1DHKA

Structure of porcine pancreatic alpha-amylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex.
pubmed doi rcsb
molecule tags Complex (hydrolase/inhibitor)
molecule keywords PORCINE PANCREATIC ALPHA-AMYLASE
total genus 154
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dhkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dhkA01
5ABEA 1JIBA 1E70M 2XFRA 2X05A 3DDFA 4BQ3A 1XYFA 2W5FA 3APGA 2WHJA 3B9AA 3T2OA 1JFXA 1MQRA 1TR1A 4AD4A 4Y7EA 5A8QA 4IM4A 1X6LA 4CD6A 3AMCA 2XIIA 1B0IA 3FY1A 4M80A 4C7GA 1QW8A 2BY1A 2VI0A 3A6OA 1S46A 4B16A 5BROA 1NARA 3UEQA 4PSPA 2FE0A 2PWGA 1NOUA 5CPQA 4ZENA 1BYAA 5A69A 3CHDA 3RIKA 1E1EA 4IISA 4FNQA 1DP0A 1UH3A 3D52A 1J0ZA 1IZJA 3B9DA 1CXHA 3K4DA 2WMIA 2ZICA 4TOQA 5ABFB 3ZSTA 3AXXA 3L2MA 3ARXA 4B9ZA 5BXRA 4JHZA 1WZMA 2D0GA 2X2YA 3QHOA 3QOKA 3D4YA 3THDA 1LG2A 4GQQA 3F5LA 2W61A 2CXGA 3BVVA 3ZR5A 2PWDA 4J3UA 1CNVA 2GK1B 2J7FA 3KEHA 1A3HA 1QI5A 4DWSA 3PZGA 2ZX7A 1GQKA 4H41A 2TAAA 5I23A 1QNPA 1KXHA 3VNYA 7A3HA 4EANA 4B3KA 2EABA 1HJXA 5HPCA 5D4YA 3CMJA 4ZE5A 4B9YA 3SCOA 1UWQA 3WQVA 1E0VA 2W66A 3WMBA 2FHFA 4OKDA 3QHNA 2ZX9A 2W4XA 2WBKA 1WPCA 1U33A 5IDIA 3EJQA 3WY4A 2WAGA 3BGAA 3OA5A 2YFNA 2VR4A 4HOXA 3AMGA 3QR3A 2EQDA 2DQXA 3DYMA 1V3IA 2JEQA 2F18A 1VEOA 4D72A 2X2JA 2WC4A 3PTMA 1B3VA 5F7UA 1C8XA 3CUJA 2AOSA 4AYGA 5AC5A 4DUVA 1E6PA 2VURA 1G9HA 1Q6EA 1H4PA 2DGAA 4GKLA 1KXTA 2VZTA 5C71A 5A6BA 2UWFA 4P8WA 2VO5A 1BG4A 4HOWA 1VBRA 5A6SA 4PSRA 3FAWA 1R7AA 3B9EA 3CTTA 2ZUVA 2YDRA 2GJRA 1HWWA 2XN0A 4L4PA 2DIJA 5FOOA 5D9OA 1TFVA 1XCWA 3LX9A 2VRKA 3WQ6A 1GVIA 5BXSA 1ITXA 1V6WA 2EAEA 1GONA 2E8ZA 2PBOA 2OWXA 3AXHA 3MMWA 5DEZA 4JFSA 1ZB5A 3BUBA 3WNPA 4CCDA 4W88A 1CLVA 1QX1A 1LWJA 3PTKA 1K6AA 4ZE4A 5BWFA 1OGSA 3WF4A 3SCTA 3SCVA 1E40A 2Y5EA 3E1F1 4HZ7A 4CD7A 3RCNA 1VJZA 3LRMA 1UD2A 3GXIA 2A3BA 4Z2HA 4IUGA 2QMKA 4H7VA 2IXVA 4OBRA 1JZ5A 3GXFA 1JI2A 1JYVA 1WB0A 4UFLA 2XVGA 1Q6GA 5E70A 1QNRA 1B2YA 3WF0A 5EFFA 2GJXA 4PTMA 1MW3A 1E6QM 1H2JA 1EGZA 2ZX6A 1WDQA 3WUEA 3UG3A 3GXNA 5GPRA 4S3JA 4M29A 4PMRA 3ZOAA 2DSVA 3EJPA 4BQ4A 1TE1A 2ZXDA 4MAVA 4PCTA 3GNRA 5DMYA 3VMOA 3PZVA 1FH9A 4UNIA 4WKAA 4PN2A 1C3FA 1MQQA 2NSXA 3EBVA 2WKLA 3VINA 1UKTA 5LA0A 1EDTA 1EIBA 1W3LA 1ZU8A 3WFZA 2WZHA 4U5KA 4WIWA 2BXZA 3K46A 4Z2LA 2QMJA 3RO8A 5E1QA 3A22A 4HZ8A 4WSKA 5C70A 3BAYA 1F4HA 3CZKA 4ZEPA 3NCOA 4X0VA 2ZUWA 3L4UA 4U2ZA 3K4AA 1OM0A 5EB8A 2OYMA 1XSJA 3SUUA 1MW0A 4EAMA 4AD2A 4UFMA 3KL3A 3HMCA 2E40A 4GPNA 2E8YA 2WXDM 2WBGA 1ITCA 3AHXA 1V0LA 3DX4A 1JG9A 1C92A 3W27A 3DHPA 1JZ8A 3WFLA 3VIIA 3KL0A 1AQMA 1J12A 4P8VA 5ABHA 4QCFA 3VVGA 3UG4A 1LL4A 1KWGA 1W9UA 1XH2A 3LPPA 3BUDA 1PZ2A 3WY2A 2J8GA 5A6AA 4AIEA 2ZUMA 5AC4A 1UR9A 1W32A 3AFBA 3ZJ7A 2D1ZA 1G94A 9CGTA 3ZO9A 1O7AA 4H04A 4WJXA 3CZJA 2BS9A 3CC1A 3WH9A 3LRLA 1FP9A 1FOBA 1VFUA 4P7LA 2GDUA 1EHNA 2EO7A 1JL8A 1CENA 3K1DA 3VM7A 4MADA 4B3LA 3NSMA 4HMEA 2BVYA 3MMDA 3ZT5A 4GIAA 1IT0A 4AIOA 1W1VA 1H0GA 3EDDA 4XZBA 3WN6A 1PIFA 3AROA 4DO6A 4Q7NA 3DHUA 3VIKA 5ABFA 1TA3B 1AQHA 4E4PA 2XGBA 3FW6A 1C7TA 5FL1A 2X2IA 1W9PA 3N9KA 5M03A 5CQ1A 1PAMA 1ZBKA 2WNWA 1QVBA 4ATDA 1BGAA 5A6JA 3W25A 4AZBA 1CXFA 2JIEA 2X8RA 4OUEA 3POCA 1JYXA 2DSZA 5HBFA 1GQLA 4KRUA 3NJ3A 4HTYA 1QW9A 4BZYA 3O2LA 1CIUA 2GVYA 3T0DA 5M17A 1J0IA 2D2OA 3ALFA 2IGTA 2FYVA 2XN2A 2CESA 1C7SA 1HVXA 2F61A 3WMSA 1ZL1A 3M46A 3VU2A 3SUVA 2WLYA 4E8DA 1UR1A 2FHBA 3MS8A 4JFWA 2X0YA 3CUHA 1X6NA 2J74A 3K8LA 4D6EA 1EDQA 4MDPA 1VFFA 1OB0A 1VB9A 4KMQA 4PMQA 4AZIA 1MXDA 4FNTA 3BUPA 3K8MA 2FDMA 3S6TA 5CJ5A 2JIWA 3AI0A 1QOXA 4TVCA 1W2PA 2XSAA 1O6IA 1NOFA 5TD4A 2YL8A 4AY1A 1HNYA 2FHCA 2DT2A 2G41A 3ARYA 1TUXA 4Z2KA 1I1XA 1UHVA 2ALWA 3IJ9A 3UESA 2UY5A 2VX5A 1CPUA 1XRVA 3VGGA 4QLJA 1MW1A 2V5CA 4RE3A 1H41A 2ZXAA 1MYRA 1D3CA 1DTUA 2YBTA 3LRKA 1W1YA 1OGBA 4C7FA 1ESWA 4NI3A 5A8NA 7CGTA 6TAAA 3TTOA 4F79A 1MFVA 2CHOA 2WSPA 4W86A 1HKIA 3PZNA 3AS3A 3H53A 2E0PA 4F8XA 3MU7A 1J10A 4MJ2A 1J9YA 4PTVA 3BAIA 3DX0A 1Z32X 3T2PA 1U2YA 3TA9A 1BLIA 2ZUTA 1Q6FA 1GOQA 4D6DA 2Y8VA 3LPGA 2FGLA 1B3YA 5I3DA 1J0HA 1W1TA 5DT7A 1KBBA 3D5HA 3EDFA 4UOZA 4HPHA 3WDHA 4LYRA 2CEQA 4AZGA 4QFUA 1TCMA 2XGIA 3VSUA 4P8XA 4HA1A 3ZJ8A 3U7BA 1G0CA 3BLPX 3T09A 1M7XA 4WK9A 4AEEA 1DWHM 4MPKA 3BMVA 3ARVA 4MB3A 4EK7A 1HX0A 1E6SM 1K9EA 4CD8A 2XSBA 3VILA 4PMDA 3BSHA 4W8AA 1E71M 1E4MM 2CBJA 2V38A 3CUIA 4DUWA 4UQCA 2OLHA 3I3BA 3AICA 1QHOA 1HP4A 5E6ZA 3IAPA 4D1IA 1CXIA 2VNCA 4M56A 1W3JA 2JF7A 3N13A 4OOZA 4U31A 3S5ZA 3VIGA 3VPLA 1AMYA 3KE0A 5HNNA 3WUFA 3WSUA 3WH8A 4H8VA 2GDVA 1EQPA 4AEFA 1GPFA 2YA0A 3KWXA 2WHMA 4PMVA 1EOMA 4BQ2A 4FK9A 2VCBA 2WC7A 3OLIA 5I0DA 1LLOA 3NIYA 1JYWA 3W29A 2V5DA 4U3AA 4AW7A 3GH5A 5CPSA 2E4TA 1J0KA 2F8QA 3RJXA 3RPMA 3MUAA 2OYLA 3WD1A 1MQPA 2HISA 3KL5A 1BYCA 3AHTA 1B30A 1V6XA 2CYGA 1H3GA 3WUGA 3CUGA 5BRPA 2FH6A 2X09A 4F9DA 5C8BB 1OIFA 1B3ZA 3BVXA 4UZSA 2V3GA 2W91A 3LXBA 3GH7A 1NOWA 3AHZA 2WZIA 2Z1KA 1GQJA 2W67A 1QHPA 1Q6CA 1CYGA 1WZAA 2UY3A 3BH4A 3HN3A 2ZX5A 1GOWA 1BPLB 3VM5A 1C8YA 2A3CA 3W81A 3WY1A 3MUZ1 2EPMX 3EMQA 1UKQA 5D9MA 1HJQA 3CHFA 1V3HA 3POHA 1WAWA 3W6LA 4M1RA 2JF6A 4CUCA 1GJUA 4OBSA 1SZNA 1QBBA 1J11A 5D8WA 1W9VA 2O9RA 1NP0A 3HU7A 4V27A 5DO8A 1KQZA 3W0KA 3WF3A 1V6YA 1LG1A 3CHCA 3SUSA 1HF6A 1YHTA 1HKJA 3SUWA 2WCGA 3AIEA 1LWHA 3OGRA 5A2CA 3DC0A 1J01A 3SCQA 3GBEA 3UG5A 4BS0A 5A6KA 4FLQA 1JNEA 2VX6A 4HA3A 4CVWA 5HPOA 3GXTA 2J7CA 3PBGA 3WD3A 5IXEA 1UD6A 3WNKA 4UFHA 5CPTA 2D22A 1ISZA 3LXCA 1H1NA 1I1WA 3QHMA 4JFUA 6A3HA 1WZLA 4NXKA 1JZ2A 5E0FA 1FFRA 8A3HA 2ZOXA 4AWEA 1HJWA 1FH8A 1PJ9A 5FD0A 5DFAA 3GXPA 2G4FA 1NP2A 1E55A 3AIBA 1R46A 1XD1A 2DSUA 1R33A 2XWEA 4UCFA 5GNZA 1V6VA 2W62A 3UERA 2PWEA 4J7RA 1DEDA 4D6HA 1UH2A 2Q8XA 3GM8A 4GQRA 5BYWA 1VAHA 2EPNA 4URIA 4GO8A 1SMDA 4WF7A 3ARUA 3VGBA 4AZ5A 2YBUA 1WP6A 2Y8KA 4AXNA 3ZM8A 4HOZA 2OSYA 2PB1A 2WKGA 4R5EA 1KGUA 2J47A 2XN1A 3U7VA 4CN1A 4CD5A 2QHAA 3WQ5A 1WE5A 1H0IA 3VO0A 4PTXA 5D9NA 4N0RA 2D24A 2YDSA 4NRRA 4MNMA 3II1A 4MNJA 1R8LA 1UWIA 1TZ7A 3CIVA 1B3WA 5EFDA 1HL9A 1EDGA 2A3AA 4B15A 4FLOA 1VEPA 2Y4SA 1L0PA 2WMGA 3ARRA 2ZIDA 5D8ZA 3WQ4A 4RL3A 2J78A 3ZMRA 4DO4A 4MB5A 2J79A 5JBEA 2WC3A 1LL6A 2DPEA 1UWRA 2QF8A 1SFSA 2VVNA 4IPNB 2D0FA 2XJ7A 4CD4A 4JKLA 4FNUA 5GQBA 2GUYA 7TAAA 2YL6A 1JYNA 2O9OA 3LPFA 1BHGA 3VKKA 4FLSA 4TXEA 3VD3A 3OIHA 1NWSA 3TONA 3BUQA 2QPUA 2EACA 4KWUA 1UH4A 2OW6A 3VUPA 3IK2A 4KH2A 4P7QA 3OZPA 4A3HA 1GOOA 1OBAA 4NRSA 1IZKA 1KFWA 4ACZB 3BVUA 4XV0A 3SCWA 1BF2A 3DDGA 2EBNA 3CHEA 3ZJ6A 1HN1A 1KTBA 1JI1A 2OW7A 3AIRA 2O92A 2DT0A 2WLZA 2VCCA 5I6SA 4J3VA 3TOPA 4HP5A 4JCMA 2OYKA 3JUGA 2PI6A 3VIHA 2JEPA 1JF6A 1E0WA 3FHAA 1C90A 3IAQA 1IV8A 1QWNA 1XH1A 1JFHA 4UFIA 3WD4A 2V3EA 1W9XA 3CMGA 1E3XA 1BSIA 5HXMA 2D20A 2J7EA 3A4WA 1JDAA 3AMKA 4AZ6A 4E2OA 3VDAA 2OWWA 4A4AA 4GINA 1J18A 2YL9A 1EA9C 2OSWA 2GFTA 2VUYA 4JFTA 2VZVA 5I79A 4AIUA 3FAXA 4UR9A 4S3KA 3NUKA 2C0HA 1FHLA 2XVLA 1MW2A 2O9TA 5DT5A 2J7BA 1ISYA 3SCRA 4AD3A 1CGUA 1V0KA 3L2LA 1VRXA 4Q22A 3BCDA 4V2XA 1HKKA 1XSIA 3O6AA 2VJXA 2WVTA 3T0AA 2XIBA 3HG4A 3MMUA 1GW1A 4CGTA 1TQWA 3ALGA 5JIWA 3K8KA 3F4VA 4MJ4A 3BAJA 1SMAA 4Z2IA 1V02A 4PRWA 4PTWA 1CDGA 4WSJA 5A2BA 1HJVA 4HPGA 2BVTA 4ZFMA 1HXKA 4FLRA 5GNYA 2ZUSA 1GORA 4TVUA 1R75A 2WPGA 1W2VA 3PZMA 4DWSB 3D50A 2F2HA 3SCNA 4CU6A 1F4AA 4ML4A 2WW5A 3W38A 1JAKA 4MB1A 2WYSA 3TP4A 4PMXA 3WBEA 3L4ZA 3SUTA 4XX6A 1JZ6A 2CIPA 3EDEA 1ISXA 3MI6A 4FF5A 3AYSA 4D6JA 3H55A 5I24A 1OGGA 1V3MA 1JNDA 2BXYA 1R47A 3BLBA 3DX3A 5I2UA 1BGGA 3L4XA 3VSVA 1UZ4A 3ARQA 2BHZA 3RDKA 1GJWA 3A3HA 4JKMA 4OGZA 3VMPA 3THCA 3AHVA 1AVAA 2XTKA 4MB4A 4TVDA 1TQVA 1CTNA 1MXGA 3FNDA 5AYBA 2VQTA 4DWSD 2C8NA 3AHYA 4FNPA 3AQUA 1C8QA 2WANA 4BCEA 1KXQA 1R85A 5M5DA 4EE9A 1CXEA 1MFUA 2VX4A 4TX6A 3TTQA 1KCLA 1V02E 4HMDA 3NDYA 4D1JA 3M07A 1OT2A 2WVSA 1HL8A 1H11A 3DX1A 1JXKA 4BA0A 4NZFA 3FXYA 4YHEA 3EJUA 4L4OA 1B31A 1VFOA 1D7FA 1PS3A 1VJSA 3MKKA 3PZQA 3WY3A 4U33A 2WMJA 5I77A 1WO2A 1HP5A 1B3XA 4GZIA 3WKZA 4H2CA 1BVZA 2PWFA 3J7HA 1DHKA 2WHLA 5JIPA 1R86A 3AOFA 3VD4A 2Y24A 2FGZA 4PBGA 1E5NA 2CCRA 2JE8A 2CKSA 4ATWA 2XWDA 1K9TA 1KTCA 1HJSA 3ECQA 3HZ3A 1TVPA 1JD9A 4UQ9A 2G3MA 2BVDA 4BQ5A 4NX0A 2ZUNA 3AZTA 4RE4A 3PZ9A 1BFNA 3SEPA 3OBAA 3IJ8A 1E3ZA 2WZEA 5A8MA 2G3NA 3WD0A 1U30A 4OZOA 3VGHA 1TVNA 3I3EA 1FH7A 3AIWA 5BXPA 4QLKA 1PBGA 4HZ6A 4PCSA 3OGSA 3VIOA 1PX8A 2CETA 3M7SA 3ARPA 1EHAA 4JIEA 3SCSA 1M53A 2YOCA 5HDRA 3W37A 4F9JA 1E56A 2CKRA 4AMCA 1UQZA 4E8CA 2YA2A 4U2YA 5A6LA 3RILA 1QI0A 4CCEA 1CXKA 3VIPA 4PMNA 5JBDA 3NSNA 3OLGA 4J27A 5A94A 1BVNP 1OINA 2WVUA 3HG5A 1ODZA 2E3ZA 3SCUA 2D73A 3VDHA 1W1PA 1UKSA 1P6WA 3BUIA 2XYLA 3D51A 2EPKX 1H09A 4UOJA 1QI2A 3F5KA 1UD8A 1GHRA 1UWSA 1RPKA 3BAKA 3TV8A 3AMLA 3WDRA 2J25A 3AS1A 2VZSA 5M3WA 3DYPA 1JAEA 1HVQA 1VBUA 1N82A 2XVPA 1CGVA 1KR0A 1UQYA 1NWTA 3VIFA 1C91A 1SR0A 4TX8A 3EDKA 1OD0A 5E6YA 2WCAA 2VT0A 3PZTA 4C7DA 2E9LA 1QI4A 5CSYA 5BXTA 3WDPP 4H8HA 3OLEA 1CWYA 1T0OA 1KR1A 3WF1A 1WCGA 1EQCA 2EJ1A 1W3HA 4DO5A 3AJ7A 1JDCA 3WNNA 4ACYA 1KB3A 5JUVA 3EMZA 1OCQA 1GHSA 3ARTA 4OOUA 3RM4A 4CU8A 3T0BA 3VGDA 4W7WA 3WDQA 2F1BA 1E1FA 2C7FA 3ARSA 1Q6DA 4U3CA 3N18A 3VD9A 2OSXA 2VR5A 1G5AA 2J75A 5BRQA 4GI8A 2CBUA 3IANA 2OWCA 3SCPA 2CBVA 2WMKA 3B8SA 3WENA 4DUXA 1CGWA 2Z1SA 1CGTA 5IHSA 1SYTA 3T08A 1ZBCA 3WEMA 3AZRA 3IJ7A 1XHGA 4RE2A 1FA2A 2XFFA 4AZCA 2E9MA 3KLKA 1KBKA 1E0XA 2IXUA 3GDBA 4JHOA 3A23A 2B31A 1DWIM 5FL0A 4PUEA 4XZWA 4W8LA 5IHRA 4MNKA 3WL0A 4EKJA 4CU7A 3WNOA 2F7RA 1A47A 1UZ1A 1DWAM 2IUZA 1V3LA 1FP8A 1VENA 1V08A 2E9BA 1UD3A 1PZ3A 4U5IA 5LYRA 2WWCA 3LMYA 2WMFA 3GXMA 2J7HA 4KGLA 2Y2WA 1EO5A 4TTUA 4QDMA 4FNSA 5KZ6A 1QNQA 4AMXA 3IGUA 2ZX8A 1V6UA 1XD0A 5A6MA 4W93A 4HMCA 2XVNA 2J4GA 2DSWA 1UKOA 2NW0A 1UR8A 3AIVA 2J8FA 4NXSA 3CZ8A 4GZJA 4PMZA 4D71A 4CVUA 5CSUA 4PEEA 3ARWA 1WZKA 1UWTA 4JL2A 5EMYA 4CKQA 4YHGA 2AAAA 2ZUUA 1ECEA 3F5JA 1W9BM 5ABGA 2VQUA 3CLWA 1H5VA 1HKMA 1NQ6A 1W91A 1C93A 1US3A 5A8PA 3EJRA 2RGMA 3ZSSA 3UCQA 4J3XA 3PZOA 1VFMA 2EADA 3MV11 3AISA 1E6ZA 1O7DC 3HG2A 2YDQA 4NZJA 4AYSA 1H49A 3L4YA 4WKHA 1XSKA 1OD8A 4TUFA 2VX7A 2GJXB 1GOMA 1E4LA 1OIMA 1KGWA 2BV9A 1EXPA 2CNCA 4M82A 3A4AA 5FKYA 1HT6A 1XV8A 3AXIA 2YL5A 3CV5A 1E15A 2VCAA 3OG2A 4J28A 5CGMA 3AIQA 4ZXLA 1NH6A 1US2A 2UY2A 1E72M 5CLTA 2BNJA 1BAGA 2BFGA 5A1AA 2BHYA 3BAXA 1WKYA 1RP9A 1JZ3A 1ODUA 2X1IA 3ZT7A 3VGEA 1XC6A 3W28A 3O9NA 1GVYA 1XH0A 2O9PA 2XM2A 4QP0A 1TQUA 2BY0A 3LPOA 4J3WA 2PBGA 6CGTA 3PTQA 2EPOA 1Q4NX 2YLLA 1CBGA 2XUCA 4LYQA 3A47A 2D3LA 3ZR6A 1PIGA 2VTFA 3VIMA 3U5YA 3EJSA 3VDCA 2YKKA 1WDRA 2GK1A 1B1YA 4BF7A 2WWDA 3G6MA 1E9LA 4AMWA 3GXDA 5E0CA 1UD5A 1JDDA 3QGVA 1BG9A 4K68A 3PZUA 1NM9A 1JZ4A 4PMOA 3FN9A 3H54A 1TG7A 2PC8A 3WH7A 1K9DA 1B90A 1PPIA 5A95A 1CLXA 4AD1A 1W9DM 3PZIA 4W89A 4M81A 3AZSA 1NWUA 2WMHA 2AMGA 2WHKA 3GNPA 2JFEX 3I3DA 4LGXA 1M03A 4JFVA 4W7UA 3WF2A 4UQDA 4AZ7A 4M8UA 3SURA 1E6NA 2F1AA 5KEZA 4NF7A 3WQ8A 4UTFA 4W84A 2UY4A 3L4WA 2QV4A 3CZEA 3RM9A 4PMUA 2YFOA 3PN8A 2VRJA 3BXWA 3N04A 3VD5A 1VF8A 4GI9A 1OSEA 2YIHA 4MNLA 5BCAA 1ZJBA 3GTNA 5CZKA 3S5YA 1V03A 3GNOA 2DH3A 2VRQA 4D6GA 1GCYA 1UWUA 4UOQA 1J0JA 3WEOA 2VC9A 2NT1A 3ARZA 4D6CA 2DIEA 2WMIB 3MSGA 1JF5A 3OB8A 3HG3A 3D4ZA 3W6MA 5E9AA 4P7RA 4AC1X 5LA1A 2WVVA 3QOMA 2ZXQA 1E6RA 3VGFA 1QBAA 2WCSA 5E09A 4AZHA 3DECA 1DWGM 1PX3A 2VVSA 2EPLX 8CGTA 3MUIA 2CITA 5ECUA 3MSDA 5DF0A 1FHDA 3TTSA 1TMQA 5D9PA 2WSKA 2D3NA 1UR4A 2A3HA 3UETA 3D3AA 5IFTA 4UZUA 1OWQA 3L4VA 1WDSA 3W82A 1E5JA 3GBDA 4ACZA 3UR8A 5HOSA 1RH9A 1UA3A 3VNZA 1BQCA 3VOCA 4HU0A 1JXJA 1Y7VA 3WL1A 2V3DA 3WNLA 1UG6A 4GO9A 2V3FA 3N12A 1KGXA 5AY7A 4LXFA 2RGLA 1M01A 3EJTA 2PF0A 1LL7A 1B9ZA 4N42A 1X1NA 4FNRA 4F66A 4OJYA 2DDXA 1DWFM 5A2AA 3RMEA 2BY3A 4PYSA 1R87A 2F7OA 3WH6A 3VX1A 3WBAA 3MO4A 3N17A 2QLYA 5A6BD 5EBAA 4P7NA 2PWHA 2J7GA 4AD5A 1AQ0A 2JALA 4UFJA 2BY2A 4AISA 2DSKA 4HU8A 1YQ2A 4KRTA 2DH2A 1QHZA 1CECA 4PUDA 3VTRA 2YJQA 1HTYA 1OT1A 3VX0A 3EMCA 3CZNA 3AYRA 3WQWA 4DM2A 2EEXA 1K9FA 4D6FA 2MANA 3CO4A 4DM1A 3WNMA 1XCXA 2WM0A 3CUFA 3BVWA 3RM8A 1UD4A 2XVKA 2GJPA 2F7PA 2DT1A 4QLLA 1E4NA 5LA2A 5A8OA 4W8BA 3PHAA 4YPJA 3WELA 2ZWZA 4MDOA 1UUQA 1WNOA 4M24A 2CERA 3CPUA 1BYDA 3CZLA 4IPLA 3MANA 3ZIZA 4JZ5A 3KZSA 1ZJAA 2VZOA 1XGZA 1J0YA 1UKPA 2ZXBA 3N1AA 1L8NA 1LQ0A 1V3KA 5FIPA 4J3TA 1HIZA 4CN4A 4UQAA 4LX4A 3WH5A 2HVMA 3NYDA 1GNXA 5AYIA 4GI6A 1E73M 4A3YA 2WK2A 1QNSA 2GSJA 2EXOA 2XPKA 3UR7A 3OGVA 3WDJA 3OLDA 2YLAA 2D0HA 4UQEA 3CGTA 4ZXOA 3W24A 1R7OA 3U57A 1WDPA 2WVVB 1MWOA 1QNOA 1EOKA 2XM1A 1DWJM 4QCEA 3M6DA 4GZEA 1HJUA 1GOKA 1KXVA 1TA3A 1M04A 4LPCA 1CEOA 3DX2A 3ZQ9A 3SIMA 1TQTA 4JCLA 3TTYA 3A4XA 3FHQA 4MTVA 5CXPA 4GXPA 4KGJA 2CBIA 1XYZA 1E6XM 4YN5A 4D6IA 4LYPA 4UQBA 2VL4A 1PEZA 3WEZA 4PMYA 1CZ1A 2XFYA 1CXLA 4JL1A 3VIJA 1EO7A 3WDIA 1KWKA 1UA7A 1V3JA 5CG0A 3VSTA 4V28A 4OIFA 1QPKA 2DT3A 2A3EA 3WD2A 1D2KA 1MVYA 2DEPA 2J77A 3MV01 1RP8A 3W26A 3BVTA 4P8UA 1UOKA 3CBWA 2ZE0A 4W5UA 4JAWA 2QPSA 5I5RA 2VOTA 3BLKA 3AS0A 3W53A 3BSGA 1GQIA 3EYPA 2VZUA 4ATLA 2BHUA 2ZWYA 4H8UA 3VMNA 3BC9A 4R27A 2G3IA 3A24A 1QWUA 2ESCA 3LXAA 3A5VA 1V0NA 2J62A 1ZS2A 4AZCB 3EDJA 5GNXA 4JKKA 1ISVA 1RD6A 1JGIA 1HXJA 1UYQA 1E4IA 2X2HA 1V0MA 3VDBA 2G8ZA 4QAWA 1GOIA 1JD7A 3KLLA 3CH9A 3GZAA 4DWSC 3GH4A 1LJYA 1QI3A 3S2CA 4J3SA 2VMFA 1JZ7A 5CLWA 3G6LA 3BMWA 1UR2A 1ZBWA 4XUYA 4P7OA 1NWRA 4WKFA 1KCKA 3AIUA 1GUVA 4W85A 1R34A 4X0NA 4UFKA 4X9YA 4WLCA 3T2QA 1PX4A 2FH8A 1BYBA 1CGXA 3A21A 2XHYA 3DYOA 4TTGA 2CHNA 2CPUA 4LQ1A 4NSBA 2X0HA 3VD7A 3L4TA 3AS2A 1ZBVA 3ZT6A 1KQYA 3WMCA 5FCZA 3N15A 3BAWA 5I78A 5JBFA 3NDZA 3OZOA 2J7DA 4MAZA 3BCFA 5CGTA 3NSXA 3U5UA 3MUY1 3HJEA 3W4RA 1CGYA 4XB3A 4Z2GA 4NZCA 2XG9A 1BTCA 1G01A 3RJYA 3WUBA 4CN6A 4Z2JA 2YA1A 3CZGA 1ISWA 1E43A 1FFQA 5A3HA 4W87A 3N11A 4AD0A 4W5ZA 1VIWA 3AMDA 1EH9A 4W7VA 1TQSA 1GZJA 4FMVA 2NT0A 2W92A 3ZJKA 3CZSA 1UR0A 1G1YA 2WB5A 1LF1A 2F7QA 5IFPA 2W63A 2G3JA 2D23A 1VEMA 3WIJA 4CCCA 1UASA 3GYCA 1I75A 1W3KA 4HA4A
chains in the Genus database with same CATH superfamily
3VFLA 4OCWL 4ZB0A 4JGJA 2Y5TA 5HD8D 1EEZA 1JIBA 4BFOA 5H35B 1IQDA 1WYIA 4MJIE 4L9XA 2VLRE 2XFRA 2V33A 5DJYA 5F7DA 3KNBA 3VU1A 5K9JH 5GRWA 1IWPA 3FJ4A 3DDFA 3GSRB 5HNTA 4Q8VA 2W5FA 2QUMA 4NO2A 3B9AA 4G8GD 4YBLC 3T2OA 1N4XH 1JFXA 3S4TA 1RIUH 2FYYA 5T9BG 3PGDA 4KQ4H 4P05A 2QCGA 4Y7EA 4AD4A 3QCUH 3JWDH 5D5ME 5A8QA 3WO4B 4NLHA 3UEZA 3WJLC 5D4QA 3MNVB 4HGKC 4LV4A 4RX4A 3EOBA 3QEQB 4ODWA 4XNYL 4RGNE 3AMCA 2ADGA 4GAJH 1BXUA 2HLEB 2YXGA 5BMFH 4YIQB 1RHCA 2VDNB 4KNTA 4M80A 3TNMA 5HHME 4PUMA 3HBZA 4C7GA 1I1AB 2R0KL 1K8CA 3ARGC 1R1CA 2UZPA 3MFFA 3VYNA 4G6AC 1XR8A 4DGVH 1TTUA 4HCLA 4L1WA 4C6DA 4YWGH 1NARA 5BROA 2ACUA 3IJHB 4YVXA 4RH4A 1CBVH 1E1CA 4HQVA 5K7JA 4LDCA 2PWGA 4TUOA 5KYUB 1MXSA 2IV8A 5CPQA 1XIWD 4ES9A 2E7MA 4IL2A 5DCBA 2DLIA 5AKTA 1XS2A 5DDHA 1SZFA 4N6QA 3TNNA 5LXEA 4HIQA 3TYAA 2OK0H 4AGLA 1BFOB 2Q6WA 3HZMB 5EU6B 3RAOA 4A2RA 5C2BL 5CCZA 3K4DA 4JFYA 4TOQA 3IS0X 1P7KB 3ARXA 3TQVA 1MNZA 1RK7A 1RUKH 1SEBA 4DK5A 5IBUG 1FAIL 2POZA 3T6QC 2AJYL 1P43A 1TVBB 4Y8AA 2C3HA 2ZSVB 5DU7A 4E38A 2CXGA 4PJCE 1ZWIB 2WINA 4BELD 2IAND 3MBXL 2PWDA 3VFUB 5FYKE 2NY6D 4BFFA 2E7HA 3VXUA 3KEHA 2ISWA 1K77A 4YXKH 1DBJH 2IFGA 3PQYB 2ZX7A 5ESAB 4PLKC 3F7PC 2ZXWB 1E9IA 3GDRA 4LSBA 1N4XL 5AHNA 3CC5B 3GSUB 3RVVD 2DZXA 3NXFA 5D4HA 3PZMA 3QZAA 4R9OA 5DMLA 1OW0A 3WS6C 1Z89A 3EFDH 3MRRB 2TAAA 1XBRA 4ZR8A 1AHWA 1E4WL 4WUUA 1MFEH 2P48B 3GRWL 3MLWH 1GVQA 1FZOA 3K71A 5EF1A 3BARA 3NZQA 4J4KA 4W70A 5D4YA 3D06A 1M6UA 2TPSA 4JRYB 1ZAGA 3O2WH 1NANH 3PAYA 5IBTL 5KITA 3MA9L 2L3BA 4PLJC 2P43B 3O9WA 2ZX9A 5JO5B 2CO2A 4AQZA 2QCNA 2XETA 5H91A 4IJ3B 1LT7A 4WEBH 5HANA 1N9PA 3VFMB 3QAZB 2PMZA 4A7UA 1U33A 4HFWA 4XVTL 3QXTA 3HBLA 1TYGA 1VFAB 3KCPB 1EAQA 4Z0BL 2PUQT 5K5YA 4DCQB 4LRIA 5TBOA 4C6LA 1RA5A 3IJHA 4KQ3H 3DXAB 4UMBA 3R5EA 3MJYA 4PGDB 4UIKL 4HOXA 3ZUCA 3DLQR 1VCFA 3QR3A 2HFFB 2ROXA 3NVQA 4E9TA 4POZD 2DQXA 3DYMA 3L08A 4WTQA 3QJFB 2JEQA 1KGYE 3C09C 2QCEA 2B0SH 4M43L 1Z6KA 1BF8A 4UV4H 4L7ZA 2X2JA 1TPFA 3PTMA 2YPLD 1GIGH 5EA9A 3NZPA 4NM4L 3UAJD 3S5OA 5JXQA 1XGUA 3OR6B 4ZYKA 2K7QA 2BIOA 4QSHA 3WI9A 1AG0A 1G9HA 4WTZG 1EFXD 5F7YC 3WUWA 5AUMB 3L3HB 4MXVF 5C71A 3QDAA 1HKLL 2EDDA 5A6BA 1TETL 2AAMA 4LLWA 1UGKA 4DYEA 4RV3A 5BOOA 4QTIL 3BOLA 4M4RA 4UTTC 1T4WA 1XYLA 2J6EA 4MQXC 3GMNB 4RSYA 4LHJB 3GSUA 4BK9A 1WCBB 2V4LA 1A9EB 4HOWA 3KBEA 2APXA 3WEXB 4RR4A 1DVZA 1W56A 1SZGA 4NG3A 5JQ6H 1XWYA 5EC2A 1II4E 2ZUVA 4BKTC 3DGBA 3QMRA 3IACA 4GC3A 2ZUYA 1WFJA 2EYTB 1F1DA 3PWJA 3CFBA 3NJGA 4NPYB 4L4PA 1U58A 3D85D 3UJSA 5FOOA 1HQRA 1B0RB 5E7FA 1KB5H 1XCWA 3CVHA 3LX9A 3ELQA 4XWGH 3TA4D 2YPLE 1ZLVH 3CQ0A 3GDKA 3QV8A 1TG8A 3N55A 4AYEC 5I1IL 4DJEC 4KNQA 2YC1B 5H37A 4DIXA 3JT2A 3QT2A 4L4JA 5F8RC 1FHVA 4XMKL 3GLCA 4JEJA 4DXVA 1A1OA 4BSWB 5CZVL 4FFYL 5BRZB 3BUBA 1EANA 2R69H 1P5UA 3WNPA 1GZPA 3CXFA 3L5WB 4WUKH 5IV2B 2ZZUT 2AJSL 4GSRA 4GS7C 1K4CB 4FQHA 1Z7JA 3NQGA 1O9ZA 4QJ3B 2DF3A 1LWJA 1SO6A 4HC1H 4JTRA 3WN5B 2DKMA 1P0EA 2V37A 3PTKA 2BVOB 4XVDA 5BWFA 1OGSA 3LNGA 1FUYA 1OK4A 3WF4A 3H2AA 4LALA 2YO3A 2DQIL 3VTTA 5KYWA 3SCTA 1E40A 1I1AA 3CLFL 3SCVA 1X9QA 1Y07A 1F6KA 2JKNA 5I3FA 4IOFD 1KLZA 3D12B 4XO9A 4CGUB 1T5WB 3LRMA 2CMRL 3P84A 1LRQA 3NFPB 3GMQA 4BH7B 2ZKYA 3U1SL 5DHYA 1DJGA 2PODA 1A7RH 4H7VA 3QIWB 4OBRA 3RTQB 2IXVA 3LEYH 4LHUD 3LN3A 4P2YA 4GG6A 1W1B1 1CFQA 2FL5B 5FXCH 4UFLA 3ZIYA 3KPSA 3RP1A 1QNRA 1OFDA 5AC6A 3OIXA 5C0EA 3QPEA 3ARFA 4L3AA 2OM5A 2V9TA 4BEQA 3CXDL 4PTMA 1H2JA 2ACRA 2J56A 2ZX6A 4MD5B 3SE4A 2IBBA 5I6MA 2QXWA 3LKNA 4UTAL 3SE4C 2J5LC 4IGBA 1SFJA 1YECL 2OXGA 2WSDA 3MSPA 3TIDA 2VL5A 4ZA0A 4M1GH 5FHBH 1DFBH 1G7IB 3GMPA 5DZOA 3ZTJH 5DBUA 4JM2C 1BKSA 2FJKA 1SOQA 1MQQA 4PI2A 3WXWH 2A7BA 2JKIS 1BVLB 5AENA 4EI5C 3IN0A 4DEFA 3HTLX 4S3CA 1CIDA 1GVSA 1SJHB 1AZ1A 2ADYA 2EG8A 5DC2A 2E9GA 3RIFK 1PG7W 3PWUB 3BKYH 1FFPA 3JUZA 3ORJA 4H8WC 5C0BD 1S7XA 2IVFC 3WFZA 2WZHA 4US5D 4WR3A 3GSQA 1E9YB 3K46A 3LIZA 1V10A 1ES0A 4H00A 4DQWA 2WXOA 1I85A 3G08A 1EP1A 5A43C 2D03H 1ZAJA 3EKGA 3MYOA 3FK3A 3MRJA 2CCVA 2WQSA 1FO0A 1EAPA 2G95A 1JTOA 1NFIA 2F08A 2YD3A 3MRGB 3TF4A 2EECA 1J87A 5B4MD 4BBWA 3VA6A 2NQZA 2QCCA 1GGBH 1RZKC 4ZAKB 1G6RA 3U48A 1X3DA 3K0YA 1GGYA 4AGMA 1IGYA 4QRFA 3FT4A 4B53A 5IOPB 3FOKA 2C9PA 3FOMB 1FY6A 5FV2A 3WQOA 2OYMA 3IS1X 1FFOA 2FO4A 5IROA 7FABL 1YW1A 2Q86A 4WUKL 3KXFA 2HE8A 5F1SA 4AD2A 4WAFA 2C14A 2Y72A 1H5YA 1ZCRA 1O6SB 5FKPA 3D0CA 2WXIA 1F90H 2E8YA 2FKPA 4F7KA 3V1PA 3DJZA 4NRXB 4UQ3B 4RRPA 1DQDL 3P3UA 1V0LA 3KM2A 5BS0D 1OX6A 1JFQH 7XIMA 1JG9A 4JRLA 5BW6A 3DIFA 4Z7VB 1QQDA 3B34A 3VB9A 1JZ8A 2PDJA 3DESA 3VIIA 2YJLA 5CSZB 1WSST 2BSCA 1JHKH 2X4QA 2HXTA 2IW0A 4QCFA 3T1GA 4X98A 2UVEA 5LN4A 1ZGDA 2D7OA 3LA4A 5ETUA 5I15H 3K91A 3VXRA 5LKYA 3FF7A 3ULUF 2OZ0A 2EVFA 3MLYH 1OC6A 2W9DL 1PZ2A 5CN1A 3WY2A 3MTRA 2GJNA 5CC5A 5HDBE 3SHSA 2WUCL 2QQLH 2TODA 2H1XA 3ZXAC 1RIHH 4GUOA 4KWSA 4JPVH 2PPAA 3MUGA 4J12A 5AC4A 1F45A 1S2TA 5L2KE 1G94A 4H04A 1R3LA 3P6LA 1NCGA 1MHEA 1SYSB 1JCXA 3G9VA 2NY6B 5HHOA 4EIBA 3AT8A 3PJWA 1VFUA 3IWVA 5GGTH 5I8KH 4EPSA 2EO7A 2H41A 4Y4HD 5IW6B 3HV8A 3EX6A 3K1DA 4UU9A 4OV9A 1ULVA 4H9VA 2X41A 3QQ9D 4Y1AA 3IIPA 1XXDC 1XZWA 4R97C 3MMDA 2QULA 4GRWF 5ISZE 2C1OB 1MG2C 3ZT5A 2EKCA 1JVLA 4NJAL 2B7QA 3BT2L 4PWHA 3VWJB 3USBA 1TTAA 3BKCH 3SFKA 4N8CL 5KBMA 3W2MA 2F8XC 1IKFL 4K36A 4XZBA 4U6XB 4KT2A 3Q0HA 3BPNB 4Q7DA 3GUWA 4OD2A 3AJXA 3MV8E 1UFGA 3JWNC 3DHUA 1XGYL 2DI8A 3P73B 2XPGB 4FLHA 4MAYA 4RMTA 3VIKA 2Q6ZA 1TA3B 3LNFA 3M0YA 2ITDB 1BFOA 3K2GA 5TE6L 2ICES 3WKQA 1B4RA 1B4JH 2FVMA 1KC5L 4LH8A 3V0HA 4QITA 3FW6A 4NOBA 3GD6A 2FLIA 4FS9A 3QDGA 1U8KB 4YHPA 4OF8A 1SY6L 3GG0A 5MEPA 1GG0A 4IMGA 4MF4A 3C2AL 1NSJA 3GG8A 2A6DB 2DTMH 2W65B 1TSHA 3D3VB 1UIPA 4MKSA 4GG9A 4PJBE 5KVMC 2H2PD 1THFD 2ESVD 1AYOA 3QUYA 5K9XA 4AG0A 1YTKA 2DMKA 4M7LT 1PAMA 4PWIA 1E4WH 3GC2A 2NRDA 3SPVA 1EL3A 5A6JA 4RLDA 2CDFB 5GIRB 4S1DC 1BGAA 2AKZA 1RK1A 3QXDA 4QGTA 4QRNA 1E8WA 2KBGA 1LOSA 2FB4L 3QJAA 1WH0A 2V69A 1IFHH 3RY5A 4IQJA 3QPQD 4DF0A 2BO0A 2YB4A 1ZY9A 4GD0A 4WWKA 4AT6A 4HTYA 4OGAC 1IGTB 3T8MA 4XOEA 2PYED 4KH9A 3DI2B 4BWLA 1CIUA 2GVYA 3QDMD 4HWBA 1NCDH 3V0DA 3QJTB 1I9JH 3QDJA 5E6UB 4DGUA 4EXPX 5C7HA 3DMMD 2D2OA 1LO5B 2IGTA 2FYVA 3MV9E 5T1MB 3WHXB 1RJQA 3NM1A 5EBLA 2IWFA 2P5EB 4B97A 4NN6C 4M6OH 3M46A 1ZL1A 3HTWA 3FRUB 4O8AA 3FO9A 4RMSA 4FTVA 3MO1B 5D7JA 2DMHA 4E8DA 3ZL1A 5ILTL 2C91A 2VZ1A 3VI3A 4JFWA 3P0GB 4PD4K 1S7RA 3K8LA 1UWAA 5T5NG 3OVRA 4G8FB 4NO5B 4PJFF 2Z24A 4GBXC 5KANG 5BO1L 3DKHA 4R7NB 1EGJL 3QC0A 4PMQA 2EYRB 1S9VB 4N2DA 2ZWNA 4M1CC 1FP5A 1S7TA 5HVWA 4HCFA 1MXDA 4QOKE 1ITUA 4FNTA 1KV3A 1HE8A 1XF1A 3K8MA 3NRPA 4XH2A 3S6TA 2W0PA 3DJRA 4OVXA 3VXSD 4GAJL 4OCSH 1M3JA 3QDGB 4Y16C 4Y5XB 4GI4A 4TVCA 1REIA 4XPFL 5TF1L 2F53B 3I6KA 3DUSA 3L3IB 1IBDA 1HJCA 1FWBC 1XXXA 5BOFA 1OCNA 2BSRB 1NAL1 2FHCA 3TYBA 4X6FA 1DDHB 2VH5H 3OX8B 3ULVL 1RIUL 4L3ED 1M6OB 3ARYA 5AYZA 4WW1A 2P5WD 3KVQA 5FCUH 1G7IA 1NF0A 1WBXA 2A6JA 2BSED 4JG1L 2PDBA 4X80L 2UY5A 4LY8A 4BSJA 2VX5A 3QDGE 5KSAC 4ZCWA 1XRVA 4NZ5A 4PJIB 4LLWB 4EJ1C 5IUCA 1QAPA 1TB3A 4H0LC 3JVGC 4K7PX 4ODVH 2OULB 1H41A 2ZXAA 2PXYD 3BPCB 4NB7A 4NPJA 1MYRA 1SO5A 5INCA 4KMLB 1QMUA 3LRKA 3U36B 5AL8A 1S1PA 3GSQB 1A4CA 4BK5A 5JPNC 1E9PB 4MS6A 2NX5E 4Y19A 1Y8BA 1CLOH 1TPXC 4OU1A 3ZRCC 4EDXA 2C34A 3QQ0A 3MRLA 5F1OB 3TH2T 4LE8A 4Q32A 1OGAB 4C7FA 1KM3A 5A8NA 3S5NA 3HZVA 1QO3A 2R69A 5EDSA 1WZ1L 3DUGA 4F79A 4EIGB 5FF6B 2Y88A 2YAMA 1GKPA 4QOKA 2FZDA 3ARDA 2ONEA 3GSNB 3ITOA 3SY0B 1FSKB 2I7OA 2YPKA 5ACMA 2ZKXA 3VG9C 4XI5C 1P1XA 1FGNH 4L4VD 1URIA 1J10A 2C6QA 4MJ2A 1QU4A 3IIXA 1MFBL 1WFUA 3BAIA 3ZUNC 1KFLA 1F9CA 3V4UH 3QIWD 3DX0A 1Z32X 5D9SA 3RTQD 4FXLA 3T2PA 3G77A 1K4CA 1XRSA 1M7IA 5HUOA 3ERPA 1FRBA 4M61B 1H3WM 1KJMB 1I8AA 4P4RA 2IDFA 3LPGA 3OMZA 4K23L 3ESNA 4TQIA 3WKPA 4JBRA 2FGLA 4WJKB 1G4EA 3FT0A 3CDGB 1EC7A 2INFA 1B3YA 4LIQH 4XSMA 3QUGA 5I3DA 4B3ZA 5IBXC 4LOUD 1W1TA 5DT7A 4X9HA 4Y5XA 3EDFA 4QJ1A 5IBXA 2XNAA 4NNYA 1I8MA 1MHCB 4XISA 3FS2A 4LAJH 2DWYA 4QFUA 1TCMA 2HXAA 2P80D 1DQDH 4JZNA 2LAGB 3SBQA 2IKGA 4H19A 5BZAA 3DSFL 3FSUA 3WK1A 2WXJA 3NOEA 1G0CA 2ZRZA 1JUFB 1XH3A 1ZALA 1D9KB 1YN7B 3PGFL 4KK5C 2KLRA 4ZUVA 2ITDA 5IQ9A 3T09A 2FGBA 4RXFA 1NDMA 5FR3A 3EXLA 1W1A1 3FFDB 4TSBH 4AEEA 3H8NA 5EIVA 1HYSD 1D7KA 1DWHM 2IDUA 3W9EA 3EZ8A 3ARVA 1S78D 3OKEA 4MB3A 1HX0A 4A2GA 4A2FA 2BOGX 3S8FB 4YCOA 4CD8A 3VILA 3LBMA 4AXWA 3P2DA 2QGDA 5K9QI 3EXSA 2O1AA 3TN3A 3UF9A 4C54A 2G5BB 4XNBA 1MZHA 5IM7B 1XLIA 3QW9A 5ENWA 5F89B 3HQPA 2CBJA 4P3CL 1IGIL 2P24B 4UQCA 2CU0A 1AHKA 2OLHA 2V38A 3ECBB 4TQPA 3AICA 3O4OB 4I3SL 1OD7A 1ESOA 2VDKH 3OHXA 4L4TD 1N8ZA 2BGQA 1XMEB 5TE4L 4P9MH 1YEKH 4RZKA 3EH4B 1PTGA 3N13A 4WRHA 3MXWL 1W3JA 1MDAA 3V0FA 1U8OB 4MWAA 4AT6B 2BVUA 1PEWA 1SJHA 5AVUB 1AMYA 3ZTNL 3BGFB 1G7MB 3RO6A 3PBUA 4OLWH 3WSUA 2ED8A 3BKJL 3C60A 4AVJA 1XW8A 4LBEA 5CGQA 5DQPA 4H8VA 2PDCA 5FSEC 1OTSC 1EQPA 1E2WA 4O51A 1NFDE 3MXVH 5D9SB 1KJ2H 4CSTA 4V1XA 2WWMD 2F9BT 2OLSA 3NR0A 3LEPA 3AZUA 3SYQA 1E9QA 3V5KB 1YE4A 2WHMA 4LY4A 4BQ2A 5AZUA 1T8QA 3CS2A 2VCBA 1NAMB 4P8QA 5C9RA 5B7ZA 1BRLB 2FZ8A 3C5JB 3QEQA 5I0DA 1JYWA 4H4IA 1F5WA 3Q9QA 3FU3A 3P11H 2LABA 2PW2A 5FHAH 3N73A 8RUCA 1EUUA 1C12A 3Q8EA 3QJXA 3PWPA 4GY1A 4IT1A 3IV3A 4NKMB 2E4TA 5B7MA 4Y2DC 4PGEB 4GBUA 3RPMA 4E0CA 4Y88A 4FXFA 4K9JA 2PR4H 1BZ7A 4XAWH 2UXVA 3MV8D 1R24B 3KPPB 4NAMA 4HIHA 3RDTB 3PF3A 2E9WA 5HGAB 1E4HA 1U4FA 4W4OC 5BO0D 5I1DA 2X30A 1Q2SA 4H40A 1D5MB 2C26A 4MFEA 2OX1A 1H51A 3GLDA 4FG0A 3VFTB 3QZ6A 5G1MA 4JDYA 4GIRA 3WU1A 1ZVHA 4HWNA 4P23D 4U49A 4YXHL 1B3ZA 3B4UA 3NJHA 3HFFA 2AMUA 4LRIC 3V6FA 4QHKI 3XINA 2CLRB 2D31A 1KELL 2F58H 3EO9L 1NCTA 3H12A 4B92A 3I02B 1N8WA 1QHPA 3TK7A 1IR1A 4A2EA 3UPBA 2AQQA 3U30C 4JCWA 4KZ0A 3G1HA 1SJMA 4FMFA 3MHFA 3BH4A 4K94L 2YPIA 4WDUA 4XG1A 3UWYA 2HVBA 5DMGD 3HB3B 2OTPA 1XBZA 4S1RL 1A1NB 2CHZA 3DEQA 1HEHC 1OXYA 3ANYA 4H1LG 2V82A 1DJQA 4OZGE 1DBKL 1W37A 2Z28A 1BM7A 2QADD 3D4GA 2A3CA 4N2YA 1ONEA 4H88L 4FOKA 3CHOA 1AIZA 4A21A 2YHGA 1TZIA 3EG9A 2EICA 1ADQL 3RIAF 3WY1A 3VUSA 2FNBA 1ZK5A 2EPMX 4XX1G 1C9SA 1HJQA 2HT2D 5LZLA 2GJJA 3DTUB 2WLIB 4XN4A 5LGHL 4QHRA 3NCMA 4OD1L 2CPCA 2X9XA 1V3HA 4FC3E 3GFXA 4Q6IB 4NFDA 1GOHA 1N5YL 2AQOA 4GMSL 4OE7A 3HPSA 1UOLA 5AD0A 3BZGA 2XU2A 5HYJD 4UCGA 1OF2A 2EH7L 2PE4A 4MYAA 5EMLA 1LO4H 1DFXA 1GJUA 5I0ZA 1SZNA 1QBBA 4WWNA 1J11A 1MRQA 1AC0A 5KINA 5D8WA 2DI7A 3DVNA 5ACLA 4MSWB 4QROA 1DDHA 4AWJC 4MA7H 1XIBA 5DO8A 3MDJA 3ZO0A 3MHGA 1KQZA 3W0KA 3FCTA 3W3BA 5AHLA 1V6YA 3DX7B 3UYOD 5DJXB 1T0NB 4UAHA 4I3RH 1K7EA 1YEHH 5BWAA 2XG5B 1AZRA 5ID1B 1LWHA 3C08L 1MI5A 5A2CA 3EJYC 4FQXB 5ID0B 5EMMA 3CVBA 5KZMA 1P9MC 1JHTA 3SCQA 2DV6A 4KRPC 3GBEA 1KACB 1Z9LA 4KV5E 3S0PA 5L4JA 1M1XA 3QSRA 4LRNL 3PGFH 2BM3A 3PL6A 4ZNEA 3DU0A 1IGFL 4XXCA 1UM4L 3WS3B 1M2VB 3BDYL 4OGAD 4W81A 1OFPA 5H2ZA 5A2FA 1KCWA 4YE4L 2W9EL 3OZ9H 1UWGH 2J1XA 4BDVB 4F8QA 4RA3A 1JNEA 4HA3A 3ABSA 2VKWA 2PXYC 3SBWC 1UM6L 2DKUA 2NUTB 3D69A 4L3FA 3WNKA 1YJDH 1PFCA 3MCLL 1EHKB 3TN4A 4JFFE 3KW3A 5KZCB 1DIEA 4B41A 2VAAB 4GT7A 1LP9E 5FYLH 3FB5A 3LKSA 4N2IA 4OV5A 3MROA 4NWUL 3GZPA 3GW0A 1LO5A 3OHXB 2R4RH 1D3GA 2EDJA 1KB9J 1JWSA 2C1GA 1DQTA 4WWPA 4FYQA 4U6HA 4IU2A 4NO0D 4NQVA 5FD0A 3OQRA 3GSOA 2CUMA 1HOCA 4FF9A 1AJ2A 3WIHL 1AGCA 1DJIA 1E55A 1AHMA 5AVHA 5XIAA 4N2HA 1I8KB 1R46A 4KK9D 3OYXA 4TM9A 3B6SA 1R33A 1WKDA 3UAEA 1WQVT 3K7UA 4XVOA 2HAZA 4EOUA 5LGHH 1TZHA 3MQIA 3EFFA 2XG4B 5IJDC 5FEPA 4ODHH 1OSYA 2AK1L 2RR3A 4ZZFA 5HHXL 5C0CD 4TULH 3TJLA 3GSWB 2QFRA 4KX8A 2YGYA 3W86A 4PCYA 5AFAA 1DEDA 4N8VB 4FQQB 1S9KC 2Q8XA 4YNGA 4YVVA 1IQ8A 3ITXA 3GM8A 1VAHA 3PQYE 3WX7A 1TTPA 4D71A 4URIA 4BXVA 3E74A 4GO8A 3W00A 1P1VA 3HCVA 4JY4B 3DJTA 1SMDA 3L4CA 2OTDA 5D2TA 4UM8A 5D09A 3ILPA 4AYBA 2IPGA 1QPNA 3B8VA 2Y8KA 1OAQH 1U95A 5FCUL 5JW4N 3NP4A 4H6EA 3MKGA 2DIAA 4S39A 3O8XC 4Z18A 1XHHA 2Q8LA 4Q4PA 4WK4B 2J6WA 3D3VE 2BX7A 1YIXA 1KGUA 3OBKA 1A6AA 4WY7L 3U7VA 5D1QB 1QOQA 4NRZA 4F0LA 1W80A 2ENQA 2HJFB 4JFED 4RWYH 3LZ5A 1NC4B 2PTXA 3MV7E 3EEGA 1EHLL 3QEQD 3ZJAA 5EBWA 4YHNB 1QK0A 3OKLA 4MHHG 3P8IA 1H9VA 4UTAA 1IYXA 3NO1A 2Y1VA 3ABZA 3FFSA 1PY4A 4AL8L 1U3HC 4FXGA 3TPUB 4PTXA 1YPZB 3VK5A 4Z0JA 1FYTE 3HOGA 4K5MA 4EDXB 1FWGC 4B5UA 2CW6A 2YSWA 5B3JE 2X4TB 4F0RA 3WLBB 4P5TB 4MNJA 3FQYA 2WZAA 1TV4A 3GHUA 3B8TA 1B3WA 3CIVA 2E74C 4NAFB 1MCKA 3T4YA 4N85A 5E6SB 5A7EA 2HG0A 3G1AA 4K15A 1ZGLB 2BNQB 4ZMXA 3FCGA 1H6FA 1ZLPA 4PJHE 2P5EE 1Z5YD 2FIKB 4RAUA 1GZ1A 4G8TA 2MHAA 3DI0A 3CUPB 4XPTL 1ID5I 2J4WL 2DS4A 2R1YA 3BW4A 3O9WD 3S3JA 4JZJB 4EQ3A 2FEJA 4PTTB 2J9ZA 2VQ1B 3LN4A 1I7TB 1J8SA 2JB5L 1O6TA 3HPLB 4HJTA 1PLBA 1QHQA 3MR9A 2AERT 3PNWB 4DO4A 5L2KB 4ENLA 5JBEA 1O94A 4ZFZB 3WBDA 1IX2A 4OJDH 3BO8A 4NKIL 3T42A 4C55A 2IMMA 5GZOD 4HJJH 5MEQB 4X0KB 3SKMB 3NA4A 3TO4B 3H56A 3HCVB 1ZRUA 4JY4A 3VB8A 2DPEA 4XE5B 8XIMA 1SFSA 1O0VA 9RUBA 2XWBA 3UABA 3VXRE 4YPGA 4Y0GA 3EGDB 4Y4KC 3CAVA 2DN7A 4AYFA 1T5AA 3V16A 2OQJB 2H4EA 1SPQA 1S7TB 1YDOA 4NVTA 5A6TC 4G3YH 4XPGH 4YSCA 4WO4B 3OAUL 4B7IA 7TAAA 1Y6NR 2FSDA 1R5VA 2YPLA 4GKSB 4KHTL 3J27A 4LEOA 4N5ED 3GB7A 4XN5A 1BHGA 5C6WH 1FTXA 3MLVH 1BQHG 2G0LA 2ZYHA 5JW3L 2V5SA 3VD3A 2WQUA 1NWSA 4F33B 2UWEE 4LHUG 5A7BA 1DVUA 3BUQA 4FQXA 3PFRA 4ZMWA 1BQHA 3HGSA 2TRYA 4K8HA 4P7QA 1CWVA 3D9AL 4AG4H 1M3UA 4TXVB 3AM8C 1ZK9A 3MFFB 4GW1A 3MV8B 3T0VA 5KVGL 1EZ2A 1IWBA 5E9DB 4Q4KA 2OMYB 5IDZA 3BVUA 2IALA 2NY3B 1IBBA 1H3UA 4H8PA 2HFTA 4FFYH 4E0RB 1ADSA 1O1ZA 1V4YA 5D7KE 1BF2A 3UZVB 4OECA 5IRPA 3SDCB 3T3MF 1AE6L 4IOIA 3P0YH 1XCQB 5F9DC 1JI1A 1XB6A 2OW7A 3DPBA 1OF6A 4Q8BA 1TQXA 4PL2A 4W6WB 1RUML 3OD3A 2VDPH 3FFOA 5KYXA 1IGML 1ECZA 1F41A 1UCBH 1HHKA 2DQGH 4PGBB 4A38A 4BI7A 4FQHB 4WEEA 1SXAA 1PMYA 4Q9QL 3JUGA 2JEPA 2YMXH 4M0XA 3V5KA 2WBJC 1XGPA 3MACH 2EG6A 4RWHA 3IAQA 2B59A 1OIOA 3QPXL 4Z95H 2GQAA 3UNDA 3SY0A 4HFWB 1BWKA 1XH1A 4OUUB 1JFHA 1Y0EA 1U8KA 1FCQA 4DW2L 3L5LA 4X9SA 4EPBC 1S8DA 4JFYB 1LDPH 5T26A 1TTCA 4OCRL 2XXGA 1T5KA 2ZCLL 4M6MH 1PU0A 4TQEH 4Y5YA 4UNTA 5D8JL 1ZLWH 3MLXL 1E3XA 4CNIB 1LXMA 1T6MA 2D20A 3ESOA 4D9LH 3MJMA 3G6AA 4XGZA 3VWJD 3QFEA 1NBCA 4MAYB 3ATYA 3A4WA 1MMFA 2B7DT 3T8XB 3SAZA 1BDYA 2R0WL 5LXGH 3LZRA 1WTGT 1GIGL 1EFZA 1M7OA 3DV4B 2VDML 4Y9CA 1GOFA 2B2XH 5FCSH 2QNEA 4M02A 3NL5A 1U8IA 1JBJA 3SQRA 4A4AA 2FQGA 5E99H 1ETA1 2LU3A 4KUCD 1DBAH 1XTMA 4L4VE 4CMMB 1QD0A 2VUYA 2JTDA 3OHXC 3TC7A 4JM2D 3WFHA 4JS7A 4IL0A 4S3KA 3NUKA 3MNZA 1DKWA 1DYSA 1VGAA 1FIGL 1VCAA 5IF0A 1FHLA 3T4CA 4ECLA 4ACPA 1ZLEA 1WIOA 4NT6A 2O9TA 1OX4B 1T04B 3SCRA 1NEZB 3VI4A 3KXQA 3ME3A 4XC3H 3O6FD 1ADDA 3SDAD 2G30A 1GGUA 4FA3A 4R2GD 4XOBA 3L2LA 4LPXA 2B8OT 4L29A 3FDKA 3FOLA 3GRWH 3P82A 1D2OA 1XSIA 1QTSA 5ABAA 4KO6A 4MCYA 5I74C 4HU3A 4WNJA 3FO2B 3GSVB 4F9LA 1MFCL 3WTUA 2EC8A 4OHQA 2XWZA 1GW1A 3RY6C 5FF2A 4IPPA 4P2VA 3ZWTA 4H83A 5IVXA 1C5DA 1JZGA 3HNSL 5AZEL 1DBJL 2X4NB 3QXAB 3ALGA 4YS1A 4LEXH 3ZVHB 1DVQA 1ITBB 1JPGB 4GBXD 4LCWE 1K70A 1ZTVA 2OZ8A 3UWQA 4MJ4A 5BJTB 4CJ0A 1FWCC 4W9DC 4BFRA 2BDNH 1V02A 4PTWA 4JPWH 4MSWA 1E28B 1EUAA 1T80A 3CK0H 2GBAA 3CK0L 3ECBA 3JVAA 4GXFA 2W0FA 3ESUF 2GVLA 1EGJA 2ZVRA 1NEPA 3TW9A 4L4MA 2HA1A 3GPSA 4G1MA 1CR9L 3NK4A 4LMQE 3LS9A 5T3XH 2KDYA 3AY4A 4N0YL 1HXKA 2CKBA 1JV5B 3G04B 3K2MC 3WTWA 2OMNA 3RGHA 5GNYA 1TNNA 3CXDH 2PKDA 2OXHB 1VESA 3U46B 1OE2A 2UVFA 4ZOAA 1UZ6F 3OJMB 3RWDA 2RKXA 5KSWA 3GYRA 4DWSB 3D50A 1V7NH 2F2HA 2H3KA 2AZAA 2QGCA 3CX5J 3IE4A 4LP5A 3QI9B 4XODA 5DHXB 4IHBA 2O0TA 2WW5A 4JJ5A 4PUJA 2YD8A 4JVUA 3RX8A 4JDTL 2WYSA 3RGVA 3O63A 4MAUL 5AZ2H 5HPMA 3SJVA 3WBEA 2XQBH 5CD3B 1GY2A 3U0WH 3L4ZA 2B14A 1B0RA 3NIFB 1GAFH 2EZ0D 2A4ZA 2WIIA 2XQYG 3CSTA 2OGYA 4N90D 4PIBA 1EZLA 2B1AH 3QG6A 2AK4D 1T1WA 4PAZA 5B7YA 5DS8A 4INFA 4D6JA 1HL2A 3H55A 1DSFH 5DK0B 5I24A 2CZEA 3CN4A 1OGGA 4ODUB 2N59A 2QQKH 2NLYA 4OFYD 1PJWA 2HSIA 2IDQA 5FDWA 3MW7A 3OODA 1YEFL 3MJ7B 2R1YB 3KMDA 4Q9RL 1R47A 3DX3A 1AS7A 5I2UA 3BO9A 1TUFA 3ARQA 1KPRB 1TQBC 4JKPH 1M71B 3I9GH 3RAJL 1Q9OB 4JFDA 2OAAA 3C0LA 2BNRA 1DANT 2XA3A 2BSSB 5HYSG 3GVRA 3SN6N 1UG9A 3GSNA 3ZVIA 3ITTA 3FQTA 1AVAA 2XTKA 4MB4A 3R0MA 4XCYA 4O58L 5D37A 1MXGA 2CKBL 3OHIA 4L8BA 3SO3C 4M7JL 4F3FB 3L6FB 4LK4A 2ZVIA 3LM3A 1XT5A 1KIRB 4Z9KB 3L45A 1JUFA 5B1JA 1BD0A 1KYUA 4QNWA 1FYHB 4B60A 1C8QA 1BWLA 3L9CA 4YWSA 4PJFB 3QHZH 1KXQA 3QIBD 3UGVA 4LWWA 1MFUA 2MKWA 2VX4A 4QPEA 3NSDA 3JWOC 4HHAA 1G9NH 2V5MA 4I1PA 5I3JA 2MNUA 4KIEA 2NXZB 3TTQA 3U4BL 3GSRA 4QTIH 1NGWB 2CGZA 1INDH 5D72H 4WI3A 2X7LA 4HMDA 3OOQA 3MODH 3MUUA 3SZ8A 4XPHL 2B4CC 3GNDA 2Y36H 2AXWA 1NCCH 4HW6A 3X11A 3WTTA 5SX5H 1A80A 2E28A 3AYVA 3PZQA 4TQTA 4MMYA 1XBXA 4FQ2L 3RFZA 4XR8C 2RDXA 4IU3B 35C8H 1OO2A 1F4WH 3TGXA 3L9YA 3IKCA 3N41F 5DEFB 5K4ZA 3TLLA 5F7MC 3LCFA 1UB3A 5IROD 1F8MA 3TEYA 4L4OA 2DZSA 2OP4L 4OT7A 2DQWA 2GTZA 1AO7E 2H2SC 2E7DA 1AZUA 1IXQA 1Y1DA 3T6CA 4P5RA 3WBWA 3KPLB 4Q8OA 4Y2NA 2WMJA 4R33A 5I77A 5I5MA 1MLCB 2W9EH 3OZ9L 3RG6A 4E3TA 2IBZY 3HG0A 1A6ZB 3NJLA 2A73A 5HP5A 1KBPA 2F8VA 4QXTA 2ZAGA 1T0PB 2BC4B 3UWVA 3MOQA 4H2CA 4KZCA 3W0WB 1D8CA 2A0LC 5C0RH 4MJHA 1MHHB 3SFWA 3MHZA 1Q94B 3FXIC 1ZGLM 4M7ZB 4AYDC 3QQ3A 3J7HA 1D5XB 5CEZH 5JIPA 4XMVA 3OKDA 3VD4A 1UR3M 2FGZA 2FEDD 1GW9A 1JWUA 3LH8A 3FT9A 4HK3N 2GGJA 5MF5A 4LVAA 1RZQA 4M6NH 2CKSA 1F4XL 3BW3A 2B5IC 3BZDA 1QAWA 2P4AB 3LRGA 1BXXA 1TZGL 1H3VA 4KTGA 4XHJD 3NJMA 3SGEH 1K9TA 2DICA 4WO0A 4E68A 5DBTA 3ZYOA 1FZMB 3DFHA 2QZRA 1IGJA 2FT8A 2QDVA 5TFSL 3F12A 2WQWA 3UA4A 5JHLL 2HZGA 4A7QA 2PDLA 5XINA 4OD1H 3LS4H 4P46B 4Y9MA 4UQ9A 4XTRC 3OKOB 1I6NA 2V6HA 3VI4F 4QIRA 1KIPA 1WC7B 7TIMA 4G43B 1R3LB 1UXLA 5T1LA 4ZUTA 2BX5A 3PZ9A 1QKZL 3D1MC 5B8CB 1BFNA 1KYFA 2NX3A 1PQZB 3K1GA 3IJ8A 1DV7A 1P4IL 1WFTA 2WJFA 3IWUA 4MXWH 5HGDA 2PYEB 2GEQA 5LIWX 5C9KA 5MEOA 2V2HA 1EJVC 1AS6A 2EXSA 2XBZA 5ANMA 5AOIA 1FX6A 4A6GA 4GEIA 1RZ8A 5DUBB 5FOBA 1WGOA 5JLZA 5MEPB 5JA8B 4IGNA 1LOLA 3JV4B 2OJEA 5BS0B 2YD4A 4GIEA 3WD0A 1U95B 1AJZA 1TVNA 3I3EA 2FIQA 3GSMA 4AHQA 1ZLUH 3BQ5A 4L8SB 3PGDB 3NO3A 1FH5H 3D8MA 1LE9A 4HZ6A 1I3GH 4QXTB 4PEKA 4KKRA 4PCSA 2HTMA 2W60B 4V33A 3VIOA 2CETA 4EZLA 3ARPA 1BVOA 5REQA 1A8JH 5DD1H 3SO5A 3SCSA 2O5YL 1M53A 2GSGB 2YOCA 5HDRA 5LDSA 3TN0C 2YXVA 2ZUQB 4PJDB 3I9AA 5KSAB 3IDXL 4GQZA 2EG7A 4Q6IA 1L4IA 4JTIA 4B90A 3P9LB 1C5DB 3SB3A 3ZVVA 5CBBA 5KVDE 2VN3A 3MLUL 4H7ZA 5HTSA 4LMQI 1H0DA 3DRQA 2CK0H 3FOMA 1NOLA 4CCEA 3RILA 4ROPA 4P04A 2PDGA 3BH9A 3TIMA 5T1DH 3IF1B 2DZEA 4QF1A 3FU7B 4GGBA 1ZTXH 3EG9B 4JN1H 5AW6B 3OLGA 3JZYA 4ZG1A 3H9SB 2HRLA 1KPRA 1AD4A 4XBJA 1FSKC 3WUZA 5KSBB 2WGXA 2MSPA 3DX9B 3TJHD 3LAFA 3P67A 4R96A 1MVFA 3Q7JA 1R30A 2ZC8A 1P6WA 2N7SA 1KKOA 3D51A 2XYLA 5F6IC 2J71A 1KBVA 4PODA 3U9UB 1GTNA 1H09A 1KV8A 4UOJA 3S2AA 1KFKA 2QKIC 5D1XB 4LKCA 1P7TB 43CAA 3PHOB 3O15A 2GAZB 2UZIL 2A2QT 4Y4HA 4GK8A 1QUNA 4YBQC 1S9VA 3BAKA 1NIDA 3L0NA 3E2HC 1E8YA 3VXRB 3QI9A 1BM3H 2D4DA 3TBVA 1KEGH 3I10A 1NIUA 3WLPA 3VJ6B 4ZO8A 2VZSA 2F74B 4NN5C 4Z3TA 1SVDA 5M3WA 1OGTA 2KQNA 5HPMB 4JFPA 4PJEF 1MHPH 1N68A 2WSQA 1IEBA 5I07A 3W7GA 3HAEG 3GS0A 5FK9A 4DK3A 2V81A 2N1KA 2VSDA 1RAKA 1DQJA 1CGVA 3WK3A 1BF5A 1UQYA 3KOYA 4F7CB 4JD4A 4PBFA 4HKXA 4R2GB 1KT2A 1C91A 1YNQA 3B3DA 3Q2LA 2ODHA 3EDKA 5JUEL 2CRMA 1VADB 1HXMA 2O72A 3LUTA 2BIQA 3WLWD 4OUIA 3FT1A 4Q7BA 4ILDA 2R4RL 2ZKWA 4AQLA 1N8OE 4ZD3L 3WSQH 2IDSA 2X4TA 4XMZA 5LJYH 2A9NL 1WJ3A 2C9UA 2E9LA 2FSEB 4MMZA 3KZPA 2AKMA 3M5VA 4H8HA 2ESVA 2YAQA 3QUYD 5C6TH 3NABH 1KR1A 5DXXA 4R9XA 3UXIA 4QHNA 4BFKA 1HSAA 4UUJA 1D7DA 2BIPA 2CR6A 1WBZB 3E6FB 3RWIB 4Y16D 4CC4A 4HUXA 3WKML 2GITA 2VGLM 3LKRA 2NOYA 5HWJA 4K55A 3AJ7A 1W0MA 1F3DH 1AYRA 3RWEA 3GSVA 4YLBA 1H7RA 1MJUL 5D7HA 4WHTA 1TJXA 5GSRB 1EPXA 3BOXA 3KAOA 2QGYA 3O3RA 1W8GA 3R12A 4GBDA 2P44B 3VC5A 3EMZA 3GGWA 1QATA 4P23B 4Z0BH 3T1FA 1OCQA 3TO4A 1GHSA 1FQ0A 4OOUA 1MCSA 2WXLA 4I13B 4Y2DA 3U9UA 3VGDA 4MS8D 1IC4L 5CJOH 4M8QA 4W7WA 3WDQA 4QR7A 1YEGH 4AF0B 4JDVB 2A83B 1N64H 1QLRB 4MYPA 3IRPX 4GKOA 5FO7A 4F91B 1E1FA 1KM5A 4KFPA 4A04A 3SSJA 2B59B 5IQNA 4IBZA 5M2FX 2AEOA 1REQA 4FTVD 5TDNA 3VD9A 3N18A 4N0UE 4WU7A 4KTDL 5TGBB 5T5NF 2EUZA 1F00I 4ZS6C 1U3HD 2YUWA 1RSYA 2VR5A 5LCVL 2IH1B 5IW1A 6REQB 5LNEA 1YMMB 2J75A 1OGAD 1CDCA 3CMOH 1UOVA 1GS6X 3Q2VA 1ZENA 3EJJX 3R06A 3SCPA 2BP3A 2JKWA 4PVLA 1FL6B 5GSVB 2Y06H 2Z8SA 3ZBMA 4ABWA 4AENB 3CCHB 4DUXA 2Z1SA 3KH4A 1LM8V 4LL1A 3SBWA 2IS7A 5B21A 1IAOB 5CFAA 4D8ZA 2XBDA 3IJ7A 3CXHK 3KPMA 4PJ5E 3V0VA 3WAKA 4KITB 4FOUA 4C6BA 1LRNA 4AZCA 4A1RA 1A7QL 1OAUL 5D1QD 3V7MA 4XT1C 2HVKB 3HI5L 5DD6B 1IT7A 1I2OA 4E41A 9XIAA 1KBKA 4MNQD 2Z8VC 3BQUC 1F42A 4IEFB 3O8AA 4ABUA 4OZHA 1ZPTA 3EBIA 3A23A 3MNZB 1TJGL 4OI7A 3MO7A 3MJ8B 2YN3A 4G7FA 1KELH 3EO9H 3M43A 4W8LA 4EXBA 3PHSA 4X6BA 2AJ3A 1I3RB 3ZYZA 3WNOA 2F7RA 2NY1C 5BUGA 3BWZA 4X6DA 5TF1H 5JTWA 1K4DA 2ENYA 4AQAB 4YFEA 2IUZA 5A16B 1HEZB 2POTA 2RJGA 3HR5A 5E03A 3QMSA 5CLZA 2FLRT 2JJTC 3P2VA 1FJ1B 2ZXEB 1MRAA 2NY4D 4CC1A 4ZQPA 1PZ3A 4BEIA 3USZA 3V5DB 3IUHA 1GS8A 1U8MA 2J6EL 4BRJA 2ICEB 2WWCA 3EGDA 2ZRWA 5TQLA 1MJ7L 3LMYA 2NY3C 2WMFA 1C08B 2G9HA 4N3TA 1X5XA 3CDZA 5EOCJ 3V5FA 5E23A 2J7HA 4KGLA 2Y2WA 1Z9OA 4Q3MA 3C8KA 4I8YA 4ADIA 1YNYA 1EO5A 2FEDC 32C2B 1I1FB 1TRDA 3ABQA 1QW7A 4TTUA 5B1KA 4CVZA 4O5LL 4EI6B 5IVXB 1QNQA 5KZ6A 4YIWA 4XNUH 3QJOA 4XZ4A 4BFGA 1V6UA 4S3AA 4M9PA 5AN7A 5FYLE 1PIIA 3IMVA 1BRLA 1Z9SA 1YMMA 4W93A 1EEUA 3H2WA 5AYTA 4A55A 2J4GA 2EDKA 4FHAA 3WMPA 4GY0A 3NQBA 1KFAL 4L56A 4NGHH 4RMVA 1UR8A 4K3EH 5MKGA 3CZ8A 4J6IA 3HQ1A 5C0BA 3DARA 3SYAA 2DMGA 4CVUA 4EN3B 3GRBA 1K85A 4PMZA 1I9JL 4XD5A 3G9AB 2X1SA 1UWTA 3U6WA 5EMYA 4JDZB 5AOZA 4NEHB 1NLDH 1P4BL 2MFNA 3HGJA 4ELKB 1ROCA 3CFCL 1DZ0A 2VLME 1PHQA 4Q89A 3VRLE 1OW0C 1U3YA 3KWWB 4L9LA 1JN6B 3CHVA 1RZMA 1YMYA 3CLWA 5SWQA 2VN4A 4DN3L 1IFHL 1HKMA 4TSCL 4WHCA 1A6WH 3JTSA 4NUWA 1YEJH 1FNSL 1C93A 1NCAH 3EJRA 1NGZA 1KM6A 2RGMA 3MRPA 5J8OA 3UG8A 3PM6A 3UCQA 2XIOA 2VN7A 2YZ5A 2V9QA 3PZOA 5HR6A 4UMCA 1VFMA 2BFVH 2ZP8A 1IM3A 5CHNA 2G0WA 4B4HA 4A7GF 3I02A 4GH3A 4L9YA 2R23A 4NJ9L 2NR6C 1W72L 4M61A 4P4RB 4AYSA 4RMUA 4RNJA 2DLFL 3P3RA 4FXSA 5EBMA 3NA9H 4NYUA 1PDYA 4M48H 2QCHA 1MCJA 3G6DL 3H85A 1W8EA 2CKBB 3G04A 5GZNA 4YX2L 5TDPB 4JB9H 2JELL 3RL1B 5IB3B 2WTOA 1DQUA 3P3YA 4KETA 5F4XA 3WL9A 3CFUA 3FUNA 1V6TA 2C3ZA 2BV9A 1EXPA 4CKVX 2AJXH 1UOWA 1TV8A 4GVFA 1L6GA 3B1TA 5BU6A 5C09B 3V7PA 1E28A 1B4TA 2J6VA 2MCPL 3AXIA 4NQDD 2K1MA 4G5ZL 4Y5XC 5EEUA 4H5SA 1ADOA 1KRCC 4FQQA 4HV8A 1KCVL 4WSHA 5CGMA 3AIQA 2HMIC 4WWID 1D5ZA 3CSFA 3EJZD 3WTXA 3LEVL 1LTXA 5JIIA 3T1FB 1US2A 1K2DB 2PD5A 2YKLH 2CJUH 3CQKA 5DO2C 3FA3A 4MCNA 4PJXE 1NUNB 1YYLH 3U7AA 2XGZA 4S2CA 4FG2A 3KJ6H 4Z76A 2DQJL 1NAMH 5ALBL 3X1EA 2VN5A 1L9OA 2GQ9A 2BFGA 3S3DB 1THCA 5A1AA 4WU5B 3AWFA 1JZEA 2QQNH 2OR7A 4KOBA 3VXMA 3WS6A 1EEXA 1KW1A 3CQFA 3L12A 5GGTL 4DJFC 3L0KA 2NNXA 2NDFA 2QKIB 3G6JE 3QUMH 3W1PA 4WU7B 4KZDL 4W1TA 5D1QA 3FS9A 1GGCH 5JOFB 2RHGA 4H8NA 4MADA 1FGNL 3ARED 2H6PA 3IMSA 1NFKA 4LEFA 1FZKA 4GA8A 4QT5A 4DZIA 1MI5B 4PS4L 4OV6F 3IS4A 2OTWB 5A2KH 4D9RD 4PUUA 2O9PA 5FX3A 3HC0B 1XINA 1THAA 1ZOXA 2NCEA 2X40A 5I18L 2BP8A 4LLUB 3BPLB 4FXJA 3SCMC 4J4PD 3LPOA 2VFIA 1R0AH 1Z8AA 3PTQA 4OLXL 3EPNA 4JAMA 2ISVA 1Q4NX 3S36L 2A1YA 2YLLA 1CLOL 4UT6L 1X1OA 3O6ML 2OX4A 3LTYA 1PKLA 3QEGH 2KZ1B 3FQRA 4CMMA 3A47A 1LO2H 3B83A 3QZMA 4N9GB 3W2DH 2C1IA 4A29A 3US1A 4WXZA 4IKJA 1G67A 4OSUH 2JKPA 3BMXA 1A3WA 2BRQA 2Z92B 4Y9EA 3C8FA 4Y7OC 5IK3B 3RURA 1IGCL 4RW5A 5U7SA 2OL3H 4X9BA 4P2OD 5CF3A 5T5FL 1XIWA 3QNZA 4BF7A 4UT7H 5IJCC 2J8TA 3M5ZA 2I9LA 3OX8A 4QMEA 5D2LE 1SZRA 4NQVB 4KS0A 3QDHA 2QKFA 3GMMA 4BSVA 1GR7A 3LMJL 5TK4A 3C2RA 5ERWA 3CQIA 2EXWD 1OYCA 3KS5A 2DL9A 1FL5A 4A66A 1FVDA 3PULA 4NAEA 1XCTB 4UMAA 4A67A 1TZ8A 1UD5A 4R96B 4MMWA 1JPHA 3D69B 2FVNA 1ZVNA 1EXBA 2GHZA 2X89A 4UTTA 3F5WB 4RAVB 4EP8C 5CBEA 3KTCA 4NHUA 4FFWC 1YPFA 3LZNA 3U0WL 2PRLA 3DRTB 2QCMA 3M5YA 4O18A 3GSWA 2DQDH 3H54A 4U1NA 4C56D 2PGRA 5IMMB 2VLMD 4P61A 1CYXA 2NTSP 2XH2A 4C4BA 3PL6B 3BZFA 4ODBD 4RBPH 3DROA 1CLXA 1DQVA 1WAEA 1OQFA 1QA9A 3GBLA 2ZRYA 3BE1L 4XXWA 4ESKA 1W9DM 4ENZA 2FX9L 5DJ0A 3PZIA 3QAZC 4X5XA 3RUGF 1TELA 3UDWA 3GIPA 4M81A 4P46C 2NQ3A 4IRJC 2QR6A 2VB5A 3AZSA 4IJCA 4LC8A 1PL9A 2Y1HA 3U9PL 4JRXB 5TPWH 4MWAE 5E1GA 3GNPA 4EXQA 2MQ0A 3RNQA 4O1BA 4D0DA 1F3DJ 3IIOA 2IOIA 4IP5A 1DVFC 5HVFB 1XKYA 4A2HA 2Z91B 2RDUA 2VELA 5DA0B 1AUSL 1M03A 4KKBC 2X6AA 3WF2A 5IT2H 4OV5B 2ORBH 2VLKE 3DSNB 4YH6A 1BAWA 4CMHB 1E6NA 2DW7A 3W1TA 3MRLB 5JHDE 3WIIH 4JYEA 4ES4A 4KZEL 5HJXA 2WUBH 4PW9A 5D2LA 5I5JA 4HULB 4N4PA 4W84A 4LSSH 3SKJH 2ZNXA 2HTLC 1UFUA 3VD5A 1W6TA 1VF8A 4R8WL 3C6SA 4OF5A 3RHWF 1BVKA 4X5LA 3MV9A 4ES8A 2WZ6A 1HXYA 1I3VA 3O3AA 5CWSA 3CWNA 4MNQE 4OT1H 1A7RL 2XXMB 5T1LB 3F4CA 3M1ZA 3URAA 1TQJA 5I09A 1PSKH 3QUYB 2FRGP 4X5WB 5KMYA 3BEVB 5AW0B 43C9B 4NSKB 3DH7A 1DN0B 3S35L 2VXVL 5D4JA 3ARZA 3CFEB 4QHKJ 1G1KA 5DT1H 2XFXB 5FA4B 2DIEA 4DPCX 3MB9A 3GGWB 4P23A 2COQA 1U21A 3C12A 4DERA 4OBTA 3VOGA 1JF5A 2Z65C 1ZLVK 2YXMA 3QHTC 3DURB 5E9AA 3COOA 4B50A 4Q4SA 4EUPG 5LA1A 4JANA 5SWZE 3VGFA 3D18A 3EZ4A 1RZJC 4LLMB 5FYJD 2XKUA 3NCEB 4DJDA 1ZV2A 4N1CA 1DWGM 1KCXA 4ICNA 1PX3A 5K9KA 2EPLX 2Y5SA 3Q45A 4NNAA 2QSCL 3OMAB 1MEXL 1ORQB 3MUIA 1BLNB 2GCYB 5DHVB 5D2NB 2NQCA 1CLYL 1JGEB 3V95A 1S38A 3M47A 4FQXD 4IBUA 4JTTA 1I1RA 4KUZH 3KDPB 3UJRA 1FDJA 3UR5A 3B0UX 1AOHA 3K4WA 3NCXA 1CMOA 5TF0A 2WSKA 3NZHH 5AKRA 5DVPA 1QBML 3D7PA 4ONVA 5E5CA 5E95B 3LS5H 2A3HA 3UETA 4PUNA 3D3AA 1ACCA 4P2RA 1VDGA 4JO1L 1B4KA 4R4BB 2O6EA 2Z7YA 3B4YA 3EX2A 4FCAA 2VDRL 1OWQA 4PBXA 3BKMH 2GW5A 4OFPA 5J6GB 4C59B 4LESA 3VUAA 5IIEA 4FZ8H 1BQGA 1EP3A 4CRPA 5HSFA 3LEXB 4XMWA 1NICA 3F7VA 3ULSB 3P0WA 4FIQA 1NCBH 1TR9A 4FEMA 4R3UA 3UR8A 4MY8A 5ESQA 2CBMA 2QUUA 4U1GB 2UZYB 5ECGA 4DW2H 5DQDL 1PZ5A 3OKKB 1WAUA 1ZHKA 4G6CA 3NJNA 2AANA 5D7LA 3QRHA 4HU0A 4LNCA 3VOCA 5IB3A 3CPLB 2E7LA 1T21A 2J73A 3ZLHA 1PG7X 3M8OL 4FXRA 1W31A 3HI6H 2GUOB 5AOMA 2IPWA 4DAGH 3N12A 2Q09A 5L4IA 2D7NA 1E9QB 2FDBP 3I9PA 1RJYB 1O5PA 4LCVA 3ZHKA 1ZSXA 3ISIX 4W68A 2VDPL 4P2QA 3SGJC 1B9ZA 3PWAA 3TC3A 5C9WA 2QJIA 1AGDB 3OJ2C 4QISA 1QTYT 4F66A 4ZTXA 1KIPB 1NPUA 1WC7A 4XVSL 1GYVA 1DWFM 1CK0H 3RYMA 3DG7A 2BY3A 2JKRM 1R87A 2KL6A 1XRTA 3LV5A 3PTDA 3WH6A 2BOBA 2CHDA 3TFCA 3JQOB 3K4ZA 3RI5F 2HVNA 1NMBH 3H70A 4L4LA 5A6BD 2PWHA 5J6HA 4LVOC 1R3QA 4U0RB 1MCPH 4MX7A 1A5MC 1AQ0A 4HNCA 2BY2A 1NDGA 4QRUA 5L2KD 1KLYA 4UYQA 3U4KA 4YHLL 1BX2B 1ED3A 2I1OA 3BLDA 2XLLA 3CNKA 4D7PA 3ULAB 3FT3A 3WN5C 4R7WA 1YQ2A 1X7QB 5HGBA 2IPFA 2QYGA 2JIXB 4KRTA 1T7XA 3BWAA 1QHZA 1SUXA 4P4KD 1AO7B 4JO2L 5SV3A 4ICWA 2C4FT 1KTRL 4WNSA 3NIDE 4XC1H 4R4ND 5J12C 1CECA 3IVSA 2HG5B 4ETQB 2R0ZH 2YJQA 3APFA 4HKJB 4PFMA 2G4EA 5AW2B 1CVRA 1GC1C 1HQ4A 4HC1A 3KPNA 4NZRL 3OG3A 4XPGL 3RX7A 5FEZA 1H19A 3LBOA 1NBYB 2EEXA 5DLMH 3KS6A 3VWKA 4ADTA 3TT1L 3T77B 1F56A 1S3KH 3ATAA 4KKXA 5H1WA 4AUJA 5E8NB 1JTTA 2D4FA 3IDIB 1P4CA 1U8OA 2J43A 5I26A 3CO4A 3TAOA 3E12A 3ET9F 3REWB 5LGXA 2IBZX 1ODAA 5C0CE 1NPJA 1N6QH 2GDQA 4ADJA 5JMUA 1CDHA 4L2LA 3BVWA 1BV8A 1YUKB 4ZJ9A 3RM8A 2XVKA 2WYTA 2YD1A 1F73A 1LL1A 8PAZA 2F7PA 4AV0A 3RWIA 1E4NA