA 4FMVA 3T2PA 3N11A 4AMXA 3WH8A 3VDCA 3FHAA 3K1DA 4MNKA 2WCGA 4ZXOA 5DMYA 1JI2A 1V6YA 4H2CA 1GOIA 5HXMA 3WNNA 1UWTA 3AIVA 4J3XA 2D3NA 4MNLA 5DEZA 1DHKA 2OYMA 1VF8A 4W8BA 1OSEA 4TVDA 3W24A 2EADA 3EDJA 2VURA 4V28A 5FKYA 1PIFA 1W1YA 1BVZA 1TQUA 5BXTA 4FNTA 3L4VA 3L4YA 3DC0A 4WK9A 1UH4A 4BS0A 3U5YA 2BY0A 2NW0A 4W7VA 4TX8A 4GINA 4MNJA 3IJ9A 2PWFA 1GQKA 2VCBA 4Z2LA 3RPMA 4NZCA 4UFHA 4ZEPA 5DO8A 3VIJA 3WBEA 1PBGA 1J18A 1W32A 5BXRA 3WEOA 1F4HA 2WMJA 5A6BD 4F8XA 4FNQA 4MTVA 4OIFA 1E6PA 3A4AA 3PZMA 4UOJA 1PIGA 3VIFA 4XZWA 4CD4A 1UZ4A 3DHUA 2ZXDA 5M03A 3EYPA 3LPFA 3MV01 4P7LA 3WDIA 2ZXQA 3GXNA 1UWUA 1NWSA 1WNOA 2DT2A 4N0RA 4W88A 4AZIA 1MW1A 2XGBA 3AI0A 5E70A 2ZX9A 3DX1A 2EEXA 1ZU8A 5ABFB 3PHAA 1JIBA 5I77A 3AS1A 1OINA 3WNOA 1VRXA 3CZNA 2J74A 4AZGA 3ARVA 1US3A 1JZ8A 1EDQA 5D9PA 3U5UA 1QNRA 4JL1A 2ZWZA 3DX3A 1TG7A 1HP4A 4CU6A 2OLHA 1QX1A 1BG9A 1UH3A 1E0WA 3ARWA 4MB4A 1UWIA 1XH2A 5TD4A 4AMWA 2UY2A 1P6WA 3TTSA 3DHPA 3ARTA 1XH1A 5A8QA 1Y7VA 3QHMA 2JEQA 3CGTA 3UR8A 3WD2A 2WC7A 4S3KA 1B90A 2WW5A 4JKKA 3AXHA 2G4FA 3VIOA 3NIYA 4H7VA 3W27A 4E2OA 3BAYA 4JCMA 4C7DA 2ZX5A 1K9EA 1EO7A 2BXZA 1ISWA 3W4RA 3GM8A 1CGUA 3QOMA 1JXJA 2A3HA 2CYGA 1GVIA 3VGHA 1MVYA 2EPKX 2DGAA 1ITXA 3ZT5A 1UUQA 4IM4A 4B3KA 5D4YA 3BAKA 1XSJA 1HXJA 4LQ1A 5A94A 3WF0A 1B31A 4Y7EA 2EAEA 1VBRA 4JAWA 3EJSA 3PZOA 2DH3A 1L0PA 4MJ2A 1ZJAA 2Y8KA 3A6OA 4H41A 3EMQA 4U3AA 3HG5A 3TOPA 3BC9A 2A3AA 2DSUA 2WK2A 2ZWYA 2YFNA 4W87A 4AD4A 4UZSA 1AQMA 5CLTA 2WB5A 3WENA 1GJUA 4PBGA 1US2A 4UR9A 4QAWA 2WWCA 4JFVA 4D1IA 1E6RA 4LX4A 1J0JA 3VD7A 1E0XA 2YBTA 1BGGA 2OWWA 1BF2A 2XVLA 4LPCA 2W92A 2DEPA 4AIUA 3QR3A 3PTKA 3VIHA 2WMGA 4NI3A 4PMQA 1JFHA 2NT1A 3BAJA 2FH6A 3OIHA 5DT7A 4LYQA 3HG3A 5CSUA 2A3EA 3TTYA 1QNQA 3WQ4A 3KWXA 3WF2A 3MUZ1 2YBUA 1UR0A 1EO5A 1E6QM 4UFIA 1Q4NX 5HPOA 2CKSA 1C8XA 3BXWA 3OLDA 3F5KA 4BF7A 1K9TA 4D72A 2V3FA 1UG6A 3BVXA 4GPNA 1DWIM 1C3FA 2YLLA 1UD6A 3AMGA 5I23A 3GXDA 1V6UA 3RM9A 3HG4A 1KXTA 3A47A 4TTGA 1IZJA 1CXKA 1E4NA 3OGVA 1QHZA 4W5ZA 2YOCA 4NF7A 3GBEA 2CETA 3VSVA 1Q6GA 2NT0A 1E4IA 2MANA 1CWYA 4GQQA 2C8NA 3N15A 2WHMA 2CIPA 2D20A 1NOWA 1ISVA 4EAMA 1B3VA 1TQTA 4MAVA 2GSJA 3AQUA 3ARRA 3W6LA 1W91A 3ZOAA 1XYZA 1J9YA 5A6AA 3RCNA 1WB0A 1W3JA 3PTQA 2VX7A 2F1BA 1X6NA 2J75A 4F9DA 2VCAA 3BAWA 2WWDA 2WHKA 2G3IA 1H41A 2DDXA 3S6TA 3II1A 4HZ7A 4F66A 5CPTA 3T2QA 3T0AA 3CZ8A 2WLZA 1R34A 4KRTA 4YHEA 1JD9A 3IJ8A 4X0NA 3UERA 2XSBA 3VTRA 1ISZA 4HMCA 3F4VA 3N9KA 2EABA 1KCKA 2VZSA 1QNSA 2EACA 3WF4A 1H49A 5E6YA 5BROA 1JFXA 1WCGA 3KEHA 2YL9A 1QBAA 5I2UA 3NSMA 4J3TA 4HOWA 1V03A 4DM1A 4AYGA 4UQCA 3BUDA 3PZVA 1UR1A 1MFVA 2ZUVA 5BXPA 1ODZA 3D51A 1CXHA 1W3LA 2G3NA 4Q7NA 3JUGA 1JDDA 2OSXA 4NX0A 3GXFA 2YL8A 3NJ3A 4W89A 3LMYA 1GOOA 3OZOA 1CXIA 4RL3A 4CU7A 1WDPA 3ARXA 1VEPA 2XTKA 1BPLB 3A5VA 4E4PA 4PMRA 3CZGA 2RGMA 3W26A 2ZX7A 2F18A 1KB3A 5E9AA 7A3HA 5A2BA 4PN2A 4W84A 2PF0A 4RE4A 5A3HA 3VOCA 5E0CA 4GZEA 4ACYA 3VD5A 1TQSA 1RP9A 2Z1SA 1FFRA 4XZBA 5A6KA 2EQDA 2WPGA 2W4XA 1FP8A 5FD0A 3MUAA 4BZYA 1W3HA 2E4TA 3FN9A 3H54A 2CKRA 4M80A 4DUVA 1GHSA 3FY1A 3MSDA 2WZHA 5C70A 3VSTA 2X05A 3B9DA 3T08A 1UKPA 1V08A 1E6XM 2Q8XA 2DIJA 1U2YA 1UQYA 4K68A 1V6WA 1SMDA 3VIGA 4ATDA 2GUYA 3HZ3A 4UQBA 1CTNA 2VRQA 4ACZB 2IUZA 3DYOA 3WQVA 2XFRA 2WXDM 4HMDA 3U7BA 4RE2A 1QHOA 4TX6A 2VJXA 1V6XA 4V2XA 2YJQA 1R33A 1W2VA 3WD1A 4OOZA 2F8QA 3VD9A 1EIBA 5I0DA 1HJUA 2D23A 1MW3A 3ZJ7A 2ZIDA 2WYSA 1E71M 3PZTA 4CVUA 1JZ6A 1D3CA 3ZQ9A 3HJEA 3NSXA 1ESWA 4AD0A 4W7WA 5CXPA 4MB1A 2VUYA 4AZ5A 3OLIA 3TA9A 4CKQA 3SCVA 4KGJA 2EBNA 5LA2A 4B3LA 2WKGA 3A24A 1E5NA 4CN1A 3EJUA 1FOBA 3RDKA 2BHYA 3A23A 2BVTA 3WFLA 1BSIA 5E6ZA 2J8GA 4Z2HA 1WDRA 1FH7A 5EMYA 4M8UA 3ZO9A 3WMBA 4GZJA 3AIUA 1V3HA 2J7HA 3MO4A 3LXAA 3O9NA 4J7RA 3WDRA 1UWQA 5DF0A 4LGXA 2XWEA 4FNUA 3VNYA 1OIMA 1TA3B 2DT3A 4IISA 2FYVA 3AIRA 5AC4A 1SR0A 1GONA 2JF7A 5BRPA 3W38A 1OIFA 4UNIA 2JE8A 2F61A 1HKMA 1TZ7A 1XD0A 2X1IA 1HXKA 3WUFA 1DWJM 1H2JA 1JYWA 1RPKA 3CZEA 1XRVA 1UQZA 4M82A 4PSRA 1W9DM 4FNSA 4AZBA 4QLLA 4MB5A 3H53A 2VRKA 1M01A 4HA4A 4TVUA 4PUDA 3SCQA 1V02A 1WAWA 3AHZA 3CO4A 3WDQA 1LL4A 3W25A 5GPRA 2Y2WA 2DSWA 4JHZA 1WPCA 2J8FA 6CGTA 1PJ9A 5GNZA 1NP0A 3G6MA 4AYSA 3WUEA 3GXPA 1WDQA 3SUUA 4UOZA 2YL6A 3T2OA 1TMQA 1G01A 2UY4A 3ZMRA 1UA3A 4AD2A 4U33A 1GQLA 3S5ZA 2X2HA 3EBVA 2WLYA 3W53A 5D9NA 2YL5A 2WSPA 2DSKA 2WMIB 1LG2A 3SEPA 1QWUA 2XN0A 4ZE4A 1GCYA 1SMAA 1E5JA 1NWRA 5AC5A 4DWSA 4D6JA 2CBJA 4CCDA 2VMFA 3D3AA 1H5VA 2E9LA 1JZ3A 3TTOA 1BYCA 4MDPA 4DWSB 4PMUA 1JAEA 1TA3A 2Y8VA 4DWSD 1BTCA 1H09A 2QF8A 1FP9A 4W7UA 1UOKA 1QW9A 2WZEA 2CESA 3N18A 3GNRA 3H55A 1CLVA 3I3DA 1JDCA 2YDSA 4QLJA 4KWUA 2VR4A 3RMEA 3ZJ6A 4YHGA 1ITCA 3LXCA 4GQRA 4D6HA 4DUWA 4OGZA 2E9BA 4OUEA 1O7DC 4JFTA 4U31A 3IAPA 1W2PA 1CEOA 1ISXA 2ZX8A 1Q6CA 1AVAA 2XVNA 2ZUNA 4PMYA 4WJXA 4JHOA 4AMCA 1CECA 3OLEA 3EJQA 1EH9A 4PCTA 2BY2A 4PMXA 3AS3A 2EPLX 1CGVA 3A4XA 1TUXA 5CQ1A 3SCOA 1M7XA 3CUJA 1GOMA 5JBFA 4MDOA 2VZVA 2Y4SA 1UR9A 1J0ZA 1PAMA 1QI2A 3WMSA 2D0FA 1DWGM 4JIEA 3WFZA 1UD8A 1C91A 3W29A 4FLRA 3UCQA 1ECEA 1W9XA 4S3JA 3IAQA 2W67A 3AROA 1E70M 1UKOA 3WMCA 3AIEA 2X09A 2BS9A 4LXFA 1HWWA 2VTFA 3NYDA 1UYQA 4U3CA 3BUQA 2A3CA 1HJWA 4TOQA 4PRWA 2ZICA 5I78A 3VU2A 3WELA 4RE3A 4HU0A 3AMKA 2VQUA 4M29A 1MQRA 2WVVB 1OGBA 3QOKA 1B0IA 1J12A 1QHPA 3WBAA 4DO4A 1UHVA 1JGIA 2YA2A 1EXPA 2WVSA 2D2OA 2TAAA 2VI0A 3CIVA 3VGGA 3L2MA 3DDGA 1TR1A 2AAAA 3BVVA 2EPNA 5E1QA 3DYMA 2D73A 3LX9A 5ABFA 2JIWA 1K9DA 3IJ7A 2ZE0A 3J7HA 1UWSA 1UD4A 1FFQA 3SUWA 4MAZA 2G3MA 3CZKA 1HKJA 3TONA 4WSJA 1S46A 3GXIA 1C90A 1VFOA 1MFUA 5E0FA 3CZLA 1V02E 4AW7A 1W1TA 3ARQA 1H3GA 1Q6FA 3WIJA 3PZQA 1CZ1A 1VJSA 3ZIZA 3K8MA 1BYAA 1XD1A 4P8XA 2VX4A 1HT6A 2CEQA 3LXBA 3AYSA 4J3SA 5GNYA 1E1FA 2WM0A 2WZIA 2PC8A 2Y5EA 5M17A 3D4ZA 2PWDA 4J3VA 1XGZA 1GOKA 3NDZA 3U7VA 3SCNA 4QP0A 1W9UA 2XUCA 5HDRA 3EJTA 3KLLA 1OT2A 3WH6A 1Z32X 4WLCA 1Q6EA 3MMWA 4GZIA 4EE9A 3EMCA 3EMZA 1XHGA 4F79A 5BXSA 1E4LA 3OA5A 3LRMA 2D22A 4UTFA 3WDJA 3O2LA 1CXEA 5IXEA 2ZXBA 3K46A 4DO5A 5AYBA 4QCEA 4YPJA 1AMYA 2VO5A 1GOWA 2OW6A 5A8PA 1OB0A 5A6SA 2X2IA 1E55A 3AMDA 2F1AA 1O7AA 3ALGA 3S5YA 1M03A 1ZBWA 4A4AA 2YFOA 3K4DA 1XYFA 2GK1B 2WKLA 3WDPP 3SCWA 5A8NA 4UOQA 3BGAA 3GYCA 1VB9A 1YHTA 2W5FA 3CHFA 3BUBA 5LYRA 4AEFA 1H1NA 3IGUA 1K6AA 3IK2A 3EJRA 2O92A 4P7OA 3OGSA 3SURA 3GH7A 2J7CA 5JBEA 2QPSA 5JIWA 5BYWA 1ZBKA 3WDHA 2VT0A 3OZPA 2UY5A 1C7SA 4WIWA 4H8UA 2DT0A 1PX3A 1JZ4A 2YDRA 4QLKA 3E1F1 1C7TA 4IUGA 3RM4A 1B3YA 1A3HA 1JAKA 2QLYA 1GW1A 4NRRA 1MYRA 5HOSA 4CGTA 1R86A 4W93A 3RM8A 1VFMA 1W9PA 1UD5A 1JG9A 1A47A 1LWJA 1OM0A 2WVTA 2X8RA 5ABHA 1CGYA 1HP5A 1JXKA 4DM2A 3VNZA 3SCSA 4URIA 3N1AA 3CC1A 4NZFA 1LJYA 3WQ5A 4U2YA 1E15A 2DH2A 3CBWA 3M7SA 3VM5A 2D3LA 3SCUA 3BSHA 5A2CA 1PPIA 3K4AA 1HKIA 1W3KA 2WC3A 2J62A 3U57A 2XGIA 1JD7A 3KL5A 5GQBA 3D52A 4WF7A 1J0HA 1QOXA 2VC9A 1HTYA 3CH9A 4WKAA 2O9PA 1DWFM 2XM1A 1MW2A 3HMCA 3VIMA 3N13A 3PTMA 1UWRA 6A3HA 3WQ8A 4GO9A 2D0HA 1B9ZA 4AIOA 1OD0A 1E1EA 3ZM8A 5FCZA 4AZ6A 1N82A 1VFFA 4CCEA 4PCSA 5CPSA 1LQ0A 1ZB5A 3GBDA 1WZAA
chains in the Genus database with same CATH superfamily
2XC8A 1OGAE 4UTAL 2R1NA 3Q43A 1CD0A 1DUZA 2AS5M 3UGVA 3GYRA 2OSLB 2HT2C 3WNKA 2Z0BA 1KB9K 4N2IA 2FLRT 3QISA 3GDBA 4CGUB 1BZ7A 2C1PB 5IHRA 2WM1A 1NIBA 1TEFA 5C08E 1OYAA 1UP3A 3M47A 1NCWH 2DQUL 3KXFE 1QFUH 5B3NA 3WJJC 2YLAA 5GGUB 1VPYA 3U2EA 5EC2B 2E86A 1KJMB 2G41A 1PW3A 1QRNE 1CYXA 4O5LL 3WH5A 5IDIA 1TTGA 4NP9A 5C0CB 1ZT1A 3QM3A 1FYTA 2QVNA 3QPZA 1UWGL 1CLYL 1HF6A 2GUOB 2WBJD 4JCWA 3TNMB 1USZA 4K3JL 2ARJA 3V4BA 2CG9X 3QMRA 5BZXA 3ZKSD 4CDGC 3RPIB 2JCCF 3EZJB 2RCSL 3VXPA 3OGOE 3BVNB 3K74B 3TH4T 3QAZC 1TNMA 2IBZX 3BKMH 2D24A 3V95A 1OW0C 4XIMA 5FW6A 1A50A 2VLKA 3UH8A 2IXQA 4XE0A 4XT1C 4MHBA 3K5SA 2E7LA 1FGNL 4UDUB 3K6FA 5F1VA 3MUUA 3HG1E 2GSGA 1UB5A 3MRGB 3RIKA 2F08A 1NGXA 4P5KB 2PTUA 3MOBL 1CTMA 1KDJA 1VS1A 3N6QA 4FTVE 4JGJA 5FO8B 3D1MC 3CJJA 3LD8C 1AQKH 1R5YA 4PJHB 3PWLA 3JWOC 5IW1A 1PHWA 3D39B 4UXDA 1VEOA 2DV6A 5EC1A 2Y1VA 2GSGB 3BESR 3O81A 4MDJA 2OW7A 4DUXA 1IWPA 4BJLA 5KOMC 3RIAF 1EDGA 3MJ7A 4Y5YA 3BWWA 3PK7A 2E27L 4WK0B 4O02A 2IFFL 5I19H 4U5IA 1RVGA 1I0DA 4EP8C 2DZAA 2W63A 2IWEA 1ACYH 5EC1B 1ZPTA 4IWWA 4C6LA 4ZOBA 5L4IA 1PEWA 3LQZB 5KUKA 3GRIA 4QROA 4OCNC 5ICYA 4ZQPA 3CHEA 4M03A 1S7TA 4BKLB 4N4YB 1PZ5A 4PLKD 4ML9A 1PD6A 1TZIA 5I66A 1A6TA 4OAWB 4QRPB 5E9DB 5GIRB 5GZNC 2GK2A 3KLHC 4L6DA 4HXAL 4LBRA 2P0IA 1NOUA 4AHPA 4FKKA 3NFSL 1MI5E 5ABAA 1GYLA 1M6JA 1SUJA 4APQB 4ZMXA 2QPXA 1V4YA 1PZ5B 5JOFB 2RTTA 3P77A 1MEHA 3EWUA 3IMRA 1P1ZA 4JRXE 4L9XA 3M0YA 1UWUA 3GHSA 4XPHL 4LVFA 1GHRA 1OTSC 2HG0A 3B83A 4I5XA 3T3PF 3L5IA 5CQ1A 4O1EA 1KO0A 4R5EA 3HR5B 2N0MA 3UJJH 4OLVL 3NIDB 3CTLA 5HI5C 4PJ8D 2W0PA 1VCVA 1I3RA 1O6IA 4LOCA 2AJUH 1CN4A 1T3FA 2FJFA 4G70B 1Q0XH 4S1DC 4N42A 1ACZA 5E2VL 3DMMC 2B59A 4FJ6A 5B38B 1E9OB 1NDYA 3DENA 5CCGE 4DZIA 4YQXL 2OOFA 3KD4A 3LUTA 3SIKA 5EN3A 1UWXH 2Z4QB 1NQ6A 5L2JB 1FG2A 1ZLUK 1W1IE 4WEVX 1NICA 2ZX6A 3SO7A 1WIUA 2WXOA 3I7QA 4H25A 4QWWD 2HT3C 2FJFB 5DRWA 4ZXBD 5MERB 3K8KA 3PFRA 3TIEB 4E8DA 4YE4H 5DHMC 1L9WA 5J13C 4Z7OF 3LDBB 1NUNB 1MLBA 4EF8A 2KZKA 3CE1A 3C09B 1T5WB 3IE4A 4OLUH 5M95B 2H9AB 1R3YA 3POHA 4KF1A 2I69A 3MSYA 1FFOB 4HJ0C 4P8UA 1RPQA 1MCIA 4ELMA 2J88H 2JKWA 3TN5A 4LUJA 4H0GA 4OGAC 4L3EA 3TO2B 3RPIA 1EPVA 2A7NA 1RZIA 2CO6B 1PDKB 3HPJB 4EI5B 3MODH 3V0VB 5I24A 4GB9A 4BDVB 1AGBB 1XDJA 4LVNB 1UWEL 3AADB 5IEKA 3P6LA 1FFOA 2FTPA 4Z2JA 1UD2A 3HBZA 2VLKB 2ZXGA 2G3FA 4OTKA 1V77A 2E75C 1J93A 1YYCA 3TO2A 5DJ2B 1XS2A 2X70A 3CPLB 3K8LA 3CZFA 5LG1A 1NGXB 1YO4A 5EO1B 1M56B 3IUHA 4BQ3A 5CKAA 1ID5I 2VR9A 1U3YA 4BSVA 3WJZA 3B4NA 4ZW3A 4BV1A 1QI5A 5F1UA 3SCPA 3WQWA 4X9BA 3UXDA 2XH2A 4U6YA 4CNIB 5I5IA 1OE3A 3MRMB 5ITBH 2PYEA 4XG1A 1DORA 4WY0A 1WA1X 3FZUC 4OGYH 3T77B 4I0PB 2XPGB 1BYNA 1G4TA 1OBAA 2CBVA 3TNOA 4C6KA 4Y9AA 4RGND 4PIBA 4MBRA 1T1XA 4QXUH 4H26A 4W6YB 4XVJL 2R24A 2Z28A 5C0NC 3G1XA 3ABMB 3RFAA 1RVFH 1WDSA 5CUSH 4C7FA 1TU2B 5AW3B 4BM7A 4ZTEA 5C86A 4PA8A 3G7TA 4E38A 1N2VA 3NQDA 2J3SA 3A13A 4JQ1A 1G4RA 3F6LA 3NN8B 4HKJB 1ZVHA 5JUEL 2VC2B 3G3LA 4H26B 4PCYA 1IR2A 4ZSOB 3ULSB 2CCVA 3PAOA 4DEPC 2IALB 4XCFH 2QMKA 4ZD3L 2G2RB 3S35X 3GC2A 1JZ2A 1KLFB 4X63A 1JPFA 2V5RA 1FCBA 4LJ3A 1T7YA 4JFWA 1GPOL 4APQA 1AW1A 1OGTB 1FZMB 1DQKA 2INFA 5D9MA 5FEWA 4D6FA 1SZEA 4E4UA 2PXYB 3AC0A 2WLIB 2AEQL 4XTRD 4ZUSB 1PE1A 3BLFA 1EVUA 3V6OC 1T1WB 3G8EA 1Z3NA 5DA0B 3ARYA 2NPLX 5EKYA 3PPGA 4DELA 2ZTKA 5ADPH 1DANU 1BIHA 2IV9A 1O9WA 2RH0A 4ZI8A 4DKEH 4XSMA 1I31A 2ZNWA 4N20A 4A3YA 4I9AA 2D7MA 2XQ0A 3P0YH 2YSWA 2GBVA 1A1OA 5EZIH 4B5UA 1MFBH 2OCJA 3MXVH 5D1ZC 4HK7A 2EYTA 1AXTL 7TAAA 1KYOJ 1K72A 3OKEA 4P4KA 4ILSA 4K3DH 2VOTA 4JRWA 4QS6A 3ARFC 3MRQA 2BNRD 2L7UA 2O9RA 3FQXA 1DTUA 5AVZB 4GXUM 4FX6M 4ZMWA 2EYTB 1FNSL 3FO2A 1T6VN 2YZRA 2QV2A 2ZWLT 4ZRGA 4EPDC 4WTZA 2LHAA 4HIQA 2VR5A 4G6MH 4GQ0A 4GSDH 4PP2A 1HJXA 3IRDA 1FWSA 5F9WC 3NEXA 2VW6A 3M4HA 1N4XH 4EVNB 2F7RA 3WFEL 3MNVB 1OWQA 4GUHA 1T04A 2OMZA 3L8QA 5DY3A 3G6DL 3UCCA 4B3EA 4QRQA 2Z1KA 4REQA 1HEZB 2CO6A 4NYYA 4ZW7A 2Y6SC 3RNKA 1RZ8B 2P80D 5BQ7B 2E6DA 1KD0A 4QRAA 1WIOA 5BRQA 3MJMA 5BWFA 3UG4A 1XIWA 3HMXH 1UR3M 4ESKA 5DFVC 1NVMA 3PWGA 1F73A 2FE0A 2MTPA 4MA8H 4JHAH 4QHMB 4GXPA 4WGHA 3QUMB 4NO3B 1BOGB 2HFGL 1KXTB 3UO1H 1F61A 2AQWA 2ZUMA 1CFQA 3C8KA 4B53A 2X1PA 1ORQB 1VHNA 4IKLA 1KBKA 1CFBA 3GBNL 2Z31D 3QO0B 4DEUA 5A2FA 3SUSA 3FRPA 4B9CA 1X7FA 3BP4B 2DUZA 3UXAA 2V3DA 4FQQA 3AWEA 4MJ6A 4PJEE 2YQ2A 5J5RA 1M05A 2Y3AA 3P54A 2J4GA 5CFHA 3MSPA 3OO2A 1NC4A 4M6OH 2RR3A 3FCUB 1I9IL 3QQDA 4FRWA 1I2QA 2OELA 3UBXA 3TFCA 4PUBH 2VLRB 2YS4A 1TG8A 2XA8L 2VZTA 5HNNA 4G11A 4JFHD 3VZXA 4ZFCA 1S5HB 3BKCH 4UMAA 1SBSL 1YAZA 3W7PA 2A9NH 1YPZB 1TZHA 3MLTB 5FUZH 3IJSB 2N1TE 4JFPA 5K93A 3BW2A 1A5CA 3KW8A 4WDTA 5LXEA 5C0DA 3SBWA 4XODA 4KH9A 3RPDA 3I9AA 2JKNA 3CSYA 3MLZL 1MFEH 3MN8A 5AZ2H 1UZDA 2E1DA 1J5IA 2NUXA 2R94A 4IICA 4JY4B 4MASA 3G77A 3FF8A 5FFOA 4NUGL 4AQAB 1CNVA 1N64L 4FP8H 1FZJA 4OUUA 4IRJB 2XSAA 3B7TA 3EH5B 1KFAH 1EBHA 3SPCA 5F3BB 4ZUTB 2E3ZA 5DTFA 3AUJA 5AHIA 5LA0A 3W7RA 4XGZA 1ZWIA 1MCPH 3A12A 5BOEA 2PR4L 4V33A 4KKPA 5JORA 5IB3A 2DMCA 5I79A 4OF5A 3MZGB 5JBDA 4HNUA 5TE4L 3N2BA 2MNRA 1ADQH 3TEXA 1D7FA 2ZA3A 4FA3A 4FFWD 4OZFA 5I2IB 2Y7FA 4PGEA 3PULA 4Z9KB 1NAMB 3OKEB 2F2HA 2QVTA 4BWUA 3WHXB 1K5NA 2BC4A 2YAQA 3V5HB 5HI3C 3AS2A 4A3UA 3D69A 3GR7A 1EP3A 1D5ZA 2QHRL 2NY1D 2ROYA 1FF5A 1XV8A 2JLPA 1PL3A 3QDMA 5FO7A 5T3ZE 1S7VB 3MUCA 2QQNL 2XA3A 3PP4L 3GVGA 4RLIA 3WQGA 2OZNA 3CN1A 1KTNA 3FB7B 4I77H 5D1XB 3KDNA 5D96C 1LUCA 4M5PA 2XQYG 2AJ3B 5GRJL 4FNRA 3CLWA 2A7PA 4HYWA 4X6CB 1NGZA 3AREC 1IC5H 4P2RA 5T5NG 3TU6A 3S88L 4AG0A 1ISYA 5IOBA 1SZNA 1JF1A 3CSGA 4E41D 1BQHG 1D5BA 1DP0A 4S1SL 1CDUA 4IDJL 4QTIH 9XIMA 4A68A 1I9JL 3QUYC 3W82A 4AGLA 1HO4A 2WQVA 1HO1A 5L9FA 4RAVB 4PV1C 1ICPA 2EG8A 5F4SA 4FEMA 3MJ8B 2FQEA 3AIQA 4ODXA 4CVXB 2X4SA 4U2ZA 7CGTA 3O11B 2PDCA 3PPFA 4GXVH 1HTIA 1IHIA 4WRHA 3WNPA 5D70L 1XIFA 3PJSB 3OA3A 4N8UA 4ABVA 1UJPA 4M81A 4B5WA 4MB3A 4PPTA 4Q8TA 1CLOL 5EWIL 4IPNB 1JE6A 5CILL 3X3GL 1FWEC 4BA8A 3BT2L 4IRZA 2K4AA 3NAAL 1SJXA 3G2GA 1OZMA 1T8QA 4P48A 3C8KB 3EW3B 4G7YL 3MUY1 1UM5L 2WOYA 4CN6A 1JRCA 2VYRE 1WS7A 2WC4A 3VG9C 2A6JA 2MQ3A 5GGVH 4D6GA 2PTTB 5IROA 2BWGA 3N4FA 2PSNA 2RD0A 1DEEB 2GEEA 4KTEL 3RJOA 5EF3A 1OARH 5EBWA 4DB7A 4MAYB 3SYPA 4J3UA 4DRSA 3QDGD 4ZO6A 3QJFA 3BUYB 3KGTA 4QR7A 2VISA 2M1KA 3O9WD 3N73A 1F3DJ 3MRBB 5SWZD 4XO7A 2CZ5A 3H9SE 4NQCB 1S5HA 1RFDH 2K8MA 4OLZL 5AG9A 3O0RH 5JQ9A 4POZD 3EGDB 5EBWB 4DP5X 4JG1H 4IX2A 4O13A 3TFBA 4U1HA 3PBGA 4FNPA 1XYBA 1HE7A 2GGGA 5HVHC 1MCWM 2X6AA 5BOPA 1Q0XL 2AMUA 4ZO7A 3OB0K 3B7RL 5J3HD 3TYEA 3HI6L 4PR4A 2PFHA 2ZUSA 3V0IA 5D02A 5TTRA 2GK0B 1BZ8A 3U4BH 2BZDA 2O61B 4H00A 1NCCH 5F7FA 3UY7A 3D0LA 1FIGL 5BRBA 3EOBB 5B39B 4KZ0A 2OYLA 1MVUB 1S4IA 5EA0L 5B22A 1YYLH 3EAKA 5DK0B 4PLJC 3VXME 1HKMA 4UTIA 1UOWA 2CXGA 4FQCL 3VX0A 1HVQA 4OBRA 4C5ZA 5DJXB 4YIWA 1ONQA 2HUEA 4O4YH 4P2OA 4P59L 3SYCA 1VIWA 1Z1WA 3GUFA 3FUFA 2XU2A 3B8TA 3CXFA 1G9MC 1UEMA 1E9QA 2JMRA 2H3KA 4L4TB 3UEQA 5JQ6L 2I17A 1IBZA 3WL9B 2EICA 2XG5A 4LCYB 2NY7H 3DV6A 4HIEB 1SM9A 1R0AL 1DJGA 3ARFA 1OAYL 1YQ2A 2YPVA 2EILB 4QEGA 5JPMB 4J5VA 3HC4H 4TMPA 2R0WH 2JALA 1A14L 2ZDRA 1AO7E 1CT8B 5BCAA 4K71B 1O60A 4DWSC 4G6ML 3T04D 4Z7QE 3QMTA 4XISA 1VZHA 5D1XA 3MLPA 5C0AA 4DXKA 3S6CA 4LCYA 5A16B 1WFIA 5KBDA 4HJTA 2G96A 3ECBB 4PB0L 4PJAF 4TLSA 2VVSA 3WKNA 2JKIS 2R2BA 4YH6A 5DYFA 3D9AH 4M7KH 3NPVA 4R97C 1MNNA 4UM8B 2VEIA 3O6DA 5D03A 2WSQA 3QQ0A 5AAWC 4X6DF 1RBOB 4NO5A 2PLKA 2BFVH 2YEZB 5DMKB 4R7DB 4X0KB 2DM3A 4J4PC 3S3CB 1I45A 3CFKA 3FUNA 3RGVD 4PRAA 1WOAA 4ES4A 4F0MA 4XK2A 5A8OA 2V8ZA 4XAWH 3NQGA 3VM7A 4KGLA 3KS5A 2VSMB 2UZPA 1DQIA 5F7EL 2ZWKA 1XBZA 1XWYA 1RJLA 4LSVL 3GWQA 1XUZA 5KVGH 1SJDA 4R8WL 3B8SA 3AICA 4Y19A 4MMXB 3WY2A 3W4RA 1C92A 1MDTA 4ENZA 3TBWA 5IOKA 1H6FA 3RAOA 3EO0B 1LLOA 1X5JA 4HUXA 5EOTA 4NHUA 1FO0B 2XTJB 3B3IA 1S7UB 4XOBA 3BFQG 3OQ3B 7FABH 3TV8A 4W9CC 1IC1A 1KIQA 4DZAA 4PBFA 4BUQA 3QWOA 5FYJL 5F89A 5GS2D 1RBAA 1RH9A 1GOXA 2J7GA 2DMGA 2PTZA 4IPLA 3AHVA 2PDKA 4W87A 3FSOA 4G8GD 2CXKA 2I27N 2NLYA 4CVWA 3CU1A 1PX8A 4JFEB 4AYDC 5EBMB 2EDHA 4G6FB 4LLWB 3OEXA 2XZCL 3KJ6L 4HZMA 4YGVA 4XRCB 3D4YA 2MKLC 1Q38A 4MSWB 4NZRL 2Q10A 2QCCA 1BQLL 5DT1L 4LL4A 5IJKA 1IF2A 3J07A 5I6KA 5I1EL 3MHGA 3N3TA 4E42A 1BD2E 4HU8A 4CU8A 1CXFA 1VCAA 2CITA 3S2NA 3S35L 1CBJA 3GI9H 3LCYA 3P73B 5FHBH 4YXKL 2WIIA 3PYCA 2J27A 1ZSDA 4N4QA 2X4TA 5KS9E 1BQLH 5DT1H 1S7RA 3QNXB 1TUPA 3KPRA 2IGTA 5DK0A 4IG2A 2HX7A 1MZHA 4Z1PA 3R4IA 5SX4I 2QYGA 3KBVA 1EEUA 5F96H 2O9TA 2Z8SA 1C12A 4WCJA 3P73A 3L3HB 5HHME 1VD6A 2R8WA 3AS0A 3VGBA 4P3CH 2J1WA 1JV2A 3CHCA 4GIYA 2WWOA 2CHDA 3MV8B 3TO4D 3KOYA 1ZT4A 4H6EA 4HGMA 3A21A 1A64A 4QXTA 2EEAA 1Z7JA 1J86A 4YS4A 1LLZA 3OGRA 5E6ID 4UANA 3QKZA 4DKAA 1EDHA 2VRAA 1US0A 4U6VL 1F97A 3QTPA 2F9RA 2E74C 3AYVA 1EHNA 3FDGA 3NCEB 3WNJA 3P0VH 5F2FA 1U93A 1BZOA 1RXLA 1JPEA 1OGSA 2AXWA 3FCSB 1HQRB 3MLUH 3WY3A 1MAJA 3PHQB 4A2GA 2K78A 3WTVA 4UTLA 4B92A 5F93C 1R7OA 3B2UC 4OQTA 3P8JA 3ZVHA 4L5FL 2ZKXA 2G3XA 1TTIA 4N2NA 1RV8A 1R6VA 3O6FC 1P4IH 2VABB 4CC4C 4CAGA 5I5JA 1TVPA 3FJLA 2AV1B 4OHQA 3IXTB 4W9LC 3VXSE 4ZA0A 3QO1B 2QCDB 1QQDA 5CSRA 4Y1SA 3VWKB 5T33L 3U7AA 2WSRA 1BXXA 1ONWA 4XAWL 1HHHA 3G24A 2W60B 5I00A 3DG3A 3VG0H 3APCA 3LKSA 4AUUA 4GMTL 2PDNA 1QPQA 1OE2A 4UV7L 2C0HA 1RZPA 4L3EE 1BSLA 5F2IA 1MN4A 4LF3A 3QDJD 4W8LA 2FGBA 5I74C 3HZKB 3C2RA 5MENA 3WEZA 2Q87A 5CZXC 1GSMA 2W81C 4OUOA 1KLYA 4QJ3B 1JGVH 4PRPB 4PV9A 4C91A 1T1YA 1MG3C 4HWBL 4FQ1L 1FVDB 1N59A 1BGXH 1I7TA 1W0WB 1J8HA 3PNWA 4OCYH 3QDJB 1CZ8L 1G7QB 4P07A 1E9LA 1E9PA 3OC5A 3ITTA 4PMDA 2OX5A 4P2CG 5KZMA 4BGLA 3TA4D 4NHUB 3ULVL 1HAUA 2VFFA 2G2NA 1CDCA 1PX4A 4M6NH 4PV9B 4RDBA 4XKMA 3C61A 4NN5B 1W0WA 1RK1A 1ICSA 4IMKC 2BIQA 4UTKA 1NCBH 2V7NB 4RWYL 1K03A 4TQTA 3T1FB 1B0RB 4FFYL 1ECYA 1D8CA 1XH0A 5C7XL 5PTDA 1EEYB 1YEEL 3VFCA 3AYTA 1H61A 1NFAA 4JFEA 4ELKA 4M6MH 3B2VH 3UWUA 1U41A 1L8NA 2QAPA 2PBGA 3BH9B 2F7QA 4PB5A 3HTWA 2EEBA 3N40P 3SE4A 4ZENA 3UACA 2H3BA 2VXQA 1IARB 1LRQA 1NBZB 2F53D 4S3DA 1XC6A 4K73A 5JXAL 4NQEE 4QJ1A 3IETA 1UA7A 5BV7B 4ZQMA 1M04A 1CL7I 5I5RA 3PAUA 1KWGA 2CLLA 2Q7AA 1JTTA 1F6PA 3EH1A 3HS0C 1AZ1A 5D4IA 1B0GB 3ECQA 4PRDA 3UL4A 1SSGA 3PS7A 3C9NA 1FH8A 2NX9A 4R33A 4DFIA 3IJIA 5HYJA 1RFDL 4OLZH 1GH7A 1H3TA 2ZUQC 5EZJB 1HL9A 1RCYA 2L4OA 3P3YA 1KRMA 1ZT4B 4B9JA 3IARA 5TDOA 3E5BA 1AIFA 4Y9GA 4F0HA 2J2ZB 2OMUA 1X5HA 3V2AR 2P0OA 5J9PA 3BKJL 2ICEB 3UX9B 1SZRA 3ZGIA 3CUGA 3CV5A 3GAKA 4GA8A 1UENA 4UTTC 3FTVA 4B9ZA 5IJDC 1ZAIA 2WUBL 1E27A 2YLKA 4LBEB 1BMZA 5DHYB 4K38A 2VDOH 3BH4A 2GOKA 4AWEA 4GKTA 2WANA 2YRZA 3QCTH 1AHWC 5FR3A 3EXRA 4GJ1A 3KZPA 2A9BA 1ZLVH 5IG7A 1JZJA 4KETA 3PL6A 1R7AA 1OTUC 4WFEE 3M0MA 1XTMA 2D03H 1IT0A 2Q3RA 3OAUL 4OFPA 2DM4A 1AO7B 4F8PA 4XAZA 4L8CB 1EBPA 4GG9A 3W1ZA 2WXRA 3SIZA 5I1AA 1T0MA 2WQRA 1FFNB 4KHTH 4XB7A 4FQ1H 3PL6B 3QW4B 4QRBA 2V9TA 3S1GA 5G55A 3GZ3A 4DP4X 5BOJA 1ZALA 2DVUA 4OZOA 5KVGE 4A6YB 2BGNE 4PJEB 3NCYS 2EDXA 4L8CA 1MQKH 3WL1A 4QTFA 4ZK8A 2DJMA 4GRSA 4NBZB 5MHBA 4KK8D 4B0MM 4X9YA 1ZTMA 2JF6A 1JSYA 2EEDA 4U1LA 1J8HB 3N41F 4XMPH 2IKHA 3IIOA 4PL1A 3TU9A 4YSQA 4XX5A 3B5TA 3MGTB 4N85A 2PABA 2XIIA 1N12A 1CG9A 1QATA 3QJUB 4AJVA 1KM6A 3TC6A 1INDH 2O7QA 2IDUA 1XLJA 1F6AB 2BXVA 2QAFA 1TKKA 1K3ZA 3UAAA 3LGDA 1U8CB 3DBPA 4BD4A 3IMWA 4HS6B 3T4AA 1M1BA 1NCDH 1S7SA 3B4UA 4O18A 5A2AA 3WIIL 3V55A 4J8RB 3IMUA 2TSYA 2DYSB 4JZJB 3W28A 1MRCH 2RDUA 4HSAC 3S2LA 1T5XA 4Q33A 1AR1C 1I8KB 3O9WC 1II4E 4FYQA 2Y7GA 4JYDA 5HGBB 4HS6A 4N2OA 4NFCA 2EJ1A 4ALAL 3FUDA 1V0MA 2YWYA 2OVLA 4J8RA 4KVNH 1YDVA 4UFLA 5BNKA 3KPPB 4JZJA 2Y72A 2ANUA 4JGDA 4M1DL 1CLCA 4GEIA 2NCEA 3EZ8A 1VP5A 3HGOA 3DETC 3AXXA 3VYLA 4K6AA 1BF6A 4Z7UF 1V3IA 1JZ7A 3AGWA 5EZPA 3KP0A 2NY0C 3KPLB 3SGEI 5J3HC 4GH3A 3VXRE 5M3WA 3LZ3A 1G5GA 4A37A 2YB1A 3K1GA 2X9YA 4TX9A 4X5WA 3O2DL 5C6TH 4MJIE 3GUTB 5CNHA 5I6SA 2F7OA 2XM2A 4K9JA 2CKBA 1FZKB 3R7RA 2PDFA 1DFBH 3UG5A 1Q66A 1UZ1A 1YJDC 1S8DB 1WBXB 3M45A 1R8LA 2DTMH 4YZWA 3FT1A 3TCEA 4HLZG 4RDQF 4KK9D 3CV1A 5F8RC 3SR7A 3X1NA 1N6VA 1T0OA 3MJ6A 3LENA 3RVXD 5CP7B 5PAZA 3F4WA 4BK4A 2NVCA 2MOGA 3VYNA 4TRPH 2OL3H 2YAEA 1EEZA 1E90A 1G6CA 4C6DA 1T4KA 5IV2A 1IM9B 1OGAA 3EG9A 4F7CA 1H19A 2ATAA 1OX4A 4J2MA 4UU9B 4AB4A 4W85A 3KZSA 3QPQD 4XP6L 3E8UL 2ZUQB 3GMNB 4FXGA 1E27B 4LBEA 4HWZB 5CP7A 1NGYB 4G8TA 4LCWA 3HS8A 4KXCA 3IJYA 4GP4B 4M6VA 3BEWA 1IQ8A 1KCZA 1XRFA 2PBOA 5DRXA 2YCIX 3BD4A 4XMXA 4XPFL 4EXPX 4S23A 1KW1A 2FJGB 3M0XA 2ODHA 3VXSA 3UPWA 1EJRC 3GH5A 3D06A 2YSSB 4L29B 4NC1E 1X5FA 3IAGC 1FZOA 1KDIA 3V5KB 3HCVA 1VBJA 3ARGD 2P49B 3ZTNH 1H15A 5C09E 5CCKH 3REQB 3BMWA 1BEYL 1NWTA 1HHGA 3OQ8A 4ADGA 2WSKA 4LS2A 1ML1A 3CXDL 3CC5B 4JPIB 4IU3B 3EKGA 4LOUD 3IF1A 4E9SA 5J13B 3ITGA 1N4XL 5DU7A 4CSSA 1XJBA 4XPTL 4ODTL 3STZA 3T8XA 1NGQH 1NGWB 2H2SD 2HFEA 2WQUA 4OKDA 5CGTA 5D5MF 1OP5K 4MJIA 4DP6X 1GOQA 4L4OA 5AVWB 3H9SB 4Z3GA 3E0GA 5JO5B 3A3HA 4JPIA 4K37A 1IRAY 4ZW6A 1T1ZA 4AY1A 3FT9A 1Z9LA 3O4LE 4D9LH 3PQYB 4QRUB 3U6WA 2HXUA 1CO1A 4UT6L 2CLZA 3JWNG 3GU1A 4TSAH 1S7SB 3IKCB 1WXYA 5CC7A 4K3DL 3T09A 3RWEB 4K2UH 3WBDA 3GX9A 4ROPA 3WQ6A 2VM8A 5T1KB 3O4OB 3GBNH 2KAUC 3QP3A 1ITQA 1WCQA 3KPMB 3TCLB 3RB5A 3WQEA 3CN0A 4QCFA 4LVHB 1AQDB 3GSOB 4LQFH 2X38A 1VQTA 3IBEA 4OCLC 4JPKL 3TNMA 1SUXA 1MFDL 4E4FA 2A73B 2EXWD 3UJIL 1W72B 4KX7A 4NPJA 4MS6A 1LRNA 3W1UA 3GSXB 4LS1A 2Y89A 5DI8B 2CIIA 4F91B 1Y18A 4OD2A 4RVBA 4TM9A 1BYPA 4I48B 3EDDA 3U1QA 2JELL 5C71A 5IIEB 1XQLA 3NL6A 3INUL 3RKPA 2QDHA 5C9RA 2JXMB 2PWUA 2XV3A 4N9GA 1WZLA 2XY2A 4JEJA 3W7IA 5KN5B 5I15H 4PTWA 3B03A 2AJYL 3L4UA 1D5MA 3C3UA 4HLZH 1WBXA 1I3GL 1W72H 4AEHH 4IMGA 5FJRA 2PWHA 1UR2A 1PKOA 3SCTA 3EBHA 4X7SH 1FSKB 1TQVA 3QUYB 3LJ3A 4JDZA 4UQEA 1ZHBB 5FV2A 5A1AA 3C2VA 5KITA 1UGKA 3VKJA 4PRTA 3T9WA 2E8YA 1QNOA 1GZHA 3HJ0A 4W4QA 2YA1A 4PGDA 5D1ZI 2EDBA 2O6DA 3DSNB 4PJ5D 2YPKB 4YHLH 5FWQA 5E09A 4LB4A 4Y2DA 4DGIH 4UQDA 4LSQL 3F6JA 4JEGB 5IMKB 4TUFA 3WSUA 2G75A 5KSUA 3SJVB 5ITBL 3PZUA 4ONVA 3GHRA 4Z1BA 4BINA 2GITB 3DX2A 5C0BB 3SKUD 4GRLC 4JNZA 4KI5C 3WO4C 1UC5A 4MNMA 3HZYA 5D37A 2BZCA 3I3BA 3QWRD 4HFWA 2P5WD 2FRGP 1A3WA 4PUEA 2X6MA 3SJVD 3F2DA 2GJ6D 3QJSB 5KYUB 1TZIB 5DRIA 1RJYA 3JXAA 3E3QC 2VERN 4JDTL 3W2JA 3S5LA 1A5AA 4IBUA 1WUZA 5T8IA 4DN3H 2KLRA 1QI3A 4PJBF 2OZ8A 3H2CA 5FL1A 5TE6L 1MQ8A 1NPJA 1FY6A 4WHYH 3ZKXB 3HI1A 5HR6A 4PS4H 5FL0A 1I3UA 1EUTA 2X40A 3K0YA 1MH5A 2Y6ZA 1MY7A 1UM4L 3INUH 3V0TA 3AZSA 1ZHLA 5DHVH 5EOQH 4UNVA 4NCC2 4E2VA 2J43A 4Z3JA 4WGVB 5CZVH 1J5TA 2DORA 2JWYA 3DX0A 1USQA 2P9RA 5GGSY 4JG0L 1OM3L 4R27A 1JJUA 5CG0A 3BGFB 1WV7T 3BZJA 4FADA 1EJVC 3DO4A 5EC2A 3B34A 3EXTA 2HH0L 2CO3A 2YGPA 3STLA 4I18C 4FL4C 3BJSA 3ZIYA 5HHXH 4GSRA 3FEQA 1A8JH 3V3WA 5XIMA 3LDVA 2JB5L 4K94H 1O66A 5CWSA 1Q2RA 4GRLA 1V27A 2GCYA 3KCPA 2EDRA 4I9XA 3TIDB 1JBJA 1CX9A 3B06A 2YPLE 1T6WA 3TVMD 4C6EA 4X7TB 4IBSA 3BQUC 1RIHL 4GXUN 5AYXA 4J4KA 2XKUA 5CC6A 5HMFA 3HC3H 2A6NA 1A0QH 1XGQA 2IAMA 5BRZA 1SO4A 1OT1A 5T1MB 2EKGA 4RCXA 5GZOD 4IIGA 1IYXA 5BU6A 5LXGL 3KJ4C 2XNAA 2FHBA 3L1GA 5IFHH 2XHNA 1TKWA 1XCQA 4GI6A 1KFAL 4ZFOL 3NFSH 1BZ9A 2GTQA 4DQWA 1E28A 3AUOA 5FW8A 4DGVL 3EIFA 5IW3A 1ZVYA 3HQNA 1KFEA 1JGLL 1B6UA 1CR9H 3V75A 1G5AA 3IS0X 2P45B 4PR5A 1NFGA 2KYIA 1FHLA 3P30L 2EAWA 2QXWA 3CDFA 1JNNL 4X3ZA 3T42A 3LBMA 4A2RA 2Y3NA 5HWNA 2FMNA 3EOTL 3AXMA 5I3JA 1E28B 2B08A 3K71B 5JYMA 1BFSA 3OKMB 3V6FB 3QUXA 3MBED 2P8PA 4HOZA 4FG6D 2GAZB 1PKMA 2J9YA 2ZRYA 5C5YA 2GI7A 3H6OA 3ILPA 4TN9A 4Z0JA 4FS9A 5HJLA 1L7TH 2W65B 2B20A 5DELA 3OKKA 1JN6A 4OFIA 3QXUA 5GNXA 5HVHB 3U0TA 1XCFA 4Q6IB 3DXAD 2CWXA 1ZA6A 4QYOB 1BQGA 2UY3A 3Q2DA 4BH7B 3QVQA 1ODAA 1S3KL 2F54A 4N22A 3MV9A 5F71A 3TH6A 3TWBA 4P2OC 3TXAA 1XBYA 1KGXA 1CLXA 3BAIA 1W9BM 2C15A 4FNLH 4NKQB 5I28A 5JOFA 3ZJKA 3LKRA 5IRPA 5KYUA 5F7UA 3QSKB 5FJJA 1G7PB 3U6RA 4WOZA 1DDHA 4DGYH 4WTZG 2HNHA 2G2RA 3QIWB 1QR4A 3BIAX 4I4WA 4KY2A 3H7UA 1W8NA 1U0QA 1U8MB 5C08A 4S3CA 2Y7DA 3EOAA 1NBVH 2DFAA 4MNKA 2WCGA 4WWKD 5IVOA 3T0EA 3AUWB 1JI2A 4Q4MA 4ZXOA 1E1CA 1X7SA 1JWUA 2ODIA 1V6YA 4U28A 2HXAA 3QSTA 1D3HA 1FDZA 1DDHB 3QJRB 2JJVA 4MA8L 4V2CB 5J12C 1A25A 1TPEA 2D3NA 4BWWA 5J6HA 2WLLB 3QORD 2EVGA 1RQBA 1AI1L 4LHUB 5IREA 2V6AA 1DHKA 1DVQA 4DI8A 3FSWA 3I50L 2VXTH 1S9KC 1OSEA 1IQDA 2WWNA 5AHLA 1DUZB 4GMSH 3EFOB 3CSFA 1JNHA 1PIFA 1EZVX 1ACYL 3QUXC 3MMEA 4WKXA 4Y5XA 1BVZA 3BWZA 5DVOA 3FH7A 3U6XS 3ZDWA 5JOEA 3WIHA 3BPWA 1LXMA 1B4TA 2VN4A 3HS9A 3L4YA 4XXDB 4ZAKD 3CCHB 4XPFH 5IBUB 4AYEC 3STCA 3BZ5A 4M8QB 4Y1AE 4HN8A 4OTXL 4NDMB 2VHLA 2ICES 3EEGA 3MV7D 4DKDC 3RFZB 4E0RB 4HUWA 4GINA 5I8CB 3L9CA 4TX8A 5HWMA 4A38A 2ZJSL 5CUSL 1UQSB 3V0VA 3LIUA 2Z35A 1GQKA 1JPTH 2BOBA 1NBCA 2W80C 3MOBH 1MHHB 3P3SA 3PHOA 3PXLA 4JHUA 4ZZFA 4C6BA 1ASOA 2C5DC 2DQFB 5G1YA 2LVEA 4GUOA 4IRJD 4QTHA 3BANA 5G5DB 3VXPB 1HEZA 4X9IA 2WMJA 5A6BD 4FNQA 3M17B 5H37H 2DQEL 3MUIA 4MTVA 4EN3B 5DZNA 2X42A 4EZMA 1U58B 4TLKA 4UOJA 4ZAKC 4FYSA 3WFDH 1ZFJA 2V63A 2ZG1A 1PIGA 4LT7A 2PP7A 2CLKA 5IJVA 3IN2A 2DDQH 1EJOH 1QTPA 3KPSD 4I3RH 5M03A 3DFOA 4HUVB 2IBZY 4OZHA 3ZE0F 2TPSA 3LPFA 3GMPA 1MREL 4CNSA 3MV01 2YAMA 2J79A 4EN2A 2O5ZL 1VRSA 2R8SL 4YCPA 5IUSA 1WNOA 1VZWA 2MHAA 4Z77B 4GS7C 5F7BA 1EPFA 1N8ZB 3W7GA 3V0DA 1LORA 1RQEA 4G6JH 3OX8A 3DX1A 1NC4B 4ADIA 1N2RA 1M71B 2OJEA 4LCCA 4JRYA 1LDPH 1TQBC 4QHUB 1TJIL 5FXCH 3SBPA 3E6HB 1Z3RA 1QTSA 1OB1A 4GUQA 4KW2A 2DWYA 3VNLA 3O8XB 4BH7A 4ORGA 3CUPB 4RUBA 4D2NA 2J74A 3HMJG 2ZKHH 4PY8I 4AZGA 4Y1AA 2D7PA 3NJHA 3NIDF 3RGHA 3ULUH 3TOYA 5K7JA 3ARVA 4FQJL 4V2BA 2OJEB 1US3A 2PXYA 4N8CH 5K9QG 4GAJH 1DIDA 1EDQA 4LUSB 5E9DA 4GAGL 5DMIH 3IACA 3SKNA 5KVMC 3TYBA 1HWGB 1KGCD 2DI8A 3CSPA 3DX3A 3LNHA 4GNKB 5IOPA 1GCFA 4O17A 2E6JA 3CFBA 3C60A 3MV8D 4CU6A 1U8QA 4O00A 3U0HA 1QHQA 2Y5QA 2VFIA 5IK3A 32C2B 2CZDA 3RUGF 1YMME 3ARED 2OX4A 3SKNB 4QRSA 3W2KA 2Y1YA 3DFHA 5I0VA 4GZ7A 1OP4A 4OR1A 4QXIA 4NP7A 1HDMB 3JTTA 1UWIA 4RDVA 1XH2A 2NNAB 1KXVC 4AMWA 5DJCB 2UY2A 2EUVA 1R3HA 3UTTB 4OD1L 3RWFB 3HGSA 2XPZA 3TSBA 2H6OA 4R97B 3A4DA 3VWJD 3INOA 4NKMA 5A8QA 2E6QA 1K5NB 1PLBA 2BC4B 1WAAF 3M8OH 4K36A 4GW1A 3QHMA 4QGCA 3O9WB 3SRFA 2JEQA 3THQA 3CQKA 1CVRA 1W8OA 4LRNH 1TZ8A 5BUAA 2HLAA 4S3KA 2R27A 3VCCA 4RK8A 2WW5A 4EVNA 4KRZA 3Q9QA 4MCYB 3RWCA 1NLBH 2R69H 2VEPA 4Q9QH 5TQ2L 4D0CA 1QSVA 5ACZA 1KIRA 3B3BA 3W27A 3APFA 4E2OA 1NU5A 3HOJA 5FOBA 4RNIA 5EPMA 5JHDA 4NM8H 5AYQA 3W88A 4C6IA 5C2CA 1XAKA 2E7BA 4X6BA 4NQDB 1K9EA 4IUOA 1L3WA 3NNTA 1OSZA 2EH7H 3M88A 4QOKD 2EVJA 4WI8A 4AGPA 4Y4FC 1ISWA 1TB3A 3RRXA 1UMLA 4NUMA 1CGUA 4AL8L 5ESVB 4YSDA 3G0UA 1NJ9B 4OLVH 1ENUA 5CJOH 5HPMB 1R3IH 2IG2L 3N9GL 4JDBA 5I16B 1VFLA 4R53A 1IC7H 1T5AA 1KIUB 4L3CA 2EPKX 4OY9A 4GMTH 1KEGL 5IR1B 1N7MH 4XVSL 2YUZA 3NQ7A 5EMJA 4ZTYA 4L1BA 1QR7A 2FKPA 3W2NA 1J9SA 1J9CT 3Q3GA 2PU1A 5G5IA 2FX7L 4HIHB 4RW5A 3BEVB 3MRJB 4G71B 1QP1A 1XX9C 5BMWA 4JTFA 5A94A 1ZHNA 2KDGA 3FGCA 4HXAH 4WY0B 3EJSA 1K3UA 1IGJA 2L0DA 2DH3A 1L0PA 2XG4B 1KM0A 5I3HA 3V8CA 1ZJAA 3RPTA 2BVOA 2G9HB 4BFNA 1EJTC 1YSOA 3L95A 3EMQA 1MCFA 3EHBB 5HDBF 3NA9H 1A4AA 1QFPA 3D85B 2Q02A 2IMMA 1WKDA 3TW9A 1FL3B 3IRPX 4X2UA 43C9A 4Y4KA 2WK2A 4F8NA 2ZWYA 3EZ4A 3UTSD 4ORGB 4ZMZA 4MMZB 4MPQA 1A5OC 3EFFB 2E6PA 4AD4A 1L6FA 3SKOB 1AQMA 1ROWA 5C9JA 5LBSL 5FJTA 1H3WM 2XN9B 2PDGA 1CK0L 5E0QA 4JN6A 4EEEA 1QOKA 1AJ7L 1H5BA 3WENA 3LLDA 1XINA 4ZX3A 1GJUA 5GGQL 4WIQA 4ACPA 2WWCA 3N29A 1JNLL 3M0HA 2FQDA 4PJFF 1Z3GL 3VXMA 4JFFA 4NY2A 4WU7A 4GKNA 3SCMB 4FCAA 4D9RE 3G6AB 5GHWH 1QWGA 2OWWA 5DR5H 5HVFB 1FHUA 2J6XA 1O1ZA 1NAMA 4LPCA 3DBSA 3GB6A 5I82A 4NC2B 4RR4A 3TZVB 2YW3A 3UJTL 5AENA 3LCFA 3UU0A 2HROA 1BM3H 3SB3A 4G5DA 3NOIA 2H1PH 1T7VA 4P5RA 3PGCB 3QWQB 3CXOA 2AL2B 2CRYA 2JGQA 1JFHA 2NT1A 3BAJA 3KTCA 3ZLFA 4U1GB 1OAQL 4ZMTA 4QLRA 1T5KA 5FS5A 4N7QA 1LOSA 4GVHA 3QUHA 5CSUA 4YXLL 3WQFA 3L3GA 3QUZA 4JG5A 3U8GA 5G2NA 4IRSB 1IM3D 5FDWA 5FF7A 4HC1A 3FQWB 3NQVA 1NKGA 2ARWA 4OGXH 1IXQA 5C3TA 1GYNA 3BMXA 2Z7KA 4RAVA 3P60A 5F97E 1FCQA 2WQ8A 5A16A 2BSSB 4YDVA 2QCNA 3WAKA 3MYOA 4UYPA 5EU7E 4UFIA 4AX6A 2QADD 4ANVA 3F3HA 4NQVB 1Z7AA 1DBBL 4KWVA 2CKSA 2WZPD 5ELIA 1GPWA 3OLDA 5A6IA 2QUTA 1JCVA 3F5KA 5FCSH 4BF7A 2VIRB 3WLTA 2DIAA 3GK8L 5CAYB 3HFML 3Q48A 3GSUA 2R29A 1U5JA 3RMJA 4AMAA 1A3ZA 4MXQD 3W2DL 5F7MC 3PBYA 2V82A 4QRPE 3EGXB 2YUVA 2NY1C 5H94A 3U36B 2DVTA 5KYWB 3REVA 4X6DA 1SF5A 5AW7B 4X6FA 3QQ1A 5IR1A 5FHBL 3F7VA 3DIVA 3MACH 3IM1A 2J8UE 1KXTA 4L8SA 1CQYA 5BW6A 1TPH1 5GJTL 1H7OA 3CASA 3LV3B 2ZYIA 1CXKA 3L5AA 3AUVA 4KO7A 3TK7A 3WXWL 3BPCA 1P6BA 1QHZA 3B7YA 3WTTA 2Z00A 3E6EA 3G1DA 1QVOA 4JDYA 4JKWA 1HL2A 4W9ZA 5JOPD 1XGEA 2CETA 3B2DC 4NIYE 3MQTA 2R1XA 5D1QD 3B5GA 1ZHAA 2EIBA 1UM6L 2NXZB 4JPVH 1E4IA 2OK0H 3FEMA 1PHQA 4H2HA 2C8NA 3TW6A 3BDXA 4MWFA 1R5IA 4OM0L 1P9MC 4YDNA 3SDYH 1ISVA 2CIPA 2REQB 4F9LC 3F7YA 4JFXA 4PG9A 5SWQB 5GRVL 1J5OL 4JTQA 3IJSA 4JFPB 3I50H 1JK9A 5A6AA 4P2OD 4Z0BL 1WB0A 1Y8BA 1DLFL 4MWFB 4HT3A 2QGYA 1X6NA 4ZTPL 1DIOA 5E8NB 1NEZA 3LRSA 4FQ2L 4PGJA 1EJOL 4I3RL 5JHLH 2DZEA 1MNZA 3KRSA 5I3KA 1KJMA 1OD9A 2NVDA 3VE9A 1V5XA 2WJDA 5AW2B 2VCAA 3TYDA 3TYZA 2WWDA 5DJ6A 2H1PL 2G3IA 4MXWH 3S6TA 1ULVA 3II1A 5FJIA 3RWIB 1EFXD 2VN5A 5DTFB 2A74B 3T2QA 3ZMEA 3SDCD 1XYLA 3B8UA 3I2CH 2WLZA 2Y7MA 5LBSA 1YXCA 1R34A 4IG2B 4KRTA 5D1XD 2Z31C 4CKVX 4EI0A 1XLGA 25C8L 3UERA 3FFDA 1OF8A 1MI5A 3CFCL 3VTRA 1JR1A 5C7ZA 4XNUL 3QR0A 4BFIA 1ZTXL 1ZE3C 1I9RH 3MKGA 4PLKC 4ZS7H 3QYSA 3N9KA 4LH8A 4L3FA 1P7TB 1IBGH 1X8CA 3DRTB 1OK8A 4X8JA 4DF9A 1D5ZB 4IJBA 5I07A 1QNSA 5DEFB 3L17A 4L65A 2R0WL 3WF4A 4RGOH 3FQWA 4GEJA 1YTDA 2Y85A 1JFXA 4PYHA 3KEHA 4H20H 5JR1L 5CN1A 5I2UA 1SOKA 2UWEE 5JXEC 4LPXA 5DUBA 4YBQC 2BSSA 2CZNA 5F7HA 5EDXA 5JLZA 3WTYA 1J79A 2H0FA 3L5LA 5DQPA 4FA6A 1S38A 3SE8H 4G9FD 2XISA 2XVBA 3PZVA 3LQAH 4EXQA 3GLZA 4DZHA 3UP8A 2IVFC 2ZPKH 4FEZA 3TGXA 4FZIA 3FUEA 1W54A 1SEQL 4W9DC 5MEOA 5D2NB 4BUGA 3D34A 1WUNT 3VUAA 3RIAK 2VDLL 4B60A 5MENE 1I4NA 4Q7NA 1JDDA 4W89A 3NJ3A 4WDXA 1FLTX 1AGEA 3PDOB 3SO3B 3LMYA 5DD1L 4LF3B 4RL3A 3M5XA 4IFKB 1YLVA 1ORSB 3APNA 1XLDA 2C9UA 4HVBA 3ARXA 1VEPA 4DTGL 4UTMA 4L8SB 5K59E 2VSDA 4FI7A 3BKYL 2WINB 2I60L 5FF6A 2R29L 2A6DB 3G0XA 3GHUA 4JTSA 1EXUA 4DKFL 1EA0A 3AXKA 4AM0A 3TF7C 3PSVA 4DP2X 3W23A 4JVWA 1LO0H 3I6GB 3GMRA 1TELA 3WFAA 1XGYH 4Z7VA 3KBMA 4O15A 1L2QA 3U2CA 4XRCA 3RL2A 4GZEA 3W85A 4CNPA 1W2KT 3VD5A 5B38A 1TQSA 5HHXL 2Y69B 4NOBA 4ZPVA 2HRPL 3TA3A 5B7ZA 5A6KA 4X4XA 4O2CA 2CIKA 1M7JA 4HYVA 3E0VA 3GZPA 5AOMA 4KJYB 2WPGA 2W4XA 5FD0A 5E1AA 4PV8A 1SW3A 3PR2A 1E50A 3RL2B 2ZAIA 4X9HA 4YTQA 3H54A 2CKRA 1DYZA 3KMDA 1TRDA 2APBA 1HH9A 3BT2H 4JG0H 5DY2A 2VC2H 3NG5A 2L7EA 5AAMA 2WBJC 3F62A 3L3OB 4GAFB 4WI0B 1GYWA 4XBGB 3N42B 1TPWA 2VGGA 2WZHA 3ABXA 2DQTL 3MTWA 1J5DA 5E1AB 3G5EA 4UWMA 4Y6GA 3F2BA 3HQOA 1XO8A 1NC2B 4ICCX 4BWLA 1ZMYA 4L1SA 3WD5L 1KCRH 3PBUA 3OMIB 3PGFL 1BX2A 4XBGA 1A0EA 2EDWA 4B9IA 1U2YA 2MSPA 3EGJA 4LTSA 3FFDB 4BDVA 4HUKB 3HZ3A 1X4YA 2GFBA 4JD4A 4QBXA 4UQBA 4LAJH 4DERA 4PHZA 5LHEA 1U6AL 3EAUA 3NPZB 4RFOL 4HMDA 1A5NC 2B4CH 3IDNB 2P3YA 4XQ6A 4UWQB 1BX2B 4RDWA 1I1RA 2UY6A 2YAHA 4NBYB 2VJXA 1MG2C 3N55A 4C57C 5JPMA 4L5FE 1QPNA 3ZVHB 4YDMA 2D7NA 1A6UL 3IMSA 3B2MA 1LEGB 3C5JA 1RAMA 1W2VA 2JKAA 2OO6A 4TTDD 1SU5A 3IU4L 4OOZA 1F6KA 2F8QA 4MD0B 5AB1A 3GRWL 3NIFE 1EIBA 5M1TA 5G1TA 4KV5E 2V5BA 4Z7VE 1HCFX 2E7DA 3PBVA 4H9MA 2OMYB 2CO2A 4G7YH 3C5JB 4F0LA 2RALA 2Z91A 2ZIDA 4OF0A 3IDMA 4FABH 1E71M 2WYSA 3UZJA 5EBUA 4JPQA 1CD1B 3ZQ9A 2XI9A 5CU9A 4NC1C 4OZHF 4PGBB 1CW2A 2NY6B 4XVOA 4JLRB 3KH4A 4EPEC 2JELH 2X0WA 1F11A 4F80A 1OC6A 2VUYA 1A9VA 1P0NA 3LEVL 4MD5B 5CJXA 4EZLA 4JUSA 1PY9A 4PJEA 4WTXA 1T99A 3OPUA 3OLIA 1KFCA 5KJRL 3LEPA 2WGNB 3TA9A 4C6FA 3OZ9H 1G7JA 1M42A 2QJIA 3NEVA 4KGJA 3SCVA 5I3IA 2QUNA 2R83A 4P2QE 5LA2A 1KYUA 2I25N 5DLML 4NC0B 4S2CA 3FS2A 4BRJA 5E93A 4C6MA 3PPHA 5L4JA 4JHWL 4G59C 1FL5B 3OR7B 4UMCA 2BVTA 3U7WH 3VNMA 5E6ZA 1S2UA 3IJQA 3VYPA 1TQCB 4LLMB 3RL1B 1F2QA 3ABOA 4GACA 4AXWA 5B7EA 1VFAB 5DUPL 2FB4L 4M6PA 4X2RA 3WMBA 4HV8B 4C6OA 2C9VA 2J7HA 4QIRA 3MO4A 1D6VH 1XGRB 3LXAA 2J9XA 3ONBA 3OHXA 3VQMA 5K5YA 4DBSA 2B1AH 3FHEA 3IFPB 2IPKA 3WDRA 2EXSA 2CMRH 4R4BB 1UWQA 3R79A 1FVEA 4LP4A 5DF0A 5KVFH 1O94A 2ZCKH 1RCQA 3NPSB 3VNYA 3GVVA 2HJKA 5A40E 4BZ1A 3EYQC 4JM2C 4LCWE 5TE4H 3S34H 2IPUK 3I6EA 5AW1B 2PE4A 5HDQL 1VPOL 2QCGA 1X1ZA 4WXZA 1SLWA 3P9LB 5AC4A 3QPQC 2BBFA 3JQOB 2VEMA 3N43B 4PP2B 3W1NA 1YMMD 3SPVB 5AVHA 4FQLL 3ARDA 2HJKB 2IQ9L 3B7UX 2VGFA 1UCBH 1OIFA 1TTUA 4MQXC 2JE8A 2EDMA 3FUJA 1TZ7A 3CVHB 1XD0A 3VYOA 5CCKL 2B4GA 4GVGA 3HUJE 3WUFA 4RPQA 3RNKB 2GSEA 5TGBB 1MFEL 3FT4B 1H2JA 4LRSA 5I18H 4PJ7A 1F8IA 1RPKA 1I1CA 3AW5A 2WJ7A 5EN2B 2BERA 3BJLA 1XRVA 3NR0A 3PQYD 3B8IA 2BSRB 4PSRA 2W5PA 1GIGH 4ZD3H 1W9DM 3AT0A 4NT6B 1QK0A 5ICUA 3CVHA 3RA7L 1BVLA 3TZFA 4TLTA 3ULUC 3UAJA 3H53A 1TJGL 4UAHA 3JTSA 1P1MA 4L37A 4PWGA 5MKGB 1YPIA 2QDGA 2IWFA 5J1SC 3W7QA 3GRWH 1S39A 1MCOH 3PFQA 3SCQA 1PDZA 5LGYA 4NT6A 4WY0F 4KKNA 3WDQA 1LL4A 2JK5A 2OP4H 1HWHB 4IMLB 5JXEA 2Y2WA 3IJHA 4WUUB 4ROQA 4F2MB 2VXVL 1OP5H 2G9KA 3KGUA 3W1XA 4R0LB 1LO5A 5AKVA 1U3HA 4JHZA 4L3AA 4HCDA 5DSCA 4OGYL 1EEQA 3GZAA 5MP6L 2WTPA 12E8L 1T7WA 3EADA 2B7NA 3C08H 4X7FC 3VFSB 4HCRH 4NQTA 3I2CL 4FG2A 4F8XA 1S7QA 4XX1G 2J7LA 5C92A 1X7TA 3KPSE 1PJ9A 1M9HA 4XCNA 1NFDB 3S37H 1F3TA 2YXOA 2RAMA 1XFBA 4IJRA 2DU2A 2PMZA 2Z4TA 4AV5A 4IPIA 5HYSG 5D1QE 1BTMA 4MDIA 5JNYB 1WDQA 1NDGB 3SUUA 4Z7UB 2YL6A 1TMQA 4OZFG 1UA3A 3S36X 3T65B 3ZMRA 5IZ7A 2Q8BH 1NFDA 4NAJA 3JYCA 1T1YB 1VH7A 3OAZH 4HWEL 2M8XA 2RJHA 4GKSB 3RHGA 2WLYA 4KVCL 4N8VG 2YL5A 1HSAA 4KCTA 2VR6A 5KANI 2DSKA 3H9SA 4DQAA 2WMIB 4LKXA 1T1ZB 2WUCL 2HCZX 3L3DA 1FL5A 3QYCA 4WWKC 1LG2A 3ZKMC 4ABUA 1GCYA 1S9WA 2BW4A 3KVQA 5FHAH 3ES6A 3VFVA 1E5JA 2QUVA 4JIPA 1C08A 3V8OA 3H4FA 3G6JA 5AC5A 2VLJD 1HSAB 4D6JA 1ZVSA 1V51A 3KS0H 2OL3L 1Q72H 3PAYA 4UT9H 2CBJA 4G7SB 4LKXB 3UY8A 3ARBA 4DW2H 4HJFA 2VD8A 4A8NA 3VFTB 3W00A 1RVFL 2CAKA 5CIPA 2XWBB 3ZUCA 1RK6A 4F2UA 2J6WA 5GGTH 3GO2A 3UDWC 2YD4A 3KPSB 5EUOA 4MDPA 5HA7A 3NBNA 4LL9A 4PMUA 4JIIX 1U9KA 3A4EA 3TXVA 3OXSA 4Q2ZA 3PWPA 5EULV 2E5EA 3DTXB 3QXTA 5CIPB 4B5EA 1EJSC 1M2VA 2DM2A 4K5NA 1AZRA 1BQHB 3ZZLA 2W1NA 5FIEA 3V5DA 1TITA 1WG3A 2GYIA 2Q6WB 4DWSD 4NJAH 1IR1A 2ZSVB 3NTYA 5I03A 2COVD 2QF8A 4U1KA 3PGFH 3HBLA 2DLFH 1FP9A 1RD5A 3IDGA 1UOKA 3LKNB 3MDJA 3CV2A 1W3NA 5BQDA 1LCOA 2Y7NA 5J0BA 2CESA 1EEZB 1UJ3A 3FJ6A 4K7PH 2J8UF 4UIKH 1ITUA 3C12A 3EG9B 4F7CB 4N28A 3QWNA 1JDCA 2YDSA 1RCOB 4KWUA 2VR4A 3ZJ6A 4DBWA 3OAUH 4YHGA 2GIYA 2B1HL 3OJGA 4J6RL 3LXCA 5MF5A 2GJJA 4GQRA 1JCXA 3RI5K 1Q63A 1RHFA 1UG9A 2DBLL 3HBQA 1TYGA 3QTGA 3STFA 5ABTA 3S0CA 2WBJA 1GAFH 3A3WA 4JM0A 1T0PB 3QBUA 3FQUB 5FM5O 3R1ZA 3UA3A 4P5TB 1AXSA 1ME8A 1JHKH 3UWEA 3FU7A 4WJ5A 1JK8A 1FQ9C 1HOCA 3CBJB 3K6NA 3ZYIA 1FXQA 5DHYA 1CEOA 3VAVA 2FYYA 1Q6CA 4PCNA 4KROB 4P5TD 5CG7A 1Z9SB 3BKYH 4HU4A 3DIFB 2EUXA 5D7LB 4LGSB 5HMEA 1SZFA 4PW4A 2COQA 1H3UA 2UY7B 4AMCA 5DVPA 4F37K 1QRQA 2DWTA 5XIAA 3VFRA 4MGXA 4ZXBB 2VERA 1A6VL 3EJQA 3NACH 3NRPA 1FFNA 3GS7A 5JPMC 4PMXA 3AS3A 1TSIA 3ZRFC