1DIWA

The hc fragment of tetanus toxin complexed with galactose
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
441
structure length
441
Chain Sequence
EDIDVILKKSTILNLDINNDIISDISGFNSSVITYPDAQLVPGINGKAIHLVNNEESEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of the H(C) fragment of tetanus toxin with carbohydrate subunit complexes provide insight into ganglioside binding.
pubmed doi rcsb
source organism Clostridium tetani
molecule tags Toxin
molecule keywords TETANUS TOXIN HC
total genus 110
structure length 441
sequence length 441
ec nomenclature ec 3.4.24.68: Tentoxilysin.
pdb deposition date 1999-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07951 Toxin_R_bind_C Clostridium neurotoxin, C-terminal receptor binding
A PF07953 Toxin_R_bind_N Clostridium neurotoxin, N-terminal receptor binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1diwA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1diwA02
1APNA 1S0LA 5JOXA 2Y9GA 2FDBM 3QLQA 2Y9FA 3VSFA 5DG1A 2VW2A 4GAFA 3HMYA 1R1ZA 2E7TA 3ILNA 5T5OA 2X2SA 5KXBA 5KXCA 2WBCA 2VY0A 1T9FA 1MZ6A 3AXDA 1DZQA 5D63A 3R4SA 2OUHA 4KEJA 1FV2A 2P23A 1V6KA 2YY1A 3BAVA 4FPOB 2ZGRA 3B3QE 3R05A 3AX4A 4GKYA 1AXMA 1FWVA 3H6SE 2ZGNA 4QO3A 1GNHA 2DS0A 1AXZA 1LJ7A 3WMUA 1W6PA 2IHOA 1BQPA 1Q04A 1FAYA 1BLDA 1DYKA 6I1BA 1VCLA 3USUA 2X2TA 2OW4A 3NV2A 5D61A 3WUCA 2PHWA 1WW4A 5F90A 1DQ1A 2UWAA 4R9CA 1CE7B 2ZQNA 3IM7A 4ZOTA 1DIWA 3DGTA 1MS1A 3M2MA 3FGMA 2D44A 4BLIA 3BRGC 4FPYA 3ZXDA 4I4YA 5F5QA 1JLYA 1BLAA 1M2TB 4LBKA 2R0HA 3N7MA 1EYLA 4GOYA 4ZFYB 4P6AA 5GAQA 3U4XA 1Y7BA 4LBJA 4I4PA 5DZFA 5CB7A 2XB6C 3PVNA 3W9TA 1FYUA 1ULGA 2H0BA 4GALA 1MVQA 2AR6A 1HWMB 2DU1A 2P34A 1UAIA 1KQRA 4IY9A 3ZXKA 3A0KA 3IMNA 3HN1A 1AVUA 3O5SA 5E88A 1TWEA 1GNZA 1WUVA 3BTAA 3HSMA 3FJFA 4XMAA 1JT3A 3HR9A 1KNMA 2LIEA 1Z2VA 3A4UA 3CNAA 4DEPA 2ZBJA 3WO3A 2PHRA 4XBQA 1C4RA 1V6JA 1RMLA 1GZWB 4Y1XA 2ES3A 3WA1A 4I3NA 1S0DA 2Z42A 3WHUA 3RRDA 2ZHLA 3MALA 1CR7A 4YM2A 1ABRB 1U0AA 1HDKA 2C5DA 4JKXB 4FPJA 2KM2A 4XFTA 3Q9OA 1QKQA 3O49A 5GLZA 3AZXA 4HR6C 4JPZA 7I1BA 3VUOA 4XJ9A 4QALA 1KITA 5F8SA 3Q7WA 1GZWA 1AXKA 1N1TA 4P14A 4M3CB 3M3OA 2D20A 1VIWB 1AVWB 1DQ4A 1RIRA 1V00A 2DU0A 1Z0HA 5CBLA 4GAIA 3BAUA 2A75A 2D7FA 5BP5C 3VKFC 1N4KA 2I2SA 2AAIB 2EXHA 2Q5TA 3AZZA 1QNWA 1J1TA 1MR5A 5JMCA 2BQPA 2G4IA 2ERMA 3D6EA 1LEDA 2JECA 4A7ZA 4TYSA 1JN2P 4IZXA 3CA3A 1QOOA 1XG6A 3CAHA 1IKQA 1TP0A 1GBGA 1RG8A 1ISZA 3AJZA 3BAQA 3C2UA 1OKQA 1VALA 4QC4A 1O4YA 1ULFA 3SH3A 1RITA 3NWKA 2R49A 3HALA 3D4KA 3N7JA 5T52A 1G9AA 5IK8A 1BFGA 3FJIA 4YW5A 5JOZA 4GP3A 4TLPA 3W58A 5F8WA 3SH4A 3RSJA 2DUOA 4Y20B 4X37A 1YBIA 2DVBA 3NV1A 3GALA 5KXEA 2D6OX 3APBA 1I1BA 2UU8A 2W08A 3UD8A 1LOFC 1YI7A 5H9SA 1CN1A 1LOAA 4AGVA 3AKGA 5T5LA 4QBCA 4JC1A 2L5XA 4Q27A 1CVNA 2E53A 2GNTA 4YM3A 3MPPG 5IK7A 2ZGOA 4LO0A 1BXHA 1FNZA 4FVVA 5FZUA 2YROA 2E51A 2DVGA 4DPNA 2V5YA 3AP7A 3WG4A 4W65A 1SBEA 3O0VA 4YM0A 4X3AA 3BRDA 1LGNA 3ZSLA 3OPZA 3O4OA 1IRAX 1GZ9A 1ONKB 2VUAA 5DUUA 2ZA9A 5BOWA 1LOBA 4II0A 1BJQA 1CESA 3WINA 2UUSA 2JE9A 4AVVA 8I1BA 3JRRA 4F34A 3WDXA 1FMZA 1MACA 3N36A 5HPZA 2CY6A 1S0FA 2FHRA 4OW4A 2GNBA 1ULDA 2NN8A 3ZVXA 3KM5A 1G86A 2V73A 2ZGUA 2ZKNA 3AKIA 5JOWA 3A21A 3RS6A 4XJUA 2LALA 5T50A 4D0ZA 4OEFA 1X50A 4KBBA 1TFMB 3W59A 2FFUA 3WDWA 1MS9A 1OFSA 2BEBA 5EYYA 1V6UA 3FBYA 4GKXA 1S0GA 3BAGA 4M3CE 5L73A 3BADA 3O5WB 3QYDA 4Y1ZA 3UK9A 1JY0A 4M3CF 1W6MB 3B00A 3POSA 1WD3A 4Y1YA 2VSAA 5EC5A 5GZFA 1KJRA 1IOAA 3SNMA 4BM8A 4BOWA 2XOAA 1SLTA 2ZMLA 4Q1RA 2GN7A 1AVAC 2ARXA 5T55A 4DFSA 2DWRA 1JT7A 4J2SA 4LBQB 2GMPA 1PUMB 2VXTI 5AVAA 3ZSKA 4K1YA 1N3PA 4LO7B 2AUYA 4ZA3B 5E8AA 1AZDA 1WBLA 3AP9A 2NMOA 5E89A 3MEPA 4EFQA 2GZBA 4G6MA 1WW7A 4Z9WB 1QQKA 1BA7A 3BA5A 4GA9A 2A6XA 2HWAA 1VAMA 3D7WB 3IAGC 4XOGA 3WDUA 5FZZA 4R9BA 3PJQA 4AGGA 1GZCA 1CVSA 2UURA 3O0WA 3OBTA 1CONA 1PZZA 3PUBA 4LBOA 1SFYA 1MS8A 3NJ5A 1IKPA 4RL7A 1W3GA 4WZFA 2VXRA 5CAZA 2P39A 3AFKA 1OQLB 3UJ4A 3KQRA 3T1LA 2ZAAA 1NZKA 3FUQA 1GICA 3AXEA 1II4A 1ZM1A 1JT5A 1UN1A 3UDAA 4EB2B 4G1RA 2NTDA 4BMEA 2CL2A 1TIEA 4XMIA 3JU9A 5DZGA 2JJ6A 4XBNA 1NLSA 1DQ2A 4H55A 1ISVA 1SLLA 4IHZA 1LOCA 4ISQA 3WDYA 2I1BA 3RTJB 4QKRA 4P9WA 2DREA 4WBCA 2PHFA 1UZZA 1RINA 5DG2A 1W6QA 3O0XA 2RSTA 2HWMA 1AJOA 3I29B 4M3CA 3CU1B 4YG6A 1UZYA 1V6NA 1DZCA 2GDFA 3QCWA 4ATEA 3M3EA 1SACA 5I1BA 1PZ7A 2GNMA 2HZ9A 3AYAA 4AVSA 4L4HA 4PC4A 3B9CA 3OBRA 5BVPI 3N3HA 1PZ8A 1RY7A 1IT0A 1HQLA 1LHOA 4YZ1A 1GGPB 1G8WA 2WT2A 1TOOA 4UW4A 2UWCA 4NOTA 1W6OA 3NV4A 1LOEA 4OZXA 1QMJA 3WV6A 2ZGPA 4OWLA 1IS5A 3AYCA 4AN6A 4ZFUB 4I30A 2ZR1B 1N3OA 2ZGSA 4FPHA 2SLIA 4LO3A 5FREA 3CA4A 1QGLA 1WLCA 2DTWA 1MS4A 1SCRA 2A6ZA 1S1AA 2NP0A 1FWUA 4J2XA 4JRAA 4YW2A 3UJQA 1HIBA 3AKHA 1BFBA 1A3KA 4K1ZA 3FJKA 3AH1A 3LSDA 3B69A 3PVOA 3ZYRA 2F2FA 1AF9A 3BB2A 3H0OA 1HWNB 1DQ0A 4I4XA 2R1BA 1KDMA 1IS3A 4I37A 3VWCA 1ISWA 4JP0A 4YZ3A 3VKNA 1DZDA 2DV9A 1LULA 2F2FC 2AENA 3PMEA 2NMNA 3CRIA 2DVFA 4XXAA 1W6NA 4GWMA 4OEGA 3V0BA 1MVEA 3OYWB 5DUVA 4G9NA 3UD7A 3AZVA 4BQ1A 2KLLA 1C57A 4R9AA 4YZ2A 2EXJA 4P9XA 3AYEA 1S0EA 2A3XA 4I4SA 2EXIA 2AYHA 1HKNA 3BOPA 3R4UA 4FQ4A 4I6IA 2NYYA 1JOJA 1GV9A 2R0FA 4XJZA 1WLDA 4C1XA 2KI6B 4D69A 1PWAA 2AQZA 3AH4A 2AH2A 2P3KA 3OY8B 4KEIA 9ILBA 1S0JA 4YGCA 3ZYPA 2EIGA 2QN4A 3ZX7A 4FP3A 4OEEA 1GYKA 3ZXGA 4Y20A 4LO1A 1Q8OA 4J2YA 4YFWA 1LECA 2R1DA 4UW5A 4AVTA 1SR4A 1W0OA 3CA6A 3T8SA 1URXA 1GLHA 4XYXA 5D62A 3H6QA 3LSEA 4UW3A 3ZSJA 4LBLA 2ESUA 1YRZA 4Q8LA 3FJEA 1MC9A 1AX1A 5B2HA 1WW6A 3BAOA 3AK0A 1HLCA 2JDZA 3D5OA 1AXYA 4G9MA 2J3PA 1T4QA 3DUIA 5GLTA 1QNYA 3N7KA 5BYNA 4LO1C 5EYXA 5EWSA 4DCKC 1LTEA 2EF6A 5JDBA 3O4BA 3CRHA 4X39A 3WNXA 5JOYA 1K5VA 3AJ6A 3ZC8A 4LBMA 2NVHA 1TWMA 2ARBA 2DURA 1DLLA 4ASMB 4CZSA 4USPA 4LO2C 3I8TA 2GN3A 2E6VA 1WBFA 3AJYA 4ZKTB 2ZQOA 1K5UA 4ZGRB 3A22A 2ENRA 2JKBA 3WO4A 1Q8PA 2FMDA 1AVBA 3AKFA 2ZMKA 4LBQA 2ZMNA 1WLWA 2DVAA 3LCPA 4U36A 2RG9B 2P2KA 1G9CA 3PVEA 4HL0A 1SBDA 3CA0A 1C1LA 3USUB 3UJOA 3OGGA 3LLPA 4GXLA 3FFZA 1CJPA 1G7YA 2GMMA 4IY8A 5GALA 5EHAA 1H9PA 2LIQA 1AJKA 2D23A 5IT6A 5CA6A 4I7IA 4TZDA 1Z4SA 4DRRA 1AX2A 1N1SA 4YM1A 4HANA 1YYNA 2XG3A 3WLUA 1ULEA 2RHPA 4XHBA 1DFCA 1FMMS 3WO2A 3H6RA 5DUWA 4ENDA 5LK5A 2VU9A 1S0CA 1V6XA 4Q8KA 4XIOA 3POWA 1ENQA 4FPCA 3HBWA 3AH2A 3TAYA 5FRAA 3PHZA 4XXPA 3WG3A 4DS0A 3VV1A 1CIWA 2E7QA 3JUTA 4Q9PA 5BXPA 2A6WA 3I2AA 4PBOA 3ZPYA 4CTEA 5BXSA 4I1EA 4XKIA 21BIA 2W52A 1CPMA 2VW1A 4LO3C 2KKIA 4LO8B 1QU0A 4FPFA 1QOTA 2WT1A 2Y9WC 3VT2A 31BIA 2WKKA 2W68A 4I96A 1N47A 4L8QA 3SISA 3NV3A 3ZXFA 4I0YA 2VW0A 4P0LA 3IM0A 1LESA 2CTVA 4ITCA 1JLXA 3WINC 4FPLA 3V64A 2E4MC 4AWDA 1XYFA 3VT0A 3AP4A 2WT0A 5DSSB 4XILA 4I4UA 5DUYA 2EXKA 1LCLA 1W3FA 1DFQA 2GALA 4ISRA 4XDQA 1RZOB 4A7YA 1V6MA 1R8OA 2D6LX 2YXSA 3FUOA 4R9DA 1I1EA 5BXRA 4YLZA 2CNAA 3BX1C 4MYEA 1OQ1A 4Q1PA 2IWTB 3O3QA 3VKOA 1FATA 3FJ9A 4YG0A 1Q8SA 5FNWA 5CNAA 3WMVA 4YW4A 5GZEA 2P37A 3IKWA 1UMZA 4PCRA 4FPEA 1LEMA 4Y22A 1G9FA 4M00A 4FQZA 4D8HA 3AJ5A 3FJ8A 2DYCA 4Q2FA 3WVJA 1QDCA 2D3SA 2KH2A 1N1YA 2CYFA 3NBCA 3IPVB 4XHXA 4JAWA 4LO0C 1SBFA 1D2SA 4SLIA 3WUDA 1MZ5A 1PUUB 2VSEA 1J0SA 3IIRA 1NUNA 3SLIA 2D24A 5JLVA 2ZGKA 3AZWA 3F62B 4JQ0A 1ISYA 3VEQA 1MD6A 4YZ4A 4Y22B 1YF8B 4ZXKA 2D22A 1E0OA 4LBQD 4DRVA 2CWMA 1VAVA 1HKDA 3E8LC 3WHTA 4Y24A 3AP6A 5BXTA 3FLRA 5F8YA 4FGFA 1A78A 3Q7YA 3BIWE 2LTNA 5SV8A 1H30A 5GZGA 1H9WA 5DUXA 4XFSA 3CA1A 4OWJA 3NBEA 2D3RA 3T1MA 3BA4A 1O4ZA 2P3IA 4UW6A 2HYKA 1AX0A 3FLPA 3I2XA 2PELA 3WOGA 5GLWA 1SZ6B 3UL2A 5T5PA 4IYBA 5FNXA 4XZPA 4D0TA 4LBNA 3PG0A 1SLAA 3UJ0A 3BODA 2A6VA 2Q3NB 3NBNA 1BFFA 1C1FA 1FGAA 2K8RA 4NO4A 1N3QA 2JD4A 3V65A 4ATFA 1DYPA 2ET2A 5T54A 3ENRA 2D7IA 3O12A 1AFCA 3V0AB 1YTOA 4YGEA 5EG6C 2PHTA 3BRFA 1IOBA 3CA5A 1V6OA 5KXDA 1W6NB 3ILRA 3K1XA 4YG3A 1Q56A 1L2HA 2Z49A 4XTMA 5DXDA 4YGBA 3IN9A 3A0NA 1QQLA 4Q91A 1XZZA 3JUUA 3POKA 3FJCA 1CPNA 1TEIA 2D6KA 1V6WA 3ZXLA 3V79C 3WDTA 3OJ2A 1HWPB 3SITA 4FPGA 1Q03A 1JTCA 4Q9GA 1LOFA 3GNEA 1SLBA 3M3QA 2ZGQA 1V6LA 3LTQA 4I4VA 1G9BA 3AYDA 2A3WA 1FN0A 4A7KA 4XJWA 4DQAA 1SLIA 3S8KA 1LENA 4XJ8A 5G00A 1JUIA 4AN7B 1XQNA 1KDKA 2GNDA 4WVWA 3M1HA 1FNYA 1QXMA 1LOGA 2C9AA 1DQOA 5JVVA 2ZGTA 1ONAA 4RA0A 2AFGA 2D6PA 2DTYA 1Q8VA 2M49A 4U2AA 3C9ZA 1GKBA 2GO2A 5GJ6A 1Q8QA 3AP5A 2R9KB 4WVVA 4H9WA 1F9KA 5HCFA 3H6RB 3O4CA 2NZ9A 2A71A 4K20A 1W6PB 3ZSMA 3P6JA 3BAHA 2DRYA 5BP5A 5F9TA 2Q9XA 3L2YA 2OUJA 2HW9A 1HQWA 1AVXB 1JXNA 4J23B 2F8XC 4AGRA 3ASIA 3IM6A 2W39A 3O44A 1UL9A 4FOVA 3ZXEA 2DUQA 1JYIA 4CRQA 1ENRA 3QR5A 1DQ5A 2K4AB 2BEAA 3CQAA 1BKZA 4YGDA 5H9PA 4YFZA 4LO2A 2SBAA 1JYCA 2YZ4A 4I4RA 2WLQA 4CJMA 1LODA 1D0HA 5GLUA 1Q1UA 1CQ9A 3MW3A 1V6VA 1V6IA 4KEKA 3CRGA 1LHVA 2A7AA 1IHKA 2RQ9A 3ZXJA 1JW6A 1W6MA 1KJLA 4EFRA 3OJVA 2Y9XE 1LGBA 2VLCA 2DUPA 1IS6A 1DQ6A 3WCSA 5GZCA 1MS5A 3S8JA 3RTIB 4PBPA 4EEEB 2EALA 4J2KA 3VKLA 4Y1VA 2MC2A 2R16A 4X38A 2A70A 3BA7A 1IRPA 1YO8A 2ZHNA 3B01A 1JT4A 3OGFA 4Y1UA 3VSZA 1FX5A 2B7YA 1LHNA 1IJTA 1G9DA 5H9RA 1HWOB 2ZZJA 2D1ZA 3KMVA 2MIBA 3WG2A 4I4QA 2JE7A 1LU2A 1DGLA 1BYHA 5HCBA 4I1BA 2CWSA 3WG1A 1QOSA 2QYIB 4OUJA 2ZHMA 1WBAA 2D3PA 4AYUA 4EFPA 1LU1A 3I4IA 2EAKA 1QDOA 41BIA 1B09A 1W6OB 2GMEA 3TC2A 2FO1A 4FOWA 2A6YA 1PC8B 3FJAA 1JQZA 2E4MA 3IM5A 1WCSA 3OJMA 1Z78A 4ZFWB 2K43A 3P6IA 3FJHA 2D7RA 3POYA 3VT1A 2VH9A 4FPKA 2YV8A 1FQ9A 4JKQA 1W0PA 5BQUA 1UPSA 1MS0A 1YIFA 5IK5A 1XHBA 2FGFA 4ZBVB 2UWBA 4G6JA 3MW4A 2AXMA 4FOYA 3ATGA 2P3JA 3N7LA 1FV3A 4KC3A 1SLCA 1NXD1 1W3AA 1I3HA 3RG0A 2PHUA 4GOVA 2D6NA 1G82A 1JHNA 5E24E 5DZUA 4HA2A 3OJBA 5DZEA 4Y26A 1UX6A 3N0KA 3WDVA 3FJJA 4P0KA 1W6QB 1WW5A 1M16A 3V0BB 1EPWA 3NBDA 1LHWA 2WNEA 4WV8A 5FZYA 2ZGLA 3VKMA 3IPVA 2BFHA 3INAA 4XTPA 4IONA 2Z48A 2PHXA 4YW1A 4FP2A 2D6MA 3RMXA 4YOLA 1ISXA 2TEPA 1BFCA 2DVDA 2ZABA 4EKXB 2WSUA 4XE9A 1A8DA 1UKGA 4I2SA 1BZWA 3TB0A 4K21A 4FOQA 1DHKB 2ZGMA 4Q26A 1ULCA 3ILAA 4L4IA 3RQ0A 4BMBA 3A07A 1F5FA 3B9UA 4JCKA 1TTUA 3MW2A 4XFUA 1SCSA 3FJBA 1BASA 5HCAA 4ZLBB 2AREA 2DRZA 2A5ZA 1ILR1 1IILA 1P63A 3AZYA 2A3YA 4YW3A 2WSVA 4LO7C 1MS3A 3RMYA 1GANA 1ENSA 3T2TA 3UD9A 1HCEA 4M01A 1S0IA 4QKSA 1LGCA 5DVHA 4YZ5A 2ZACA 3WCRA 3Q7XA 3HOMA 1R8NA 5BQUC 1WBCA 1EV2A 5IK4A 1HCDA 2WJSA 4H04A 2FFVA 4P9YA 2OVUA 5GLVA 1DQGA 4I4OA 2MLLB 4QD2C 3SNVA 4Z8BA 4R6UB 3OYWA 4Z8SB 2D43A 4GP0A 3SH5A 4PF5A 1ZA4A 3FJDA 3ILFA 4USOA 5GZDA 3ZC9A 1ITBA 1F31A 1YXWA 2WQZC 1S0BA 1LHUA 2YMZA 4QBVA 4QD2B 2ERFA 3N35A 3F1RA 3V0AA 1QF3A 2AGSA 2KI4A 1DBNA 1BARA 3A23A 3FLTA 5T5JA 2YUGA 4I8MA 1N1VA 2ZHKA 5H9QA 3OY8A 4BLJA 4OWKA 4XJAA 1SR4C 4GWNA 1VLNA 4IQPA 1DJSB 4C1WA 4XBLA 4F83A 1WD4A 4P0JA 5EXOA 1JBCA 4PQ9A 4HJJA 4XIKA 4BPZA 3P53A 3O4DA 4DENA 1KRIA 1EVTA 3M3CA 4IZEA 3EF2A 2NM1A 1IS4A 5IUQA 5GM0A 3WZ1A 2WRYA 1GSLA 3O4AA 1PZ9A
chains in the Genus database with same CATH superfamily
1APNA 5FPBA 1JZ2A 5JOXA 1S0LA 4AEJA 2UY8A 1OLMA 2Y9GA 4HVQA 2HEWF 2JDAA 5CFDC 2FDBM 1RJ7A 1Z7S2 5A7NA 3QLQA 2Y9FA 3VSFA 4UFHA 2HWB2 4NRPA 5DG1A 4CEYA 5A33B 2VW2A 4CDQC 4GAFA 4L97A 4QWNA 1F5JA 3P5BA 5F2SA 3HMYA 1PVC1 1XSQA 3KT1A 5C8CB 1R1ZA 2E7TA 3ILNA 3PNAA 4OZOA 1QHDA 4Z1VA 5CEHA 5C4WA 3IWZA 5HI0A 5SV5A 4FXGB 4EWAA 5T5OA 3VZMA 1ZX5A 2VVDA 3THDA 1DU3D 5F5IA 2X2SA 4OHVA 3JB8A 5IVVA 5KXBA 4CDXC 5JXGA 1IPKA 4AVAA 4OI4A 4LKDA 3ZOIA 1QJU3 4OULA 3SCHA 5F6LB 1VBD1 3ETPA 2WWUA 2C24A 4MVTA 3AC0A 4GH4A 4P5YA 5FZCA 2WBCA 2GSYA 2VY0A 2VZTA 1JZ7A 1MZ6A 3AXDA 1DZQA 1T9FA 5D63A 1C8M2 2P6HA 3R4SA 2OUHA 4KEJA 1FV2A 2P23A 1V6KA 3VDAA 5FUPA 5LZ6A 1W90A 2YY1A 3E5UA 4FPOB 1XE0A 4RQPB 5FXXA 3BAVA 3WW1A 3LA3A 2AEZA 1HB4A 3H7YA 5LBFA 2ZGRA 2WFF1 4AVBA 4OUMA 4K7JA 3JQWA 4X8NA 1OT5A 1DZTA 3MUZ1 3B3QE 2VOVA 3R05A 2D40A 4LE3A 2R043 1FMD3 3EYPA 4Q4W3 4CDUB 3AX4A 1F4HA 4GKYA 2RM23 4CEWC 4HPKA 4QB6A 4V2WA 1AXMA 4HKWA 2ZS6B 1ZRRA 2WO2A 1FWVA 2QUOA 4LHKA 3HOBA 3JCIA 1UD1A 2ZGNA 2FZ2A 1GNHA 3H6SE 2DS0A 4QO3A 1AXZA 1LJ7A 2RM21 3WMUA 1SMVA 4S2HA 1W6PA 3KT4A 4UAPA 3PMSA 2IHOA 3FN9A 1BQPA 5A3NA 4B8EA 2BFUS 1BEV3 4CDWC 3IBMA 5C8CA 1FAYA 1A8MA 2HWF2 1Q04A 1BLDA 1DYKA 1F2NA 1KFUL 1RUC2 4BK4A 2RVAA 6I1BA 4PI2A 1VCLA 1VBC3 1AR72 5BXXA 1DGRA 5FP3A 2OW4A 5FY1A 3USUA 2ZAHA 3NV2A 3J7HA 5C4WC 2X2TA 5D61A 3CZUA 1PO21 1WW4A 2PHWA 3WUCA 5F90A 4CUGA 1DQ1A 1RTVA 2UWAA 4R9CA 1PGW1 3GBFA 3RZLA 2XL9A 1CE7B 4LA2A 4JGYA 4QPGC 2PLV1 2VMGA 3M4FA 5K8SA 5G04L 4R52A 4XFAA 4Y5Z0 1JZ6A 3IM7A 3EQEA 4ZOTA 3H9AA 1DIWA 3DGTA 1MS1A 1MQTA 2R32A 3RI8A 4YSFA 1ZREA 3OUHA 2VJXA 4PDWB 1NXMA 3M2MA 3FGMA 1VBE1 4CSWA 3IDEA 5DPNA 1FMD1 2BNMA 2J1TA 1RUG3 5F2WA 2D44A 4P9LA 3VBSA 2JEMA 4BLIA 3BRGC 1QJZA 4FPYA 3ZXDA 4I4YA 5F5QA 1JLYA 1D4M3 5AFBA 1BLAA 1M2TB 4BIFA 1RUD2 4LBKA 2WNOA 2Q8OA 4PIZA 1HN0A 3POEA 4QGLA 3HEIA 2GC1A 3VBFB 3VL9A 4UFKA 3RZHA 3R6SA 2R0HA 3NJVA 4LE4A 3N7MA 4NHMA 1EYLA 4GOYA 4ZFYB 3D0JA 3PU8A 5FPZA 3Q8FA 1ASJ3 5FAXA 4P6AA 1KD7A 4HZFA 2NPIA 2OT7A 4B7KA 1UIKA 5GAQA 1W8TA 1O8SA 4Y4RA 4JX0A 5FIXA 2WIIB 3USSA 2WYFA 4A6OA 4HMZA 2PLV2 2WINB 5F3CA 3U4XA 1Y7BA 3DCQA 4LBJA 4I4PA 1W9WA 1YWKA 4KWLA 5DZFA 4LIUA 5CB7A 1UYZA 2YFUA 2XB6C 2JIJA 4FO9A 4RS5A 5BNPB 3M7AA 3NW4A 2BJSA 2KI6B 2WRAA 4L0PA 4O65A 3PVNA 3MF9A 1JU3A 3AL6A 3WP6A 4TLGA 4AFBA 3W9TA 2LROA 1RHI3 4NIGA 1FYUA 3WF0A 1MQTB 3WSOA 4TLFA 2C4XA 1ULGA 2BDRA 3FHQA 3HBKA 5FY0A 5LBBA 2H0BA 2R062 4KG0A 4GALA 1MVQA 2AR6A 2WNUB 5AC92 3ZFEA 2Y34A 4LIVA 5K9YA 4A41A 5CFCC 5KXCA 1HWMB 3DYMA 1RJ8A 1K42A 2DU1A 4QM8A 3RYRA 4MXVA 2P34A 3PL0A 5J1XA 1UAIA 1H2NA 1K12A 4CCMA 2VBPA 4ZZ8A 1AL23 1QIQA 1KQRA 4FFIA 2VOTA 4YARA 4IY9A 1YCIA 4EJRA 3ZXKA 3A0KA 3IMNA 3KV9A 3ACLA 1S55A 3HN1A 4YVSB 1NCRB 1W9FA 3E6BA 2ADDA 3I2IA 3NAPA 5DDJ1 3VBFA 1AVUA 1HXS2 2YBPA 2WS92 1VBB2 2RR11 3O5SA 5E88A 2JD9A 1TWEA 3HWJA 3AKSA 1SFPA 1GNZA 1W8HA 1WUVA 3BTAA 2VTXA 3B7MA 4GULA 4V2VA 4CXWA 5BV6A 3HSMA 2JDKA 4Z07A 4TTGA 3FJFA 1XNCA 3CJIA 3S7IA 3O1UA 1C8NA 4XMAA 1O4TA 4Q29A 1JT3A 1ST8A 3HR9A 3FC0A 1KNMA 2LIEA 3PLQA 5A3UA 5FZGA 3A4UA 1UZ0A 3CNAA 3T4HB 1Z2VA 1W8UA 2IZWA 1HX6A 4Q5OA 4XCBA 1RUF2 2Q8CA 4DEPA 2ZBJA 1F8VA 3WO3A 4J1XA 5JI7A 2WBKA 1JYWA 2PHRA 1X7NA 1C4RA 1EUTA 1V6JA 2OZJA 2VMCA 4XBQA 3FHAA 2WS91 4XZUG 5FZ9A 4ARXA 1RMLA 1GZWB 2V5DA 1UOJA 5IW0A 4CP2A 4Y1XA 2VZOA 3ZM8A 2ES3A 5C8WA 3RZKA 3WA1A 4MADA 2JG9C 1S0DA 4I3NA 1PNFA 3H8OA 2Z42A 4OI1A 1ZA7A 4UOJA 3WHUA 3RRDA 2ZHLA 2C9KA 3L2HA 4NAMA 3MALA 1CR7A 2OKXA 4YM2A 1ABRB 5A7QA 1QY4A 4BZ4A 1YFXA 2RMU3 4RQPC 1U0AA 3MUY1 5FMBA 2C26A 4GWJA 3JZVA 3UKVA 1HDKA 4B3NA 3DKQA 3HAGA 2C5DA 4JKXB 4FPJA 4OUSA 2KM2A 4YVSC 3UKNA 5BNNC 3BI3A 4XFTA 5IVEA 4JQRA 4XAAA 3Q9OA 3OF1A 3BGAA 1QKQA 3AKTA 2VNGA 2XMLA 2XR4A 1UPIA 5F39A 3B9IA 1JZ5A 5IAVA 3AFGA 3THCA 3NKTA 5EJ1B 3O49A 1NA1B 5GLZA 1UY2A 3NMBA 3D8CA 1VRBA 3AZXA 2ILMA 2G9GA 1AYM3 4HR6C 1PX4A 2RS11 3BUCA 4JPZA 7I1BA 5ACA3 4CXYA 1UYXA 3TEXA 3VUOA 1AL0G 4XJ9A 2X09A 1KITA 4QALA 1NLRA 1LNSA 1W28A 4DY5A 5BNPC 1IGOA 5F8SA 3Q7WA 1TME2 5C9AC 3LFIA 4XQ4A 1GZWA 1BLZA 1MEC2 4AI9A 1AXKA 3Q8AA 3MLKA 1N1TA 4F3JA 2J42A 4P14A 4F8AA 4M3CB 1J3RA 3M3OA 4BJ0A 4A44A 2D20A 1VIWB 2WABA 2Y60A 1AVWB 4IEWA 4O9EA 1DQ4A 1RIRA 4QU2A 4CDXA 3AMPA 1OLME 1V00A 1RVF1 2DU0A 1Z0HA 4RD7A 4XAEA 5CBLA 3H1MA 3ZSEA 2IXIA 2FD8A 4GAIA 3BAUA 2A75A 2D7FA 4H3WA 1R082 3LEGA 3RZZA 5BP5C 3K4AA 3VKFC 3H1WA 4XUTA 5FZ7A 1N4KA 4WBBA 2I2SA 2VTXJ 4CCEA 2Q1MA 1CZTA 2AAIB 3WNMA 1QQP1 1ZYBA 2EXHA 2Q5TA 3LPGA 4LHLA 3AZZA 1GOGA 1QNWA 4IV3C 4R4ZA 1J1TA 2KD7A 4OFGA 3GM8A 1MR5A 3T0AA 5JMCA 2XOMA 1OHFA 2IFRA 1V0AA 2XONA 2BQPA 2G4IA 1FPN2 5FYBA 2ERMA 3D6EA 3MGUA 1LEDA 3CBNA 2DFBA 2JECA 1VRH3 4A7ZA 1D7PM 4TYSA 4NAOA 1JN2P 2HEVF 4IZXA 2Y6KA 1DYOA 3CA3A 1QOOA 2EIBA 1TME1 1XG6A 5K0UA 1QJX3 4FAGA 5FMOL 4CYDA 3CAHA 1IKQA 1O3QA 3CJXA 1W8OA 1AYN2 1TP0A 4HLTA 3CL1A 4PHZA 4TXWA 4BQYA 1ULPA 3NNGA 1GBGA 2R6QA 4AHZA 1RG8A 3S6PA 1ISZA 3AJZA 3POBA 3BAQA 3C2UA 1OKQA 3FZ3A 1VALA 4QC4A 1OD5A 2CSGA 1O4YA 1ULFA 4M0HA 3SH3A 2HWC3 1QJY1 1RITA 2AACA 4CCDA 1GP4A 4LJHA 4C91A 2JWPA 3NWKA 5FQ0A 4R8HA 1EAH1 2BYVE 2R49A 5C3PA 5BNNB 4IE5A 3HALA 3K77A 3D4KA 2CAVA 3E6CC 3N7JA 4COWA 5T52A 3C7HA 3KSCA 3U37A 3ZR6A 5CKNA 1G9AA 5IK8A 5J96B 1BFGA 2MEV3 3U07A 5J98B 4B1MA 3FJIA 2PMWB 4YW5A 5JOZA 2YYOA 4RR3A 3K4ZA 4GP3A 4TLPA 1WMDA 3W58A 5F8WA 1QWRA 3SH4A 3TYJA 3U75A 4QDSA 3RSJA 2DUOA 1JU4A 3WF1A 2B39A 4XF3A 4Y20B 3ZN6B 2GP5A 4X37A 3I2FA 5FO9B 1YBIA 2DVBA 4PLMA 3LKJA 5A3TA 3NV1A 3GALA 2D98A 3I3BA 5KXEA 2D6OX 3APBA 1I1BA 4CU7A 2UU8A 2W08A 1QEXA 2OQ7A 3UD8A 1LOFC 1YI7A 5H9SA 1CN1A 1K45A 5DAPA 1HJFA 3J9SA 2P3YA 2ZX0A 5IYYA 1LOAA 4AGVA 3AKGA 5T5LA 4QBCA 4O7XA 1K5MC 4JC1A 4N7UA 4CEWB 3TN93 2L5XA 5ABJB 1UIJA 4Q27A 1CVNA 1RUI3 1YJLA 2E53A 2GNTA 4YM3A 5KWRA 4LT5A 2H0VA 1JUHA 3MPPG 4HK8A 3W21A 3GF6A 5FZ3A 3I49A 3I3EA 5IK7A 1Q43A 2HWB1 2ZGOA 4LO0A 1BXHA 3P6BA 3SCFA 1FNZA 4FVVA 3W9AA 5D8AC 2XWJB 5F3EA 4EWDA 4QXCA 5FZUA 2YROA 3VBUB 3ZFEC 5FYSA 5FOJB 1TMF3 1JHJA 2DVGA 1H1MA 2E51A 1PGL1 1W2OA 4HSLA 2V5YA 2WL1A 4DPNA 4EE2A 3AP7A 3WG4A 4XC9A 3VBHC 4W65A 3NAPC 1REFA 1SBEA 5LBCA 5FP8A 3O0VA 4YM0A 4AEKA 4X3AA 2XJPA 4XPVA 4YYOA 5A6QA 3QBQA 4COYA 2HWC1 2WR9A 3BRDA 1LGNA 3U1XA 3VHPA 3MPBA 3OPZA 3ZSLA 1GNYA 3O4OA 2QQNA 3BALA 1YQ8A 4IESA 5D8AA 5J48A 2RJKA 3NRUA 4Q0UA 2YBSA 1X9PA 2RS31 2W2IA 4XUQA 1AR62 3B94A 4K40A 4QQ2A 3DPRB 1IRAX 2BFUL 2MEV1 1ASJ1 1GZ9A 1VPHA 2QJVA 5IWFA 1CWPA 1ONKB 3RZMA 4IEVA 2VUAA 5DUUA 1WMEA 2ZA9A 5CG8A 4ENDA 5BOWA 2H6BA 1NKGA 5IVFA 5ABJA 1CAXA 1ALYA 1LOBA 4GJYA 4XFFA 4NIDA 5KC5A 4II0A 1BJQA 3NBCA 1CESA 1EP0A 3WINA 2RG4A 3RNSA 2UUSA 1DLCA 1J58A 2JE9A 4AVVA 1PMIA 1WZXA 1L7RA 1YQCA 2WQ8A 2IVJA 4PT6A 8I1BA 1XOYA 2B9VA 4QX2A 4GQ7A 3JRRA 2FCVA 4KMQA 4A6SA 2B5HA 4CP0A 2ETEA 4F34A 3KHBA 4XDOA 2HWD3 1SZBA 3WDXA 1FMZA 2WDBA 1MACA 3N36A 2X5IC 4NVPA 3VN4A 4Q4X3 1KEXA 2JKXA 5FK7A 5JCTA 5IHRA 5HPZA 4PLOA 2CY6A 1WCKA 4IEYA 1S0FA 2FHRA 4EN8B 2XOAA 4Q0PA 4RYDA 3VLBB 4A4AA 4OW4A 5FP9A 4LKFA 2GNBA 3DEMA 1NZIA 1ULDA 2WN2A 1RUD1 4DUVA 1GZTA 4LNVA 4Y33A 4AG4A 2NN8A 5A6ZA 3RZJA 4LXLA 3ZVXA 1TNRA 2XKPA 2QDRA 3W5NA 3KM5A 2BGCA 5EIYB 1G86A 4UXAA 4AFMA 1HRI1 2VZQA 2RS13 4QD2A 2V73A 2WZR2 2ZGUA 4IEXA 4LTAA 5FMCA 4BA6A 3VBHB 4GOVA 2VOKA 2ZKNA 3K51A 5K0UC 1JOPA 1CAXB 3AKIA 3OEBA 5L7OA 1R1A1 5JOWA 4QPYA 4D0QA 5JXJA 3A21A 1L7QA 1OOPC 1YQ5A 1WCUA 3RS6A 4XJUA 5CADA 1CX4A 1DG6A 5EV7A 3ES1A 5CYYA 2LALA 2QQOA 4ES9A 5FXWA 5T50A 4D0ZA 2XQRA 1X50A 4OEFA 4KBBA 4IV1B 4AI3A 1TFMB 4LKSA 3ZXAC 3W59A 3HT1A 3WP4A 5FZLA 4AI8A 2FFUA 3WDWA 1MS9A 1OFSA 2GH2A 4XFCA 2BEBA 5EYYA 3AVRA 1V6UA 4FXKB 2G19A 5E1RA 2VOXA 3FBYA 4GKXA 1UMHA 5CG9A 3W20A 1S0GA 2YGLA 4CCKA 1HB1A 3BAGA 4M3CE 2VVFA 3ZDVA 5L73A 4AHYA 4LO7A 3BADA 3O5WB 5ANQA 3QYDA 4Y1ZA 4Q4V3 1ODNA 2IXJA 2HWE3 1Z7S3 2JB4A 3MDPA 2FCUA 2XUMA 4IV1C 4M3CF 3UK9A 1JY0A 4Y4YA 2FBEA 2VQUA 3CEWA 3FE5A 1YHFA 4N8MA 4E8DA 1W6MB 3B00A 3T09A 1BBT2 2ZJCA 2QKDA 3POSA 5F37A 1WD3A 4QGMA 4Y1YA 1SHWB 4GB32 4RGAA 2Y33A 3T2OA 5FZ4A 2VSAA 3ORJA 4IEQA 5KR7A 5EC5A 2XVLA 5GZFA 1KJRA 1IOAA 4LPLA 3SNMA 4QXKA 1TZOA 3VBSB 4BM8A 4XABA 4ZS2A 2Z69A 1OUSA 1SLTA 1WA4A 2ZMLA 4BOWA 4OUEA 2RJLA 2GN7A 4Q1RA 3UT0A 1AVAC 2VO5A 2ARXA 1COV2 1R081 1O3TA 5T55A 1GOHA 4DFSA 1OBNA 4E4SA 2WA4A 2ARAA 2DWRA 1JT7A 4BCUA 4J2SA 2JDUA 1T6BX 5K4LA 3KF3A 3KLSA 4LBQB 3QH6A 2GMPA 5JAXA 4EKXB 1PUMB 1UU6A 2VXTI 2BEOA 4MLOA 2CDOA 1R1A3 1W2AX 4WM8C 4RN5A 5AVAA 3AKRA 5JUVA 3NNFA 3ZSKA 4MGTA 2G9ZA 1YC61 4K1YA 4Q4Y2 4QPWA 4Q4W2 1RUE2 4W6WA 1N3PA 1EYBA 4J2KA 4URAA 3AMHA 4W4ZA 4LO7B 2AUYA 4ZA3B 2O8OA 3ZYGA 4GMP0 2ZEYA 1OH4A 2JG9A 5E8AA 5FY4A 4C90A 5A1LA 1AZDA 2BTVC 1PIV1 1UO9A 4GH4B 1WBLA 3JBG1 1AR93 5BY5A 5F7UA 3AP9A 1HJGA 1PIV3 5A80A 2NMOA 3RJRA 1C5IA 5E89A 2E9QA 1UOBA 2VTFA 2W46A 2IXCA 1HN1A 3MEPA 5JR7B 3BKZA 1YI9A 5C9AA 4EFQA 2VAUA 3Q8EA 1BK1A 5J7MA 2GZBA 1WW7A 4G6MA 2BVBA 3C7FA 4NIAA 1VBA2 1PMHX 4BH9A 2E32A 1POV3 4LQRA 3MZHA 5JXHA 2D5FA 3VBRC 2XBO3 1VMJA 2BNOA 4YNIA 2UYAA 4Z9WB 1RMU2 3H42B 1QQKA 1BA7A 1C28A 3KGLA 4MO3M 4B29A 3BA5A 1OPMA 1PHMA 2XDVA 1OOPA 4GA9A 2J1RA 4INDA 4JV4A 3OSDA 4N53A 2A6XA 2HWAA 1VAMA 2NLRA 1PO22 3D7WB 1IZ3A 3IAGC 2X29A 1DGRN 4GJZA 4XOGA 3JB4C 4QKNA 4R9BA 3WDUA 4AK3A 3PJQA 2TUNA 5FZZA 4AGGA 2XXZA 1OI6A 3I2GA 3QD6A 1GZCA 1CVSA 2VMIA 2UURA 3O0WA 5FY5A 2G1MA 1MPXA 3T2PA 3OBTA 1CONA 4PF1A 4B1LA 4COVA 4LBOA 1SFYA 3I3MA 1MS8A 1PZZA 3NJ5A 3PUBA 1IKPA 2JG9B 4RL7A 1ZBA2 2HBTA 1W3GA 5FLIA 2G9FA 4WZFA 2VXRA 3ACHA 5A32B 5CAZA 2P39A 1ZRIA 5FZEA 3VBOB 1ZRDA 3AFKA 3WNOA 1OQLB 3UJ4A 4HVRA 1EV11 3PUHA 4YVWA 2P4EA 4D6QA 3KQRA 3T1LA 2ZAAA 3ZLIA 3U0ZA 1NZKA 2WO1A 3B93A 3FUQA 1GICA 3C3VA 3AXEA 2B46X 5FYTA 1II4A 4XF4A 3OUJA 3O1OA 5JMOA 5KHKA 1KXGA 1ZM1A 5EJ3A 5LASA 1HRV2 3KB5A 4DY3A 1GWLA 5E16A 1T6GC 4CP9A 2F17A 1JT5A 1UN1A 4M0NA 3UDAA 4DUXA 4EB2B 2QQLA 4DXRA 5FY8A 3IAPA 4OMDA 5JSRA 4G1RA 3EJKA 2NTDA 5FYMA 4BMEA 3LE0A 2CL2A 1TIEA 3Q8BA 4XMIA 4AOCA 3R4DB 4W6YA 3JU9A 1OOPB 4LLOA 2OQ6A 5AC93 1W8ZA 1ENXA 4N53B 5A70A 5JSPA 2CGPA 5DZGA 2JJ6A 1PO11 4XBNA 1NLSA 3AKPA 4E4DX 2RDNA 3I7DA 5KHIA 2XJQA 1LAJA 1BVP1 2ADEA 1AL22 3VD9A 1DQ2A 4QU1A 3LOIA 4H55A 1O5UA 1RUH2 4QPIB 1ISVA 1PVC2 1SLLA 2VQ0A 4FTSA 4IHZA 3IDBB 1LOCA 4ISQA 1VBB3 1HV1A 4FTEA 1YFWA 3WDYA 3S30A 5EQUA 2AC1A 3RGBA 2I1BA 3RTJB 4QKRA 4MGKE 4P9WA 2DREA 3LIGA 1IPSA 2PHFA 4WBCA 3F95A 1UZZA 4IE0A 1EPZA 1RINA 4JGYC 3DN7A 4QPGA 5DG2A 4YVWB 1W6QA 3O0XA 3WW3A 1BCXA 4D7SA 2RSTA 3MIGA 1AJOA 1V9U2 4M3CA 3WNNA 3DXTA 2QNKA 2WWJA 5FPVA 4E2SA 3CU1B 3I29B 4YG6A 5JWPA 1IQDC 2XVGA 2GC0A 2VNVA 2GC2A 1UZYA 1V6NA 4OHZA 1KS5A 2GDFA 3QCWA 3PHMA 3LB9A 4ATEA 3M3EA 5HV4A 5LA2A 1SACA 5I1BA 1PZ7A 2GNMA 4LO6B 3AYAA 5G05L 2HZ9A 4AVSA 2Y6LA 1X36A 1UZVA 4G9SB 4L4HA 4PC4A 5LY1A 3B9CA 3OBRA 2K2SA 5BVPI 2HYXA 4AF9A 3N3HA 3UGGA 5C3QA 1JZ3A 1PZ8A 3BOWA 1RGSA 1RY7A 1IT0A 3WY6A 1HQLA 1LHOA 4XFGA 4AI1A 4LO4B 4YZ1A 1GGPB 1G8WA 5HCHA 1W2TA 2WT2A 2Y6JA 3ZDSA 5J37A 1TOOA 4UW4A 2UWCA 2PFWA 2RS33 4QX1A 4E27A 1T2XA 3CJIB 4NOTA 4XFBA 3TBDA 1D0GA 4AI0A 5FZMA 1NAEA 1CAVB 1H6YA 5FKCA 1RVF2 1W6OA 3NV4A 3GYDA 5A7PA 1NG0A 1LOEA 4OZXA 1QMJA 4QPIA 4AEMA 3WV6A 5C7GA 5JI9A 5LA1A 5FMDA 4OI2A 2ZGPA 3LEMA 1NQDA 2YUEA 1UCXA 4FI9A 1V9U1 2VOWA 1PK6C 4LHNA 5J3UA 1CGPA 4MGZE 4OWLA 1IS5A 2JDHA 3AYCA 1WGPA 5IVYA 5F5CA 4I30A 5FZFA 4C0BA 4AN6A 4ZFUB 2ZR1B 1VBD3 3MBWA 4ZY9A 4DO0A 4ZXEA 5AFEA 1N3OA 2ZGSA 4FPHA 4GAZA 4QPGB 1QQP3 4LITA 3KVAA 1XNDA 2SLIA 3T3YA 1OA2A 5FREA 4LO3A 4FFFA 4NN0A 3CA4A 1QGLA 1WLCA 1L3JA 4CUCA 1CJDA 2DTWA 4ZONA 2RMU1 1MS4A 4EN6B 1SCRA 1VP6A 2A6ZA 1S1AA 3ZKYA 1UYPA 2NP0A 3POGA 5DN2A 5DQ0A 1FWUA 4J2XA 4LORA 4E9KA 5FDBA 4JRAA 4RGKA 4YW2A 3UJQA 5B4NA 1HIBA 3AKHA 5DDJ2 5FJKA 4CDWB 1BFBA 1A3KA 1SEFA 1ZNPA 1XNAA 1TME3 4K1ZA 4KWUA 3FJKA 3AH1A 3M70A 3LSDA 2R073 4LO5B 2B45X 3JBG2 5D21A 3B69A 3VZLA 5A1AA 3PVOA 5LRSA 4XF9A 5HV0A 3ZYRA 4N43B 4QPIC 2YGMA 1AF9A 1J1LA 4PQQA 1RUJ3 2F2FA 3BB2A 4CDUC 3H0OA 1HWNB 1DQ0A 4I4XA 1NA1A 1XE7A 2R1BA 1KDMA 1XPWA 1IS3A 1NT0A 4I37A 1U5XA 4PI0A 3FX3A 3VWCA 1H2MA 2BV4A 5LA0A 4NIIA 3PIJA 1ISWA 4JP0A 2W87A 5K7PA 4YZ3A 2D93A 4LHSA 3OEAA 5FZOA 3VKNA 4I0AA 1POQA 4I2SA 4BU2A 3U11A 1DZDA 2DV9A 2QQWA 1LULA 2F2FC 2AENA 3PMEA 1ZZBA 3I3DA 2VNOA 2NMNA 2V72A 2DVFA 2Y6GA 3EHKA 3BTZA 1BK0A 3CRIA 1R092 4XXAA 1VRH2 1W6NA 4DEQA 2OIIA 4GWMA 1OF3A 4ZHNA 4CDXB 5FP4A 1M4WA 4W8JA 3GBWA 4OEGA 3I97A 1B35A 1UWWA 3V0BA 1MVEA 4HN1A 2DCZA 3SXWA 4Q9GA 4Y5SA 5FYZA 3OYWB 5DUVA 5F6KA 3JD72 5JZGA 2VCBA 3J8F3 5IJRA 2XGXA 3HBZA 4UBGA 2E31A 4MXWA 4G9NA 3UD7A 3AZVA 3VBOC 4GWIA 4BQ1A 1HRI3 1XYPA 2KLLA 4ONUA 1C57A 2H6CA 4R9AA 4YZ2A 2EXJA 4P9XA 1OFNA 2JIGA 4PIYA 4QQLA 3AYEA 3NO8A 1S0EA 2WFF2 5D2AA 5LBEA 2VZ1A 5FYVA 2A3XA 4I4SA 2EXIA 2AYHA 4PJYA 1PM7A 2VMDA 3NVCA 3BOPA 3R4UA 3E5QA 1X9TA 4L2NA 1HKNA 5EFUA 2PTMA 3WXPA 2QVSB 3MIEA 4FQ4A 5I0SA 3O1SA 1ZBE3 4K3UA 4X6RB 4I6IA 1H2LA 3M3IA 2VR4A 2ORXA 2NYYA 4EV0A 4KGQA 1BEV1 1JOJA 1GV9A 4CDQB 2R0FA 2LS6A 1HQNA 3X29B 4XJZA 5GKAC 2C1FA 3JD71 4Q4X1 5JSOA 1WLDA 4TWTA 1NCQA 2WZEA 3MFAA 3DXUA 3OGJA 4HG6B 4C1XA 4D69A 1PWAA 5C3OA 2HWD1 4RHV1 4QXHA 3NNJA 3WW2A 2RS51 3W5MA 2XUEA 2AQZA 3R0RA 2CDPA 2CHHA 4JKLA 2DDUA 3THTA 2BRTA 4IV3B 3OGRA 2AH2A 4MGIE 4WM7C 3AH4A 2P3KA 3WNPA 3OY8B 4HKOA 5BNNA 2QBXA 3ZYIB 2VM9A 1AR91 4UFLA 1ND3A 4KEIA 1HV0A 1OSGA 1S0JA 9ILBA 4O61A 3L9JT 4NHYA 4YGCA 3WF2A 3ZYPA 1JH5A 1KGYA 2EIGA 3NJYA 4XQWA 3UETA 2QN4A 1RUI2 3ZX7A 3ES4A 3AVSA 2VCAA 4FP3A 4WM7B 2A1XA 2JG8C 1X33A 2VE1A 2BBAA 1HRV1 1GYKA 3LOBA 4OEEA 3ZXGA 2JG8B 4XFIA 1W05A 4WVMA 4Y20A 5I91A 1OLQA 4LO1A 1Q8OA 3AL5A 4UYBA 3LF7A 1E5RA 4J2YA 4QX3A 1Y9QA 4YFWA 4E4ZA 1LECA 3H3LA 5FV3A 2R1DA 4UW5A 1VMFA 3ROUA 1W0OA 4AVTA 4CXXA 1SR4A 4ZS3A 3CA6A 2RR12 4IETA 3T8SA 4D6RA 1URXA 1GLHA 4XYXA 2Q1FA 1RB8G 3UGHA 3LWCA 5D62A 3H6QA 3LSEA 1RYYA 4K8RB 5JPMB 3HNBM 1KFXL 4UW3A 3VZNA 3ZSJA 1I9RA 2ZX1A 4LBLA 1QJU2 1ND3C 3MLLA 1RUI1 5ACA1 2ESUA 1YRZA 1WMFA 4Q8LA 3FJEA 1Y3TA 4NJ4A 1E5SA 1U5YA 1MC9A 1AX1A 1OLRA 3VZKA 2PAKA 1UX7A 5B2HA 2C0ZA 1Q5OA 1WW6A 4RGGA 3WF4A 3BAOA 3AK0A 1QH6A 1HLCA 2BGPA 4MGYE 1O6UA 4AHWA 2BGOA 2JDZA 3D5OA 1AXYA 2PXJA 4BK5A 4G9MA 5FWEA 2IC1A 5FZ6A 2J3PA 1IG3A 4AQ6A 2HWF1 3HIFA 1T4QA 3DUIA 5GLTA 1QNYA 2DCJA 5FP7A 2ZX2A 3N7KA 1OA3A 2P6CA 2FDIA 5BYNA 2R042 5LEKA 5A33A 4EN9B 2RM22 1JMUB 3I2JA 3KV6A 4LO1C 3AMMA 3GBGA 5EYXA 2FDJA 4HBNA 5EWSA 2FDKA 4DCKC 1LTEA 2EF6A 4JRLA 1OURA 5JDBA 3O4BA 3CRHA 2JG8A 4X39A 3WNXA 5JOYA 5KHHA 1K5VA 4WVMB 2J7MA 5FPXA 3AJ6A 3ZC8A 4I09A 3VZJA 4QX7A 1BEV2 4LBMA 3TNPB 1TWMA 5HXVA 2ARBA 2GC3A 3N9LA 2NVHA 3TN91 3P1IA 2DURA 1DLLA 1TVGA 3CF6E 1VBC2 3SKVA 4Q4X2 4ASMB 1O59A 3UNPA 4LMFA 3QACA 4CZSA 4USPA 2ZEWA 4LO2C 3I8TA 2GN3A 2E6VA 3HQXA 4OI0A 1WBFA 4JDMA 3AJYA 1OKOA 4ZKTB 2ZQOA 5I8TA 2VPVA 1SFNA 4HONA 1PO13 3OUIA 1K5UA 3BU7A 4ZGRB 3A22A 1R64A 4R4XA 5I8SA 2VNRA 1XC6A 2WNVB 2ENRA 1CZSA 2JKBA 2VECA 4JHZA 4KWJA 3WO4A 3K4DA 1Q8PA 1ZZ7A 5FXVA 2FMDA 3VL8A 4EZHA 1NE6A 3CO2A 4O9GA 4HPKB 3RFRA 1AVBA 3AKFA 2WZR3 3SMHA 2ZMKA 4LBQA 3ETQA 2ZMNA 5FBZA 1W9TA 1DZRA 1WLWA 2DVAA 3C8XA 3S57A 3LCPA 3LD8A 4OLLA 1D4M2 4U36A 4HA2A 4IW3A 2RG9B 1OD3A 4N7IA 1ND2C 1RUD3 2P2KA 1G9CA 3PVEA 4HL0A 1SBDA 5HBAA 3CA0A 1C1LA 3OB8A 3USUB 3BVCA 3UJOA 3MV01 4CCCA 5DABA 5LB6A 3OGGA 5C8CC 1MQTC 3LLPA 1J3PA 3KV5A 1W0NA 4GXLA 1OMIA 1CJPA 1COV1 1G7YA 2GMMA 3FFZA 3POIA 4Z82A 5GALA 4IY8A 1H9PA 2LIQA 1VBB1 4W6XA 1AJKA 2D23A 3UESA 5IT6A 2W91A 4JKMA 5CA6A 3D3AA 3OD0A 4I7IA 4TZDA 4LUKA 1QJX1 3IB3A 3K3OA 5FYHA 1H1IA 4DRRA 5KHGA 5LW9A 1JOBA 1FOD3 1AX2A 1N1SA 2FCTA 1WWYA 4GMP1 1NOVA 4HANA 4I3GA 4YM1A 3SC7X 1YYNA 2XG3A 3FJSA 1ULEA 5T3NA 3WLUA 3I2OA 1O3RA 4AAXA 4KWKA 3ZN5A 2DCKA 1JYNA 2W92A 1AYM1 1I5ZA 3POJA 4UF0B 2RHPA 1NLQA 5ISLA 4XHBA 3MIFA 2DBIA 3PUIA 4QT6A 2VC9A 1RHI2 1YNAA 4CP1A 1U5IA 1DFCA 1W2NA 1FMMS 1K3IA 3WO2A 4Q4V2 4XUNA 5B4XA 5DUWA 2R063 2W1SA 2WN3A 3KZ4C 5FZAA 5LK5A 1O7FA 5M0TA 2VU9A 2RDRA 4B4PA 1S0CA 1V6XA 4Q8KA 4BWOA 5A3PA 4XIOA 3POWA 1AUYA 3IAQA 1ENQA 4AQTA 4LOSA 3LIHA 4FPCA 3HBWA 2R7EB 4IV1A 4YW6A 5I0TA 3E97A 4AFAA 3AH2A 3TAYA 5FRAA 5JIUA 4XXPA 4GIQA 3PHZA 3GXUA 1QJY2 1NUKA 4ZU4A 3WG3A 4DS0A 3OPTA 1JYTA 1XU2A 2XJUA 3VV1A 4NHKA 1S4CA 1GWKA 3MLJA 5FYUA 3MFCA 3MHZA 1IHMA 3I2HA 1CIWA 1XRUA 2E7QA 2RS52 1EV13 3NKGA 2VL4A 5BNPA 1MZEA 3RZGA 3JUTA 3LDRA 3WNKA 1J59A 2Y38A 3ITQA 4Q9PA 2CU5A 3KVBA 4MV2A 2RDQA 5BXPA 1REEA 2A6WA 3DYPA 2W47A 5JIAA 4GB31 2YBKA 3I2AA 4V1PA 1R1A2 4PBOA 3ZPYA 4CTEA 5BXSA 4I1EA 4XKIA 1OC1A 21BIA 4L92A 2BWAA 1CPMA 2VW1A 2W52A 3CU7A 4LUMA 2KKIA 4LO3C 4UBHA 3VBUC 3ZFEB 4LO8B 3C7EA 1QU0A 4FPFA 3RI9A 1QOTA 2QQMA 2WT1A 5FZBA 2Y9WC 2UYBA 2XLGA 3VT2A 31BIA 1BBT1 2WKKA 4CP9B 2W68A 2WAAA 2E26A 3LEKA 4I96A 4HOOA 4D3WA 1N47A 4KI5M 4L8QA 3ZFGC 3BU0A 4JGZA 3SISA 3LA2A 3NV3A 2GZWA 3J26N 4L9BA 3ZXFA 4I0YA 2BZDA 1VJ2A 2VW0A 4P02B 4P0LA 1PIV2 1RUC1 3WD5A 4QDQA 3EMRA 4D7TA 2W9XA 5L9BA 1ILR1 4I3PA 3IM0A 4QMAA 3N9PA 3LEIA 1LESA 2CTVA 1H8TC 4DB5A 4HT1T 2WAOA 4ITCA 2AZ5A 3T08A 3T2QA 1C5HA 2WWSA 3ACFA 5I8YA 1FXZA 1E5IA 2OPKA 1JLXA 2PQSA 4MX3A 3VHRA 3WINC 3SKJE 4FPLA 4JDOA 4CUAA 2B8MA 3V64A 2E4MC 4AWDA 2WUHA 1RMU3 1NY72 3GDBA 4HKLA 1PM4A 1XYFA 3VT0A 3AP4A 5DAQA 2WT0A 2YU2A 1S2EA 1W8WA 5DSSB 4XILA 4I4UA 4XF0A 3VDDC 5DUYA 1JI6A 4IERA 1RMU1 2EXKA 1LCLA 2JE8A 2Z79A 1GUIA 1W3FA 1DFQA 2GALA 4ISRA 2E63A 4XDQA 5FK8A 1RZOB 4A7YA 1YIPA 2XHNA 1V6MA 5HXMA 5CKQA 1C8M1 3URFA 1CAWB 1R8OA 1Y4WA 2D6LX 2YXSA 4QX0A 1F15A 4LEJA 2ORZA 1MEC3 3FUOA 4R9DA 3SEPA 1H2KA 1I1EA 1GR3A 1GU3A 5BXRA 2W94A 1UNBA 3E1F1 2CNAA 4YLZA 3BX1C 4MYEA 1OQ1A 4Q1PA 3O1PA 1VAKA 5A6XA 5CFDB 4JGZB 2VG9A 2HWF3 3VBRB 2IWTB 2RDSA 3O3QA 3VKOA 4KU8A 1FATA 4IE7A 2VMHA 3Q8CA 1NE4A 1K5MA 1I5PA 1W9SA 1X8MA 2ZOEB 3FJ9A 1XU1A 4YG0A 2WYSA 5FZKA 1Q8SA 4OYUA 4RFT0 5FNWA 5CNAA 3WMVA 2Y6HA 4IEUA 4YW4A 4AZZA 5GZEA 2P37A 1XNTA 4LA3A 4CU8A 3IKWA 4AXOA 5A3OA 3TEZA 3WP5A 1QJEA 2K46A 1GQGA 1UMIA 3MIDA 4NE9A 4MSVA 1UMZA 2QTWB 5FFOC 4PCRA 4HK9A 3TWIA 3ZFFC 1YJKA 4OQ8A 4FPEA 4YRDA 4IEOA 3EBRA 1UYYA 1QXRA 3FHIB 1LEMA 4Y22A 5A32A 1G9FA 3J4UH 5IVJA 2HWE1 2Y26A 4M00A 3RWKX 2PQQA 4FQZA 2VUJA 1AR81 4BXSV 4AEDB 3KV4A 4RHV2 3G7DA 3P3PA 4UFIA 4D8HA 1D4M1 4BQWA 3AJ5A 4AHXA 3FJ8A 2DYCA 4Q2FA 1CAWA 1LB2A 4QGNA 3WVJA 1QDCA 5C70A 1D2QA 2RJ2A 3RVHA 5F3GA 2VUCA 4NIHA 2D3SA 3CZJA 3GZEA 1A6CA 2I07B 4ARYA 3H8RA 2ZZQA 2Y64A 1J84A 3MYXA 1ZZ6A 2KH2A 4RR3C 3NSTA 1E5HA 1N1YA 2CYFA 2V09A 3IPVB 1W9YA 4WM8A 4XHXA 3NAPB 4HFSA 2O0OA 3V56A 3VBRA 3S5QA 4JAWA 4MHUA 4LO0C 1SBFA 1D2SA 2PLV3 2QQJA 4D7YA 4SLIA 4ASLA 3WUDA 1MZ5A 2ZEXA 2VZPA 3KCXA 1V9U3 3CHXA 3KHCA 3VD7A 2MEV2 4N43A 2EVXA 4NHLA 1PUUB 2VSEA 1O5LA 4A45A 4CCNA 1J0SA 5APAA 4X6QB 1NUNA 3IIRA 2X53S 3SLIA 3GJBA 2D24A 5JLVA 1TG7A 2JB8A 4QXBA 3NNLA 2ZGKA 3NQHA 5C5TA 4QKDA 2J1UA 3AZWA 3F62B 4JQ0A 2XLFA 1ISYA 1UU5A 3VEQA 1MD6A 2P5BA 4YZ4A 1YFUA 4Q4Y1 4Y22B 5FMOS 2DBNA 3ECQA 1YF8B 4ZXKA 4HN0A 2D22A 1E0OA 5FPUA 4LBQD 3ZYFA 4AEDA 4DRVA 2CWMA 2FDGA 1VAVA 2YHJA 3A7QA 1HKDA 2OPWA 2LUWA 3E8LC 3WHTA 1VBE3 4Y24A 3AP6A 5BXTA 3PDQA 2WS93 2HLEA 2VVEA 3FLRA 2HWMA 4QX8A 5F8YA 4H14A 4FGFA 1A78A 3BIWE 3Q7YA 3LDBA 2BVVA 2LTNA 5SV8A 1YQ6A 5JZGB 4NWVA 1H30A 1HXS1 2PN5A 1H9WA 2J1VA 5GZGA 2KR2A 2ZTNA 4OMCA 1UQXA 3PVBB 4UFMA 5DUXA 4XFSA 1TMF2 3CA1A 4FAHA 1AR61 3LDKA 5BNOC 4MH0E 4OWJA 4K6BA 2VD7A 2Q8DA 2ID4A 3NBEA 2BOIA 4ORFA 3SHRA 3GHNA 2WQ4A 3OGVA 2D3RA 5FTTC 5CU1A 3HD8B 4IE6A 4URTA 1WCDJ 4YPJA 4EYUA 4OHYA 1XNBA 1PGSA 5DDJ3 3T1MA 2HKXA 5IVBA 3SQOA 4DXZA 2BU9A 3BA4A 2Z5WA 1O4ZA 5FZIA 3I3QA 3GJAA 4BQ3A 4XACA 1CIYA 2P3IA 4CEWA 2Z4FA 4BB3A 3CIHA 3MICA 2MPFA 1AR63 3CKHA 1P8JA 3JBG3 1REDA 4NRMA 4UW6A 3S0MA 1NCRC 3MV11 2HYKA 4Q4W1 1AX0A 3IZOA 4IGQA 2XWBB 4IGOA 3HPNA 3FLPA 4YW7A 2ZQNA 4I02A 2RMU2 1RUJ2 4A42A 2PHDA 2PELA 3WOGA 3I2XA 3OBZA 5GLWA 4Q0VA 3BPZA 4IV3A 1OUXA 1SZ6B 5JXIA 2BNNA 3J7MA 4BIOA 2HJIA 3BIEA 5FUNA 4AFDA 4P00B 2J1AA 2XVKA 5T5PA 3UL2A 3RYKA 5L7OC 4IYBA 4MUVA 5FNXA 4XZPA 2IUWA 1FOD1 4D0TA 4S2DA 3T4VA 4LBNA 3PG0A 4A2UA 1SLAA 3UJ0A 3BODA 2A6VA 2Q3NB 4KBZA 4AW7A 3NBNA 1FPN1 2WO7A 3KCCA 2HWD2 1BFFA 4W50A 4E4HA 4ZZ5A 1E57A 3U4SA 1C1FA 1FGAA 3TOJA 2K8RA 3WR0A 1OXCA 1GWMA 3POFA 4NO4A 1UXZA 1H4GA 3TEWA 3D82A 3HVDA 3C7GA 3PU3A 4I0WB 1N3QA 2JD4A 1XNKA 3V65A 4XW3A 4HSJA 4I0BA 4ATFA 1DYPA 4OQ9A 2ET2A 4A3XA 5T54A 3ENRA 3CJIC 4KNCA 4XEZA 2WC2A 3WF3A 1NZCA 1DDLA 3NJZA 2CAUA 2QQUA 1HRI2 2I45A 1R091 2I74A 2D7IA 2P1BA 2X5IA 4OVEA 1W8FA 3O12A 1AFCA 3V0AB 3VBFC 4DOUA 1YTOA 1CZVA 2HEYF 4YGEA 5EG6C 3BYWA 2PHTA 1RUG1 3ALQA 1UW8A 2RS12 1QXPA 3MO4A 3J7NA 4AVCA 3BRFA 1TE1B 1DZCA 1R083 1IOBA 5I93A 1XJAA 1V6OA 4IXLA 2A73B 3WW4A 5KXDA 1W6NB 3ILRA 3CA5A 3K1XA 3LGRA 4YG3A 5FKBA 3QH7A 2ZKLA 2NS2A 2LM3A 3OGSA 4NPRA 3UV9A 3U10A 1Q56A 5FWJA 1OVPA 3DPRC 1UU4A 4KL1A 5IAXA 4YVWC 1L2HA 2Z49A 4D6SA 3I54A 1H1AA 4XTMA 3ZFFA 4XUPA 5FYCA 1YEWA 2GAUA 2Q1ZB 2V4VA 2XL7A 4QHBA 5DXDA 1GOFA 4YGBA 3IN9A 3A0NA 4UFJA 2F4LA 1D4VB 4EROA 3O1MA 1QQLA 1QJX2 1ZZ9A 4Q91A 1XZZA 1VBA1 1AYN3 4IEPA 2KXLA 5FCCA 1POV0 4E2QA 3JUUA 5KBFA 3POKA 3FJCA 1OQEA 3O7OA 1GQPA 1CPNA 1TEIA 2UY9A 3LAGA 2D6KA 1VB4A 1CAUA 1RHI1 2WZPP 3ZXLA 1A34A 5FO8B 1ZVFA 3O14A 3T0BA 1V6WA 3V79C 3WDTA 3OJ2A 3NNMA 2HWE2 2FZ1A 1NCQB 2XJRA 4CU9A 3SITA 1HWPB 3C7OA 4FPGA 4IL7A 5FBJA 1Q03A 1H8TB 4JQTA 5FUIA 3WQ7A 1JTCA 2WNVC 2WNVA 1LOFA 2O8QA 2EA7A 1BBT3 3GNEA 3BTXA 1SLBA 1S2KA 3M3QA 2ZGQA 5A3MA 1EAH2 2EAAA 1BHGA 5ABJC 3LZZA 1SPPA 1YQ2A 1V6LA 1PGL2 2VCCA 3LTQA 4PIXA 4I4VA 1UOGA 3ABZA 4QKFA 1G9BA 1RC6A 2W95A 3AYDA 5A7OA 4B7EA 3ZFGB 2A3WA 1FN0A 4A7KA 1NCQC 5L19A 4XJWA 4DQAA 1SLIA 3S8KA 1AR82 3AM2A 4M4RA 3N0KA 1LENA 4XJ8A 3F2ZA 5G00A 1JUIA 4AN7B 1COV3 4MHRA 3UGFA 1XQNA 2Y8KA 1H4HA 1KDKA 2GNDA 4MOAA 3M1HA 4WVWA 3TNQA 1SDWA 1FNYA 1QXMA 1IG0A 1UXXX 4WM7A 2JDNA 1ZBE1 2FQPA 1LOGA 5FZ0A 4DXSA 1BMV1 1UY3A 2C9AA 3HNYM 1ZZ8A 4AFCA 4Z2AA 1IPJA 1UF2C 1DQOA 1W06A 1I6XA 5JVVA 2ZGTA 1ONAA 2DCYA 4RA0A 3S7EA 2AFGA 2D6PA 2DTYA 3ZO0B 2O1QA 4BE3A 4YWAA 2IXLA 1Q8VA 3DPRA 5CIRA 5AC91 3N9OA 5FZ1A 4CUBA 2M49A 5ANNA 4MGSA 1UOFA 4U2AA 3J7LA 1S2BA 1POV1 2YC2A 3PUSA 1GKBA 4LK7A 3C9ZA 4DUWA 2GO2A 3NL1A 4P9IA 4MGQA 2HWB3 3PIGA 5GJ6A 1Q8QA 4RSUA 3AP5A 1OVSA 2R9KB 3FFQA 4WVVA 4A3ZA 4H9WA 3WQBA 2NQYA 3SCGA 5CFCB 4FSJA 1F9KA 1BMV2 2WNUC 5HCFA 4ET7A 3H6RB 1FI2A 3GGLA 3O4CA 2NZ9A 5LATA 1VR3A 4MZUA 4N9HA 1LRHA 2QDNA 2Q0AA 2YC0A 4HETA 2A71A 3ZFGA 1PK6B 1AR71 1TNFA 1W39A 2AEYA 3I59A 1RUE1 4K20A 3DV8A 1W6PB 5E6HA 3ZSMA 3P6JA 3OD4A 3BAHA 3K46A 1C8M3 4NMIA 3DYOA 2CGNA 5C3SA 1PX3A 2W0XA 4CPBA 2XBO2 4GH4C 2Z2SB 2VZUA 3SEEA 2DRYA 5BP5A 3RDIA 4XVHA 5F9TA 1YUDA 4Y3OA 1GP5A 2Q9XA 2YFZA 3L2YA 3RWNA 3AKQA 1Z4SA 2OUJA 3H8UA 2HW9A 1HQWA 2VCMA 2XPJA 5BNOA 5KHJA 2VZ3A 1PO23 4XURA 1RXGA 4CVUA 1AVXB 1FMD2 2X8KA 1JXNA 4JGYB 4ASKA 3OPWA 3S5AA 2PAMA 3M8LA 5ERLA 2ARCA 4FBFA 3WEZA 2EIEA 4J23B 4CEYC 2F8XC 3K48A 3H3UA 2W5FA 4PDWA 5FXZA 5A3WA 4AGRA 5A7WB 3ASIA 4CA9A 4PLNA 4LO8A 1LKNA 5L7OB 2WO3A 2QCSB 3IM6A 2W39A 3O44A 3AMQA 1UL9A 4FOVA 1ND2B 2DUQA 3ON7A 2BWCA 1RUC3 3WNLA 3ZXEA 4CRQA 5C9AB 3O1RA 1JYIA 4MZFB 5FLHA 4QKBA 3CMGA 1AR73 1ENRA 3QR5A 5FO7B 1DQ5A 3BCWA 3P3NA 3HJRA 1XBFA 4PDWC 2JXAA 5DAWA 5LCWL 2OX0A 2BEAA 2K4AB 1OA4A 3RPQA 4XFHA 2BERA 5FPLA 1FOD2 1PK6A 3I59B 4FCAA 3CQAA 1BKZA 1QXJA 1WA6X 1XB9A 2XLAA 3HQUA 4QQHA 1W8NA 1WKYA 1AL21 4YGDA 1GP6A 1NA1C 5H9PA 4COUA 1VRH1 4RFRB 5EPAA 1O3SA 4YFZA 4LO2A 2SBAA 4F7ZA 1JYCA 4M4PA 2XJTA 2ZEZA 2YZ4A 3HQRA 4JKKA 4UT5A 5DAVA 3WQ0A 4I4RA 5I0UA 3ZYBA 5C4WB 4JHTA 1RUOA 2WLQA 1YLLA 3DKWA 4CJMA 1LODA 1D0HA 2XH6A 1RUG2 1W3VA 5GLUA 1Q1UA 2GH8A 3QOPA 1CQ9A 1TQ5A 3MW3A 4QX5A 4MZHA 5CKMA 1V6VA 3GCXA 1V6IA 5BNOB 2YG0A 4C0HA 4MG2A 4KEKA 3CRGA 1LHVA 1ZZCA 2VXJA 2PHLA 3TRSB 2A7AA 4JTNA 4BQ4A 1IHKA 4DEVA 2RQ9A 3ZXJA 4I2OA 2DF7A 1JW6A 4P5HA 1G6NA 1W6MA 4D8MA 1KJLA 1RUH3 3OOXA 1PVC3 4BXFA 4EFRA 2W3JA 3OJVA 2L9LA 1U12A 3KMHA 4RQPA 2WNUA 4AQSA 4UF0A 2Y9XE 3GZAA 4DZGA 1LGBA 1ASJ2 3H8XA 2RS53 5JR2A 5FPAA 1EV12 1ND2A 4OCTA 1HW5A 2WZR1 4UWDA 2VLCA 1SG3A 2DUPA 1H6XA 1IS6A 1DQ6A 1XE8A 2W1WA 4JTOA 3WCSA 5GZCA 1MS5A 2DCTA 2LW8A 3S8JA 5CFDA 2YPJA 4P08A 3I2DA 3PTYA 4YVSA 4PBPA 4COZA 5FR3A 3RTIB 4EEEB 2EALA 3UKTA 2VUDA 2WZ8A 2XKOA 2XJVA 4IDZA 4J1WA 4XQDA 4Y1VA 3VKLA 5K0UB 5EP9A 2MC2A 2R16A 2BUKA 2TNFA 4X38A 2A70A 3LQCA 1SQ4A 4EQVA 1JYVA 3BA7A 1IRPA 4FFGA 4TN7A 4N43C 3BB6A 4KGGA 5BPXA 2QQVA 2XQXA 4B4RA 1YO8A 4KQ7A 2ZHNA 3B01A 4IEZA 3VGIA 2B42B 4E8CA 3VD3A 2Y0IA 1JT4A 4XUOA 3VHNA 3OGFA 4Y1UA 3J8F1 1PNGA 4IGPA 1SDDB 3PUQA 2BP6A 4DMIA 4GB33 3EB7A 4WZCA 3VSZA 5FY9A 3ZYHA 5DMYA 3K75B 4BHPA 4LR4A 1FX5A 2B7YA 1LHNA 1IJTA 1G9DA 3VDDA 1GMMA 3BTYA 1HIXA 1HXS3 5H9RA 2MHFA 1HWOB 2ZZJA 2D1ZA 2ZX3A 1WMXA 3KMVA 1VBC1 2MIBA 1J3QA 3VB9A 3WG2A 4KG8A 2D97A 2RE9A 4I4QA 1PVXA 3DL3A 2JE7A 2YDEA 1LU2A 5LRRA 4ES8A 4MZGB 1DGLA 2WA3A 5I0DA 3ZN4A 1TMF1 5FYIA 4JVAA 3KT7A 1QQP2 1BYHA 3G6JB 3IIAA 2JICA 3CQOA 5HCBA 4L99A 5EZWA 1LR5A 2QZ3A 4D94A 4WM8B 2HBUA 3GZTB 3VZOA 1RUF3 4I1BA 1F35A 2VZSA 2CWSA 1JS9A 2ZCWA 5F8PA 4AQ2A 3WG1A 4Q4Y3 4K9SA 3ZR5A 2VULA 1RUE3 3H50A 1QOSA 1DF0A 2QQIA 2VMEA 2ZHMA 3HNMA 2QYIB 4OUJA 1WBAA 2FMYA 2D3PA 2K0GA 4AYUA 4EFPA 1LU1A 4BQ5A 3I4IA 1HB3A 2EAKA 1QDOA 3GHMA 5I0RA 41BIA 1NY71 1B09A 3KF5A 3KWVA 5L9VA 2R071 3FBMA 1F4AA 1RUNA 1W6OB 4H75A 1AR92 2GMEA 5L9RA 4P9JA 5J36A 2JDYA 3VBSC 2QQPA 3TC2A 4AI2A 2FO1A 3T0DA 5EJZB 4FOWA 4C8DA 2A6YA 3MIBA 4RS5B 5CVRA 5LEJA 1PC8B 1ZRFA 3WX5A 4DIQA 3KS7A 3FJAA 2IXKA 4DNYA 3FL7A 1JQZA 1NQJA 2E4MA 3VBOA 3UYJA 3IM5A 1WCSA 4JGZC 3OJMA 4BISA 3VDDB 4B4QA 2B9UA 5F3IA 1Z78A 4ZFWB 2FDHA 1VBA3 2K43A 3P6IA 4G4FA 3FJHA 5IFTA 1H8VA 2OZ6A 2D7RA 1B35C 1L7LA 3POYA 3O1VA 3VT1A 2VH9A 2ZPXA 1H0BA 3N9QA 4JDNA 2RV9A 1R093 2QFEA 2YV8A 1AYM2 4FPKA 1FQ9A 5A7SA 4JKQA 1W0PA 5BQUA 4CDWA 4FT8A 5B2GB 1CX1A 1UPSA 2ET1A 1KS4A 4KU7A 1MS0A 1NCRA 1YIFA 1QJU1 2GU9A 5ACA2 5KC6A 2FDFA 3ZMNA 5JZGC 3VD4A 3LA7A 2CV6A 5IK5A 3N9NA 1UY0A 2W1UA 1XHBA 4RHV3 1JTZX 2FGFA 4ZBVB 1K5MB 4GD4A 5A6YA 2UWBA 4HXCA 5LY2A 1K5JA 2IFWA 2VBBA 3JD73 3K2OA 3MW4A 1VMHA 4OHWA 3VD5A 4QDRA 2W1QA 4G6JA 2AXMA 3HN3A 4AAPA 4FOYA 4JZRA 4N53C 1ZBA3 4K8FA 3ATGA 2P3JA 5FLJA 3N7LA 1FV3A 2J1EA 3E5XA 1Y9MA 2WFF3 4KC3A 1NYWA 1PGW2 1JODA 2VMFA 4N9IA 4FTBA 4NHXA 1SLCA 1NXD1 1W3AA 1I3HA 3KGZA 4Y5TA 3RG0A 2HH9A 2PHUA 4NPLA 4IUGA 3FWEA 1O8PA 5F1RA 2XBO1 3D0SA 3MI8A 4NPMA 2PAEA 2D6NA 1YFYA 1ZBE2 4ZU5A 1Y43B 4NWWA 5FZOB 1G82A 1JHNA 3ELNA 5E24E 5DZUA 1Z7S1 1HRV3 1ZBA1 3OJBA 5DZEA 4Y26A 1UX6A 4J25A 4CCOA 5J09A 3WDVA 3EXUA 4NRQA 1W6QB 3FJJA 4P0KA 1WW5A 5FQ0B 5A3LA 1M16A 1XYNA 1Q3EA 1FPN3 2E33A 3ME2A 2BOJA 4DINB 1B35B 1XSRA 3V0BB 1EPWA 4LULA 3NBDA 4QHOA 2X10A 4UY4A 3VDBA 4DXTA 4N90A 1LHWA 3B02A 4UI9L 2WNEA 4QB2A 4WV8A 3LFMA 5FZYA 2ZGLA 3VKMA 4CCJA 2VQAA 3IPVA 2BFHA 3H7JA 2B4KA 2J1SA 2JDPA 3INAA 4RR3B 4XTPA 4IONA 3IMMA 3T30A 5C5UA 1HB2A 1OH3A 2Z48A 2PHXA 2PYTA 4YW1A 3U78A 3ZIWA 4Q4V1 4FP2A 4EZ4A 2Y6FA 2F6BA 2D6MA 3RMXA 4P9GA 4YOLA 1VBE2 2TEPA 1BFCA 1FT9A 1US3A 2DVDA 1GFF2 5TSWA 1ISXA 3IIIA 2HWC2 2ZABA 2JENA 1W3XA 2OS2A 1A8DA 1UKGA 2WSUA 1CAVA 4XE9A 1BZWA 3TB0A 4K21A 4QM9A 5IVCA 1JYXA 4FOQA 1QJFA 1DHKB 4AEDC 2BBVA 2VZVA 2ZGMA 4Q26A 1ULCA 4CDQA 1C3HA 5IATA 3ILAA 1ACCA 1V70A 3N9MA 5L36A 2OA2A 2YC4A 2VGDA 2X5IB 3AMNA 4L4IA 3RQ0A 4BMBA 2VQTA 3A07A 4XCAA 2ET7A 1F5FA 2IXHA 2RR13 4X8PA 3WT3A 4J6GA 5FOBB 2JX9A 3JQXA 4JCKA 3MW2A 3HT2A 4L11A 3B9UA 2Q8EA 4XFUA 1TTUA 1UY1A 4E2GA 1QH7A 1SCSA 3TEYA 3FJBA 3OBAA 2KA3A 2QQKA 1UY4A 3ACGA 3KQ4B 2C6SA 4EN0A 5C6CA 1BASA 3IDCB 1CD3G 5HCAA 5CZKA 3RYPA 4ZLBB 2AREA 1EUUA 2P17A 2DRZA 4I01A 2CGOA 2A5ZA 2LRPA 4LLFA 1IQAA 1DGWX 2QE3A 4QQOA 2BW8A 4XETA 1DP0A 1IILA 1P63A 3AZYA 2A3YA 3ZFFB 4YW3A 2WSVA 2RS32 4H7MA 4EN7B 2YB7A 1US2A 2F4PA 2J22A 5C33A 4LO7C 1MS3A 1VE0A 2PA7A 5D1IA 3RMYA 1GANA 1ENSA 1RVF3 3T2TA 3TN92 3PJYA 4BYYA 2X05A 3ZPOA 4BQ2A 1ZRCA 1WLTA 4CPBD 3UD9A 2ZX4A 1HCEA 3WP3A 2R061 4M01A 1S0IA 5D8AB 4QKSA 1LGCA 5FYYA 5DVHA 1WCQA 2TBVA 2IVIB 1OQDA 4YZ5A 3WQ1A 1DGWA 2ZACA 1RXFA 3EO6A 1EY2A 3ACIA 4H2AA 3WCRA 1AHSA 3LPFA 3Q7XA 2BPA2 1VBD2 1CAUB 5HPOA 2ATFA 4LOTA 1R8NA 3HOMA 4ZPIA 1MZFA 1WBCA 5BQUC 4CE8A 4META 2QZ2A 4Z92B 4CCLA 1RUJ1 1W2UA 3ZYJB 1PMJX 1EV2A 4FFHA 5EHDA 3VDCA 2YU1A 3BN6A 3BPSA 5IK4A 1OPOA 1HCDA 4BDVB 2WJSA 3ZKUA 1UZWA 4NROA 4QQPA 5LA9A 4WVZA 2FFVA 4H04A 2R041 2E7AA 4P9YA 2XHKA 3MF6A 1PO12 2OVUA 1OF4A 2ZXQA 1SPPB 5GLVA 1X82A 2Q30A 1DQGA 4I4OA 1JZ4A 2MLLB 3VHOA 4QD2C 3SNVA 5FZDA 2R072 5BNQA 4AR2A 4OHXA 5FJHA 4Z8BA 4R6UB 3OYWA 4NR1A 4KH9A 4CU6A 4GMP3 3OCPA 4QB1A 4Z8SB 2D43A 4GP0A 3SH5A 4MXWB 4QAWA 1RUF1 4PF5A 3IDAA 3FMGA 1ZA4A 3FJDA 4XDPA 2K9ZA 3GCWA 3ILFA 4USOA 5GZDA 3ZC9A 3IT8A 3DF0A 4XF1A 1U5ZA 4S2GA 2N7GA 4EWEA 1ITBA 3ZN6A 3KD4A 3PTRB 1F31A 4JAAA 5LWBA 1GQHA 3DECA 2OYZA 3GZUC 1YXWA 5F32A 2WQZC 1S0BA 1LHUA 3ZIXA 4AE2A 1X8EA 2YMZA 3ST7A 4QBVA 4TSVA 4LK6A 4QD2B 2XJSA 2VZRA 2ERFA 3VBHA 3N35A 4QHZA 3CLPA 4H7LA 3F1RA 3THPA 1VB2A 1XXNA 4Q0SA 4SBVA 1MEC1 3U14A 1QF3A 5FZ8A 2AGSA 3V0AA 5BUVA 1DBNA 2KI4A 1BARA 2O14A 3A23A 3FLTA 3B5LB 1W99A 5T5JA 1NX9A 1XYOA 4Z2WA 5CFCA 1UKRA 5A1FA 2YUGA 3H3ZA 3OG2A 3KCYA 1ODMA 1N1VA 5FY7A 4BQXA 4I8MA 3H1YA 1DCSA 2ZHKA 1STMA 3J8F2 5H9QA 3OY8A 4BLJA 5C71A 4OWKA 3VBUA 1W03A 4XJAA 1ND3B 1SR4C 4GWNA 3N4MA 1RUH1 1VLNA 4CEYB 4RS5C 4IQPA 1DJSB 3ZMOA 5FZHA 3WINE 3I2KA 2EICA 4ZU7A 1JZ8A 3NJXA 5F5AA 4C1WA 1AYN1 2R30A 4XBLA 4LKEA 1EAH3 3AB0A 3JXSA 4F83A 4IE4A 1WD4A 1BVVA 4P0JA 5EXOA 2OXBA 2YPDA 4AL9A 1JBCA 1QJY3 2Q4SA 4S2FA 1M06G 4PQ9A 4Q0QA 4HVOA 5C3RA 2IWGB 2WFPA 5IFPA 4HJJA 4XIKA 4BPZA 3O1TA 1O91A 3P53A 5LK7B 3O4DA 1AR83 2D5HA 1Y9GA 5EHAA 2EIDA 2JDMA 1ULOA 2DFCA 5AVPA 4GZ9A 4DENA 1KRIA 3PURA 1EVTA 3M3CA 4IZEA 4NUBA 3EF2A 3E6DA 2MNGA 2VBDA 2Y0OA 5A7WA 3H6RA 3MIHA 3OTFA 3K3NA 1H8TA 5CISA 5JPNB 2NM1A 2GP3A 3CDZB 5DAXA 1IS4A 1RL3A 5IUQA 1J83A 5GM0A 2WLPA 1W04A 2V4AA 3PUAA 3RJ2X 3WZ1A 2WRYA 1GSLA 3O4AA 4CDUA 4G3YC 1PZ9A
chains in the Genus database with same CATH topology
1APNA 1S0LA 5JOXA 4AEJA 2UY8A 2Y9GA 4HVQA 2HEWF 5CFDC 2FDBM 1RJ7A 1Z7S2 3QLQA 2Y9FA 3VSFA 2HWB2 5DG1A 4CEYA 5A33B 2VW2A 4CDQC 4GAFA 4L97A 1F5JA 3HMYA 1PVC1 3KT1A 5C8CB 1R1ZA 2E7TA 3ILNA 3PNAA 5HI0A 1QHDA 4Z1VA 4MZHA 5C4WA 3IWZA 5SV5A 4FXGB 4EWAA 5T5OA 3VZMA 1ZX5A 2VVDA 1DU3D 2X2SA 4OHVA 3JB8A 5KXBA 4CDXC 1IPKA 4AVAA 4OI4A 1QJU3 4OULA 3SCHA 5F6LB 1VBD1 4MVTA 5I91A 5KXCA 4GH4A 2WBCA 2GSYA 2VY0A 1T9FA 1MZ6A 3AXDA 1DZQA 5D63A 1C8M2 3R4SA 2OUHA 4KEJA 1FV2A 2P23A 1V6KA 2YY1A 4RQPB 3E5UA 4FPOB 3BAVA 3WW1A 3LA3A 3H7YA 2ZGRA 2WFF1 4AVBA 4OUMA 4K7JA 3JQWA 4X8NA 1DZTA 3B3QE 2VOVA 3R05A 2D40A 4LE3A 2R043 1FMD3 4Q4W3 4CEWC 4CDUB 3AX4A 4GKYA 2RM23 4HPKA 1AXMA 4HKWA 2ZS6B 1ZRRA 1FWVA 2QUOA 4LHKA 3JCIA 3H6SE