1DINA

Dienelactone hydrolase at 2.8 angstroms
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIENELACTONE HYDROLASE
publication title Refined structure of dienelactone hydrolase at 1.8 A.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolytic enzyme
total genus 80
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 1996-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dinA00
3RM3A 2QS9A 3PF9A 3FYUC 3ESDA 3H2GA 1UKBA 2QKYA 2O2IA 5IVIA 1XRRA 3E3AA 2JGLA 5EIEA 3LIPA 3TGLA 5K3CA 2XMSA 2HFKA 1CEXA 4UHFA 4UPDA 5AIBA 1B41A 3KDAA 2JGFA 1WHTA 1G66A 2WJ3A 3DL7A 5EGNA 1DU4A 1A8SA 5ALXA 4J0CA 4C4YA 3BL8A 3NWOA 4AN0A 5FLKA 1VOTA 4N8DA 2DHEA 2OCIA 2ZJFA 1L7QA 1N8SA 2YXPX 1JJBA 4W1RA 2XUGA 4N8SA 4EY7A 1YR2A 1ZI9A 1ZOIA 2Z8XA 1BS9A 5HK8A 4L72A 5AI4A 3E0XA 1SCKA 3WWCA 3KWJA 5HK9A 2WIKA 1MU0A 1ZI8A 4G8CA 4BE9A 5KREA 2QRUA 2XUIA 2WG1A 4PNZA 4DMCA 4BTLA 4FDMA 4QWWA 4G4IA 1VE6A 3C5VA 1HQDA 1X2EA 1MAAA 4BCDA 2WM2A 4J3JA 5AI8A 3OTQA 2HU5A 1WPXA 1TQHA 4H7KA 1ZD3A 1E89A 1LGYA 4CIBA 2WFMA 3C6YA 1QIHA 4OYYA 5A71A 2J4FA 4CG1A 2H9YA 1OILA 3HLKA 4BP9A 2IIVA 4X3CA 2ORYA 3ESBA 3ZV7A 1SCQA 3STTA 3BJMA 3WKBA 2VEOA 5HF5A 4GLBA 2I3ZA 1XRMA 3WWPA 2ONCA 4QNNA 1ZD2P 3H1BA 3G0IA 3STUA 2XE4A 3R3WA 5JD5A 1LLFA 5LKRA 1A88A 1ZJ4A 5JYCA 3MVEA 3H19A 3SWWA 3IBTA 4X95A 2EDCA 3IURA 5CT5A 4WJLA 4UHEA 5E4TA 3VISA 1Y7HA 3EQ8A 3O9MA 2GZSA 1AGYA 2FUKA 1E8MA 2XUPA 1M33A 1R3DA 4LXGA 1ODCA 4I4CA 2JBWA 5YASA 3I6YA 5ALGA 5EHXA 3HABA 5BWCA 4IH1A 5ALYA 1GKLA 2VT7A 1E66A 2V9ZA 4B84A 1PV1A 1LZLA 1CUAA 3HYSA 4GECA 3WQHA 3CCCA 2Y2UA 1VXRA 5ALLA 3GA7A 1QIIA 3V48A 3EBLA 4UBIA 1UFOA 3M3DA 2ACEA 4GW3A 3G0BA 4NZZA 4BP8A 5T4FA 4AX4A 4RE5A 1JU3A 4W63A 1NX9A 1QTIA 2QR5A 2PSEA 1XZKA 3R3VA 4CCYA 1LNSA 1DTEA 4UBOA 4U2BA 2QXTA 3FLEA 1X70A 4Y2RA 2HA6A 4BRSA 3HZOA 1HPLA 4X00A 2BCEA 4G4GA 1CRLA 4EUSA 2FJPA 1G5FA 3RKSA 1FFCA 3BIWA 3BXPA 4G1FA 3ZLTA 3HSSA 4TPKA 1ETHA 3DYIA 2W6CX 5AI0A 4YPVA 3BF7A 4FTWA 1BN6A 1EDBA 5LLSA 4Y2JA 1CUJA 2DSNA 3AIMA 1J2EA 1ZJ5A 1XQWA 4AMYA 5A7GA 4Y2UA 4B9EA 1MNAA 3U0VA 4Q05A 3DDUA 1YSCA 4UHHA 3QMWA 2C4HA 1YCDA 1XRQA 5EIAA 4Q82A 2Z3WA 1W76A 4KE9A 4MWTA 2C5FA 2RHTA 4EY4A 4XVCA 1VZ3A 2Y6UA 3QMVA 5AM5A 3V1MA 1XZHA 4GXNA 4DM7A 5D6OA 1CLEA 2G63A 1PJAA 1QLWA 4DSZA 2QVBA 4BVJA 4C4ZA 1QIEA 4CCWA 3TEJA 5AK3A 3ANSA 4Y7DA 3ED1A 3G9XA 2BUCA 4H77A 2Y2VA 2JGMA 5A62A 2VSQA 3QM1A 1EHYA 2XUQA 2VAXA 4DSAA 2I03A 2AJBA 1ZIXA 3QBJA 2WG0A 4LHEA 2PL5A 1QIGA 4WFIA 1CUXA 1G42A 1HKHA 4UHBA 4DMFA 1FFAA 1GZ7A 3IDAA 3O4IA 1UT6A 2QJWA 1GT6A 3I6MA 5K3EA 1W52X 3EIOA 4H7DA 2JEYA 4FBMA 2WU4A 2XUFA 4AO6A 4WY8A 2WFLA 4E15A 4FLEA 3H04A 4ZV7A 4LYDA 3ZPXA 4UUQA 2BUAA 3HI4A 1UZAA 3A6ZA 4HXFB 3G0DA 2QUBA 5HFAA 3F97A 4KRXA 2XUDA 5JD4A 2HA4A 3AFIA 4KE6A 1CIJA 2WIJA 1LPOA 4RGYA 5FPPA 2HM7A 2H1IA 4X97A 4B80A 1MJ5A 5A7FA 1EH5A 3PDCA 5E4YA 4EY8A 4DYHA 5AHXA 4I19A 5ALZA 4IH4A 1EK2A 3WK5A 2HU8A 4MQLA 1F8UA 1W1IA 1MX1A 4X71A 5C7YA 2WJ6A 1XKTA 2WUEA 3RARA 4U2EA 4B0OA 5AKHA 3F98A 1TIBA 1DWQA 5AKKA 4AMZA 2VAVA 4PO3X 4S0XA 1A8QA 4KAAA 3I2IA 2VJAA 1KEZA 5ISMA 1P0MA 2CJPA 4ZGBA 4KACA 4IO0A 4PV7A 5C8ZA 1S8OA 3X3HA 1EB9A 1DWPA 3R3ZA 2HU7A 4BC1A 5A7HA 2OXEA 3B12A 1JJIA 4K2AA 1ZD5A 3QMMA 4BVKA 3PFCA 4X85A 3C6XA 4Y2TA 2DR0A 3K6KA 5JZBA 3H17A 3CCBA 5K3DA 1XQVA 5HKAA 1A8UA 2GBFA 2JF0A 3DNMA 4ZI5A 2PU5A 1IUNA 1EVEA 1SC9A 4X6UA 5AP9A 3IULA 2PPLA 4BBZA 5JAOA 5ESRA 4J0IA 5KWJA 2OAGA 4ITVA 2XUOA 5AKZA 2C7BA 4PW0A 3FLAA 4INZA 1BEEA 5AOCA 3R3YA 1F0PA 2GBGA 1ZGBA 2WHRA 1KU0A 4XIIA 2GZRA 5A6VA 4K6HA 2VJBA 3WIBA 2ZSIA 4J0KA 4Z49A 3FYUB 5HFNA 4FBLA 1CV2A 3PUIA 1CFJA 3C43A 3C6BA 4QWMA 5JZ9A 5CTAA 3TJMA 3FOBA 5LZ4A 3BDVA 5CW2A 5BOVA 3DYVA 1CUFA 3I2KA 5SYMA 1H22A 4WY5A 2XMCA 4UHCA 1R1DA 1U2EA 4PQEA 1QIFA 1TCAA 2RAUA 2DQZA 4OSEA 1CQWA 1JMYA 1CUGA 4HVTA 3AZQA 2BGNA 4G5XA 3BF8A 2DHDA 4BE4A 5LZ9A 5ALOA 3DJYA 2AJ8A 1UOPA 1TCBA 3H18A 3S8YA 3O4GA 1LPSA 4DNPA 4J03A 3V1KA 1SOMA 1E8DA 1LBTA 1AX9A 1NU8A 4QDOA 3AJAA 3G8YA 4F0JA 4QDUA 3V1NA 4LXHA 3FAKA 1ZI6A 4BDSA 2UZ0A 1R4ZA 1QONA 5DJ5A 2XMZA 2VF2A 4NS4A 2G4LA 1YAHA 2H7CA 3IUMA 3H0CA 3WK9A 3ESAA 2WIGA 4GI1A 4UBNA 4WFJA 2FX5A 4X91A 1FJ2A 1CUEA 5AI5A 1W4LA 4V2IA 3GROA 2QM0A 2W22A 4CG2A 1XZGA 4OYLA 1FFDA 2CB9A 2HA5A 3STVA 4X92A 5CXXA 1PFQA 2D5LA 4LXIA 1CUCA 5BV7A 2WG2A 3WA7A 1T2NA 4HAIA 4BZZA 5FUMA 3I2HA 1UK9A 4KAJA 5CMLA 4JEIA 4HXEB 1Q83A 2C0QA 2DQYA 2HADA 4BATA 5C8VA 3AZOA 5DNWA 1U65A 2XLBA 2VA9A 2WHPA 4OCZA 4DLNA 5DYWA 4PSCA 4AZ0A 5FKJA 4FKBA 3FVTA 1LBSA 4X93A 4BRZA 4W1SA 2R8BA 4BAGA 2XQFA 1VLQA 3ESCA 3ICWA 4D9JA 4C6HA 2PU7A 4AXBA 4B85A 1W6RA 4KEAA 5ALRA 5JALA 2PUHA 5DNVA 2ZJ7A 3D4LA 3AINA 1CUWA 5JIBA 1HDEA 3FYTA 5K3BA 3WZMA 2OCKA 5FRDA 1UK8A 1L7RA 1R9MA 5AICA 1CPYA 2QOEA 5AKEA 1EI9A 5AH0A 3WL7A 4C87A 4BZWA 1CUHA 2RONA 2WTNA 1LPBB 2WJ4A 2Y1KA 2ZSHA 1K5PA 1XROA 1ZD4A 3G9UA 3G0CA 4EHBA 2OG1A 2QMQA 4FHZA 2VTVA 4WDRA 4UFNA 3VDXA 4DMKA 2GYVA 1N5RA 2ZYHA 5AI9A 4LYEA 5E2IA 3C8HA 3OG9A 2CMFA 2XQKA 2BKLA 4MXDA 1DQZA 1R9NA 3C6ZA 1E8NA 2PSFA 5ALFA 3AUKA 2I3DA 4JNCA 3BJRA 3PF8A 3H2JA 3AZPA 3IUQA 3WL8A 1IZ7A 5CH5A 3WYNA 1CUBA 1UWCA 3D0KA 3PE6A 3HJUA 4RPCA 1AMNA 2B4KA 1YASA 2GYWA 3G9ZA 1XQYA 3FVRA 2AJDA 3FWHA 2DFPA 3UMJA 1MX5A 5K3AA 1WB4A 2ZYSA 3C8DA 4TVKA 2EDAA 3QVMA 2JIDA 3E4DA 1H23A 2JGKA 3W9BA 5CH8A 2QZPA 5ALIA 5DWDA 1RP1A 4FOLA 5HF6A 3C45A 2Y6VA 3WI7A 4B9AA 3IVMA 2WILA 4EA6A 4BAZA 2OCLA 5LIPA 1ORWA 3HACA 5AM4A 4B82A 1AZWA 3GZJA 4L9AA 1QE3A 3I2FA 4XWGA 4ZWNA 1XZAA 4BDTA 4YX9A 2XI4A 4HRYA 3IB3A 1UKCA 3QZUA 5K5EA 2HRRA 2OCGA 3QPCA 6YASA 3WWDA 2CUTA 3BWXA 5JAUA 1VKHA 3U1TA 2ZJ6A 3FCXA 2D0DA 1CUIA 1CVLA 4MYDA 2BFNA 1XZCA 1CR6A 2J3DA 1VE7A 2CEKA 3WL6A 1XLWA 3H1AA 3NOXA 4GBGA 1R88A 4J0DA 3HXKA 1IMJA 1EDEA 3VXKA 3V1LA 3M82A 3I6ZA 5DLPA 3W9UA 1R50A 2XMQA 3R0VA 1H2XA 4G4JA 3W05A 1QJ4A 2X8BA 1TKRA 3B5EA 5AOAA 1XLVA 4Y2YA 2ZYIA 1UOOA 4QA9A 3GBSA 5ALDA 1LZKA 1YS2X 3BE8A 1AUOA 1BN7A 2Z8ZA 4HXGA 1DT3A 4G8BA 4W9RA 1TK3A 3A2NA 3CN7A 3NUZA 5AKJA 4PSDA 7YASA 5JD6A 1XZBA 3FLBA 1GKKA 3QPAA 5HKBA 4N8EA 3YASA 1QFMA 1O6FA 2R11A 5I7UA 2K2QB 4HTAA 1LPNA 5E4JA 3HRHA 1UK7A 3A2LA 3QYJA 1GPNA 1HLGA 5KBYA 2AJCA 1WPRA 2XT0A 4CI9A 4WDQA 3CN9A 5IKXA 2DCMA 3WK7A 4CCYB 3KXPA 3SK0A 2O7VA 1GXSA 3VVLA 1USWA 5LZ5A 3WKAA 4KJXA 4QDTA 1K63A 2HHAA 3KD2A 4M0FA 4MJ3A 1QTRA 4DNOA 4EB0A 4RE6A 1CUZA 1SFRA 5A2GA 2WUDA 1QO7A 1X2BA 4GWLA 2Q0XA 5FDFA 2PVSA 2XMGA 3DS8A 1NU6A 4ETWA 3GUUA 2AXEA 5DYTA 2H7XA 2Z5GA 3K9BA 4GHWA 4C89A 4OD0A 1XZIA 4C88A 4K6KA 2OQVA 4KRYA 5CT9A 3K2IA 1EVQA 1QZ3A 3AILA 5AOBA 4MWSA 5KWIA 1CUSA 3UUEA 1ACLA 2WUGA 5AKYA 1BROA 4FLMA 5DTJA 3GFFA 3D5EA 4OUKX 1MX9A 2FJ0A 2WKWA 2QXUA 2JEZA 4W1PA 5ALJA 5ALVA 1Q0ZA 1Z68A 5EI5A 1Y7IA 2XMDA 4Y2QA 3AIKA 1TAHA 3G0GA 4WCVA 4Q3LA 2X5XA 3WKEA 2PSJA 3D2CA 2XUKA 2QJRA 1LPPA 4A5SA 2XUHA 1DT5A 3DQZA 4P92A 4FNGA 3DKRA 3WJ2A 4KAFA 4H7HA 1QIDA 4H7EA 3R41A 3HEAA 2JGEA 4Q3KA 1H2YA 4H18A 5LZ8A 4OB7A 1Q84A 2C0PA 3FSGD 3DOIA 4X7BA 3LLCA 1P0PA 1OCEA 3D3NA 4FLFA 2VATA 4C01A 4QEKA 1JMKC 2WFLB 4I3FA 5ALWA 3T52A 5JAHA 4CFSA 5IVDA 4UBJA 1ZGCA 1ZIYA 1RWQA 2VJDA 3GELA 4EY5A 2V97A 1MT3A 5AKLA 2PM8A 2VQ6A 3I2JA 2CKMA 4LIPD 3T4UA 4BYMA 1P0QA 4AZ3A 3F8SA 3KWFA 3Q0TA 5CT8A 1QFSA 1EK1A 5T4BA 1T4MA 2CBGA 4BCCA 1JKMA 1K6EA 4MYSA 1IUOA 5AK6A 4LKOA 5LZ7A 3STXA 1CQZA 3F67A 3P2MA 4P08A 2HFJA 4EZIA 3A2MA 5ALMA 3B3QA 3VVMA 1VA4A 5EIHA 2WU3A 4MEAA 5FOQA 1FFBA 2O2HA 2YASA 4BVLA 4CIAA 4Q1VA 5EHNA 1O6GA 3I1YA 2PBLA 2PKYX 3EQ9A 5T4HA 1J06A 1YS1X 2OQIA 5JAPA 5AKGA 1P0IA 1RYYA 4DNQA 1IUPA 4YK7A 4G9EA 1XZFA 4UHDA 1AC5A 1WOMA 3DKKA 3W04A 3IIIA 4L0CA 2BAGA 2WQZA 4U2DA 3LCRA 4BAUA 5IH7A 4H35A 2OGTA 3D7RA 1KU6A 2HA2A 1THTA 3WWOA 3O95A 4OB8A 4ZRDA 4XJVA 1AQLA 5AM1A 3WK6A 1UKAA 4C4XA 4H7JA 3O4JA 5FP0A 2CZQA 1IZ8A 3LS2A 3KSRA 4OU5A 1EXWA 4F21A 1JI3A 1A7UA 1BEZA 5CRIA 3WL5A 1EB8A 1Q0RA 2GYUA 1J07A 3STYA 3DD5A 5DYYA 3R3UA 4FWBA 2QTBA 3HC7A 2HL6A 5DTIA 1GPKA 2J4CA 3VJKA 5J3JA 4QDZA 2C58A 5AK4A 3L1HA 2XLCA 2G5PA 1THGA 4B7ZA 4H7FA 5ALNA 2AJLI 3N0TA 2LIPA 2NW6A 2OGZA 2VJCA 2BGRA 2X76A 4PSUA 3D2BA 3FNBA 1ORVA 1XZDA 1UOQA 2IX9A 4KE7A 1GPLA 1VZ2A 1QGED 4DNFA 4J0GA 3TRDA 4ARAA 5CH3A 4Y2XA 3G7NA 2RIPA 3R3XA 1YAJA 5SYNA 2Z3ZA 4ZREA 3FBWA 4H0CA 4K6GA 1BRTA 1XLUA 4G8DA 1MTZA 2HRQA 4E11A 1XZLA 1EDDA 4JH0A 1QOZA 2B61A 3W2TA 3I28A 1K8QA 4P9NA 4AB1A 3WK8A 1H2WA 4FNMA 4ZV9A 1EINA 4J7AA 3O9VA 5HZGA 5AM2A 4HS9A 4M0EA 5ALHA 3VKFA 3IA2A 4B0PA 4Y2PA 2C5GA 3A70A 5AK5A 4X94A 1UXOA 3L1JA 5ALSA 5ALUA 1WB5A 4H7IA 1BE0A 3UUFA 2P8SA 4BCBA 5I8PA 1CUVA 1JFRA 1U4NA 5JATA 4FFVA 4E14A 5CURA 4X6XA 1L7AA 3OURA 2OGSA 3PUHA 2G5TA 2JGJA 2ECFA 1C7IA 3LP5A 2VT6A 3WMRA 1BCSA 1ISPA 2GBIA 1ODTC 3C70A 5AJHA 2XDWA 2E3JA 2BUBA 3G02A 5HF9A 4XX1A 3I1IA 5C8XA 3OM8A 4GDMA 4KE8A 1MPXA 5ALTA 2EEPA 4QLOA 5F4ZA 2WIFA 4Q34A 5EFZA 4UBKA 1YA8A 3ZWQA 1D07A 2HIHA 5ALPA 3FSGA 5D3KA 1U8EA 2HA0A 5AM0A 1SCIA 2WHPB 3WZLA 4BC0A 2PSDA 2O7RA 3DEAA 4B83A 1C4XA 1K4YA 3O4HA 4G9GA 4P93A 5EHQA 3ILSA 1C7JA 4A23A 1EX9A 2XB6A 3R40A 5EHZA 2QT9A 4WFKA 3WYDA 4E46A 3JYHA 4NMWA 3OOSA 5D3ZA 3QH4A 4J0JA 2RGUA 4DIUA 4CG3A 5AKXA 2XUJA 3H2KA 1TRHA 4IHAA 3JW8A 5JASA 1QIKA 3RK4A 1DX4A 1TCCA 1ODSA 4A16A 5HCUA 2QUAA 1JU4A 3C87A 3JWEA 1CUYA 4AN1A 4FMPA 1YB7A 4HZGA 3DOHA 2BJHA 4JYPA 4W1QA 3WIOA 3WJ1A 2HA7A 2V96A 5LYYA 3VJLA 3F9CA 5AO9A 1XZMA 2OPHA 4X6YA 3E1GA 3L1IA 4EY6A 2DHCA 2WIDA 3OC0A 1AURA 4UFOA 4Y2VA 1VA5A 1DWOA 3CXUA 3H2IA 1CUUA 3WKCA 3IUJA 4O08A 2HDWA 4DTCA 4QZVA 1VJ5A 2WLSA 4F5ZA 4AO8A 3DCNA 3LIIA 1WCYA 1XKLA 2ES4A 3WKDA 4U2FA 5IVKA 3EQ7A 1BU8A 1GQSA 5FXMA 5LZ2A 1YA4A 1I6WA 2WUFA 1E5TA 5H3HA 1YB6A 5K3FA 1Y37A 3M83A 4U2CA 5DNUA 4B81A 4HRXA 4JYMA 1XQXA 3D59A 2ACKA 3EF3A 2YH2A 4QDXA 3ANTA 4UFPA 2B9VA 4OB6A 3PI6A 4DMHA 3AIOA 5CXUA 1F6WA 1DX6A 1W75A 2PUJA 4IH9A 4EBBA 2XQIA 1XRLA 1G4HA 3ZLUA 4KR0A 1WM1A 4RNCA 2RHWA 1OXMA 2V98A 5AI6A 2WFZA 3QITA 1JJFA 4PF1A 3STWA 2PSHA 2WHQA 4OU4A 3ZI7A 2B20A 4QE3A 4J0HA 3FYUA 2YYSA 4JUIA 5D7BA 3WLAA 3F96A 4QLAA 5HQ3A 1UK6A 1J1IA 2XMBA 1XRNA 3G9TA 4TGLA 5FPQA 5C81A 2WSLA 2HA3A 4X90A 5FV4A 4U2GA 2O2GA 2WTMA 3WA6A 1MAHA 3O0DA 2PX6A 1AKNA 1E3QA 1VXOA 2IITA 2OAEA 4Y2SA 2XUAA 2ZYRA 1MO2A 4NVRA 3FCYA 4UBMA 2JGIA 5AIAA 5IVHA 3QPDA 4N5HX 4KYVA 4B6GA 1HL7A 4AO7A 1LPMA 4MQMA 2XMRA 4DGQA 3DL4A 1XFDA 3M81A 1MN6A 3S2ZA 3ZLVA 1LPAB 2ZVDA 2XQJA 3BDIA 3SX4A 3KOOA 3N2ZB 1DINA 5BWBA 1MNQA 1XZEA 3RLIA 5JADA 3WWEA 3OPMA 1DQYA 3BIXA 3NGMA 2GBCA 5ALKA 1H2ZA 4AQDA 1QIJA 4ARBA 1QIMA 4UBLA 5K3FB 4F60A 5T4EA 5AKIA 4GEGA 1XZJA 1ACJA 4IQ4A 3H2HA 5JARA 1XRPA 1GQRA 1WHSA 2RI6A 3MGAA 5I9IA 1BCRA 1QO9A 4FFWA 3PFBA 1IVYA 2H7YA 5LKAA 2ROQA 3DLTA 1GGVA 5ALEA 3WK4A 1FFEA 3I2GA 4BB0A 3SC2A 4ROTA 5JZSA 5CT6A 4N5IX 4ZXFA 5HF8A 4MEBA 3V9AA 2J3QA 5HQ3B 1FSSA 1HBJA 4K5QA 5ALQA 1N1MA 4Y9SA 5CBKA 3MUOA 1N5MA 5JANA 4Q3OA 4YASA 3MUNA 2OLEA 1F0NA 1B6GA 1ZICA 3C5WP 3W06A 4L3WA 2I78A 1EA5A 3IUNA 4BTVA 1CUDA 3PICA 5CT4A 4M0MA 1WB6A 1JT2A 2XQGA 5LP1A 3VJMA 3ICVA 4OPMA 5AM3A 3Q8WA 3D2AA
chains in the Genus database with same CATH superfamily
3ORYA 1Z2OX 4YJKA 2RG7A 3KFXA 2OZLB 4R8VA 4RDIA 4MVJM 1JSRA 1U4OA 2VQFB 3QBDA 4ENQA 2WAXA 5EERA 3JR7A 1QRTA 1QJCA 3EEYA 4P38A 2NU8A 3WGTA 4C0XA 1P9WA 4LFBB 5GQSA 4GQBA 1XRRA 1JSCA 2APJA 2QNIA 2R7NA 4LY6A 1SG9A 1YI8A 1JTVA 2E1RA 2QZ4A 3AUSA 3E03A 1T0UA 2QYTA 3ZDXB 5EIEA 4RMGA 2C83A 3GDHA 1MJFA 3NNDA 2P9ZA 3IP7A 4EA7A 5BMVA 4ZJPA 1PZHA 2WJAA 5F52A 1P81A 1B41A 2ST1A 1EUQA 4MV4A 3NHFA 1KYVA 2DKNA 4ZP1A 3ZKAA 3P9RA 2ZW9A 5IM4A 1V7ZA 1QKKA 4C0HA 4KXQA 3PHJA 3PPVA 1E7RA 4OHYA 4GKKB 2IP4A 1US8B 1P4GA 2AHOA 5IZCC 3IE0A 2JGFA 1E62A 3TTSA 3AEQA 3EXFA 1TUEA 3EHDA 5JFOA 1YXMA 5C52B 5F35A 1UMBA 1JN0A 2FWRA 1H6CA 2PKQO 3ZU5A 1JAHA 1Q2UA 1PL6A 1SGWA 2RHRA 4LGVA 2H00A 2H2HA 2E55A 3H1PA 2W4QA 1MV8A 1DBWA 1K7YA 1VECA 2VBFA 5T3YA 1FMJA 3EUEA 3WHKA 2IOYA 2HEIA 3D3WA 3PCXA 5CM9C 5JS7A 2C9ZA 2WJIA 1NF8A 5EG5A 1MZVA 2UU9B 2PXAA 4XRRA 4F38A 2O5CA 1P6UA 3OH8A 1YR9A 4ZMBA 5BSMA 3FTPA 1FZQA 2QNRA 1VOTA 5DM4A 3S68A 4N8DA 4KBYA 3CWZA 4JOBA 4LC1A 1N6LA 4G36A 4EGJA 4X3OA 1KQNA 2V4UA 2ADFA 5I7VA 2PAFA 3W5SA 3B51X 2QN8A 1VSVA 1U1CA 2Q3JA 4BWGA 1SZDA 2P9EA 3L7LA 5CGQB 1D7OA 3ZHTA 2ZRNA 3PQ5A 4HWOA 5TB5A 3L18A 3CVOA 3PIIA 1XEXB 1JEEA 5AESA 4EY7A 1YR2A 2CXSA 4YRRA 3JX9A 4MRSA 3BWEA 1JXMA 3RS2A 4JUDX 4RL6A 2JZNA 2PGIA 3JAKA 1X7ZA 2D5IA 2IUTA 2WI8A 4KQKA 4D9NA 5BXYA 2HDOA 5FA6A 3HADA 4IBOA 1RMYA 3E0XA 4LJ6A 4MIEA 4QYWA 1OU0A 4RY0A 1XP8A 4ZKEA 5ELXA 4YAEA 3GDFA 3KWJA 2PE5A 2CZGA 2ZRBA 5KYKA 3MK31 3THWA 4G8CA 4PPYA 4JB0A 3WZ2A 1XXHA 2JVIA 3NBXX 3W8DA 3W5UA 3IKLA 1F0KA 1IXKA 2GD1O 2QN1A 1QQ6A 1CQJA 2P4QA 1R6BX 2JFUA 4IILA 4BE9A 2XUIA 1G8SA 4KITB 5KREA 1QVAA 2EQ5A 3FWZA 4POOA 1GCUA 5LWQA 3OMWA 4CN8A 3ITDA 5TJHA 4BTLA 3COZA 4CV3A 3NYQA 4FDMA 4QWWA 2OVFA 3D43A 5B1YA 1E2FA 3KEFA 1AS3A 1VE5A 4WAUA 3LSYA 1AKYA 1D5WA 2BGIA 2YXLA 2XE6A 5K4GA 1DXHA 1UMCA 3FDFA 5CCEA 2NPFA 3C5VA 5J5AA 1HQDA 2R6FA 5JMTA 3DLBA 3OJEA 1MAAA 1EVJA 4BCDA 2RGNC 1ENZA 2EP8A 1H65A 1XX6A 3HE3A 3OLVA 2WM2A 2G82A 4LBVA 4J3JA 4MPTA 5DNEA 4L8GA 3IJEB 1KOJA 3KV1A 5JOQA 3DE0X 1WPXA 4AU1A 3K8YA 4KN8A 4U8GA 1JKIA 1TZJA 2FQXA 2JAXA 2B8JA 4QXQA 5B1SA 2P4SA 2Q1SA 3UW3A 1SO8A 2SCUA 2VWGA 4ODIA 2C4VA 1THZA 1FNBA 1EAMA 4KLRA 1KZ1A 2LDXA 3WLLA 5JBNA 1Y48E 3X1KA 3IOBA 4KO4S 2C4TA 1XAJA 3TCKA 4QUEA 2PZLA 3LT1A 2I2DA 3AEZA 1K4MA 3HLKA 5BN5A 5HJ5A 3P71T 4X3CA 1T5LA 1K98A 2NT4A 3STTA 4ZU3A 1U2DC 3R2JA 5B30A 2QUIA 1NONA 1XJWA 5ULLA 3BSYA 3W9YA 3K05A 1WPGA 4TV9B 3NBYC 3ZUPA 2V3CC 2OMKA 5CDFA 1RAHA 1BVHA 3PG5A 3RYIA 3N8IA 3IJ5A 2ZTLA 1BTOA 4QO8A 4FGJA 4LZNA 4RAQA 5FUWA 2HEGA 4JJ4A 1Q1AA 4FFOA 3NC1C 1D6SA 1E1KA 1V7CA 3PC8A 1RC0A 4FP9A 4DTIA 2A9PA 3T0GA 3W90A 3MCWA 2V8OA 1WZEA 2GXUA 4LXYA 4R2XA 1D1PA 1ZD2P 2NYAA 3CMMA 4RTKA 3G0IA 4YBZA 3STUA 4EG1A 3ZHXA 4UEWA 5NLLA 1MGPA 3MLAA 1LBHA 3DHEA 4UW9A 1DQRA 4P3OA 3TSAA 3ELBA 1P3DA 3IDSA 5EY5B 3WDMA 3KEQA 3L0OA 1J2YA 3MVEA 3DXYA 2IZOA 4K0RA 4CQMD 3K09C 3OPVA 3A3PA 1XCGB 4BNFA 2KS6A 4E30A 3IBTA 3CC8A 4RDHA 1JNXX 2EDCA 4X95A 3T7AA 4O63O 1KXJA 3BFVA 2QPOA 4WESA 1KMQA 1QF9A 3KLMX 5K0GA 5E4TA 4JLMA 2PD4A 3VISA 3UHPA 1KQFA 3ZCRA 1UEIA 1WUYA 1Z2DA 4MW2A 4QHSA 2VHXA 1TVMA 1E8MA 1JJAA 3B8EA 4G1VA 4JOCA 5C32A 2GJKA 2PT9A 3H9BA 2HMVA 4JGIA 3A9CA 5G53C 2HWYA 3NNSA 4L4ZA 2X0EA 3M2PA 3TQTA 4BNMA 5CA0B 3TCNA 1AK9A 3EOZA 3NGXA 1P9NA 4ZYXA 4MQFB 4GT1A 3H5OA 3ITEA 1NQ5A 3GJ8A 5ALGA 4MB0A 1K8ZB 1W59A 2DPGA 3SFTA 1ESMA 3UJ9A 1VPVA 2G8LA 2WPNA 2YHSA 3GLRA 3I8OA 3IUYA 5B53A 5ALYA 4IV0A 1GOTA 2V9ZA 2AG5A 4DV3B 2A33A 3FOWA 2BTEA 1O57A 1LZLA 1CUAA 4DJAA 1VHDA 1YMVA 3AXTA 1CDEA 2QE7A 3OPYI 3QXXA 2CYBA 1Y9AA 2EX1A 4GECA 3USZA 5ALLA 1SIUA 2Y2UA 1WU7A 5I3CA 3IKMB 1GNVA 3WNDA 2O4CA 1S1CA 5B2EA 5KYXB 1RPNA 3CZQA 4UBIA 5AXCA 4RYLA 2I65A 4YMHA 3OKFA 4UTRA 2ERYA 4GP6A 3VYSB 1HE8B 2R2AA 3OLQA 4XDGA 4HVCA 3M3DA 4BGVA 3BK1A 4MA0A 1ORDA 2ACEA 3WQRA 5K3OA 3RRNA 2V5AA 4NZZA 1I8TA 1IZ0A 8MHTA 2V65A 4BP8A 2GUGA 3Q11A 3GJTA 1KYWA 4PSVA 4AX4A 3SBOA 4RVDA 4L02A 3QYPA 4RE5A 1IQ0A 3GDOA 4WXEA 3EJ6A 5IDWA 5K09A 2CJYA 2KPOA 1RAFA 4FEAA 1X1CA 4L9RA 1BQ3A 2GF0A 4NC9A 1WR8A 1XZKA 4D3FA 5JQGF 1DTEA 2G1AA 4UAGA 1QP7A 5DM60 3AETA 1S4QA 5CDGA 1ZNQO 5JLJA 1TJYA 5CP8A 5KMGB 1XTTA 3NIDB 3VR6D 3EZ9A 2R47A 2HU2A 3BXXA 9ABPA 3QELB 5CX1A 3TVDA 3LO5A 2ZAIA 2R6JA 1Q21A 2REQB 5IAGA 4X00A 2QMHA 5JY6A 3VO9A 2J9RA 4HN9A 1JV2B 4LZLA 4OQPA 1AKEA 3O1IC 1E1YA 2FJPA 3FVVA 2YWEA 3JSAA 5B3JA 1BQ4A 1OLSA 3GN1A 1A9RA 2Q2WA 2Q2NA 3BXPA 2XBLA 1CR1A 1U0TA 4GGPA 3U49A 2BMWA 2XWBF 1UJ2A 4TPKA 4AY4A 3WYGA 1ETHA 4YALA 3JD3A 4C78A 3L02A 1ULTA 4QYIA 5JJLA 2YJ6A 5EIWA 1TJ4A 2FWMX 4RSRA 4TTRA 4DT1A 1PWZA 4FTWA 4OQMA 5JSKA 2XXAA 3C5EA 1Y3AA 1N9ZA 3PQ8A 3DUWA 4TKUB 1TAUA 2R751 1Y8ZA 2DSNA 4R7TA 3HM9A 3NOVA 3VAYA 4AQ7A 3L40A 4NWIA 1WQ4A 2CXTA 3HBMA 2X8WA 3GXBA 4CTKA 4BQFA 3V33A 2DTDA 4AMYA 3W9SA 2PDAA 3WBBA 1KO1A 3BIFA 1F48A 4IIJB 4MGEA 4Y2UA 4Q12A 1Z45A 4ZQFA 4COOA 1HSZA 2G0TA 2OFXA 2XSZA 4TLMB 5G1PA 2EFHB 2BGWA 1VPTA 2RKOA 4TT3D 5A4IS 5CEJA 3DDUA 4HXYA 3CKLA 1GGEA 3DB2A 4IVNA 4NCXA 4OBXA 3S44A 1T6XA 4WADA 2D2FA 1YSCA 1U1IA 3LP8A 4FSDA 4LUCA 4E0BA 5JDCC 2O57A 3QMWA 5GIPE 2C4HA 2FSSA 4Q1BA 3DPIA 3W7VA 3VOAA 4DV7B 3VSCA 5EIAA 4YUAA 3O2JA 2IBMA 1M0WA 2AUNA 3QEMB 5BW5A 3BTVA 4HZUA 1LB1B 1VMIA 5F1PA 4NXNB 2RHTA 2V9PA 3TR5A 4EY4A 4L0MA 5D6NA 4F1WA 4XVCA 3QMVA 5AM5A 3BE5A 2VTBA 1UEXC 2I5PO 3ESRA 1TU4A 2FKAA 4MUAA 4RTQA 4GXNA 4LAFA 3OJLA 2E4VA 1B0PA 2GO1A 3E22B 3NAQA 4KIGA 1T15A 4U7HA 5EVCA 3ZCSA 2QVBA 4BVJA 1NJ2A 4E5VA 1QIEA 2IYLD 4EHIA 2D8AA 3BD6A 3ELDA 4NH4A 1F7VA 4I7EA 3TM5A 2VH2A 4PGAA 2QL6A 2YC4C 1T9AA 3K71B 3G9XA 1I94B 2J46A 3SSMA 4JR1A 2IEYA 5JR3A 1DAFA 1OFUX 2G40A 3QM1A 1EHYA 1N7JA 3AHFA 4S1OA 1EFRD 3OIYA 1VL2A 3AGQA 1GU1A 4RIHA 3QBJA 4MP6A 4G4SP 1RNLA 1Z6TA 4HBGA 3HBFA 2PL5A 1QIGA 2WPDA 1TD1A 1Z6AA 3QYFA 3RUPA 2WQ7A 2OO5A 4WFIA 5KNCA 4TS1A 1HKHA 3QTBA 4YT5A 4AVYA 2CYCA 4A0HA 4DQXA 4A8JB 3L04A 5E6RA 3O8RA 3UBTA 3LLVA 3UJCA 1FFAA 1U9YA 2OCAA 4JB2A 3O4IA 2OBBA 2XT9A 5KYWA 2ATVA 1E9EA 1L5HB 2HJVA 3NV7A 4GPTA 4UZEA 4G56A 3QJYA 4QU8A 4BVBA 4ZT2A 5B57C 4OHFA 3MJVA 5JC1A 5K3EA 2JAOA 3A3YA 4OBEA 1A2QA 2NQ8A 2W6ZA 3HDVA 4GNRA 4LJ7A 1IG0A 1OXSC 3B48A 3I39X 4GM1A 5CVTA 2EW1A 2JEYA 2BISA 1VE3A 4GPZA 4FD3A 1KEUA 1KQ3A 3H9CA 3K9HA 4WBSA 3GT0A 3HZRA 3LDFA 4L74A 3TWOA 3RU3A 4D74A 2DERA 3L6OO 4IGEA 4N6OA 1RPTA 3RAPR 3H86A 1UQTA 2PYDA 1E64A 1OZAA 4FLEA 4E94A 2YVQA 1LSUA 1KFBB 4ZV7A 3NUQA 4LYDA 3LI2A 1T9DA 5TMPA 1NDHA 3ZQUA 3LTNC 3EXIB 1D2RA 2WWVD 5CB6A 5IYZA 2HUPA 1BX0A 1OT5A 1U0FA 5IEBA 2IPAB 1I0LA 5A05A 1J2JA 1ZOLA 2CXNA 2GETA 2I1QA 2JASA 4R2HA 1XNRB 1TUGA 2JK1A 4J1TC 3A6ZA 1IONA 3IAS6 3GYGA 3QY0A 4NU6A 3G0DA 1G16A 3SKXA 2C54A 4A03A 1NBMD 2QUBA 5HFAA 4DUPA 1HT0A 3FR7A 2YJTD 2UXBB 1JJVA 3AL0C 2XUDA 2R0QC 3ZX5A 2HA4A 4IEEA 4CMKA 3PD7A 3Q0EA 4QFCA 4U4AA 3BD9A 4MB6A 4KFCA 1YOBA 2XB8A 1V25A 2VLIA 4N3BA 2OWEA 3KAPA 5D3QA 3ROTA 2J9XB 1EFVA 4DCOA 3PGKA 2EZ4A 2H4YA 4QQNA 1PSDA 3WNQA 5DI3A 1OIVA 1TYZA 4B80A 2PRYA 4F4FA 4N5MA 1I6LA 2PH1A 3S8MA 2BHNA 3N75A 1X13A 2RHDA 3NYWA 1EH5A 2GR9A 3OHMA 4E4TA 3DLIA 3T5TA 3WY9A 4O0LA 3CUTA 4KX5A 1M5UA 4GRAA 1AF4A 3P2OA 1DKLA 2WJYA 5AHXA 2NVUB 2DT5A 3EIQA 5EKTA 5ALZA 1N8NA 3GQVA 2RH8A 4XIJA 3WK5A 3DO8A 1LTKA 4Z9FA 4EFLA 2FP3A 4OUDB 1OD6A 1T1JA 2HU8A 2LGJA 2AQKA 4UU1A 1N77A 4WLFA 4B7XA 1F8UA 1W1IA 2H2FA 1MX1A 1CETA 1O5IA 2RHLA 5C18A 2XBUA 4HPXB 4UTVA 1G5HA 2WJ6A 4ZKDA 4MUBA 4RKQA 4X63A 3VU0A 1PGOA 1BHSA 1BDMA 2WUEA 4B0OA 5IK2A 1ZN9A 4I08A 4MAAA 1XCOA 4TSKA 1DWQA 2GSDA 1TO1E 1AN9A 1RQRA 3U17A 4CEJB 3AO0B 4EG6A 3ORSA 2B25A 1A8QA 1E1RA 4HDKA 3THSA 2P35A 4KAAA 4O2AB 1J24A 3U80A 3Q7PA 3PNKA 3DVAB 4GXQA 4BLUA 4JLPA 1LH0A 5EMJA 2P3OA 2EF1A 1G5PA 2QRMA 3SEQA 4BHTA 3EC1A 4QRDA 5T57A 3UMGA 4N6NA 1EZ1A 2ADMA 3FNEA 2WFAA 5IMBA 5EWMA 1Y4DE 1FLNA 3B1XA 3RVRA 2CUNA 2HU7A 3NOQA 4PR0A 2P6PA 2OXEA 2ZSAA 3QFRA 1SBNE 4N0PA 4G1BA 3AKDA 1M8GA 4OHKA 1SUFA 3ISJA 2WWXA 5TARA 3C6XA 3P9ZA 4QJIA 2P2ZA 4AUEA 1PGNA 1IRIA 5TE9A 3VDMA 4A0QA 2DFLA 1WQ3A 4MW7A 3V4SA 3M0EA 4Z0PA 4HR7A 3IXMA 4Y2TA 1N2SA 2H1RA 4AL4A 1NXPA 2F48A 4PWYA 1V1JA 4PPQA 3EYWA 3NAGA 1CR0A 5JZBA 4B3XA 5LMCA 3WXBA 1O6CA 2E1PA 3DP9A 2XCIA 3EUFA 2WD9A 5GOTA 3TSWA 4QQKA 2KW5A 3VR3A 4KQ6A 1YT5A 4D99A 1S3IA 3QHAA 1V41E 2Z9CA 3C3DA 3N0RA 2AWNA 2JF0A 3VKWA 4AWXA 3TI7A 1SOAA 5JZOA 1NW6A 3V6MA 1ZOOA 3VGJA 4ZI5A 3OBIA 1IUNA 3S2SA 5IS2A 1SOVA 4CLOB 2VJLA 1O87A 4X6UA 1ZJZA 2HLDA 5L3RA 4IZ6A 3PXEA 1XMQB 5IAEA 4FUQA 4A36A 3IULA 1ECGA 1YACA 5DOZA 4EITA 4BLWA 4NAVA 1JAYA 4JXXA 1NPTO 3Q2KA 4D0RA 2VHQA 4RTJA 4Z4GA 4RWZA 4UE6A 1JHAA 1V11A 4ZHQB 3BQNB 2DOKA 2OAGA 5JSFA 1C29B 2BFFA 3RS8A 4E5PA 4FMDB 5A3VA 1SXJE 3KOWA 5KOHB 2Q6LA 2V7WA 3JQ9A 4ITVA 1XRJA 5JWHA 2C7BA 4RCZA 4MYTA 1YIAA 3OQVA 5TQ2A 1ECFA 4O1IA 3H2YA 3IMFA 4TS4A 4JBLA 4PXSA 2CDAA 3FLAA 4INZA 2XRFA 3OHPA 3U19A 4GD3Q 2QV0A 3JVEA 1T5TA 3BCUA 3FPBA 3R3YA 1IDOA 1F0PA 4A92A 4NY1A 3EFEA 3SYLA 5B36A 1QHXA 3NH9A 4H3KB 1LJ8A 2D4AA 2IDZA 1DBPA 4NAHA 3W2FA 2AI2A 5KTKA 1FVOA 2F43A 3O1JC 2XECA 4OSPA 3DTTA 5U9CA 2FX3A 2VJBA 1RRFA 2P68A 3H8SA 4YP5A 1YFLA 2EKLA 2ZSIA 4MP3A 5C3UA 1FNSA 4J4TA 2ZQ5A 1V1MA 3WLTA 3R7WA 4FS8A 3T1VA 3NEAA 4FBLA 3X43A 3OQMA 1GTJ1 4Y1FA 2Y71A 4EGQA 5FBLB 1KE1A 1B42A 3W3AD 5LNK6 1F0YA 2V7VA 4ZQGA 3DHVA 5AVVA 1ADFA 3I52A 2OBFA 1HT3A 5BVGB 1W5AA 4C6SA 3NT4A 4DWVA 1G21B 1MIHA 5HDQA 5LZ4A 2GZ2A 4S3MA 3RU7A 4CIDA 5BOVA 1ZHHA 1AZLA 1MR3F 1NY6A 4QAJA 1ND6A 1D4AA 3A6HA 4TXMA 2Q5EA 2R2GA 4IJKA 2O14A 2XMCA 2F1HA 2VCEA 1G20A 1K75A 4W8OA 4P82A 3SHFA 3HV2A 3WLIA 2ZQZA 5B55A 3RAEC 2A2ZA 1WVMA 4Z7NB 1DXQA 1HL3A 1U2EA 2EYUA 2GPBA 4PQEA 2CXQA 2JDIA 1HZJA 1PX0A 3GNLA 1TCAA 3GUVA 4E09A 1L7PA 3NCTA 4BRUA 5EMNA 2IXTA 2A30A 5JXGA 3OI7A 5LN1A 2MMCA 4BGUA 4DJJA 3D2LA 3KLOA 3BJEA 4DEXA 5HMLA 1E7MA 3EAGA 1KJZA 1OFHA 2W2LA 1C30A 2GTPA 3BQMB 4MR9A 4XGKA 2X0FA 1Q0LA 4KNVA 3B2QA 2D2VA 4BVEA 4DYVA 1TLLA 1NATA 2BEWB 1SD2A 2VHVA 3BF8A 1KP3A 1Q91A 5B1DA 3F49S 3O6VA 5ALOA 2ONYA 3GUCA 3AI1A 1KY3A 3CLUD 4EF5A 2CCGA 3OAAD 5IASA 3CG0A 5IC6A 1NUQA 2GJ4A 1FMCA 3BMCA 3H18A 1AB5A 5L51A 5JXJA 1M2FA 3ADKA 4NABA 3TQSA 5A3QA 3MLBA 2V0GA 3MGGA 1ZMTA 2SICE 2V45A 3MTIA 2F6RA 3ASUA 3OZCA 4J03A 1SOMA 3SXUA 1FC0A 5AW3A 1N32B 2HBQA 3A8TA 2A5DA 1Y9EA 3AYZB 3E84A 3HN2A 4MAMA 3WYCA 3VKGA 2PNFA 4BMNA 1NU8A 5CIYA 3N6VA 2FCAA 5C5EA 2H08A 4PYMA 4RLFA 4UD2A 3I6IA 1UQUA 3IJRA 3SQLA 2QW8A 1GZDA 4OQLA 4LXHA 1T5OA 1QRRA 5JT1A 3T3PB 3G1TA 1M7GA 1ZI6A 2J30A 2CV0A 2G9RA 1GQYA 1PZEA 1NFFA 1PCXA 1R4ZA 2XMZA 3OZUA 1UPXA 2Y1LA 4XVHA 1KAQA 3HU5A 3IEXA 3I64A 4NS4A 4BN4A 4F1JA 1FRNA 3ND5A 3C48A 1HURA 2P41A 4RMIA 5JFTA 2WIGA 4Q4JA 1DKRA 4MS4A 4RLSA 4DMUB 3MQ4A 1RKVA 1TMKA 1ZA2A 1DX9A 2Y1CA 3M1IA 3ZNPA 2CY0A 2PXHA 2BCJQ 2FX5A 3LQQA 4GMGA 5ADWA 4X91A 1T8UA 1P0FA 2ASVA 1XT6A 4FR2A 1KQGA 1U7TA 2DLNA 3AV0B 1USIA 3G1UA 4YJFA 4DLSA 3ILXA 5EE9A 1SG0A 1BC5A 1W4LA 1MA3A 2PV7A 5IAKA 5CCXA 1NQTA 1J8QA 1TVKA 2QM0A 2HI0A 1F38A 1KSJA 4U5QA 1BEUB 5A9TA 2G5GX 2B98A 3B82A 4UEJA 2CVHA 4ZA2A 2BDUA 4PGHA 5F2NA 5I7AA 5GIOE 2W22A 1VL5A 3DYBA 4UREA 3GRZA 2IHTA 4K81B 4B3JA 1EFLA 2BEVA 7ABPA 1PJCA 1GRRA 1PK9A 3CA8A 3TKAA 2QAGB 4BKPA 5KYUA 1IL0A 2Q0QA 5I4KA 1QH1B 1UIRA 2V6JA 5JSUA 5EFOA 4LVNA 1TTTA 3VKHA 2HAEA 1FFDA 1B14A 3E9RA 4D57A 3KYCB 4PZ0A 4N3NA 1R4AA 1T2EA 3STVA 1U9IC 2GN6A 3QKUA 3TLJA 1JIKA 3EFOA 3F8WA 5CXXA 4EPWA 4YLEA 1PFQA 1TRKA 1JDTA 2D5LA 2PR2A 2PYZA 3TPZA 1WW3A 1N7GA 4JZKA 1FTGA 2H16A 2WG2A 2ZRKA 5AW0A 1QVRA 1T2NA 4HAIA 5AUPB 1FYWA 4PONA 4BZZA 4OXYA 4ZAWA 2BC9A 4EYSA 4QUGA 3PR1A 2EXXA 3CR7A 1RQLA 2PGOA 1MH9A 1UK9A 3KB2A 3PD0A 4KAJA 3OM0A 2IYXA 4JEIA 4JLSA 2ZI4A 4Q7JB 2W6IA 5CMLA 9LDTA 5KNCH 2C0QA 2EJUA 3SIRA 5HS4A 1ZMRA 3PPXA 3W34A 3D0RA 5C8VA 1IJKA 1H66A 1H8HA 2A0KA 2X9GA 2VDPB 3CHYA 2N46A 3FNHA 3OOJA 1KOLA 3HDHA 4DA0A 3F4BA 1D7AA 2GM3A 5CAEB 5HCIA 2JARA 3UG6A 3VHXB 3ZKWA 2FB9A 1U3WA 1TM2A 3PNOA 3UYKA 4A27A 2IP1A 4HY3A 4IXTA 3LQYA 3RVMA 5TS3A 2X22A 3ULKA 3ZJTA 4TLEA 4FEGA 4NESA 5GY7A 4IFTA 1SY7A 4PGMA 5DYWA 2GEKA 4PSCA 1BA2A 1QYXA 3LBAA 3L9XA 3QUAA 3PV0A 2FAXA 4TN1A 3CF4G 3COSA 1OI3A 2OYRA 3RFVA 4LMBA 2DLCX 4KGDA 5EWJA 4HFJA 3B38A 4KYIB 4E88A 4FKBA 4I5GA 4XVRA 1Z38A 1MV5A 3IPCA 2A7QA 5CGZA 2BGGA 2DGDA 4W1SA 2R8BA 1W44A 1Q0SA 2XQFA 3M6UA 3M89A 4ZVKA 1Y1QA 1V3UA 3MTEA 5I9NA 1P8JA 4C6HA 4L7QA 1FX1A 5KI6A 2BFPA 3OEEA 1H6BA 4J9VA 2XXBA 3BSSA 5DNVA 3WX0A 4DDUA 3D4LA 2RH5A 5ETJA 3X1YA 1NKVA 3CWQA 1ONOA 3DTNA 1PKXA 5LMZA 1RHMA 4Y1GA 2I6QA 3UWMA 2YJ3A 1C2YA 1WNTA 1CUWA 3OZ7A 1ZH8A 2XVXA 1YRYE 5I7EA 3T7RA 1TM5E 5K3BA 2DUUA 3MRTA 3HWWA 3WZMA 5A5DA 1HOXA 5FRDA 4JVNA 3BILA 4I1OA 3N2EA 4Q48A 1R9MA 4QJ5A 1SU6A 2CUKA 2XVMA 5A9SA 1OSNA 1UUFA 2C88A 2R60A 5CX4A 4ZHSA 3V8NA 2QVYX 2NWQA 4LOKA 1QQ5A 2QENA 3JWJA 4EATA 4RQTA 3LPNA 3UCFA 2X3YA 1WZNA 4C87A 1KETA 2AMFA 2QSUA 4MPRA 4EB3A 5JSZB 4BZWA 1CUHA 3ETEA 3DV9A 3KPWA 1FLDA 2J5XA 3PUJA 5JJCA 3PZBA 4Q1FA 4OSOA 4AS2A 1LPBB 5IT9A 2Y1KA 3MCTA 1CD5A 1SXQA 5BURA 3QNMA 2JFZA 2OOSA 3FTDA 4Q1DA 1WHTB 3QVLA 1QFYA 2BSAA 1R4MB 5FUXA 1Z75A 4FYKA 2YWDA 4MTCA 1E98A 4FHZA 3PC7A 7REQA 4AX8A 1RWBA 3GFPA 1U9ZA 4RA6B 1G17A 4WDRA 3ZCQA 4UFNA 2Q2OA 2ZSBA 2QK4A 4DMKA 3P2YA 4LX8A 3EIHA 3I09A 4QREA 3R8FA 4QQ8A 3OPXA 2O6LA 1QG2A 3DDOA 4P3KA 4TV8A 5CUQA 5TQJA 1X80B 2IPMA 1NN5A 2QUJA 1PKEA 4C7MA 4U7DA 3OG9A 4PZPA 3L0YA 1ORTA 3N6XA 4JBIA 4ZZIA 4P4LA 4OHPA 4KI7A 4OP2A 4BZPA 2JJYA 4TKVA 3KU4A 4MXDA 4M88A 2DYKA 1R9NA 4D3ZA 2P9BA 3RGWS 2VYCA 2AMVA 2F3QA 1VJCA 1RBYA 4GRIA 5AJYA 1II9A 4R1QA 3HCNA 4LTDA 3U44A 1X14A 1GGNA 3UBMA 4WQMA 5I4IA 3SIWA 4D02A 2OESA 4JNCA 4INPA 2W2QA 3HZHA 1HFEL 1YBAA 4XCQA 2X9VA 2V6GA 3G89A 4RVHA 3IVCA 1MQSA 1DG3A 5IWCA 5CITA 1PZGA 1C7RA 2D7CA 3B36A 2NZ8A 1UPBA 4GI7A 4WNAA 4CODB 3LCUA 2CHUA 5EQTA 3ZV6A 3GF4A 5CB4F 2NZUG 4NBLA 4QRIA 4R7ZA 4MROA 3MGBA 3HQ4O 2BFEB 2WWRA 2JFNA 4RPCA 1SH7A 1HDIA 1AMNA 2NG1A 2RDMA 3BWMA 1JJ7A 2DFDA 4G37A 2JANA 3K32A 3DQQA 3LMKA 4WIAA 2QR2A 2VDRB 3CG4A 1G5IA 1S96A 3WQBA 3ROQA 3DWGA 3VR5A 3RS3A 1NR7A 1A27A 3EC7A 2ZYSA 3QE3A 1P7ZA 3QVMA 5KPDA 4XDHA 1QPBA 2JGKA 1CR2A 3W9BA 2H2GA 4BXOB 4P0TA 2JHPA 5CH8A 2R8ZA 1K7FB 5LQKA 1C9KA 3AB3A 1L1QA 1IPHA 4RHEA 5ALIA 2PUFA 2ZETA 2F62A 2V7QD 1JILA 1ZC4A 3PEUA 4C1BA 3ZVNA 1AQ6A 2Z6UA 5HF6A 2A0YA 3C45A 2CCKA 2OXIA 4BN0A 1V2HE 2Y6VA 3F1LA 4G9BA 3D02A 3ZEIA 5K7SA 4QVGA 1K6IA 4U6SA 4LVCA 4EA6A 4BNGA 4DG5A 1X7DA 1QVWA 2B34A 2HUNA 1M72A 4DA7A 1VHTA 4Y67A 4R3UC 2R9VA 4PLYA 1HQCA 1MG5A 1ORWA 5EMLA 4ZYVA 2BLLA 1E4VA 3HACA 5TC4A 4DA9A 1VLVA 1PR2A 3GZJA 4QTYA 3JYPA 3ZD6A 4DMGA 2B0JA 3ND8A 5MN5A 3B1JA 2VUIB 3GXOA 4F9TA 1AZSC 1FBNA 4AJ2A 4E08A 4EGFA 4FZ5A 5CFMA 2C5HA 1QV7A 2IEIA 2UVDA 5JCZA 3K9NA 4XWGA 3RFUA 1Y9ZA 3LKVA 1VLHA 4ZWNA 1L4YA 3PNSA 1JKJB 3R23A 4YX9A 4KVFA 1C3OB 1ABFA 1ICIA 1T2CA 2V7GA 3RCBA 3WL4A 4GQIA 4Q7QA 1CY8A 2A0WA 3MEQA 2P77A 2FSUA 2PJUA 2PXCA 6YASA 1M1YA 1E0SA 3BREA 3LZ6A 1JECA 3O7MA 2IXGA 4DC9A 3CBGA 5T8KA 1R0XA 2VC2B 3BWXA 1EG2A 3VR1A 1KKUA 1KSFX 1Z73A 3G13A 1VKHA 3K0FA 2VPTA 5KUTA 1W4BA 1VE9A 5U4QA 3WLPA 2D0DA 3DE5X 3UJNA 4KUGA 1CUIA 2QX7A 4LHWA 3AVTA 1ZJ6A 2VG8A 2EZ8A 3MT7A 3PUXA 3QXHA 4PAWA 5J40A 3RYCA 1RZ3A 2NADA 2BFNA 1XZCA 2YHUA 3V8BA 1CR6A 3RK1A 3UT0A 3QGMA 4PZUA 4UUPA 3ODPA 1L5GB 3VR4D 3K31A 1KC3A 3IP8A 1QLJA 5T3UA 1XLWA 3BTUA 4QOSA 4FYYA 3GA0A 3N5KA 1Z5NA 1PVDA 3OZAA 2ZI9A 3TXAA 4CLRA 3ZWKA 4OXNA 1GQOA 3ODGA 4GBGA 4TWBA 3HXQA 3HJCA 2XZLA 5L4NA 1BE1A 1R88A 3HYTA 2FN4A 2IZ6A 3AUYA 1NMZA 3V1LA 1B3BA 1F12A 1CT9A 2X7HA 5DLPA 3W9UA 2A14A 3RF6A 2NSHA 3RSFA 2EFEB 2GGSA 1CZUA 3FPLA 2Z2YA 5DX0A 2XMQA 3U39A 3ZI0A 3R4CA 4YRAA 1XVUA 4M4SA 1EUYA 5CU7A 1Z06A 1H2XA 4JXKA 1DBQA 2CJWB 4DN6A 2BMJA 4ENSA 4PG5A 2X8BA 3KHKA 1M34B 2XZOA 1ZL2A 4LWPA 4HEQA 1P91A 4DCSA 1WV0A 2F7SA 1ZUNB 1NVUQ 2M1XA 2QZJA 4Z9YA 3UV7A 1O4VA 5BPHA 3MIZA 4Y2YA 1RP7A 2C9DA 2Q5OA 4CRWB 4UPEA 2JG3A 2Q6TA 3IUSA 1YRQA 4GZ3A 1YS2X 1BZYA 4DR2B 4TLBA 2CXXA 3H6HA 4DLPA 4ZI7F 4YRFA 2WY2D 1IY1A 5DLYA 4IDFA 2V74B 1GRCA 2Q7DA 4G8BA 3S55A 1DG1G 1JB9A 3DTVD 1FMFA 1EP2B 1Z12A 3AXSA 1U1FA 3VU1A 3OIGA 4Y98A 3JVUA 4CM5A 3FUUA 3KT3A 1IIBA 1ZAKA 3TNYA 3YASA 3DW3X 1SXJD 3KFLA 5FQOA 1O6FA 2AUTA 2R11A 3B6EA 4CQNA 4II2A 4O4LF 1HR0B 4C1NA 1LV8A 4CQMB 1RZRD 2PAAA 1DTSA 1VCHA 3FCSB 5I9SA 1E6LA 2ZBVA 1UK7A 4QGHA 3SLKA 3U9TA 5JTUA 3UFXA 1AUVA 4NBTA 3FZYA 1N3YA 4DCUA 4JX8A 3PWSA 2VP4A 2AEJA 3NP9A 4OQDA 2FW0A 2OAQ1 2DCMA 4EARA 3WDKA 4DILA 1E63A 3KXPA 1QQAA 4X9XA 5AJUA 4MH0R 1CEEA 5HM8A 2C7QA 4R2JA 2CVQA 1ZMOA 1CS0B 5CJPA 2O2JA 5GOZA 3VC7A 5BYAA 5A6SA 2OBXA 2HB6A 3NWPA 2VRBA 3LW8A 4CUKA 3GFOA 2ZSKA 1K63A 1RHKA 1EM6A 1GKIA 1QTRA 4DNOA 4TM8A 3IFSA 3U3ZA 3EISA 4MV8A 2TS1A 3HCOA 2B4TO 1KKLA 1UL1X 3KDPA 4E4RA 5A5GA 3TVYA 5LQJA 2HYIC 1SFRA 2O1XA 3VZPA 4R2KA 3JQ7B 5A2GA 1VSTA 3Q40A 4G01B 1K2VN 2D06A 3OF5A 4CEHB 4QNMA 3A4NA 4TYWA 1SQ5A 2C3PA 2ZBFA 2B3TA 4CN9A 5FDFA 3AEYA 2PVSA 3DMTC 2XEDA 3FPCA 2IYZA 3KLBA 4QT0A 1MB9A 2J32A 2DJIA 3TQFA 2CLKB 1KYQA 2QN2A 1OT3A 1O96B 3HKDA 2QLTA 3P2IA 5FI1B 4EECA 3GUUA 1JSXA 1XD2A 1IPFA 5DYTA 3WQHA 2JFWA 1S2MA 1AGPA 3B85A 5JPDA 3WDLA 2WMYA 1GPDG 2R6R1 3EGCA 3LE8A 3SNHA 4GHWA 1M2KA 4WGFA 4OD0A 5G0WA 1QM5A 1W29A 2PIAA 2ZTUA 3I76A 4C88A 3TIVA 5BN4A 4KRYA 5CT9A 3K4PA 1XVLA 4PX9A 1FP1D 4IMJB 1QZ3A 1ZQ9A 2FLVA 2YIJA 4HSEA 3SNKA 4WJZA 5DXFA 5E6SA 2BE7A 4XLTA 1YJ5A 3JWHA 2Z1DA 3UUEA 1QYIA 5DBGA 1J7JA 2YXEA 4LY9A 3RU2A 1M2OA 4K26A 5JQGA 3CO5A 1X0XA 4K2HA 3AUAA 1BROA 4HEJA 5FWYB 4GEKA 1HYEA 3N74A 4WKPA 3TOCA 3GFFA 3D5EA 4K6MA 3STHA 4Q9JA 3LAWA 5F5XA 1MX9A 4AI6A 1CNEA 2QXUA 3L8YA 3PUKA 4ITUA 4YAOA 5AXAA 5ALVA 2ZEJA 1GVNB 2PH7A 3IA7A 2O8FB 5BWMA 2FLWA 4TTSA 1SXGA 2R6DA 2L17A 4KUHA 4RJJA 4BQRA 2WMDA 1U7XA 1KPGA 3VV2A 4YYEA 5K8UA 2JAQA 3LWZA 4HNHA 1GAJA 3SAJA 4ZT6A 2BP7A 3F6RA 2B1QA 3SE7A 5DW3A 1VP3A 2XMDA 2ZTHA 1NUUA 3TQOA 1PS9A 1Q0UA 1UDXA 1TAHA 3K8ZA 5E3HA 2JJ8A 3G0GA 4EQZA 3TL2A 4QUHA 3THXB 1PGJA 3HB9A 2RI0A 1N0HA 3VTKA 2AG0A 3RSZA 1TW3A 4H7PA 4XD7D 2PSJA 3DUFB 3Q3HA 4Q7MB 2YCBA 4DGSA 3IOMA 3PXXA 1QRDA 1LPPA 1RYBA 2QJRA 1DT5A 1CZLA 1SR8A 3ENWA 5SZKB 4XM2A 1AA6A 3DT8A 4ALKA 3OO0A 3AWDA 4O25A 1OU4A 4KAFA 5DI9A 5FO0A 2PWYA 2GLUA 1QIDA 2YIDA 2QVLA 1V16B 2ZR9A 3QWHA 4OYHA 4Z4CA 2I9KA 4RZSA 2B1JA 4CKCB 4KWTA 1VL8A 3QLVC 1T1IA 3A1DA 3NBUA 4PCVA 5AVOA 2G8NA 3P32A 4H18A 3EZ2A 1Q84A 4HEA1 4CLXA 4CTNA 4WK2B 3FSGD 4G85A 2Q2VA 1X1SA 2M6RA 1GUAA 1Z37A 1R6UA 4Z2AA 2EG5A 1I4TD 2FEAA 2RGGA 1GNRA 2OILA 1H2BA 3O83A 4QEKA 3TSZA 3P9KA 4M9UA 2DPXA 3VX3A 4NMHA 1VCMA 3AW8A 3N7AA 4BKRA 4MX8A 4NJMA 1UZMA 3DXXA 1VIYA 3QP9A 4HJRA 5JAHA 3A2KA 2RHHA 1GEEA 3IP1A 1EIWA 4KXFB 2ZUVA 3B89A 2RGAA 1NKSA 1IHYA 2ZAMA 1PTJC 3MTAA 4R1NA 4YRTA 1XU9A 3SIXA 1U28C 1T4GA 2W90A 1AUXA 4TWIA 2PUBA 3LZCA 3I1FA 4DV1B 5BV1A 1R8YA 1XRSB 1JA0A 2PUTA 4ABYA 2XTNA 1KHTA 3I2JA 4ZYUA 3OECA 3TOVA 3GVXA 4P84A 3F8SA 3KQWA 1GZSA 1XXHE 1KMCA 1T29A 2CBZA 3K0AA 3KWFA 1UT5A 3OX3A 1NI5A 3PE4A 5D7NA 5BR1A 5KCZA 1QFSA 4OOEA 1EK1A 5LJIA 3K8OE 1Q7GA 1D9ZA 5FB3A 1KKMA 4DAEA 1OB2A 3PLRA 4B75A 4DCCA 1NXWA 1SBCA 4OG2A 5A0FA 1MZPA 4MYSA 3MTBA 1UXKA 3MJEA 1GLVA 2DZDA 4OVKA 2ZB4A 2ZSFA 5JCOA 3TRFA 2GHIA 2VH5R 1E7YA 3VHRA 4DIFA 1CK4A 2BLNA 1DC5A 4ENTA 3TMKA 3PFHA 4P08A 1G8KA 3VR5H 4EZIA 1RQ7A 1T13A 3A2MA 2DHQA 3QE2A 2KMLA 3KKKA 3DE3X 4ZMRA 2QXYA 3ONFA 1Z2EA 3OCWA 2ET6A 1WTAA 2QVGA 3SQMA 5ED4A 1G6Q1 1PRYA 4OM7A 3TL6A 2P8JA 3R74A 5TY0A 2OVBA 2J08A 2WU3A 3VYUB 3CB2A 1JDNA 4MEAA 4EJMA 2BRUC 3JTEA 2B5VA 2AC4A 3CSSA 1QHYA 5FOQA 1OWMA 3RE1A 1MABA 3AR8A 3DHYA 1RCFA 4US2R 1DXOA 2OG2A 5K6AC 3F6CA 4NYMQ 1ZISA 4RPIA 2PLAA 1V4NA 1KO8A 1W2GA 3LECA 3W77A 4D0SA 1I7SB 4IIJF 2XB4A 4V0KA 3ZBTA 3ONEA 4EG7A 4IUDS 3U16A 1E3TA 1XNGA 5LUBA 1ABBA 2Y0EA 2J7PA 3JQGB 4Q1VA 3CM0A 1AV7A 3FUXA 4WACA 1OW3B 1BJTA 4XASA 1LNZA 3AH8A 5B2ZA 5CDFE 4R71A 3ESZA 1E2DA 1EQ2A 1M2HA 3TAHA 3I5XA 1TMYA 3A1EA 3SI7A 3CV3A 2HH9A 2WKQA 4PIVA 5DPMA 2IUFA 3T3OA 2PKYX 3EQ9A 2F9LA 1Z4NA 3KKZA 2OFOA 2FOXA 3R5KA 4G1CA 1YS1X 3TZQA 3ZHCA 4EG3A 3MJDA 3M1LA 3TZEA 1O95D 1RXIA 1PLLA 3O8QA 4HUQA 3CTMA 1B4DA 1OH8A 3KAJA 2QTTA 2GRJA 4TTAA 4CT0A 3IALA 1T2VA 4HEA6 3WLNA 4HQKA 1TECE 1ZM2A 1D1SA 3QF7A 4G9EA 1XZFA 3RQIA 5L53A 4NCBA 4DUGA 1AC5A 1M83A 4MO9A 4RV9A 1Q77A 1SRRA 1WOMA 1K5GA 2FFQA 3KB1A 3IIIA 3W04A 1ZUD1 5I9TA 4YEDA 3DBOB 3Q3IA 1F2DA 2EOAA 2G04A 2WQZA 4URYR 3AW9A 3FIUA 3MM4A 5JAMA 3CMCO 2FA9A 2P5YA 2AZTA 4I6EA 4MVJG 3JATB 3SR4A 3KHTA 3H5RA 1BGWA 1VRWA 1PT7A 5DULA 4C03A 2WB4A 3ADOA 2D54A 4H4CA 1Y3DE 2DAPA 1SUSA 5JJBA 2EKPA 3C3YA 2GCGA 4N0QA 3AVYA 1XBTA 2HA2A 3DA8A 1RI5A 1T8WA 2W6NA 3O95A 2QTGA 3R20A 4OB8A 1SCJA 3NONA 1L5NA 2QD5A 3ENKA 5G02A 1OI7A 3U9LA 4N5LA 3S5UA 1UKAA 1JH8A 1BRMA 1H2HA 4DMLA 4JC8A 4NQZA 3USES 4HNSA 1J4AA 1GPH1 4NJEB 4H7JA 5FP0A 3I92A 4CG0A 4CIVA 4EENA 4PEVA 4R31A 3RC9A 2DWOA 1IZ8A 2QY6A 5KHOC 1OYVA 3TEFA 1DNPA 1JHVA 1Y4ZA 1PS0A 3S2UA 1EXVA 1DKOA 2P9GA 1PIWA 1JI3A 4CM4A 4F21A 2F59A 1BEZA 1FUUA 1I14A 3IDQA 3CSDA 3P0EA 3SFZA 3IEPA 3WL5A 1EB8A 2E9SA 3FIJA 5JS1A 3OT5A 1QC5B 3VVBA 2HGZA 2LDBA 1JSLA 121PA 2MSEB 3FZQA 4HTFB 1NL3A 4YJ2B 4YNBA 5ARDA 1GQFA 2FMKA 1SVOA 3V55A 1MC8A 3E2MA 1M2NA 3STYA 1G2OA 3L79A 5ITZB 2FSGA 1K9SA 3T4XA 3R8XA 4UASA 2XGJA 3K6SA 1H9AA 3OWXA 4ARZB 2CFCA 5DYYA 4P7FA 2DY1A 3AUXA 4A2QA 3JYOA 1XDWA 3WGVA 1M7BA 1LX6A 5JU6A 1P3JA 2QTZA 4JU9A 4AD8A 5DTIA 1OR8A 3BJIC 3P0FA 2Q4RA 4HT3B 2J4CA 1FSFA 5J3JA 2V54A 1Q7CA 3OVMA 2VA8A 2AN9A 3PR2B 1Z28A 3EW7A 3FFAA 4GP9A 5AK4A 3VYTB 4CKYA 1TGVA 2PRZA 2NVWA 4KMRA 1O0BA 2BBTA 3OSUA 1PZFA 1XJQA 2CYAA 3L01A 2G5PA 2NT3A 1THGA 2AB0A 4H7FA 4DUZB 1S4MA 5JECA 4A10A 3QY9A 1A2BA 2WNSA 4BZQA 2ZJ0A 5EUCA 4Y2GA 4MCHA 4HAXA 2X76A 3AFGA 4D3YA 1AXRA 2B2CA 4A6EA 3D2BA 3FNBA 1ORVA 4J91A 4UM8B 2IX9A 2EW2A 4IJMA 4BPBA 1YC2A 2WSSA 3N59A 5EE0A 2Z4SA 3QHQA 1Z8DA 1VZ2A 3HJAA 4UTZA 4DNFA 4N9WA 2WABA 1IM2A 4RH1A 2CJFA 2JKZA 1B2RA 3VNVA 1GL6A 1TEVA 4CUZA 4ZIRA 4Y2XA 3C3BA 4Q4CA 1NQUA 4TVOA 3O0TA 3FXAA 1PWXA 4BLQA 3R5HA 4LSZA 3VTAA 1QP4A 2RIPA 4C04A 3I04M 4GKJB 1KO4A 1U0RA 1ISGA 4MKRA 1W5SA 4I50F 4MAFA 5SYNA 4EGCB 1QAQA 3OE7D 4MSUA 1E1QA 3O8OB 3FBWA 2GN2A 2P79A 4K6GA 2FZGA 3UB4A 4BFCA 2WD7B 1E0JA 1P62B 1XSEA 3ZV3A 1JG3A 3FSJX 3QSGA 4HNTA 1UAAA 4UUOA 2H1WA 4O2AF 4KOEC 1QOZA 1AVTA 4Q9DA 1B1AA 3ZNOA 1KP9A 2AR0A 3ZX4A 4ZCPA 4PO8A 2VJQA 1DGQA 1YOVA 3FWPA 4E5MA 3I28A 5I8WA 3PR3A 4ENPA 3KQKA 1XXLA 2FY8A 2Q5HA 1E1LA 2AN3A 2YHBA 3GAFA 3QF4B 4GOXA 1H2WA 2B37A 1LF0A 4ZAVA 1FIUA 1T1RA 5EJMA 3OUUA 1NJGA 1NQXA 1Z16A 1ZLXA 1QZUA 2OBYA 3H2ZA 4KGXA 4MINA 5IUNC 1RI3A 4P3YA 1UXGA 5EESA 4M49A 2J0UA 2XDQA 3IYLW 2NUPB 4O4JF 5I47A 3EH1A 4OJMX 4C9BA 2F55A 1JH9A 3WNCA 4A0GA 4XYLA 1PG2A 3L1JA 1IY2A 3H84A 3QA9A 4RYDA 3C7KA 5FUYA 4YTEA 4DB2A 1IYZA 3RVKA 3REGA 4A2CA 4HNGA 4MGHA 4BCBA 2WV9A 2YVAA 2CMHA 1CEYA 4YROA 4HWTA 3JALB 3PNLA 3U37A 2INGX 1RM0A 5EZSA 3ZQKA 2JA2A 5D87A 4DQLA 3H1EA 4F91B 3KUXA 1CUVA 1JFRA 4HQLA 1QWOA 2HD4A 4JCOA 3L6BA 1Q20A 4K9KA 3V80A 5J5VA 4X6XA 4K0KB 1L7AA 1WS6A 3HVIA 5IW8A 3RC1A 2GZAA 1P33A 3GHHA 2FZVA 1JXQA 4PFSA 2ECFA 2PTGA 5F98A 1C7IA 3DV0A 3LP5A 1BVRA 3VPFA 5BXQC 2VPZA 4R1LA 1HZZA 3C24A 4JBXA 3JZDA 4KO3S 1BCSA 2QX8A 1PO7A 1WXGA 1QFJA 3LUDA 3MUEA 5K45A 5AHKA 5KB3A 1T4CA 3KT0A 1JDJA 4BP1A 4RA9B 1B8VA 1TLTA 1DKNA 1ODTC 1G9SA 2J6BA 3Q3CA 4ZDIA 2WF8A 3B3JA 3IV9A 4RTRA 1JDPA 3EOAI 4A1FA 4QXPA 4R51A 2QLLA 4KVGA 4XX1A 3I1IA 2PX3A 2HPVA 4G5QA 5ALTA 3AVVA 1D2MA 1ECCA 5DE3A 2BHRA 4RACA 2GXSA 1L5RA 3W1VA 1DPFA 3UYLA 2WIFA 2CWWA 2DWPA 4I14A 1NVKA 1ZNWA 4NFHA 4BNNA 1JR6A 3LCJA 3ZWQA 1A98A 1OWLA 2F17A 3ZNQA 4CLHA 1VI2A 3GLHB 4BNTA 4QKQA 1MP0A 1E1CA 2IE8A 5BSRA 4D4JA 2IU6A 2JFFA 4L07A 4EJFA 1NE7A 4EO4A 2VHJA 2C9MA 2REXB 4K9NA 2ZULA 4JT8A 5ES3A 1T9ZA 1SZPA 4YT2A 1SQ0A 2ZE7A 4U1RA 2O3SA 1NW8A 2BF4A 5CVCA 1L7EA 1H2RS 3DVRX 5L6LB 4MPDA 2IS6A 4MV5A 3H11A 3WZLA 1G8AA 1A7JA 2HPAA 2PRSA 4YI5A 4OHVA 4YUVA 4BNZA 1D6MA 2RMKA 2JLAA 3TI9A 2HO4A 1Z17A 2VDLB 4PHCA 3QFTA 1HQYE 3DEAA 3A36A 4JI4B 1KE2A 2BZSA 2QTVA 1C4XA 1E2MA 3CNEA 4P3NA 3UGQA 1X0VA 3ZJ5A 4B83A 4YIHA 1JQKA 1R9JA 4F3YA 5FTWA 1R0YA 2PBZA 4ND3A 4BV9A 4D8VA 4A23A 4TWJA 4OJTA 2O3TA 1GAQA 1KIAA 1M75A 1V5FA 4YFVA 1MXFA 4E51A 1FP4A 2UV8A 4Y6PA 4ZDJA 1N6HA 3VU9B 5EHZA 1JEYA 5D5QA 4UOZA 3V4VB 1N0VC 1H9CA 3ROMA 2FRXA 4HX2A 5DRTA 4JNKA 6GPBA 3N87A 2EU8A 3C3XA 3JQFA 1T9HA 1JVSA 3O2QB 2VSYA 4PINA 4PRYA 4R1PA 1DO8A 4XQ9A 1R6DA 5H02A 4Z3DA 1I24A 2ICAA 3WSTA 3PVCA 1OX6A 3ROXA 2A84A 3JYHA 2HT1A 3BMOB 1LSOA 4G63A 4OJQA 5D3ZA 3DAYA 4RGVA 4UTNA 5DBHX 3PWZA 4NDZA 2XITA 3EEOA 4BVAA 3SF8A 3ND6A 3MZ0A 2RGUA 3OLCX 2GJSA 4EH1A 2NSDA 2YRWA 2IUEA 2P4EA 3NYIA 3TUZC 5IP5A 3UJ6A 3AHEA 4PPFA 4UNIA 2WZQA 3ABOB 3S7ZA 1DCTA 1CRQA 4E5NA 1TCCA 3OA2A 1LJUA 2YWFA 5IBPA 3ZLBA 1JU4A 4PGGA 1IRXA 5CFOA 1JDZA 3TW8A 4FMPA 3RKSA 4GBJA 1YK0A 4HZGA 3JASB 5GM2A 4WLNA 3NHZA 1Z5OA 9LDBA 3DOHA 2BJHA 1XMSA 2QSYA 4GU5A 1CQPA 3SU8A 2B7CA 3WJ1A 1PR5A 1BD4A 2EBHX 4H16A 3TUJC 2DQSA 3EZXA 1YFJA 3OEWA 4ARSA 3ZH2A 4RFSB 3T0FA 1PE0A 2AFHB 1XTVA 3RT9A 2V96A 3D6AA 3L49A 4NCIA 5LYYA 3GFTA 2IU0A 1XO1A 4BLOA 4Z0HO 2WJGA 3E81A 3LFHA 2W11A 5ER9A 3VPXA 1P2DA 3FBGA 2IV2X 4AJKA 3SSOA 4BMVA 1PQPA 4WBXC 2WAAA 4QDKA 1MMFB 1U0BB 4YJGB 2PZJA 3RBVA 2PO5A 3S27A 5AW9A 4C30A 2C59A 4MS1A 2WIDA 3ISTA 4XX0A 3EFBA 3H9JA 1YKSA 5HTOA 2QR3A 2PZGA 1LK7A 2WWFA 1RT9A 3EVEA 2IWRA 2P1DA 1XP5A 3JQAA 3AF0A 1JDSA 3OOWA 2VRWA 2QRZA 2GBLA 3OMXA 3UUGA 2O8CB 1Y33E 1HE2A 1RHQA 1C7FA 4RW0A 3IXLA 3SZRA 4N7BA 1J23A 4XJTA 1FXUA 2WIBA 4IS2A 2Q4BA 4OIFA 3IUJA 2AXQA 1OB5A 2O8BB 3HJBA 4DTCA 3COJA 2QTHA 3JQBA 4QZVA 2NTNA 4E4YA 1VJ5A 2WYIA 4NQRA 4FNOA 4I46A 4RVSA 3T6KA 1W1WA 4IOKA 5DSXA 4GICA 4F5ZA 1OH7A 3LIIA 1XKLA 1P1BA 2O5VA 3O92A 4DWWA 5JAZA 3GPLA 2NU6B 4RLQA 4AF8A 3UCXA 1ZIDA 3INNA 3LUGA 2W2VA 1J5PA 1RIFA 2ADOA 2EJVA 1C9NA 2FWAA 2J5KA 4RF4A 5JH7F 2ZDGA 2IBSA 4KREA 1GPUA 4G1EB 4U2FA 4Y2HA 3PCRB 4JBNA 4JLVA 3ZDQA 3MFYA 3A25A 4BMPB 5E3IA 3ICPA 3OFSA 4U3JA 2CEAA 2OC4A 2RFLA 3D6UA 3GRUA 4OQFA 4FOSA 5FXMA 4CR6A 4Y9DA 1LBEA 2UZAA 3DOCA 4JSRA 4BMCA 4AJHA 1GUZA 3NAMA 1Y5LA 4LGCA 4KXYA 2Z57A 3O2SB 1E5TA 5COBA 5FNVF 4B4VA 4PGFA 3QLUC 4F2HA 5JRZA 4Q3NA 3VH1A 4DBLC 4U2CA 2BJVA 1EP1B 1SA0A 1U3DA 3FZNA 4MRPA 2NO1A 2J33A 4UPVA 1ONSA 1DOZA 1ZBQA 4RNDB 5AVUA 5CYGA 2Y92A 1H9BA 1U94A 1OZ0A 2I1VB 3D59A 3L6DA 2YS6A 3R0ZA 1JPNA 2YH2A 4DLWA 3W3ZB 5C53B 1G2QA 1KH1A 1KXZA 2WR8A 3GQBA 3HCDA 2VP9A 4CKWB 3KJGA 4HUJA 5TGTA 4OB6A 4JL8A 5BMOA 3AU9A 4CNBA 4J43A 3RSOA 5EIBD 3ZHZA 1GP2A 1WUIS 3PI6A 1M5RA 3GD5A 3OJCA 1RXWA 1DX6A 2R6HA 1W75A 4GSLA 5LC1A 3TLEA 4EHJA 3H87A 3FCOA 4IH9A 5JXWA 3RADC 4PX5A 1K6XA 3RS5A 3TFQA 4AZVA 1GTG1 2PKEA 4O5OA 5IK2D 3PQDA 3U7QB 4WW0A 3PDJA 3AEKA 3ZLUA 2PMDA 3BVPA 5FV7A 2G09A 2IRWA 1JRLA 2B1GA 1G20E 1S89A 2RC6A 4M7PA 3GPCA 5L3QA 2RHWA 4KFSA 1GNQA 1OXMA 1KJNA 1V6AA 2NO7A 4R68A 3A37A 2NZXA 3HBNA 2YN4A 3TLGB 3TB6A 1G38A 3HMQA 2NZYA 1O9BA 1YO6A 1NV9A 1SC1A 3CUWA 2QSZA 3K0BA 3L77A 3S2IA 2WFZA 4AXXA 1M6NA 4UOQA 3IEIA 1Y81A 5HX7A 3THRA 1UFKA 1FTSA 1LRJA 2JVJA 5FWXB 3HCRA 4PF1A 3GOQA 4KWCA 4MUHA 1A9ZA 3BFXA 2P2CA 4JSYA 1O2DA 4OU4A 2OFFA 4MKIA 3S29A 3WSWA 3ZZ1A 2G76A 3ZI7A 3MJ4A 4BNUA 3F7MA 1EJBA 2WAYA 3QWBA 5EQJB 3KQLA 2IEGA 3B52X 4LBWA 3SJBA 1Q15A 4HAZA 1YL5A 5HR5A 5KIAA 1F6DA 5K8VA 3WLAA 4PFJA 4CKEB 1XB2A 2LD4A 3G2MA 5H59A 4UCXA 5HUJA 1YUNA 1KDYA 2ZIXB 3FFWA 5FPQA 1L4HA 1D6JA 3HO1A 1IATA 1KI6A 1FY2A 3CUSA 5EMHA 1CVIA 5FV4A 1WLYA 2AOUB 2YDYA 2ZSUA 3HDTA 1LCIA 3WA6A 3ZVLA 3EY9A 4KDRA 4KIFA 2A7XA 3PDUA 1MAHA 3X1ZA 5AVJA 2PX6A 4DLZA 1ID8A 1O6BA 2OTCA 4TYYA 1E99A 4EW1A 1E3QA 4A8JC 5IJ9B 3TTTA 4X1KB 3H16A 1T1SA 2GUWA 3H4MA 4ARUA 2AEMA 4R40A 5EZQA 1U5AA 1FYDA 2TMYA 3UAZA 4B3GA 2Q62A 1N2CA 2WRZA 3C2QA 3L7AA 4TXNA 2Y1EA 2I91A 4BLRA 4F3TA 4L6IA 1K4KA 2ZYRA 1MO2A 1R0CA 2JGIA 3FI0A 4LRUA 1R12A 2AF3C 4L1KA 1H3EA 1SPBS 2XCLA 4N5HX 3ZWCA 5CG2A 3GLGA 2D0IA 1E3MA 4G41A 1I5EA 1OLXA 2NV0A 3L06A 3RRFA 1LPMA 1GUBA 2EJCA 3P4YA 4CL0A 3IVRA 3MERA 1I2ZA 1K0FA 3OPNA 4GH5A 1VC2A 1KDRA 1ZW1A 3QG1A 4G07A 1HFKA 2DE0X 1NNEA 3SX4A 5I01A 1NMSA 1S8NA 2TMDA 2WHEA 4XB2A 2JLBA 1JU9A 4FQ8A 1U81A 3MAGA 2FPGA 2ZCJA 4WCFA 1LJLA 5BWBA 3HXLA 1MNQA 3I1JA 5DM70 3HJGA 1MB2A 1ML3A 2GZMA 2OZLA 4TMVA 3CX4A 5JADA 2ZGVA 4C7XA 4IS3A 4R8MA 5BV2P 3GP8A 1EE1A 4N4AA 2NAPA 2J5QA 3GUHA 4DG9A 3E5HA 4H6WA 1Y5NA 3PDIB 1N4DA 3DZHA 4GYJA 4NS1A 4F86A 2OZVA 4AQYB 1USGA 5BRNA 3MILA 1DJMA 4AQDA 3IV7A 2Z09A 1YB4A 4RHUA 5M7EA 4M0KA 3A04A 5JXHA 1QRAA 3FNFA 1DBSA 1XK7A 2Z8YA 3H5NA 3VFDA 4HNAA 4YRGA 3E27A 5ESWA 1NI4B 1XTSA 3LPMA 4MI9A 4P1ZA 4JKYA 4C22A 1UBMS 3U09A 4S2EA 1SVWA 3GJ0A 4FSHA 4DYDA 1FYXA 3VX4A 4BJ3A 5I9BA 3LRPA 2COEA 3QE4A 1PV4A 3RC3A 1U3GA 1T6ZA 4IDDA 3F3YA 3KSAC 1W5FA 1YE3A 4Y0VA 3HUFA 1NW3A 3DZCA 1D2CA 2Z5LA 3FFTA 1V26A 2C4KA 3IKTA 5JARA 3NJRA 2GOYA 1XRPA 3K0KA 4ZZ1A 2MMGA 3RC7A 1LEHA 2X0KA 1WEHA 3GGOA 4Z5XA 1FQKA 3JQPA 2RI6A 3MGAA 4CBVA 2QE7D 2AN4A 3MMXA 4LF6B 2QQGA 3HB7A 1GAEO 4IXNA 1UM8A 2R6AA 3I73A 4X7PA 4WCDA 1BCRA 2PUCA 1ZM9A 1UWVA 4MW0A 3PTAA 4MVJF 3BIJA 2EHJA 1NM5A 2OFWA 4AG3A 5KQRA 4I2NA 2HN9A 2FW8A 1PR0A 1ST3A 3IAFA 4IHKA 4R1OA 2ROQA 4GWKA 2ECKA 3SHQA 3TLKA 5HUQA 1GGVA 1K68A 4HN4B 1BFDA 1YRAA 3WK4A 3ZWOA 1GKYA 3UKJA 4ZI7A 3OFND 1C0PA 1DAEA 1JDBB 4ZVNA 3TS1A 5L6MB 1C3EA 2H5EA 3I2GA 5CK4A 2IVFA 1DAIA 2CXRA 2JA1A 1QHHB 2Q27A 4RIFA 5EP4A 5JJKA 1T3HA 1X8JA 2C7GA 3KYDA 4GE3A 2C77A 3EQZA 5LP6F 4PTZA 2XKAA 2O05A 2C8LA 4HGQA 1NQOA 1TYBE 3AVQA 3NHKA 4M0PA 3V8EA 1CIVA 4FGUA 3U7HB 3R5FA 1PT8A 2DF8A 4TWZA 2CFTA 5L7YA 3RFFA 3MWDB 2FQQA 5HF8A 5IUJC 4TMWA 2QZSA 2J3QA 4KXMA 3WHPA 4O4LA 4ENUA 1EAYA 1X7WA 1TUIA 4ZRMA 2I62A 3G3EA 1TEXA 4UMEA 1RJFA 4XWYA 5ALQA 5U4XA 4MMZB 2P90A 1JEJA 2ERXA 1N1MA 2UDPA 3HL4A 3N5CA 3EPKA 5BNIA 3NGLA 4IIBA 1E5QA 2LKCA 3CT4A 3KKQA 2GCNA 1I1HA 3A6FA 5I9MA 3SJZA 1VJDA 3TPFA 1E7SA 4RVNA 5C4IA