1DINA

Dienelactone hydrolase at 2.8 angstroms
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
232
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of dienelactone hydrolase at 1.8 A.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolytic enzyme
molecule keywords DIENELACTONE HYDROLASE
total genus 80
structure length 232
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 1996-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dinA00
2CZQA 4A23A 3PICA 5CRIA 4E15A 1BU8A 3A70A 1WPXA 1HL7A 4IO0A 4ZV7A 5EFZA 4K6HA 4OYYA 4C4XA 3M81A 3HLKA 2OPHA 1IUPA 1EVEA 4GECA 4J0IA 2VJDA 5C8VA 5AM5A 3ZI7A 5F4ZA 2HM7A 3W9BA 3HJUA 2YASA 1VXOA 4L72A 3C8HA 1EINA 3A2LA 1LPSA 3I2GA 1XQWA 4B7ZA 1JFRA 5HKAA 3G0CA 4IQ4A 4AB1A 5FV4A 4PNZA 4Y2JA 4BZWA 3FLAA 1MTZA 3KXPA 4DNOA 5AKEA 1IVYA 4AN0A 1W52X 3H2KA 2J4FA 4Y2XA 3QMWA 5HQ3A 1YAHA 2OCLA 2C5GA 4HXGA 1HQDA 3EF3A 3PF9A 3I1IA 3WWCA 4G8CA 3HRHA 4LYEA 5DTIA 2QUAA 2DCMA 5EHZA 1ZICA 2JEZA 1H2ZA 4OU4A 2DFPA 4B9AA 3DOIA 5AP9A 5D3KA 3TEJA 3WA7A 1CQZA 4OSEA 1EK1A 3UUFA 1CPYA 4BP9A 3QPAA 3DDUA 2XI4A 1YS1X 3FYTA 2VATA 3BDIA 5A2GA 4Y2TA 2H7YA 3R3WA 4IHAA 4W1RA 3ICWA 1E8MA 1Q0RA 2P8SA 1UK7A 3MVEA 1H2WA 5AKHA 2BUBA 1CUAA 4FFWA 3GFFA 1U2EA 1XROA 1QOZA 5AJHA 4JUIA 4DNPA 2BKLA 2J3QA 2YXPX 5K3AA 3H2HA 2AJLI 2G5PA 1ODTC 1C4XA 4X94A 2WHPA 3ZLVA 1XKTA 1BEZA 5LZ4A 4TVKA 3VXKA 3FCXA 5LYYA 1N8SA 4HVTA 2OCGA 3KSRA 5ISMA 1BCSA 3D0KA 4FLEA 3YASA 2YH2A 1VOTA 3O9MA 4HS9A 1EX9A 1TCBA 3PF8A 3FYUC 2O2HA 2WTNA 1DINA 1O6GA 5I9IA 5JD4A 1Y7IA 2Y1KA 4WFKA 4JNCA 4OD0A 4U2CA 5FUMA 1QIEA 3G0IA 1N5MA 1CEXA 2VA9A 4QLOA 2XMSA 4UHEA 2GBGA 2WILA 1G4HA 4Q3KA 4BYMA 4AXBA 1MPXA 3M83A 2OAEA 3P2MA 3WKCA 1ORWA 4X7BA 3ZV7A 3VJKA 2JIDA 1GZ7A 1R9NA 1USWA 5ALRA 1UWCA 1CUEA 2O2IA 4G8DA 5H3HA 1XZFA 1LBSA 4B85A 4X95A 4X91A 4OB7A 4L0CA 4W63A 4C89A 4YK7A 1DT5A 1QFSA 3CXUA 3FVRA 4H7JA 4H7IA 1UKBA 4FLFA 4UUQA 4FLMA 2NW6A 2WIGA 3WYNA 3WK6A 4UHCA 1Y37A 4C87A 4EUSA 4UBLA 2ZJ6A 4ARBA 1VZ3A 3V9AA 5FXMA 2X8BA 4NS4A 1QIDA 5AK6A 2WHQA 5BV7A 4XWGA 3WIOA 1JI3A 3UUEA 3JWEA 1EB9A 5AKYA 4PSDA 2VF2A 3D5EA 2C0QA 2V97A 3CN7A 5ALXA 1MT3A 1VXRA 5HF6A 3GUUA 3EQ7A 3QVMA 2WKWA 2HIHA 5D3ZA 2PVSA 1YA8A 3D4LA 4B82A 5T4BA 5JZSA 4F0JA 1FFBA 3STTA 2WU4A 5JZBA 1J06A 1SC9A 1GPNA 4PW0A 1TAHA 3FYUA 3ZLUA 4H7DA 1U65A 3H0CA 3HXKA 4N8EA 2DHDA 4IH4A 5DLPA 1ZJ4A 4AZ3A 5AK3A 1AUOA 1AC5A 1CFJA 3FNBA 2CMFA 4QLAA 1MNQA 2PL5A 2Y6VA 1MAAA 1UOOA 1XZIA 2ECFA 3D3NA 5AI8A 2E3JA 3C5WP 1XLWA 3NGMA 3WZMA 4KYVA 3EIOA 4GHWA 5EGNA 3DYVA 4DGQA 3D59A 3I2IA 4Q3LA 4C6HA 1H2YA 3ESDA 4BDSA 2OGTA 3AINA 2HA7A 4ZV9A 3VJLA 3WJ2A 1WM1A 4B0OA 3G0GA 4ZREA 1LZLA 3I28A 1IUNA 5ALNA 5JYCA 3E3AA 4CFSA 3OURA 1CUXA 4HRXA 4NVRA 2C0PA 1XZLA 4BAZA 1CUUA 1MO2A 2PKYX 1XKLA 2GYVA 1THTA 5DYYA 1GKLA 1DU4A 4CCYA 1LBTA 4YPVA 5DYTA 4Q05A 5DTJA 2RHWA 4UHDA 1HDEA 4S0XA 1UK6A 4U2EA 2OLEA 3V1MA 2RONA 2CBGA 4EZIA 3F8SA 3DS8A 4J0KA 2HA3A 2I3ZA 1A8SA 2HA4A 1JT2A 4BCBA 1XZHA 1YB7A 4IH9A 4N8DA 1DX4A 1FFDA 3L1HA 4FNMA 5A7FA 3I6MA 3OOSA 3DKKA 4EHBA 1L7RA 1TCCA 3SK0A 2C58A 1KU6A 3ED1A 3Q0TA 2ACEA 2Y6UA 5CT9A 3TRDA 1ZI9A 3STXA 2RAUA 1XRPA 3V1LA 4D9JA 4BE9A 4KRXA 3IUQA 5JARA 1CUSA 4PSUA 1K8QA 4X6XA 1G5FA 4KE8A 4FHZA 4BAGA 1XZKA 1QIJA 5KREA 3H17A 5JD6A 4TGLA 4JYMA 4ZI5A 4C88A 3WL8A 2WFLB 2XUGA 3V1NA 2X76A 1ZGBA 3R41A 2WIFA 5JD5A 1ETHA 2H1IA 3LS2A 2DHCA 1T2NA 5ALJA 4BBZA 1OCEA 3I1YA 4EY4A 1NU6A 2CKMA 1CUIA 5C8ZA 3E0XA 1PFQA 3DQZA 3BIXA 1YS2X 4F60A 5J3JA 3NUZA 4G4GA 3RARA 1GKKA 3DNMA 4P93A 1EDDA 2HRRA 5CW2A 1SCIA 2PU7A 1MX1A 2WIKA 2VAXA 2ZYIA 5AM0A 4WFJA 4E46A 1CUJA 2XMBA 2WFMA 2QRUA 3D7RA 3WK9A 1F0NA 5CXXA 1EHYA 3EQ9A 4H35A 5K3BA 5AOCA 1TQHA 3R3VA 2HA0A 5LKAA 4EA6A 3QH4A 3WKEA 1DX6A 3DYIA 4HTAA 4CIBA 2XUFA 3FYUB 3FWHA 4JYPA 1XRMA 4GEGA 3IB3A 1A7UA 3KOOA 1CV2A 5AI9A 4UBJA 4BRSA 3DJYA 3L1JA 4UFOA 1THGA 3ZPXA 1QJ4A 2ZSIA 5KBYA 2RI6A 5AIAA 2GYWA 3IVMA 2ROQA 2B61A 3LCRA 1B41A 1CUCA 1XZGA 5ALMA 3O9VA 2XQJA 2QS9A 2DHEA 4GW3A 1I6WA 5CH8A 5KWIA 3QMMA 3DCNA 4ZXFA 2WJ4A 4AN1A 4Y2SA 2X5XA 4QDUA 3QYJA 1DT3A 3VVLA 2WU3A 4LXGA 2LIPA 1XQVA 5CBKA 3VJMA 5JIBA 2HDWA 2WLSA 2W22A 2D0DA 5CTAA 3QITA 4N8SA 4X00A 3WWOA 4CCWA 1CUZA 4EY5A 2QVBA 1E8NA 1K6EA 3AZQA 1QIKA 1L7QA 5HF9A 5JAPA 4Y2QA 5EIEA 3JYHA 3DKRA 4L9AA 5ALGA 4ROTA 3QMVA 3SC2A 1DWPA 1R9MA 5ALUA 2WFZA 3ZLTA 1VA4A 3F97A 2HU8A 5HFAA 2BGNA 4BE4A 3I2FA 4EBBA 3G9XA 1BE0A 2HHAA 3F67A 2PBLA 3RLIA 1L7AA 4RPCA 1O6FA 3WL5A 2VT6A 3E4DA 4M0EA 3IULA 1QFMA 3R3ZA 3DD5A 4NZZA 4J7AA 3T52A 1A8UA 4HRYA 3ICVA 1J2EA 1ODSA 2OG1A 4UBIA 4GI1A 3N2ZB 5HF5A 2I78A 4LYDA 3WL7A 2XQGA 3IUNA 5IH7A 3AILA 5CT4A 3OG9A 4CI9A 3LIPA 5LZ7A 1CQWA 1OXMA 2FJ0A 1VE7A 2Q0XA 2WM2A 2VJCA 4B81A 4Q3OA 3R3YA 5ALHA 1G42A 4OB8A 4G8BA 1XZJA 5AKJA 2JGEA 4X97A 2YYSA 1MU0A 3H2IA 1H23A 3ZWQA 1W1IA 4H7EA 1QONA 5EHNA 3DL7A 5AK4A 5FKJA 1RP1A 4FKBA 5ALSA 5DNWA 1FSSA 5LZ5A 4H77A 3O4HA 2HRQA 2XMCA 1YSCA 4B6GA 4KE7A 1R1DA 1QIIA 5ALOA 4XJVA 4QDXA 2HA6A 1K4YA 4ITVA 3IDAA 3BF8A 2EEPA 1KEZA 4GBGA 4P92A 1OILA 1EB8A 1F0PA 2XLBA 3WIBA 5A62A 1JMYA 1JKMA 4Y2UA 4XVCA 1EA5A 4QWWA 4MYDA 3WZLA 4DIUA 4UBNA 4AO7A 5ALQA 2VAVA 3G9TA 5FPQA 2Y2VA 1DTEA 4X71A 4G4JA 4UBOA 4N5HX 3I2JA 3EBLA 1H22A 1G66A 2CB9A 2XUDA 4W9RA 5FRDA 3STVA 3FAKA 2WHPB 1Z68A 2OQVA 1ACLA 3RKSA 2FUKA 1ZGCA 1YCDA 1A88A 4AMYA 1E66A 1XFDA 2WG2A 3GROA 4AX4A 4EY6A 4BATA 1CUDA 2C4HA 4C4YA 2QZPA 1VA5A 4EY8A 5A7GA 1AQLA 4UFPA 5YASA 3CN9A 5K3DA 1XZCA 4MEAA 1SCQA 3HI4A 1BN6A 3DOHA 5ALPA 2ZYHA 4KAAA 3AJAA 2QXUA 2IIVA 2VQ6A 1AZWA 4BZZA 4H18A 3MUNA 3NOXA 5AIBA 3AIMA 4DNFA 4QDZA 5EI5A 4AO6A 5EIHA 5I7UA 4WJLA 4MQMA 1TRHA 3HC7A 3WK7A 4Y2RA 1XZMA 1VKHA 1CUYA 5ALFA 2H7XA 1LPBB 4J0JA 4MQLA 1MNAA 4XX1A 5CH5A 1CUHA 4K5QA 3LIIA 4CG2A 2QXTA 5HFNA 3QPDA 4Y2PA 3LLCA 1K5PA 3BF7A 5A7HA 5IKXA 2BFNA 3PE6A 2OQIA 2QJWA 2QKYA 1W75A 3U1TA 3ANTA 5C81A 2GBFA 1HPLA 4LIPD 1HKHA 4QE3A 3BWXA 1QIGA 2V98A 2ZVDA 4DTCA 2XQKA 3BDVA 1W4LA 1GPKA 4OYLA 4PV7A 5BOVA 4QZVA 2IX9A 2V9ZA 4OUKX 2GYUA 1TIBA 1D07A 2B20A 4INZA 3WYDA 3V1KA 1GGVA 1BN7A 1QTRA 1ZIXA 4C4ZA 1LPAB 3NWOA 4XIIA 3PUIA 3I6YA 2OXEA 1W76A 1EI9A 3IUMA 4Y9SA 1WHSA 1YASA 1GPLA 4CG3A 1CIJA 5LP1A 2XMGA 1AKNA 2ACKA 4I3FA 2JGMA 5E4TA 4KR0A 3SX4A 3AZPA 3STUA 4WFIA 1AX9A 5LLSA 1HBJA 1BCRA 3FSGD 4FMPA 4LXHA 4MEBA 4F5ZA 5DNVA 2QOEA 2IITA 3CCCA 1T4MA 4OPMA 4Q34A 5A71A 3GBSA 5SYNA 5HK8A 1GQRA 4FBMA 1U4NA 3WMRA 4J0GA 4FNGA 4G1FA 4X90A 3KD2A 1AMNA 1WCYA 1XQYA 1UKCA 3BXPA 3IBTA 3R40A 2O7RA 1P0IA 5AICA 3WJ1A 1F8UA 2JGIA 5EHXA 1N5RA 4GWLA 1HLGA 2J4CA 4KAFA 2XMDA 4J0CA 5HKBA 4NMWA 1LLFA 3VISA 1ISPA 1M33A 5EHQA 5E4YA 5DYWA 2WG1A 1E8DA 1CUGA 5ALDA 3WKBA 5AKIA 1K63A 2DQYA 5HCUA 1JU3A 4FOLA 2WIDA 2OCIA 1E3QA 2JEYA 1WHTA 2R11A 2FX5A 3K6KA 1XLUA 5JATA 2HL6A 5JAOA 3TGLA 4H7HA 1FFAA 1FFCA 4U2FA 4M0MA 1CUVA 4DNQA 1UZAA 5JALA 4U2GA 3F98A 7YASA 5CT6A 4JH0A 1FJ2A 3WK8A 4YASA 1EH5A 1QIMA 1UKAA 2WJ6A 1U8EA 4PO3X 1EDEA 4MWSA 1GXSA 5E4JA 1JJIA 1TK3A 3H19A 4N5IX 2XMZA 5LZ8A 3C6YA 1CVLA 4BDTA 4EY7A 2VJBA 1LPPA 2XMRA 4U2DA 3PI6A 4X93A 4P08A 5FPPA 1XZBA 4QEKA 5AM2A 4P9NA 4UFNA 1CUWA 2XUJA 4EB0A 4UHHA 1E5TA 5DWDA 2XDWA 4B80A 2GBIA 3H2JA 3W9UA 4K2AA 1R50A 2H9YA 5SYMA 3ESBA 3IURA 3WWPA 2WJ3A 3KDAA 2B9VA 5AI0A 5ALEA 3UMJA 2PPLA 4BTLA 2OGZA 5IVDA 3T4UA 5CH3A 4WY5A 3VKFA 2VJAA 3H2GA 4DMFA 4QA9A 2QMQA 4X92A 5CXUA 1ZD3A 2ORYA 5T4FA 5K3FB 1ORVA 3H18A 3M3DA 4DMCA 4F21A 4X3CA 1E89A 1MX5A 2XUKA 1BROA 1GQSA 3G9UA 5ALVA 3O95A 1IMJA 1SCKA 2DQZA 3FSGA 2XE4A 5CT5A 3LP5A 5IVHA 2BJHA 2GZSA 3F96A 1R4ZA 4ZWNA 5AKKA 3O4JA 1J07A 3HYSA 4Q82A 4JEIA 1ZIYA 4HAIA 5HQ3B 3B3QA 2BUCA 3ESAA 4L3WA 2EDCA 3AZOA 4OCZA 4Y7DA 3W04A 5AKXA 4IH1A 3WWDA 6YASA 3IA2A 2XUOA 4DM7A 1WPRA 5ALZA 2PSFA 4BAUA 5CMLA 2PSDA 2BGRA 5JASA 1QO9A 2O2GA 5ALYA 3MGAA 5AOBA 1X70A 2HU5A 1ZI6A 3WA6A 4B9EA 3QBJA 5I8PA 3D2AA 1VE6A 1JJBA 4QDOA 3MUOA 1NX9A 2XLCA 1SOMA 3G02A 1H2XA 2WUDA 5JAUA 1XRQA 3N0TA 2XUIA 2BCEA 2UZ0A 3F9CA 4UHFA 4J03A 1ODCA 1SFRA 1P0QA 2QUBA 4RGYA 1BEEA 3WL6A 3PFCA 2ZYSA 1Q83A 2RIPA 1VZ2A 3WKAA 5ALIA 1QIFA 3VDXA 4FWBA 5C7YA 2QR5A 2XUQA 4KE9A 4DLNA 4J3JA 2QT9A 3A2NA 3WLAA 1YB6A 5DNUA 1XRNA 1BRTA 1J1IA 3W06A 3M82A 5KWJA 4BVKA 3H1AA 5ESRA 5K5EA 4ARAA 4RNCA 4MXDA 4YX9A 2CEKA 3WK4A 1X2EA 3HABA 3D2BA 3V48A 2QM0A 3OPMA 1XZDA 2WSLA 1WB4A 1FFEA 1WB5A 3WWEA 4H0CA 1GT6A 1ZJ5A 5AO9A 1R3DA 3STYA 1MJ5A 4FBLA 1R88A 3WK5A 4G4IA 1UK9A 2PSEA 2PSHA 4PF1A 2HA2A 3C87A 2PU5A 1RWQA 2DSNA 5LKRA 3BJMA 4E11A 5D7BA 4CCYB 5FDFA 1EK2A 3IUJA 5AK5A 2RGUA 4OB6A 2Z3ZA 3PDCA 3FVTA 4HXFB 2AJ8A 4BC1A 5BWCA 3WKDA 2ES4A 3AUKA 1YAJA 4I19A 4BVJA 1UOPA 2G5TA 5AI5A 3X3HA 3JW8A 3TJMA 4QNNA 4OU5A 1BS9A 3FOBA 4PSCA 2WHRA 3C5VA 4CIAA 3EQ8A 4WCVA 2QTBA 3BE8A 3C6BA 4K6KA 3RK4A 4AMZA 2AJDA 1X2BA 2VEOA 4HZGA 4LKOA 4K6GA 5T4HA 2DR0A 3I2HA 5ALKA 4MJ3A 4V2IA 5DJ5A 4BVLA 2WUEA 1EDBA 5ALWA 3OC0A 1UXOA 1TCAA 4BB0A 1Y7HA 4BC0A 2AJCA 5AM4A 1MX9A 2WG0A 1DQYA 2XT0A 4RE5A 4X6YA 4WY8A 4A5SA 2XMQA 3R3UA 3ILSA 5C8XA 2XQFA 4O08A 5HZGA 5K3CA 2HFJA 2OAGA 2ZJFA 3DLTA 1QE3A 2JGLA 4GXNA 4G5XA 4G9EA 1UK8A 1RYYA 5JADA 2GBCA 1MN6A 1XQXA 4B0PA 3QM1A 5AM3A 4W1PA 3QPCA 2PX6A 3IIIA 4B84A 3AIOA 1WB6A 3OTQA 5AI4A 2ZYRA 1LPMA 5JANA 3E1GA 1MAHA 3R3XA 1TKRA 2I3DA 3PUHA 2HADA 4MWTA 4W1SA 2PUHA 4U2BA 4QDTA 4BTVA 3DL4A 4KEAA 4FFVA 4WDRA 4A16A 4Q1VA 4UBMA 1EXWA 3B5EA 3PFBA 4DYHA 1ZD2P 2Z5GA 2K2QB 3HEAA 1DQZA 2WUGA 1QLWA 1UT6A 5JZ9A 2HA5A 5T4EA 5AH0A 3GA7A 3WQHA 5IVKA 1KU0A 1UFOA 4AO8A 2WTMA 3G7NA 4H7FA 2I03A 2WFLA 1W6RA 3I2KA 4GLBA 5E2IA 1QZ3A 4B83A 3G9ZA 3O4IA 2RHTA 1ZI8A 1DWOA 4UBKA 1JMKC 1LZKA 4KACA 3A6ZA 2QJRA 3SWWA 3S8YA 1C7IA 2JF0A 2G4LA 1N1MA 1Q0ZA 3CCBA 4MYSA 2CUTA 3H1BA 5LIPA 4DSAA 2H7CA 1CUBA 4WDQA 3WI7A 5D6OA 1Q84A 1A8QA 4UPDA 1NU8A 1F6WA 1IZ8A 1XZAA 3GZJA 3OM8A 1YA4A 5IVIA 2OGSA 3U0VA 3HZOA 3L1IA 3O4GA 3ESCA 3HSSA 1P0PA 2XUAA 2BUAA 3KWFA 5AKLA 4BP8A 4FDMA 2ONCA 3H04A 5K3FA 1PJAA 3B12A 5HK9A 1IZ7A 4C01A 1LPOA 1CR6A 3K2IA 1AGYA 5ALTA 2BAGA 3BL8A 1DWQA 3HACA 4KAJA 3FCYA 2JBWA 1QGED 4J0HA 1XRLA 1EVQA 4KE6A 5JAHA 1WOMA 4E14A 4Z49A 3KWJA 1CUFA 2Z8ZA 2EDAA 4I4CA 3STWA 2AJBA 3Q8WA 2XUPA 4DMKA 3G8YA 3I6ZA 5LZ9A 5HF8A 1QTIA 5BWBA 3BIWA 5AOAA 2JGKA 4Y2VA 3C8DA 1VLQA 4UHBA 3C43A 2R8BA 3AIKA 1PV1A 4ZRDA 1CLEA 3R0VA 4H7KA 4LXIA 4AQDA 2HFKA 2ZJ7A 1ZOIA 3O0DA 2GZRA 3G0BA 2JGJA 3C70A 3FBWA 5AKGA 4QWMA 1AURA 5FOQA 4X6UA 3VVMA 2WQZA 4X85A 4ETWA 1ZD5A 5FLKA 2XB6A 2Y2UA 4W1QA 2G63A 2ZSHA 2O7VA 5CURA 4J0DA 1QIHA 3S2ZA 5K3EA 3AFIA 3GELA 2B4KA 2D5LA 1ZD4A 3FLBA 1P0MA 4BCDA 2Z8XA 3C6ZA 4PQEA 1B6GA 2JGFA 1XLVA 2WIJA 4KRYA 4HXEB 3C45A 2PM8A 5AHXA 1LPNA 1LNSA 1XZEA 5A6VA 3BJRA 1LGYA 2FJPA 3K9BA 4AZ0A 4DMHA 3W05A 1S8OA 4FTWA 2XQIA 1C7JA 3C6XA 4ZGBA 1UOQA 3ANSA 3G0DA 4G9GA 2J3DA 1YR2A 1QO7A 2VTVA 2HU7A 4TPKA 4BRZA 4DSZA 5AI6A 2CJPA 2C7BA 3D2CA 5AKZA 1JJFA 3QZUA 2VT7A 3RM3A 4CG1A 5EIAA 1VJ5A 4Y2YA 5AM1A 5FP0A 4GDMA 2Z3WA 3DEAA 2PSJA 3A2MA 2XUHA 4KJXA 2AXEA 3FLEA 2PUJA 1ACJA 5ALLA 1IUOA 2V96A 2WUFA 3W2TA 2VSQA 4LHEA 1CRLA 4BCCA 1JU4A 2W6CX 5CT8A 5LZ2A 2OCKA 1XRRA 4M0FA 4RE6A 2C5FA
chains in the Genus database with same CATH superfamily
4HAYA 2AFIB 1T9BA 1NUQA 4LE2A 4A23A 2VP0A 3PICA 2ZREA 2NT3A 4ILKA 3Q7TA 5CRIA 1FNSA 2QX9A 1BU8A 2OLKA 2B6NA 3AX6A 4MW9A 4E15A 3IDFA 1U8AA 4ESHA 3OJOA 1HL7A 1OVGA 4IO0A 4DR4B 1MZPA 4M4SA 4Q9LA 2C2YA 3L6BA 4R7ZA 3MIIA 2CJFA 1JJVA 4DCUA 4DHEA 1NWCA 1YR6A 1NR1A 4C4XA 4UPEA 3TQRA 4NE2A 1QH8A 2DBZA 4PZZA 3HLKA 1GPAA 2G7ZA 2I3GA 5KYUA 1OAOC 2QLNA 2VJDA 5EKUA 2OO5A 4IJMA 4F8EA 4W7HA 3TBFA 2XRZA 5AM5A 2CVOA 5F4ZA 2FZLA 1GNSA 3PLNA 2P9EA 4PAGA 3PFNA 2I4MA 5BMVF 4DPKA 1GWNA 4AW9A 4GM1A 2O2ZA 2C2HA 1Y3CE 3D3QA 4HD8A 4NYJQ 4UOZA 2YASA 1HG0A 4DS3A 3NWBA 2Q6KA 4L72A 4N47A 3AF6A 3AGPA 3C16C 1W1WA 5A04A 4B74A 3A2LA 1QAQA 1XO1A 5E6SA 5EE3A 5FAXA 1XQWA 1S2IA 3GZTB 4LBWA 1GTL1 2QB5A 4Q9HA 4XQEA 1J4AA 5IZCA 3BVPA 1YS9A 1JFRA 2J6CA 1J33A 3CZMA 5HKAA 2FPMA 2D7DA 5AW4A 4U63A 2HB6A 4X5OA 2CFSA 2P4UA 2QMEA 3UXMA 1DXQA 5TQJA 4DLUA 4BB5A 4PNZA 4A6DA 3UJNA 4BZWA 2VHZA 1KYXA 5I7OA 5AHKA 1A1VA 5K0EA 2J9RA 2WTEA 3EW9A 4BNFA 1QZXA 4CM6A 1I0IA 1HYHA 4TTVA 4J1TC 4CEJA 1T2AA 1I5RA 1WW2A 4EUHA 1IVYA 1X1AA 2AWNA 3D7NA 4IHJA 2BMJA 3UT5A 4DXHA 3ZXUB 1GCUA 2YN2A 1L5FA 5HDBB 4PYOA 4I9NA 5E6UA 4F6CA 5JZMA 3ED5A 2JFBA 2C5GA 3PGA1 1OKKD 2PX3A 3MJTA 1IDN1 1Z5VA 3CBQA 4NHEA 3LQ1A 4EX6A 2SKDA 1FZQA 1D6MA 5DBHX 1NVDA 4IX9A 3PF9A 1AA9A 4MGKR 1MOQA 4YDHB 2EJBA 5EXDA 1W581 1YQGA 3MHPA 3DDHA 5FUVA 5EP4A 1SBCA 5H02A 3JQPA 4NDNE 1GGJA 3T94A 3ENNA 4R3WA 2PQMA 3CLTC 3N53A 4ALLA 3TTUA 2HXYA 4FK8A 3OEYA 3TFOA 2QJFA 1C7RA 1NN5A 1WKCA 3C8MA 4Q4AB 5EHZA 1CZHA 3DSRA 1RXUA 2AEFA 5LOVB 2HBQA 2RJ3A 1JQ5A 2DFPA 2VNIA 1AB5A 2VUIB 2CN1A 3VR2A 4B9AA 3SKVA 3DOIA 4LOKA 4D9GA 4R7TA 3IAM1 3GLVA 2JRCA 4TYQA 3WA7A 1UZLA 4GIBA 4MTCA 4YUXA 2ZB7A 2ASEA 2FSSA 1XB2A 4OSEA 4UW9A 2GKOA 4IRXA 1CPYA 1QG0A 1GR1A 3QPAA 1CNEA 4JB8A 1DCKA 3R7NA 1OLSA 2FB9A 3UAZA 4AJLA 2H31A 1S9HA 2ODBA 3FYTA 4JGGA 1SIBE 1GAJA 2CWWA 2VZLA 2I7VA 3V8QA 1LRJA 4D1YA 2H7YA 4DV6B 1C0LA 1OE0A 1HM5A 3R3WA 3RVLA 5KJCA 5FQOA 1TTQB 3UJDA 1H0SA 4Q5IA 4PO8A 1VHJA 3NTOA 4JSYA 2ZZNA 4W1RA 4BO3A 4M9CA 1M1YB 3WHKA 2QRHA 4D4KA 1DUIA 1ZKMA 3S5JA 3HFGA 3FHOA 2JFVA 2X7HA 5CFMA 2PRKA 2QGZA 1GLVA 1H2WA 1X94A 1XZNA 2FPPB 2BUBA 2GX6A 3MVEA 4ZYLA 2A3RA 1C0EA 4LOJA 4G0ZA 1VYVA 2ID4A 3HB5X 4TM7A 3ET4A 1WOYA 4FIZA 4TXJA 5EMMA 2PL1A 4DNPA 5K6RA 1GGNA 2J3QA 5G1PA 5K99A 1SVWA 4BVBA 4BNGA 2BKXA 3BA1A 1X80A 4LYYA 4PGFA 1GQ2A 1YKGA 1C4XA 3PD0A 1H6AA 1RXIA 2PAFA 1RHRA 4FX2A 2E1PA 1ENOA 3ZV3A 1XKTA 1VCOA 3HKDA 1DUSA 2UZIR 1QDUA 2II6A 1OFIA 4LN1A 3WX0A 1KMMA 2RKBA 4JI7B 3IQZA 5DASA 3T7KA 4DSOA 1SG6A 5JYBA 3T5CA 1Q1AA 5DULA 5KYNA 5LYYA 3NRJA 1M2EA 1MIOA 1N8SA 3AUYA 2D2VA 4AJKA 4E7PA 2WD8A 2VPWA 5ISMA 4TUYB 1X1EA 3V6LA 3TW8B 2V7QA 3QVSA 1M6EX 3CW8X 2AI1A 1V9SA 5CTJA 4EKYA 1A5SB 2PUWA 3VZDA 4BMYA 5A3QA 5LU9A 1F51E 1W30A 3B7GA 1Y7LA 2OQRA 2XOEA 3QU7A 2FFJA 4O4HB 4YC7A 2VSXA 3HN6A 2CHVA 4ZOLB 4BKPA 1TCBA 1IBSA 3JD1A 1QQ6A 3PQ3A 3PUKA 1EFPA 3KKNA 1FQOA 2QTHA 1UPUA 2W0MA 4L9SA 4A82A 4XRGA 2W11A 1C4WA 3CJTA 2P5TB 4IUDS 1B15A 4J4TA 2CLKB 4ZKDA 2GEUA 4WCFB 1TAGA 1HEIA 3ABRB 3DKPA 3IAHA 3TAUA 4BFXA 4ESEA 4YAIA 1E1CB 4PLVA 2Q2NA 4M8SA 2J09A 3COYA 4DCMA 2C3PA 3HH8A 5I01A 1ZONA 2A9OA 4IZ6A 1LSJA 3PHCA 3UB4A 1XWIA 1SK8A 1U0FA 2AFVA 4ZEWA 3WLRA 5I48A 3T5PA 2GPWA 3TG8A 3NMUF 4M1ZA 4ZAFA 5KKNB 1OTXA 3ZHCA 2QF7A 4UMEA 1NVWQ 3L43A 3W3AD 4NYJR 2NPFA 4GPTA 4X64B 1KE2A 2O8BB 5F12A 4F7DA 1IZZA 1XVLA 3LC2O 1L1RA 3EIFA 2ZSKA 4GWGA 1WF3A 2JVIA 3K0KA 4EJFA 4W82A 5JH7A 3LNCA 2Y1XA 4GSYA 3ZS8A 3S8EA 2IYEA 4ZRMA 4Q3KA 2BF4A 1BFKA 4M6WA 4RHTA 1P8AA 1AJEA 1C81A 1OZHA 4IQ0A 3T3GA 3TVTA 3M83A 3G2NA 3K6SB 2OAEA 5FTNA 3WKCA 3EWNA 1F1BA 4W99A 1DDIA 2FN9A 1ORWA 3DNFA 4MV1A 3BMNA 3CEHA 2QD5A 2DT5A 4GYYA 5I9MA 3S6JA 5ES4B 4NE7A 4FS8A 1GZ7A 3FRHA 1L4FA 1TGVA 1BNCA 4A2CA 1MO5A 2FP4B 4D8UA 1JRLA 3P2YA 3SY8A 1O8CA 1BXZA 1L1QA 4D4MA 3SU8A 1L5VA 2D74A 4AUNA 5AJTA 4A03A 3ZHOA 4GSKA 3VR4D 2ZCJA 4X91A 4TWAA 3A1UA 4TZTA 5G0WA 2ZXEA 4NYIR 4I55F 3HNPA 1H8HA 4C89A 2R5NA 4L5IA 1W5TA 2MHCA 3NHSA 1LBQA 3PG5A 1HGXA 2QN1A 2OHJA 2VRCD 4ITUA 3COJA 5FI3A 4KK4A 1QFSA 4KQJA 1J90A 1HSZA 3FVRA 3Q9NA 4GSLA 4RA6B 4YBRA 4L4XA 3TQCA 4QXQA 1Y6FA 2GRAA 3BXHA 3DAFA 2IX3A 2PBRA 1JKIA 3I92A 3M34A 1JN0A 1OXVA 3MRSA 4H7IA 4ZCPA 1NXPA 2VJPA 3EIWA 3LTEA 4UUQA 2O05A 5BR8B 4FLMA 3ZDXB 3OJCA 4LPKA 4OA5A 3PR2B 4IIXA 2IDMA 4MB0A 2XKBA 3DOEA 4EFDA 3K4HA 4UBLA 3FNQA 1I13A 3ZN2A 1PF7E 3IPAA 4YXFA 1ZOSA 3LU1A 5ANRB 1N78A 2GN8A 2D1FA 5FXMA 4CM8A 5JLJA 1DHTA 3LBAA 3QKTA 4ZPXA 2JLBA 3FMIA 1Z39A 4Q1AA 2IYVA 4JYBA 1TO6A 2H06A 2PQ0A 4LDJA 3ZNOA 1CJTC 3KOXA 1QIDA 2F62A 4S1TA 4YAUA 3KTFA 5AK6A 3TTYA 3OECA 4D74A 4Q03A 1F8GA 1QPBA 3THWB 1ST3A 2BFDB 4XWGA 3WIOA 1AXGA 1PNQA 1Y80A 4F46A 3E22B 1R0KA 1EUDA 3H4IA 4GUAA 4NYMR 4BVGA 2IZ7A 5CB4A 2C31A 1KP3A 3EZGA 1I4WA 2VWQA 1D6JA 3DMGA 2JIMA 4AF8A 5IJZA 2B6HA 1PEYA 3BTVA 3CYFA 2J3HA 3L8YA 4JROA 1D0IA 1P39A 3H42B 1RHJA 2BBTA 1Z5PA 4FYWA 1HOXA 5CYGA 2F3TA 2QAGA 1IY2A 3I58A 1ZFNA 4G5YA 4L75A 3SHTA 5CLIA 1M34B 3JD4A 1M34E 4IFEA 2VJLA 3H9UA 3DB2A 5B36A 3BXXA 1Z0IA 5I7WA 2ZIXB 1TI7A 3LUJA 3EH1A 1ECGA 2ZRAA 5JAMA 2WHEA 1JLLB 4BWVA 2Q5IA 1HR0B 1T24A 4EPRA 4MWEA 2H63A 3EPJA 1V1MA 1BW9B 1EJ6A 3UXEA 1JIKA 2B8WA 2HKIA 1S89A 2CMHA 3KHTA 4ZO4A 2QMYA 1YMUA 2HAEA 2VNKA 3AEYA 3KFXA 5FBHA 1T5TA 2JBHA 5G53C 1N5JA 3RTAA 1ZMOA 3STTA 4CF6A 2XDYA 3E7XA 3JWIA 1O94C 3CUWA 2NTYC 1CJSA 1U7DA 2AOXA 3BWYA 4PFJA 3GAFA 4YR7A 2HLDD 2AEEA 1M0WA 1P6QA 1TJ3A 5EG5A 4MP3A 4B32A 4D56A 5LMNB 1K66A 3A6JA 1PT9A 2J0UB 3HU1A 4PFKA 4H7DA 3TE6A 3ZLUA 1I9CA 3H0CA 3IDOA 1NUUA 1JIJA 1B1CA 1QM5A 1S2DA 2C2KA 5DK6A 2JG3A 2RH8A 3K71B 1CY2A 2IXTA 1EXVA 4WZAB 5CB6A 4WXEA 1KKMA 1ZJ4A 4P31A 1T1JA 5B1HA 4BMSA 5AK3A 3KUKA 4IUBS 4EKEA 2BGJA 4OHRA 1AC5A 1LBEA 5LDDC 1V3VA 1ZWLA 4WKCA 5EQFA 1J00A 4L07A 4U0KA 5EEGA 4WBNA 1BS1A 1SNYA 2Q0HA 1Z6AA 1ORRA 1N2JA 1Z07A 2ON6A 3VR6D 4L3VA 4E2WA 1QE0A 1YZVA 2ECFA 1XZIA 4ZT2A 2G71A 3ZWVA 1DMSA 1RRVA 4CLOB 2YXNA 221PA 2ZROA 4E1VA 5FPYA 3EGEA 1Z6QA 3CWZA 4HEHA 3RV3A 3JVUA 5KPDA 3N8IA 2FU5C 4OJMX 2XYQA 3DYVA 4L6AA 4DGQA 4IEEA 3D59A 4O5OA 2W5UA 4Q3LA 4UKDA 4C6HA 1H2YA 1BXGA 1JEQB 4OIFA 2X9QA 3CKKA 5KPJA 1OA1A 1R16A 3NNSA 5KYTA 2A5LA 1IN5A 4PIVA 2HA7A 2OG2A 4TS3A 3UV6A 5JS7A 4WUVA 3SSAA 3AL2A 4KTTE 2J7PD 5A3JA 1NNEA 1KPIA 3QY9A 2H57A 2NUAA 4NYMQ 1BCRB 2LCIA 3WLKX 2VXOA 3EZLA 5HX7A 1Q0LA 1IY9A 2X15A 1KZGB 1IEXA 3MGKA 3WGYA 5EKSA 1NRIA 2JH8A 3HM2A 3WLIA 5IN5A 4R31A 5E0OA 4EHJA 2YY5A 3RUAA 1CUXA 4NVRA 5JVDF 1XEAA 2WHYA 3IAS1 3HB7A 1L4NA 1U6JA 1ID8A 3WJ7A 4XCXA 1ZU5A 4MIKA 2PLNA 2PMCA 3TH5A 1OUMA 3EA5A 4R2HA 2Z58A 3FX2A 4GYKA 3I9V6 3L04A 4GS5A 1R5OA 2ETVA 1TJ5A 3E5MA 1C9DB 4QUIA 2BEJA 3IRVA 3USES 4B47A 1NBWB 3ZC3A 5JS6A 1W7AA 1NRJB 4CQMD 3S8MA 3WLTA 1R0LA 1SXGA 1T6YA 3NOQA 1DU4A 2IS4A 2COEA 4JKYA 4TKUA 4AIRA 1LBTA 5EJGA 4GXQA 2P2ZA 4ZYVA 1CB0A 1TJNA 4FONA 3LCJA 5DYTA 1IN6A 1NTRA 3IBGA 4DUGA 2RHWA 1W5BA 2IA5A 2EFEB 1OC2A 1O5TA 2E4WA 1UK6A 3GYGA 4AMVA 1SHTX 5BN1A 1UFQA 2YDXA 3PRHA 2QIOA 2VUHB 3RVKA 2BT4A 3EYAA 2CBGA 2QIPA 4G0PA 3PR1A 1UDRA 2H2FA 3F8SA 1NP6A 2DX7A 3MJRA 4FFRA 4P2BA 3UANA 5C35A 1DEOA 4Z7JA 4X8OA 3D8SA 1CQPA 1SEPA 2XB4A 3FYSA 3P45A 3UA3A 1BDJA 4EL0A 3OCVA 5K9ZA 3NHFA 3EEFA 2PUAA 4ZV4A 1A8SA 3FKJA 4GICA 1O57A 4Y7CA 3RRZA 4C2TA 4P6VF 4AM8A 1F5NA 1ADGA 4NMMA 4IH9A 2A0FA 3MT7A 4JR2A 4KSCA 4DPLA 1EK6A 2G67A 1DX4A 1FFDA 1GSIA 2PX8A 1EU1A 2VDUE 2GEFA 2XT6A 3I6BA 3CPSA 1CIPA 3O84A 4YRDA 5AO9A 3UFXB 3UPDA 3G68A 5IW8A 5LLTA 3FPLA 1ZAYA 3JY6A 5KVSA 2GHTA 5H70A 4F2DA 3QEKA 4YMTA 2P9CA 3DKKA 2YN4A 1FU4A 2YRXA 3RBZA 1JSRA 1TCCA 2H92A 4QUJA 2QRNA 4CKZA 1ISHA 3K9CA 5B1DA 2NXEA 4D6XA 1HZZC 2YWHA 3KL4A 3NNNA 2C58A 4HDRA 2EFJA 2O0KA 4KB5A 4HB3A 4IRMA 4LQDA 5KX5F 2BGGA 1PZNA 3FHLA 4X1IB 5C8YB 3K35A 3NTXA 5JMOA 2JLVA 3MBIA 2WP0A 4XJTA 1BYUA 3GFSA 3ED1A 4M1MA 4RMGA 1LQ2A 4GX5A 4F38A 1GL7A 1JR3D 3WGUA 1SKYE 4QUKA 1ETUA 2ZSJA 1VHWA 1U0GA 3DAOA 1A2QA 1E9RA 3IQXA 4AMBA 4WBNB 9ABPA 1APBA 2CLDX 1R0SA 3CZ4A 1D3AA 3UT5B 4WXMA 1V9CA 2Q2WA 3FBTA 2GXSA 4FFOA 4GMHA 1YVDA 3ZEIA 1Z4OA 4C2BA 2BY4A 4KRXA 2PA3A 1EM8B 1ZK0A 4V38A 2YNMC 3TLKA 1CUSA 4D44A 1IWOA 1JECA 1K8QA 4PSUA 4C3UA 3H2BA 4DY4A 4ZMSA 5IVKA 2XCQA 4LYHA 5B37A 2J87A 4WESA 3SF8B 1GFIA 2P2DA 1QIJA 1UJ2A 3V8NA 2OPBA 3PQ7A 5LR6A 1BWSA 3GFRA 3NHWA 5EIXA 1NW8A 1TD9A 4GOJA 4W6ZA 4RD6A 3R24A 2VHJA 4KN6A 5E1BA 4A6XA 3DZCA 1M6NA 1Y98A 1XELA 2HWYA 2VXYA 4TRMA 1DO8A 3I2YX 3M6UA 2X1MA 3ZYCA 2FG7C 3DVLA 1QR6A 1KGSA 1ETHA 2AOVA 2H1IA 4RABA 5BWNA 3EISA 4ZEXA 2XCSB 2IEBA 4NBKA 3BUSA 2VDMB 5ALJA 5IFLA 1KYVA 1YZFA 1EFDN 1J7JA 1KZ1A 1V45E 2CL7X 4MGIR 3LZCA 2BM0A 4LNHA 5FJIA 4P5EA 2HV9A 5L3ZA 3WGLA 1GG2A 2CKMA 5B58C 2CWDA 3T7JA 3UMCA 2O14A 5C8ZA 4IXNA 4R6WA 2OP1A 3NJ8A 4A2QA 2UYQA 1YRWA 3DQZA 1OQAA 2YXEA 4DMMA 3O91A 1YS2X 5E6UB 4JBYA 1DKQA 4G4GA 3RARA 4DMLA 4IXMA 5M3BA 4RDXA 4D9CA 2HRRA 1SHJA 3L01A 4ERXA 5ICMA 6ABPA 2HK6A 5PNTA 5DXFA 2O1XA 4ZI2A 3MTQA 4L85A 1F14A 4OREX 1EJ0A 1CUJA 4JX9A 4MCAA 1ZH2A 4CIXA 3GLGA 3CV3A 3U7JA 3OMLA 3OJEA 4UAGA 1L4EA 4IIUA 2ONJA 3H5IA 4TUYF 3NVKI 1L7OA 1F0NA 5CXXA 1XP8A 2WZBA 4G63A 4AKSA 1JR3A 5IT5A 1B0AA 2XHEA 2JAXA 4TM8A 5J2UA 4Z4FA 1TQHA 3B89A 4XR4A 3K1ZA 1KDPA 4J2TA 2HA0A 4E31A 5LKAA 3OE5A 3OPYI 4JLPA 2OBYA 5AWFC 3UHJA 4H0FA 3CVWA 5K45A 1EUCA 2ZRLA 3KT6A 3HDVA 3ZCSA 4BFUA 4DZZA 5BW5A 2IUFA 3VNRA 1CIVA 5JNUA 1GNVA 1KXZA 5HRAA 3KOOA 3QBVA 1Q95A 4CTOA 4OX9Y 3AEQB 3SYLA 1TKCA 3AVQA 1E9CA 1N75A 1Q6ZA 1O96A 1XAJA 3I5AA 3VJRA 3KHUA 1BJRE 4M9ZA 5ECWA 5KTYA 5FLXA 3NDIA 3LY5A 5KSPA 4TGLA 1Y89A 2RHCA 3ZE6A 4AZVA 1Z2PX 1TAUA 5KBYA 4J3FA 1V8OA 5AIAA 1EBBA 2CYCA 2OHGA 5EJFA 3EA4A 3VX4A 1U1DA 1RYFA 3QEOA 4R1LA 4YAJA 3W8DA 2ROQA 1EQAA 4PY2A 1O8BA 3L7MA 3NC4A 1B41A 1JDBB 1PI3A 1PZMA 1NLMA 4D4GA 3R3SA 1DOZA 3Q6IA 1GQYA 1P6UA 1SIWA 2C8KA 3GD7A 2X6TA 5EP1A 5H80A 5KQPA 1YCGA 2B2XA 4KFTA 2NPOA 1XALA 2HN9A 5AJXA 3U39A 1SA0A 2FPGA 2QS9A 2REQB 4E4TA 1TLLA 2WWHA 3LPNA 3GVCA 5EP3A 3CSSA 1Q7RA 4GW3A 2P9HA 4NAVA 1AA6A 1I6WA 1JHMA 2FLKA 3HBFA 1R8JA 1PWZA 3K9WA 3E8MA 3H1EA 1WNFA 5B6PA 4MJ7A 1QQAA 1I6MA 5JC1A 2B8JA 1U7ZA 4QELA 2BVNA 2PFKA 3DCNA 5THQA 1P1IA 1JSLA 1N8NA 1IB0A 1LY1A 1WVGA 3HP7A 1T3TA 2IXFA 2BTOA 2IXGA 3AKDA 4AN1A 5IUKC 1ZGGA 2GWHA 4D43A 1RAFA 5TJHA 3TDNA 5K8JB 3NHJA 4DIEA 1T8PA 2GD1O 4RH3A 4QDUA 4V1CA 1TYZA 3K16A 5K4GA 5BXYA 3VX3A 3VVLA 2WU3A 3G7UA 4RFSB 4J1TA 2LGJA 2LIPA 3D6TB 3ENWA 3L41A 4FQ7A 4K9DA 5CEFA 5IYZB 1WSBA 4Y2HA 3VJMA 3GARA 3PRYA 2XPCA 3IRUA 1SVLA 5COQA 2WLSA 2W22A 3SMVA 2YVUA 3FGZA 1V48A 4F1KA 4HUQB 4N76A 3NIBA 4JCCA 2OBFA 1V7ZA 4B3DA 4BMVA 3CIOA 5LFAA 2F3SA 3TIXB 4CR6A 3DDZX 3GPLA 4MUHA 1ATIA 3IAM6 4MPPA 3PGKA 1UMKA 2J5RA 1QFJA 3MJDA 2EJWA 3CEAA 1SCJA 3FN4A 2C97A 3PJFA 2NO9A 3MJFA 1L7QA 4AX8A 1HE2A 4WLVA 4UU0A 5I8WA 2Q46A 4N18A 4LF8B 2EQAA 3KKQA 3KKPA 4F9GA 3PDJA 4FOSA 1XPJA 1Z8HA 2FMUA 1C9JA 3A6GA 2PRIA 2ZUDA 3T3OA 1DRUA 5E9JA 1JLMA 1Q21A 4C2AA 4G1VA 4JC8A 3RVBA 3BDAA 4R8MA 2ZBVA 3S2SA 1UPXA 1R7RA 5DPMA 2NAFA 3H9JA 1AGNA 1YC2A 2DQ4A 2OGUA 2QRGA 3KFVA 4MKFA 2OA0A 3SC2A 3ZTWA 1TJYA 1Z28A 1R9MA 3PYLA 3DZDA 4LV6A 3ZDDA 2V4ZA 3E3OA 1PW7A 3KQTA 4HSEA 1VA4A 3SFTA 4J7XA 5CG2A 2ZCVA 1JSXA 3IDSA 4KPGA 3OIVA 1J39A 1P60A 4NULA 2H16A 3L92A 4CMCA 5KNCA 2VP9A 3LV8A 5HFAA 4K6MA 3RFXA 2OOKA 1H9BA 2P0AA 1GGEA 2PUCA 1Y6GA 3LC7O 1RCUA 4EBBA 4IMJB 4I81A 2FP4A 3FFAA 1A7KA 1KO1A 2O8NA 1KQOA 4JZYA 2AHRA 1BE0A 4MUAA 5FHQA 1LTHR 4YRKA 2DEUA 5HZKA 3VDRA 1YWGO 1LNQA 3M6FA 2HHAA 3FDXA 4BXOB 3RLFA 3RRJA 4E2XA 4JSRA 1ICIA 4ZANA 3TOCA 3B1JA 2XCRB 3TSAA 1HE4A 4RPCA 4RPKA 1PNRA 1EUCB 3SBEA 2EKDA 2ERCA 3WHIA 1WXIA 3DOCA 3GJ4A 3LHIA 5TPZD 3QVXA 2G9UA 3IULA 3H1TA 1EFCA 1Z6ZA 5F76A 2B8EA 2HRCA 3O82A 3FB1A 4IP0A 3WQSB 1IQ0A 3FPFA 4LY0A 3BG5A 3AVPA 4B73A 2OZEA 5TIIA 1HRKA 3DVAA 3ZU4A 1J2EA 3TW0A 3LKZA 4IQGA 3Q3GE 4DDTA 3HKBB 2X42A 1ECCA 3LBYA 3IS3A 5KQSA 4MVJH 2HK7A 3N2ZB 2W2MA 4RORA 3U4CA 3VOBA 1GYQA 2W7TA 3TRKA 2I78A 1UJ4A 2XADA 5HHTA 5ARBA 1RJFA 1LX7A 1P2DA 2XQGA 2QRVA 2FWRA 3GLTA 3IUNA 1SRQA 1F4VA 3KXDA 5CJ2A 1QH8B 1UBFA 4D0SA 1EE1A 3K6JA 5KDOA 1G0OA 3CLHA 1BOFA 3AILA 3N2GB 3P9XA 4YJ2B 4CHGA 4OUDB 4G1CA 5GQSA 2JGDB 4IVRA 1GFWA 1MABB 3PNLA 3WAKA 4OATA 1Y6RA 4B3SB 3USCS 4CIVA 5J47A 1U4OA 3G59A 2FRXA 5LZ7A 4J6EA 2IWHA 2O06A 5C53B 1Z47A 1M3SA 2JH9A 4B3MB 5DF1A 1EFVB 1VE7A 1DAIA 2BFBA 3AR4A 1KH2A 1NONA 2P30A 4EPWA 2HOQA 3VU9B 4AG6A 1TRKA 1Z0ZA 2A1IA 1ABFA 1NKVA 1NJ1A 4NI5A 3SXUA 4CMIB 1LDMA 4A8PA 2ZK7A 3PC8A 4G8BA 2W6MA 1XZJA 3O4RA 3OKAA 4Y2GA 2OFPA 5I7FA 1OXUA 2BBWA 4EECA 1AQYA 2GLXA 2IUYA 2F9LA 3HFSA 2FFQA 3LGSA 1OPRA 4UCQA 1Q7TA 1LI5A 1UBUS 1IJFA 1V43A 1YB4A 2B78A 3VDMA 3SM3A 2D0IA 3F6SA 3KHSA 4I8IA 2HJWA 4D8XA 4JI6B 3B9QA 1OB2A 3ZWQA 1W1IA 4H7EA 1D6NA 3TJRA 4Z54A 5JUWA 3ISVA 1KJ8A 2JCSA 2VDQB 4FFBA 1NDHA 3BC1A 3HB0A 3W2EA 1VYTA 4KPFC 8ADHA 1YFZA 2DY0A 3KQVA 3DL7A 4YCMA 2E55A 4QQNA 4F4CA 2J5BA 1F3OA 4Q48A 1P5ZB 4O1MA 2PPVA 5JEDA 1LK7A 5ALSA 1GVNB 2P62A 5JDCC 3OUUA 1EFRA 1CZLA 4LDNA 3WIUA 2QUHA 1I7NA 1YT5A 4YR9A 3JVVA 5JQGA 3HDHA 1EUZA 5K0GA 5TQVA 1KJIA 4JI1B 2W43A 2H2DA 2RJOA 3FWYA 2R7MA 3ML1A 2D3TA 1TW3A 4YUYA 1NIPA 3A7DA 4DA9A 1BMTA 1UXIA 2B7BA 2PE5A 2RB5A 3O4HA 2QE6A 2JZCA 2WUWE 3H3XA 5IYZA 2Q8PA 1CRWG 4MQBA 3Q7EA 3JQEA 1C8VB 2JBAA 1AZLA 4KE7A 3E9QA 4Z0TA 4Q4HB 2QD1A 2V0NA 1Z7GA 1HT1E 3LX8A 2HA6A 4R2KA 3UWSA 4Z86A 3HCBA 3TDMA 4E94A 4A8JA 1OXTA 4IOKA 1FRNA 4TZKA 2EKLA 4E33A 5AXDA 4EYKA 4P92A 4EJSB 1VE1A 2GD2A 2NU9B 3EZ6A 2PIAA 3KQQA 4TMFA 4EQZA 4AJIA 2KBEA 1WMAA 1OILA 3LCMA 4KP7A 1MC4A 3TS1A 3WL3A 2GYYA 4JVOA 3HBJA 5AW0A 3FCAA 4G26A 4EGSA 1K97A 5IJXA 3E9RA 2AK3A 1WS6A 2HF9A 1T2CA 2PT9A 2CUZA 4OLAA 4NICA 1C1DA 1S8AA 1K9SA 4DIUA 1N0UA 2BI7A 4TLCA 2PNJA 4E5UA 2OL4A 3HYNA 3GRAA 1TQ2A 5E1MA 4FYKA 3T4EA 1LFDB 4BBAA 2GAAA 5KYWB 4HFMA 1DTEA 4X71A 3L06A 2ZYVX 4H59A 2R7KA 4G4JA 4UBOA 3KOYA 3R5JA 4EHNA 4N5HX 1A8PA 1L8AA 2A57A 2FEXA 3KOUA 4GPIB 5EN4A 1ZWKA 5CB4F 1F2UB 2QPOA 4FHFA 1ZD8A 2XUDA 1O4VA 3KE8A 4YCDA 5FRDA 3FAKA 1KI8A 4MQEA 3IKLA 1VDZA 1Z68A 1RVDA 2OQVA 2Q3BA 1ACLA 2HLHA 2H8GA 1HC7A 3ZBQA 4EO7A 4KXNA 5CB8A 5JXGA 4M8IA 1H9CA 4EW1A 5JCJD 3ZXXA 1Z16A 1YCHA 4UREA 2HDNB 2F1RA 3QFTA 4FSXA 4QATA 1YCDA 1I33A 1OKKA 5FF9A 3U3KA 2Q1SA 5J1TB 4HADA 1JIUA 3A04A 3ILHA 1Q20A 2BTQA 3MWEB 4HNTA 5L6LB 1JG2A 2D4HA 4EY6A 1ZD9A 1X92A 2C4HA 1VA5A 2QZPA 3NP7A 4PC3A 5UKDA 1M1NB 2V03A 3I0ZA 4DLWA 3KXIA 1PV4A 2IYOA 4BNMA 3DA8A 5D7NA 2XA9A 3EGIA 3IKJA 4ID9A 4LMPA 5M5BA 1C3OB 5A9RA 1FTGA 4FYJA 3EEOA 4B6EA 4FKZA 5JO0A 1D5WA 4PZ9A 5CA0B 1M8GA 1YJXA 3HI4A 2QW1A 3DOHA 3N8GA 3GDHA 5EWMA 2QXUA 2FEMA 2IIVA 2QRVB 2O8CA 3DZJA 3GRZA 2PN1A 1DEAA 4L8FA 3HA3A 2BBOA 3KV3O 4H18A 4ONEA 3MUNA 1EX7A 1N3BA 3CLVA 2XJ9A 3UB3A 3ZZ0A 4DR7B 3BERA 1U28C 3DT6A 2VP5A 3QEMA 3TF5A 5B3AA 3CO0S 4FR0A 3KLMX 4I08A 5I7UA 4WJLA 3LWBA 4MQMA 5C5EA 5F2EA 2HDOA 2QMZA 1DWUA 1WR8A 3WK7A 5KYXB 1GV1A 1M8PA 3LUHA 2G9VA 2NO4A 1W94A 5K8TA 4NBRA 5F9FA 5BW4A 1PFWA 2PMEA 2QN8A 1CUYA 1FJHA 1NXXA 1VHTA 4WA7A 2O3RA 4JNKA 5ALFA 2W6ZA 4HDMA 2OXTA 4RF4A 3GJ6A 2CE2X 3LVRE 4OI2A 3LO5A 2PG3A 1ZK3A 2VDRB 4QSHA 4AK9A 2EATA 2FCRA 3C3XA 4XYEA 1RXCA 3JQBA 2EU8A 4EW3A 3QA3E 4DWOA 1N92A 1YRHA 2NSHA 4K5QA 4M1QA 2VP2A 5DBGA 1Q7GA 5I7AA 3OHPA 4HDSB 4CL2A 1BA2A 1QFXA 3H6HA 5HFNA 2FPOA 1WMBA 2H9IA 1GLGA 2V6BA 1AKRA 4A0FA 3BF7A 4E70A 1TQDA 2C4MA 5IKXA 3ZK9A 2V45A 2BFNA 3GGCA 4RVUA 5C5IA 3UM9A 4R1OA 4B35A 4D97A 5K0ZA 1E5QA 4I8XA 1YR7A 5DRTA 2JFHA 2OQIA 3H3JA 3ZWXA 4D0RA 1R4NA 2VPQA 5G4KA 3UKJA 4D45A 1SZCA 1WEKA 1F3LA 3KQWA 4YT4A 5C81A 2W37A 3QV2A 5A0VA 3SJZA 2R1UA 3LYUA 2R6HA 2C0CA 2V98A 4ER5A 4PS1A 2IZOA 1UKVY 2N47A 1GEEA 1T9CA 2AK2A 4MP8A 4EFNA 1W4LA 2X0EA 5FPSA 1UBHS 2GMWA 2I66A 2IY9A 3DFMA 3C3YA 3A9SA 4OYLA 1TVCA 2MINB 1T6ZA 3KFLA 2J3KA 2OFXA 3CRZA 3ETJA 4ZQBA 5HUHA 1A72A 1L5MA 2ST1A 3IJ5A 2MT9A 1AKWA 4QZVA 2R25B 4JLBA 2GSWA 5HCIA 2V9ZA 3CH4B 1G55A 3A3YA 4NJMB 3VKWA 3WLHA 1FSGA 4QTYA 1X1RA 3ER8A 3D5TA 4D98A 1KWGA 2WWRA 1VCMA 2GRUA 1UBKS 6ADHA 2H11A 4EATA 2G7MC 4IIJA 3S68A 3CLKA 2VLBA 1RZ3A 2EW8A 4OGGA 1ZRSA 3BEOA 4R2JA 4KLZA 2JAQA 3MWDA 1IQRA 1PX2A 2JHGA 3GP3A 5SY9A 1MB0A 3WYDA 4C7JA 3P5BA 4BP3A 4DSUA 1ILEA 2OV6A 3QXGA 4RTOA 4MUXA 3NHKA 3SIPA 1QTRA 2BGWA 1TZBA 1NNSA 5TS2A 1USVA 1MXFA 3NWOA 4QYWA 2FPSA 2YMMA 3DFZA 4RSGA 4XIIA 1MZVA 2X5OA 5DP1A 1TE2A 4NZ9A 3PUIA 3G2HA 4GR9A 1YBHA 1B0UA 3E22A 3PJGA 4X6XA 4WGGA 4MULA 4ALKA 2BC9A 1D1SA 2QTCA 3AU9A 5GIPE 3ITNA 4LC9A 2PCLA 1Z83A 3TWOA 3WV5A 4TYYA 1DKPA 3AESB 3T7EA 1OFUA 2DR2A 2QTGA 9MHTA 2CLLB 4JLMA 5C31A 2XMGA 3A7EA 3KLPX 4ITRC 4UJ5A 2NYUA 3SX4A 5J4YA 2EZ4A 4KR0A 4JBLA 1GG8A 3STUA 1PE0A 3N0XA 4HAZA 4AMGA 2F64A 2ID8A 2WOJA 3BYZA 5LLSA 5K0LA 1E4YA 2ZSBA 2PO5A 3OZFA 3PJEA 1BDMA 1NQAO 3A31A 4M9SA 5KEIA 3FSGD 3QKSA 4MEBA 3PS9A 3VHQA 2BLLA 2R8OA 3T0FA 4CCSA 3PNQA 3IMCA 2V7XA 5A9TA 4BYGA 1T4MA 1WTCA 3JARB 4BGVA 1FP6A 4N0PA 3M1IA 4YRQA 2O8EA 2R6AA 1ZYUA 5SYNA 2HUNA 3QVTA 5HK8A 2FN8A 3NIGB 2O0LA 3H2ZA 4MRMB 5KYYB 1NSYA 2AOUB 1NVXQ 4KLNA 4RNDB 2QSJA 1SULA 1U4NA 1E62A 3PCRB 2JJ8A 1KARA 3QRWA 4DLBA 1SD5A 2ZBQA 2X8JA 5JNTA 5F1YA 1DGQA 2ETXA 2W2PA 1Y63A 4G1FA 3TLBA 4D96A 3CPJB 1OA0A 4L57A 3LGAA 1U2RA 2CCJA 2O7NA 3WBJA 4ALJA 5A5DA 3SC2B 2OEPA 1NXOA 3O3NB 5DDIP 1B0ZA 2Q3EA 3T9AA 3U19A 2F3RA 3BXPA 3R40A 1JEYA 1NQUA 3KD3A 3W3ZB 1NM5A 4MKGA 2O7RA 1C9NA 1NLYA 4MI9A 1MB9A 1P0IA 3V7UA 4AC9A 5HE8A 4EAQA 1PT6A 3ABIA 3AY7A 4LY9A 1ISSA 5AICA 5F23A 5MHTA 4KIUA 3IOMA 2ZR8A 1E1KA 1IB6A 2ZE5A 5EHXA 3UPTA 1AHNA 3MJHA 3UFBA 3O75A 1I94B 3IP8A 3UMSA 4P0PB 3GVPA 2QPTA 3T4PA 4W5WA 1XPOA 1N5RA 2W42A 1H8HD 3OZIA 4KAFA 3RUDA 3OQVA 2R5WA 2GD6A 3PE3A 3C8ZA 3L6UA 4TTJA 5BSTA 3DBOB 3LQRA 1Z5WA 2CVQA 2FWIA 2VK8A 4Z8YA 1YHNA 1O2DA 4ZO9A 2D2EA 2XWBF 3DR5A 2X6QA 1QXSA 3NC1C 4U7JA 3SBXA 3VTAA 1B4DA 4CKBA 1I2BA 1KI6B 1DAKA 1NJ5A 4HDMB 5F1PA 1M33A 2WWGA 4FWTA 4HDOB 2D62A 2ZRQA 3AL0C 4K9SA 1IBCA 3NAQA 5DYWA 4MHTA 4E1BA 2WG1A 1AUQA 3F7MA 1U9IC 1Y1LA 2BEVA 3RSCA 2NN3C 3LRXA 1PJ8A 4G37A 1Q22A 1Q6YA 2Q4TA 4PYRA 5K51A 2NUAB 2D2IA 6NULA 5AKIA 1K63A 4J16C 2DQYA 4PCUA 1KVRA 4R40A 4BGUA 4BMXA 1CDEA 3D8BA 4QTXA 3WLEA 4YI3A 2JEYA 1AKEA 1E0DA 2DP4E 2FX5A 3PBKA 3VYSB 2Z98A 1RBQA 3FI0A 5IAOA 1N2CA 2Q07A 2OXIA 4G5SA 3VNQA 4JK3A 4YCAA 4BO7A 4N40A 2ARKA 2NSJA 5I9NA 1Y7TA 3C6KA 1FFCA 1Z3CA 8MHTA 2YIDA 2GEDA 1LRKA 1KIAA 4HS4A 3ODPA 1UZAA 1Q1NA 3OLWA 2IEAA 5DHPA 3T7CA 5G0UA 5TXGA 3E82A 3B3GA 4BBPA 4EPTA 1MO4A 2NYVA 4U7PB 3Q2IA 5BVHA 3H84A 3MK31 2F1JA 1QIMA 1UKAA 3EVNA 3URMA 3J81A 4W5TA 3VNSA 4PONA 4XAQA 5HGXA 4QOSA 4CTKA 3U3RA 3LCUA 2H5IA 4FHCA 1EDEA 3RGGA 1JG7A 1GXSA 1H5NA 3D7SA 3FVWA 3DMTA 4FJ0A 4QHSA 4L3OA 4YDSA 2ZT6A 1XUOA 2Q7OE 1JI0A 2XMZA 1X80B 1YFKA 5C8YA 3M8KA 1PSDA 3UK1A 1UF9A 2VJBA 4YY3B 3MAAC 3G82C 4RANA 5JEEA 4QDJA 4DPMA 4ROSA 2A4MA 3LECA 1MC1A 5GMOA 5A2QA 3HEBA 1L5GB 1DJQA 1LDGA 3D7LA 1D7OA 1D2NA 4FIDA 1WZCA 2BFBB 1CUWA 3E7FA 4IF6A 1ZEMA 4P9NA 3SEAA 5M34A 4AJPA 2X4IA 4UHHA 1DE0A 1O54A 2Y67A 2Z2ZA 4NOMA 3M2PA 3K0CA 2FN4A 2FWAA 4GQIA 2Z0MA 1VLMA 2EX4A 2LPMA 4MRVA 4UEJA 4F2PA 3QF4A 2PR2A 3BULA 5MGBA 3WTCA 2ZJ4A 3B9PA 4PX3A 4LKRA 5LQUA 2IU3A 5HIJA 4WVLA 1YC5A 2AI2A 4MDYA 5SYMA 4BVFA 1UMCA 3WHPA 4RADA 1XF9A 4P3NA 1L6IA 3OBIA 4CPDA 3PWSA 1VGVA 3GLFB 1J8YF 2C1EA 2D5IA 2BDTA 5CNMA 4DG8A 2NX2A 2CUKA 1G3UA 4HYYA 3FJYA 2AN4A 2E2WA 5AI0A 5ALEA 3UMJA 2PPLA 1MABA 1H9AA 4BTLA 4K6FA 2Z1DA 2JI7A 3IYLW 5F33A 1Q7BA 4FYMA 3BK2A 2OM6A 1YS4A 4LSMA 1I1QB 3ORFA 5H0IA 1XA0A 4BIMA 1MHPA 2YICA 4QD3A 1JXMA 2LR0A 3DDOA 1DAGA 2KI5A 3RYIA 1T0HB 3VKFA 3TZQA 4KIGA 4Q18A 5KTSA 2J7PA 3E5HA 3IX7A 3P71T 4ZJUA 4K6CA 1VJGA 2D2FA 4ISCA 1L5OA 5A3VA 2JS7A 1ZNZA 1JILA 4DT1B 3C24A 3QLVA 4MKIA 3L6OO 4JI8B 4XQ9A 1FMTA 1V8FA 4FU0A 3I04M 3L4SO 3VTFA 3VYVA 3C7AA 2Z09A 3PC8C 4QEZA 5IMBA 1PS0A 2I80A 1CE8B 2FPWA 2YHSA 1SCBA 2GESA 4M99A 1G21B 2H18A 4ZU6X 1OXBB 2FX2A 3PNSA 1MX5A 4QYXA 2XUKA 5DYGA 5AQEA 1BROA 4ZI3A 5FWAA 3GRCA 2IYLD 4OQDA 5ALVA 3U6KA 4NARA 3UBTA 4QHTA 3M33A 4MWDA 4I3GA 3LX4A 4FKMA 3K30A 4X1YB 3VVBA 2P9QA 3AKCA 4CF5A 1AH2A 2ANBA 2BPOA 1TOAA 1XAIA 2G5GX 2XE4A 3BMOA 1FP4A 3M3HA 5D01A 5TQ0A 4CEIB 1I2ZA 1KMNA 1N7IA 3G2JA 2ZUEA 3LP5A 2I4RA 1KQ3A 2RG1A 5IVHA 1AIPA 1QBKC 2HK8A 2ZI3A 1KAQA 1E18A 5AKKA 5F7OA 1PSZA 3KQYA 5J59A 1J07A 2POCA 1Q1GA 2P67A 4GOLD 5JNSA 1F8XA 2EW2A 2WWWA 4ZVTA 1YFLA 5FI1B 2CMDA 3OWXA 5HKOA 4MYCA 1ZIYA 3PKZA 3OFJA 4QO7A 4EZBA 1OB5A 3CWCA 5HQ3B 4FC6A 1RYZA 2AX3A 5A4IS 3DZKA 3RWMB 4UZEA 3WMFA 4C0KA 2VQ3A 2HCFA 2I22A 4LBYA 1YNOA 2X2PA 5HOEA 3WGOA 4JA0A 1Z0JA 1H2BA 5FULA 1SY7A 3LY9A 4IH1A 5AKXA 3TLGB 2YWRA 3LAWA 3BD9A 1N2CB 2XW6A 3DLCA 4MIYA 4A9AA 3BE6A 1KBQA 1NZDA 2ZPUA 3WGMA 3QMPA 6REQB 3R76A 3UOGA 5BMOA 4MQUA 2A92A 3DTVB 1G6OA 2PSFA 4J90A 5C46F 4YCCA 1ZC3A 2XRFA 4AKEA 3GHHA 4HYEA 2XWPA 3AFOA 2H0QA 2FW8A 2DVMA 2VRWA 2PSDA 3H9EO 1V7QA 2BGRA 2VKTA 2B83A 3ECSA 4HQLA 4V0KA 4FT2A 1P0CA 4FI3F 3GAZA 3RQSA 2QP4A 5KQGA 1FYDA 3WB2A 5BUZA 1ZOPA 3MWLA 5KNBH 1ECBA 3EFBA 2M6RA 4QIHA 5LB2A 2W6JD 3UMRA 1T6XA 4HXYA 2Q49A 3PGXA 1KEPA 2ECOA 4YRJA 1ZI6A 3VR3D 1CDDA 1YQWA 1TF2A 4H17A 4RXTA 4U39A 3WA6A 2HIMA 4PC7A 5EJ2A 2NTJA 3MLAA 3P2IA 1UPBA 1YIOA 1Z38A 1D2CA 3TEFA 1JVBA 1RAAA 4MJLA 4QDOA 3RH0A 1KP9A 2XBLA 3Q88A 4MYHA 5LLDA 4GBJA 1Z34A 2A88A 3Q9UA 2HPVA 2XLCA 3M5PA 3DGFC 1WPQA 2Y1WA 2PX0A 3OBBA 2F90A 1NJ6A 1T2DA 3IBYA 4P3OA 2OFOA 2Z9BA 1WJGA 4PICA 2B35A 3BGSA 1Z4NA 3BJZA 4MV9A 3EGXB 3L49A 3VH4A 4CN8A 1AZTA 5KC8A 2BCEA 3AVTA 3EVCA 2R66A 2EARA 3B36A 4ZJPA 1BA3A 2IZ0A 2Z2IA 4RHYA 3FZYA 1ODCA 2C8JA 3AF3A 5LM3A 1IQPA 1GUFA 2WMYA 2DBQA 4B2LA 1MQ8B 2QUBA 1HEUA 4KQIA 4QASA 2FVXA 2LWIA 3KJNA 5EWJB 2DZDA 2MYPA 1T36B 5U1PA 4L5YA 3WRYC 2J6IA 1LV7A 2HWWA 1VPDA 3DM9B 5EMLA 2JZOA 3NT4A 3PPXA 2VJOA 1Q83A 1XNHA 4BLWA 3FWPA 1RBYA 2B5OA 2RIPA 1ULHA 3QUCA 1XEWX 4NU8X 1FP7A 1NT2A 5ALIA 3A6DA 3GO4A 1SVSA 3PR3A 3Q15C 2WIAA 3VDXA 4K1LA 4KO4S 1N6RA 1OLXB 4WLFA 2A2ZA 2GJ9A 2QR5A 2XTAA 5T6MA 3RFTA 3ZQ4A 1ICEA 1HDOA 1M8JA 1QS0B 2ZJYA 3P4XA 5TEVA 5BNZA 3KIPA 1H4TA 5FOXA 3EAFA 4JT4A 3LP6A 1AD2A 3WMXA 1IBKB 1OI4A 2QK4A 2JNWA 2QT9A 1JWLA 3LA8A 3P2EA 2WSSD 3KAJA 4FUQA 4IOMA 1DC3A 4F45A 2DERA 3LLUA 2G9RA 5CJPA 1J25A 3AERA 4JQCA 3T3PB 4LOLA 4HGYA 2AG1A 3NIWA 1SKQA 4EABA 3F5SA 4O4LF 4BFCA 3EG9B 4I50F 4BVEA 4BVKA 2IYRA 3LY7A 3CB2A 1HTWA 2VC2B 2CV2A 1JIIA 1SB9A 3EDRA 4P3YA 4MXDA 5COBA 2JI4A 4DCGA 4EWLA 1F7UA 3WK4A 1X2EA 3G17A 5BW8A 3F78A 3I9V1 3RIYA 1AO3A 2ZOSA 3D2BA 3FUCA 1XHLA 4GKVA 4BQRA 5H81A 4CFZA 1AQ6A 1IN4A 3KLOA 3T5GA 3W5SA 1XZDA 2AEJA 1KI2A 1OXSC 3WWYA 3W6OA 4NE9A 3E0QA 5GJWC 2R8YA 5IZCC 2JJQA 2Y1OA 3JQQA 1GZHB 4D9FA 3RFFA 4P4UA 4MW2A 1ZSNA 2VH1A 1P91A 3C8UA 1R3DA 3GRKA 2BFWA 5EL0A 4RZ3A 1GFZA 3WK5A 3AG6A 2XB2A 3SOZA 2RAFA 2BP7A 4G4IA 4X65B 4WXYB 1AMOA 4PTYA 3SZMA 2Q4BA 2PSEA 2XGGA 3RRFA 2X41A 2C3OA 3FOZA 3C87A 1WKVA 5B3LA 4LJ7A 4DY6A 1G2PA 4RK5A 3HO1A 3TRJA 2OECA 3GK3A 4ZT5A 1W4CA 5JVDB 4ZYTA 3SF0A 4DEVA 1LVGA 3LCVB 3P9IA 1OVMA 3TTSA 4DF3A 4D26A 2IHJA 2ZTLA 4NENB 1V37A 1BSVA 1A98A 4KH1A 2FSVC 2DHQA 1OR8A 1Z4IA 3ROEA 5FDFA 5AK5A 4QPJC 3U3MA 1X38A 1Z33A 3PDCA 3WRVA 2DULA 4CV2A 3ZDRA 1PKXA 1VL2A 3NS7A 3X44A 4YMVA 5EE1A 4ZTUB 1QUFA 3T06B 3FOFC 4Z4QA 3SSNA 3RU3A 3LT2A 2ATXA 1CETA 1E2HA 4OHPA 5LNK1 5LWQA 2ZAOA 3Q4GA 5KKAA 4CKCA 3Q8KA 2HHHB 2ZWOA 2CNWD 4WACA 4DDVA 1KMCA 1L4YA 5I4BA 3E15A 2C7OA 2K6GA 3VBCA 2JCXA 2CK3D 4BVJA 3MHTA 4XIGS 3DULA 3X3HA 2FKAA 3OUZA 1JXAA 1NDUA 4U8GA 1U0HC 4TMWA 4YEDA 3PENA 3KQPA 4M7WA 1QYRA 4FHGA 4RHUA 5TDHA 3SQLA 3K53A 4OM8A 4QOIA 1K4MA 1KNXA 1E2IA 2I2BA 3MOSA 4YWJA 3W1WA 2I2AA 4MTLA 4CR8A 5GTDA 1HFEL 3RK0A 4CIAA 1D2EA 2HMAA 3DFFA 1TEVA 3ND8A 3C4QA 4KWHA 3UT0A 4IDOA 5H7XA 5KWEA 4N5MA 2QV7A 3E9ZA 3IIMA 4KOEC 3U6BA 2BBSA 3VDQA 3OQBA 4RKRA 3HZZA 4ZAYA 3ZKWA 2Z1MA 3NB0A 4KGDA 3SQDA 2AJDA 4NOLA 3K0HA 1UL1X 4N6NA 4MKRA 2Q5OA 2IBMA 3I8SA 3LBIA 4Z3KA 2ERYA 4MVJA 4MDEA 1BVUA 3GDWA 4Z1MA 3BRWD 1KZ4A 4FINA 8ABPA 2EFCB 3PB3A 3KQSA 4QPCA 1N2OA 1EGVB 1KYIA 3IILA 3KKKA 1LDNA 3T99A 4BMDA 5B4UA 2AS0A 2YMPA 3SE0A 1OH8A 3DNPA 1OHHA 3IVRA 4PTZA 4QREA 4BJ1A 4F4DA 5T8KA 4ZT7A 2IJGX 1EHIA 4XUDA 121PA 4GX1A 1RWMA 2NAPA 5ALKA 3P0EA 1W96A 5JMWA 1KAOA 2QRJA 2YUIA 3TNJA 5ICFA 4PG4A 4CV3A 1W0JD 2MCFA 4BVLA 4IGIA 3T34A 2R7NA 4JHXA 4Y0VA 5CR9A 3LC0A 4RIFA 2OVFA 4C4SA 4Q6WA 5EAIA 4HLUC 5LXTF 1Q0UA 2HXSA 1Z2EA 1ZSVA 1UXOA 3CNOA 1QQBA 1C7FA 5KNCD 3MZ0A 3PQ8A 1SU6A 1U8ZA 2QE7D 4LDZA 4RK7A 3AXSA 4YV1A 2ZIEA 1A0OA 2CDRA 4TROA 1ZLXA 4UDNA 2W2NA 3DE1X 3I0NA 4RMNA 1RRMA 4UJ3A 2GUGA 2DFVA 1ZEJA 1ZITA 1EJBA 1FTWA 2VTDA 3ONNA 1Z4QA 3V8RA 3RVPA 2O54A 1DAMA 4EOGA 1MH9A 2GD0A 2WG0A 1BWRA 3NDRA 3NNDA 3I32A 5HBRA 4DYVA 5JDIC 3MD0A 2EOAA 2XEXA 2C42A 4ZVNA 1NJ8A 2VWGA 1M72A 1RM4A 4RXUA 1E3JA 3A4TA 1H8EA 3R3UA 4KLCA 4XWKA 3CMCO 1PNOA 1XD2A 3OT5A 4LAFA 3Q9LA 5K3CA 3DLTA 5F7XA 5HRCA 3ADDA 1MOSA 2P6MA 1BE1A 2SCUA 2XT9A 5EGSA 1UBLS 1YI1A 2G8LA 3TLXA 4R71A 2Q29A 3LG2A 2JGLA 4RL4A 3IIKA 3WNBA 5E6RB 5LSAA 4B2IA 1NBEA 2FZWA 1E58A 1UK8A 5B58T 3TYXA 4N7BA 4AJHA 2H2WA 1UXHA 1KTVA 3F2VA 5F9MA 3UT6A 1G19A 4CNBA 1T0PA 1M1YE 1GRVA 4IHQA 4AS2A 5IKPA 3GMSA 3H05A 3QSGA 3FZNA 1RMTA 2HJ9A 3CH5A 3VOTA 1QWSA 2BEVB 2NIPA 2P2CA 2VNAA 1X7XA 2C4NA 4U6QA 5BN5A 3BRWA 4KPUA 5J2TF 2VZ8A 2HZ7A 1QTNA 3IIIA 1C14A 3HPQA 2XD4A 3DE3X 1KAGA 2RHDA 4FGLA 1YHYA 2ECQA 2VYND 4XPIA 3HTXA 1AGXA 4FYVA 4H6WA 3AIOA 4I9UA 1X14A 3KPJA 2JCVA 3OTQA 3CHYA 4LG1A 1VIDA 3N2NA 5AJWA 2ZYRA 3IPXA 4CIWA 3A4VA 5L8VA 1AKYA 1RP7A 2BMFA 5DHTA 2WF5A 1DP4A 3JALA 3QV1A 4DIOA 1SBYA 1QZTA 1TKRA 1YR1A 1GUAA 1CERA 2BJWA 4UCXA 1H6CA 2H1LA 2PUHA 1LUAA 1V35A 3GNSA 5DHSA 1HNZB 1QBGA 4ALMA 4P54A 1Z8NA 4UZFA 1NW3A 1RJGA 5BSHA 4F4UA 2HRZA 4YCBA 4L1KA 3IOBA 3R2JA 3OM1A 4IXDA 2X9NA 2GK7A 1N34B 2HT6A 4TL6A 4MS4B 2DCUA 4OM7A 3UXYA 2XITA 4UBMA 4LJ6A 3LT1A 4JT2A 2N1MA 1DQSA 3GT3A 1ZD2P 5L45A 1O95A 5FOUA 3ONEA 1BCSB 4J94A 1YDFA 3L4EA 1PK9A 1UT6A 4TMTA 2CHUA 1XMPA 4GPEA 4ZQHA 3DE6X 4IDBA 3WNVA 3JWGA 3WQHA 1L4HA 1XU4A 1PWEA 3DPSA 1T3ZA 2V3VA 4OHOA 4F1WA 4ZFNA 4K0RA 1N3IA 4ND6A 1KMHB 5IG2A 4GOMD 2XF2A 2Q3FA 5KUTA 3VHXA 5TNXA 2EL9A 2WTMA 4HG2A 4LJ8A 3AEQA 3OIYA 3UAWA 4ZMBA 5ITZB 3PJDA 1VKJA 3OCWA 4F5DA 1WY5A 3ZIAD 1E94E 3IGFA 3WC4A 4BIIA 2P5YA 4WK6A 1L8XA 3SNHA 1QHSA 1XVTA 4CT0A 1M2VA 3WBBA 4E22A 4GPAA 1EGHA 1RI3A 3K0CC 4E6EA 2RHTA 4FDUA 1SU8A 1ZI8A 3HCCA 4MAMA 1J0BA 1R8QA 5FLEX 3TN7A 1DWOA 3UGTA 1T0IA 3O8OB 1GPDG 2AZDA 4NV0A 4UBKA 1TU3A 4OSOA 4KACA 2YVQA 3JZDA 4LDRA 5BR4A 4XGRA 2IY7A 3RBAA 1CX9B 4FSDA 3UY4A 2CXRA 2IVFA 3ZDZB 5LA6A 4AUMA 2E37A 2NXNA 4RJIA 2HXGA 4CEHA 1Q0ZA 3CCBA 4MYSA 2ZM6B 3B9BA 4LWOA 1I3MA 3GXBA 3WYEA 3EPLA 5B5SA 3NEPX 3H4MA 4XX0B 3MJEA 4KPEC 4RAOA 4E0BA 4JFRA 3REGA 3T1HB 1EXNA 1WSWA 3N2KB 1YE5A 2UYCA 2R47A 4IIJB 1P7WA 1ZOOA 4CWAA 1Z2CA 1TMYA 4P83A 1JUDA 1GZDA 1JPUA 1NU8A 4KTVE 2MYTA 5JS2A 5AESA 1B16A 3CF6R 4JCOA 5FEMA 1IZ8A 3FUUA 4FJ2A 5BVGA 1IG0A 2OQ2A 2XQVA 2LP4Y 4PNPA 1GG5A 3L1IA 4P7GA 3W7BA 2C2OA 3LNTA 2A3NA 2HWKA 1ZIDA 3JYOA 4KQFA 3ZUPA 1P0PA 1W35A 4K7JA 1IVNA 4BPBA 1E3IA 1J9ZA 2CKDA 4UDXX 2ENWA 2GXQA 2TS1A 3H04A 2A1UA 1PJAA 1U5BA 4Y1GA 5I7VA 3B12A 3AR5A 3WB0A 2RGRA 3JZIA 1IZ7A 2BMAA 5JWHA 3PUXA 1SCDA 2WWXA 4QJ4A 5C1IA 2PX5A 1CR6A 1YZLA 1AGYA 2VIIA 5ALTA 2HEGA 3N3BC 3QELB 2HZBA 1AKQA 1RKXA 4G67A 2B1GA 3NJ4A 4RX1A 4RY0A 5BSRA 5KYVA 3ZH2A 3I1FA 1ZM2A 3DO6A 5E95A 3X1XA 1V16A 4BEWA 1U81A 4N82A 3V42A 4WOKA 5FOWA 4FC7A 4U02A 1DC6A 2O0HA 2Y66A 1IDOA 1U3FA 3ICPA 5FQNA 3ZWKA 4AZWA 1E2PA 4F93B 5AXBA 3KWJA 4ZA2A 4NSNA 1NBAA 2O4CA 3EGXA 4UTVA 2Z8ZA 4DARA 1A7JA 2EDAA 4WN9B 2FQXA 4DCCA 5BUQA 5EIBC 3N8KA 1LI4A 2I9KA 5C8YF 5GVSA 1G18A 3U4HA 1QHIA 1LDBA 1PDVA 2DJIA 2R00C 3JASA 4R1UA 4A2WA 1E99A 2R84A 1KPHA 4BV3A 1CNMA 1QTIA 5HF8A 1PR1A 3UWPA 1YKSA 4GKJB 2D1YA 1KY5A 1GZ5A 4NFHA 1U2GC 1DOAA 3RBXA 1ZPDA 4LBVA 3V4SA 2N9UA 4B33A 1XSEA 1A9OA 1NUSA 2IOQA 4V0LA 5JHHB 5IRCD 3R5XA 1NI4A 3WYGA 1KMIY 2EZUA 2JAPA 1CKEA 4JJKA 1KOJA 3AIKA 2QD2A 5EUMA 5FA5A 4WSOA 1SUEA 1QG2A 2VT3A 3F46A 1W29A 2FZVA 1XAGA 1XIVA 3P27A 3D0RA 4WTOA 2GTHA 3R0VA 1Z6TA 4MS1B 1L5NA 3EXHA 3RF7A 4K3VA 4LXIA 4AQDA 3OE7D 2ZJ7A 3B6IA 3VPSA 4B7CA 1QCZA 1FS5A 2WB4A 2C5SA 2Z2KA 2ODTX 5DEIA 1XCOA 2Q7XA 3MCTA 3SI7A 3G0BA 4O02B 4X8HA 5E3HA 4LF7B 3CSDA 1E5DA 1RKVA 1D6SA 2NU7A 3ZJ4A 4HQKA 3N8DA 3PT9A 5GOTA 1T8SA 1MJFA 3BCUA 1YQEA 3GQBA 3OEHA 4J43A 3ST7A 3PXGA 1IC6A 3V4LA 1AURA 1RLMA 4E12A 1JTVA 3T7AA 3FM9A 1SBQA 3I0MA 1KK2A 5KVQA 2WQZA 4V1CI 1NR5A 3QXXA 2CNNA 3NKFA 1ZD5A 5FLKA 1ORDA 2D2XA 2EP8A 3NUGA 2YCBA 4DCOA 2ZAYA 3B1YA 5B4TA 4CLEA 5J40A 4H31A 4UAJA 3I3SR 3TX2A 4ZCSA 1AV7A 1XCJA 3C2QA 3K4QA 4RTNA 2BGKA 1IHPA 2ZSHA 2YWFA 2UAGA 1QIHA 1SQ5A 2AMFA 1I0LA 2CFIA 2I54A 3NTLA 3NYQA 3OFSA 5BP7A 5IASA 3MMXA 4YJDA 3BB3A 3T7RA 4YAGA 3NHPA 4U6NA 2GCEA 1NHWA 2FGKA 2BSQA 4BNKA 2O8BA 3BPSA 4DCVA 1COWD 1W34A 1X8XA 4UUNA 2PGIA 3A9RA 4Y9DA 3S29A 1P0MA 4EI7A 1LW6E 4OVKA 2PWAA 3ECAA 4IVQA 4WKBA 2G06A 5TT0A 4N39A 4LTNA 1S02A 2JGFA 4UXHA 1XLVA 3RO7A 4KMMA 5HYVA 1N5OX 1K5DA 1XDWA 4A8TA 1F9EA 1W0JA 1QHXA 2WIJA 2X7JA 2YS7A 4M9RA 2GILA 4O1IA 2HMWA 2WJGA 4QRDA 4IQFA 2F8MA 3ICCA 3ONFA 1PLLA 4RLFA 3R0JA 1SBIA 2GAJA 1CC1S 2PM8A 2HF7A 3IEPA 3FPSA 4NMLA 4NONA 5EXPA 3HL4A 2O3UA 1ZVKA 2QG4A 5FL7A 3VR0A 3R74A 1SMKA 3GU3A 4JN6B 4L5JA 4NBWA 4LX0A 1LTQA 3ELDA 4HR7A 4URFA 5AHXA 4M49A 3GEDA 1XJWA 2PUBA 1TC1A 4PVCA 4BP1A 1ZJ6A 3BJRA 2W4IA 3MTDA 4NBTA 3ZVLA 2XCLA 3SN6A 4DR5B 5LA6F 3K9BA 3TM4A 4AZ0A 3L5OA 3DE5X 3W05A 3IKMB 3LKVA 4RCYA 1I2MA 2B94A 4JB0A 4Z8XA 2GBPA 2GLTA 3JTMA 3GJ8A 1QVAA 4F04A 5LMCA 5BSMA 1AB6A 3E23A 4RQUA 1ZLYA 1XU7A 5KSZA 1YR2A 4WFQA 4LWQA 3AI1A 5D3MA 3QFSA 1QO7A 4HQNA 5BY2A 4I5EA 8AT1A 3NBKA 2JBAB 3OQOA 4DSZA 5AI6A 5F98A 4ER0A 1FW6A 3PXDA 4KVFA 5AKZA 2Q6TA 3KQOA 4CM7A 3W90A 4MCJA 1LI7A 3IR7A 2VT7A 3U2QA 3RM3A 4I2NA 4BFLA 1YVUA 3B78A