1DIWA

The hc fragment of tetanus toxin complexed with galactose
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
441
structure length
441
Chain Sequence
b'EDIDVILKKSTILNLDINNDIISDISGFNSSVITYPDAQLVPGINGKAIHLVNNEESEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TETANUS TOXIN HC
publication title The structures of the H(C) fragment of tetanus toxin with carbohydrate subunit complexes provide insight into ganglioside binding.
pubmed doi rcsb
source organism Clostridium tetani
molecule tags Toxin
total genus 110
structure length 441
sequence length 441
ec nomenclature ec 3.4.24.68: Tentoxilysin.
pdb deposition date 1999-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07951 Toxin_R_bind_C Clostridium neurotoxin, C-terminal receptor binding
A PF07953 Toxin_R_bind_N Clostridium neurotoxin, N-terminal receptor binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1diwA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1diwA02
1ENSA 1DGLA 4XJ8A 1BFGA 1N3QA 4HL0A 1XYFA 4GKYA 5JOXA 5F5QA 1NXD1 2PHFA 2ZQOA 1BQPA 2IHOA 1SLIA 1LOFA 1PUUB 5DZUA 5B2HA 3CA0A 2D7IA 1JW6A 5DUUA 1BXHA 4ZGRB 4LO3A 2WQZC 3MW3A 1Q8VA 4JKQA 2TEPA 2ZGRA 2AH2A 1X50A 3JUUA 4XYXA 4GKXA 2JJ6A 4FPFA 3AKFA 1LEMA 4IZXA 2MLLB 2A5ZA 1MVQA 1W6NB 1Q8OA 2F8XC 5L73A 2BFHA 1FNZA 2R1BA 2DWRA 3T8SA 4Y1YA 3UJ0A 1YI7A 2WKKA 1Z78A 3H6RA 5BQUA 4GOYA 3FJDA 3H6SE 4OEFA 2ARXA 2D43A 2OW4A 4LO0C 1Q56A 3A23A 3FLTA 4LBQB 1N1VA 3WUCA 4EFQA 2Y9GA 4XBNA 1XG6A 1SLAA 3VT1A 5GLVA 4I8MA 4X39A 1TEIA 4OEEA 1GKBA 5T5PA 4I0YA 4H55A 4FPKA 4WBCA 2QYIB 1GANA 3RMXA 4F83A 3AKGA 4P0LA 1ULFA 1R8NA 5EWSA 2Y9XE 1ENQA 1ZM1A 4BM8A 1GGPB 2ZQNA 1OKQA 1DFQA 1GNHA 3AKIA 1V6UA 3WA1A 5JVVA 4X38A 3RS6A 1BLDA 2ZGUA 4ZFYB 4FGFA 3SNMA 1GZWB 1AZDA 4ZA3B 2VW1A 3USUB 3BRGC 1DFCA 2Y9WC 1I3HA 1PZZA 3FUOA 2ZGKA 3N7KA 1VCLA 1DBNA 3ZC8A 4AN6A 4GP0A 4ITCA 4D0ZA 4YM3A 1LHOA 1YXWA 4JC1A 4UW5A 2XB6C 4AGVA 1DQ5A 1G9FA 4AVTA 5H9SA 1HKNA 3QYDA 4DCKC 3T1MA 4USPA 3WMVA 1Q8QA 4JP0A 5EHAA 2NM1A 3UL2A 3A4UA 1DQ1A 3FJFA 1N1SA 1JLXA 4JQ0A 3W9TA 4P0JA 1A8DA 2YROA 3DGTA 3SLIA 5T50A 1DYKA 1F9KA 3FUQA 3T2TA 1F31A 2BEBA 4XMIA 1N1TA 3OYWB 1GBGA 5JMCA 4X37A 1VALA 1JOJA 4BMBA 4ZLBB 4FQZA 4Y1ZA 4QO3A 3AZXA 4MYEA 3IKWA 1GSLA 1BFFA 4AVVA 5FZYA 3HMYA 4Y1XA 2VSAA 1BASA 3GNEA 5D61A 1OQ1A 1WBFA 1WW5A 1N3PA 4YG6A 5BVPI 3O0WA 2DREA 3UJ4A 1AFCA 3NBDA 2FO1A 5T5OA 2AFGA 1APNA 1GLHA 3N35A 2CL2A 1Q04A 1V6KA 1V6XA 1NZKA 2WJSA 2E6VA 1MR5A 1JTCA 4LO0A 1Z0HA 2DS0A 3P6JA 1ILR1 3PUBA 4ZFWB 4DPNA 1GICA 3C9ZA 4WVVA 3PVEA 1CPNA 4YW1A 5FZUA 2NTDA 1RIRA 3MEPA 4XMAA 1AXZA 2CNAA 1Q03A 3IIRA 1HQWA 1D2SA 1IILA 1SCRA 1W6PB 5GJ6A 1S0IA 6I1BA 4GALA 3HN1A 1QOOA 2V73A 2DRZA 3WV6A 4XKIA 4LBKA 1FNYA 4LO1C 4BOWA 5E89A 3IM5A 1CIWA 3B69A 1LOAA 2JE7A 4D0TA 4PCRA 2DVBA 1QKQA 3OY8A 3PJQA 5BXTA 2NVHA 4K20A 4ZKTB 3BAOA 2ZMNA 1ISWA 2SLIA 1KDKA 5FZZA 4GAIA 3UJOA 4Z8BA 4YGEA 3AZYA 4BLJA 3ZSLA 2W39A 3WDWA 4EB2B 3AP7A 2WT1A 4Z9WB 3O12A 4Q1RA 2DRYA 3RRDA 4FPJA 4FOYA 3V0AB 2ZBJA 3CQAA 4XTPA 2D6LX 4RA0A 4XJAA 2AAIB 4R6UB 5IUQA 1B09A 2ZGQA 1BJQA 3ENRA 2VLCA 2PHUA 1N3OA 3ZPYA 5IT6A 2A3WA 2A6VA 2ZGSA 3WMUA 1W6MA 3WNXA 1RG8A 1ISVA 5BXRA 4JKXB 2CTVA 2DU0A 3ZXEA 3POSA 1WD3A 3A0NA 4I1BA 4QALA 3OGFA 5GLZA 4DQAA 1DQGA 3WDTA 1CR7A 4DS0A 2ZGOA 2E53A 5T55A 4IY8A 1QOTA 3LLPA 3ILNA 3B9UA 2EALA 4DENA 3F62B 5GLTA 1LHVA 3O44A 3W59A 3Q7WA 3FJEA 4YZ3A 5GALA 5CB7A 3AP5A 4XJUA 3I4IA 2PHXA 5T54A 3JUTA 2P34A 4GAFA 4LBLA 2GDFA 4Q91A 4SLIA 3BAUA 1G8WA 4W65A 3A07A 3PHZA 1JQZA 1RINA 2D23A 4I4RA 4J2YA 4QBCA 4I3NA 2ERFA 2Z48A 3ILRA 2DTYA 5T5JA 3ZXGA 4HANA 5IK7A 4LBMA 3ZXJA 3AJYA 5BOWA 2CWMA 31BIA 2KI6B 3BAVA 1LOBA 4OWLA 2FFVA 1IS4A 4P9XA 4Q8LA 1DQOA 3EF2A 4LO8B 1UZZA 2DUPA 4C1WA 3I29B 4JPZA 4K1ZA 3WO2A 3VUOA 3R05A 1SFYA 1HWNB 4G1RA 1IT0A 3WOGA 5GM0A 4Z8SB 4YZ2A 3HOMA 2D7RA 5H9QA 4JAWA 1WD4A 3NBCA 5BXSA 4Y20B 3NV3A 3MW2A 1FMMS 4A7YA 3BRDA 5DUWA 4M01A 4YW3A 5DG1A 1WW7A 4EEEB 1S0GA 2ZA9A 1N47A 4Y22B 1Z2VA 3FJBA 4CRQA 1AJKA 2R49A 1TIEA 1RZOB 1SCSA 1W6QA 1BLAA 1YO8A 4YOLA 1H9WA 1WBLA 5BP5A 2WBCA 3O5WB 4HJJA 1JT4A 4YM2A 5EYYA 2K43A 4HR6C 4I1EA 3OJMA 4GOVA 21BIA 4AYUA 3ZC9A 3S8JA 5AVAA 4P0KA 1QNYA 1LU2A 1O4ZA 4G9NA 2A7AA 3AH2A 4DEPA 4G9MA 5EC5A 1MS0A 1JT3A 4LO2C 1LENA 1HIBA 1SR4C 3D7WB 1WLCA 3ZXLA 1A78A 5F8WA 4IHZA 3AJ5A 4I4YA 1VIWB 5EYXA 3UD8A 3IPVB 2YXSA 1O4YA 2GMPA 2C9AA 4M3CF 3OPZA 5IK8A 1JXNA 1CN1A 4J2SA 2A6YA 1H30A 5CNAA 3FFZA 1LESA 4LBNA 3VV1A 5T52A 2IWTB 3O4OA 1AXKA 3SH5A 1TTUA 1IKQA 1I1BA 2A75A 3H0OA 4KC3A 3SH3A 4M3CA 4LBJA 4FPLA 1IS3A 3V64A 4YG0A 3AP4A 3WCRA 4G6JA 1BFCA 4PF5A 2NZ9A 5KXBA 2X2TA 2Y9FA 2ERMA 1IRAX 1ULDA 41BIA 2I2SA 4AGRA 4QD2B 5GLUA 3NJ5A 4A7KA 3FLPA 2DVAA 2R0HA 1N4KA 2RSTA 4P9YA 3WG3A 3B00A 3B01A 1PUMB 2XOAA 2DUOA 1QOSA 2VXTI 1HDKA 1TFMB 1Q8PA 4HA2A 2ENRA 1GZ9A 1QDCA 1FMZA 4YZ5A 2DYCA 1LGBA 4FPYA 4XTMA 1T4QA 2ZGMA 3O0VA 2VH9A 4YGBA 3ILAA 1GYKA 1K5VA 2GN3A 1FYUA 1FN0A 4P14A 2BEAA 3Q7YA 2JDZA 4DRVA 1Z4SA 1SBFA 4D69A 1WBCA 1PC8B 1KQRA 4YM1A 1HCEA 1R1ZA 2ZHNA 2X2SA 1HQLA 3N7MA 1ONAA 3VWCA 1WW4A 4AN7B 4GWMA 2VUAA 3MW4A 1MD6A 3WDXA 4FPGA 1QQLA 1ABRB 4NOTA 2KLLA 3S8KA 1BZWA 4LBQD 1IS6A 3ATGA 3UD7A 1CESA 4L4HA 4QKRA 1Y7BA 1BARA 3A22A 3RQ0A 3N0KA 4JCKA 4M00A 3CRHA 2KI4A 2W68A 1AVBA 2D44A 3QR5A 4H04A 1J0SA 3BTAA 1V6MA 3FJHA 1DZDA 4Y22A 1WCSA 5IK5A 2E51A 2A3XA 4YZ4A 3CU1B 2NN8A 2R16A 1L2HA 2ZMKA 4YW5A 3AKHA 3ASIA 2D3RA 3AH1A 4WV8A 3I8TA 3LSEA 5JLVA 5D62A 1SR4A 2AR6A 4I4OA 4R9BA 2DURA 4XZPA 2F2FC 4QBVA 2GO2A 3H6QA 2AYHA 3AFKA 1IJTA 4M3CE 3MPPG 2CY6A 1FWVA 1TWEA 4XFSA 3KMVA 5E24E 4D8HA 4XXPA 1MZ5A 2D3PA 2A71A 4FVVA 1SBEA 1AVUA 2KH2A 1LGCA 3O0XA 2FGFA 5FREA 1DLLA 1UKGA 3Q9OA 4CZSA 3AZZA 1I1EA 1JYCA 2D7FA 2ES3A 1ULCA 3SISA 1RITA 1W6OB 2C5DA 1AX0A 3ZSMA 1JUIA 7I1BA 1CQ9A 3UJQA 3BX1C 4XFTA 1AX2A 3CAHA 3WDYA 3LSDA 4OWKA 1MS5A 3SH4A 3IPVA 2VXRA 3A0KA 2A3YA 3WVJA 2D24A 3PVNA 1R8OA 2A6WA 1EPWA 1WLDA 1LOEA 2VW0A 1FAYA 3N7LA 1S0EA 5GZDA 5F9TA 2E4MC 3O4CA 4ZBVB 1UAIA 3ZSJA 1W6NA 2P23A 2P2KA 1EV2A 1JHNA 1FGAA 3R4SA 2RHPA 2EXKA 3V0BB 2YUGA 2P3IA 4J2KA 4AWDA 1DYPA 5CA6A 2D6MA 4LBQA 1DQ4A 1EVTA 4PC4A 1QGLA 1KITA 2Q3NB 3D6EA 4CTEA 1GZCA 4X3AA 1C1FA 2WT2A 1UX6A 2ZGNA 1QXMA 1S0FA 2AGSA 3POYA 5SV8A 1SLBA 1LHUA 1AJOA 2JD4A 2DVGA 1JN2P 2PHTA 4Y26A 4FP3A 4K21A 1YF8B 4YG3A 5DUXA 2Z49A 1DQ0A 2ZMLA 1LEDA 3WG4A 1CPMA 1KNMA 1GZWA 1ENRA 4F34A 3WZ1A 3USUA 3MALA 2WLQA 3E8LC 3AYEA 1DHKB 4IY9A 2ESUA 4YFZA 3P53A 4OWJA 1FX5A 5DXDA 2RG9B 2RQ9A 3H6RB 2EXIA 1D0HA 4Y1VA 5HCAA 1V00A 2DV9A 2JKBA 4ATFA 3AZWA 4LO3C 1T9FA 3K1XA 3JRRA 3UK9A 2KM2A 2L5XA 4R9DA 2ZABA 4KBBA 4DRRA 1KDMA 2Z42A 1U0AA 4YM0A 1FV3A 2D6KA 4ZOTA 2ZHKA 1V6JA 3ZXFA 3ILFA 4UW6A 3VSFA 2NMOA 5F8SA 2FFUA 1VAMA 3ZVXA 1JLYA 2HYKA 2KKIA 3IAGC 4ZXKA 4ATEA 3AK0A 1LHNA 1BFBA 5DSSB 3IM7A 2H0BA 2DVFA 4USOA 1V6OA 3BIWE 4EFRA 4ISQA 3WG2A 1MACA 3OYWA 2AXMA 1LU1A 3SNVA 4IQPA 2EXHA 4IZEA 3AYCA 3AJ6A 1G9DA 2PELA 1G9AA 4I4PA 3CA5A 3AXDA 1YTOA 1A3KA 3M1HA 1OQLB 5EXOA 1QDOA 4XFUA 3AX4A 3IM0A 2PHRA 1HWOB 4I4QA 4IYBA 4I37A 3UD9A 5BYNA 4Q9PA 1QMJA 3APBA 1LOGA 2VSEA 3B3QE 3BODA 4XOGA 1GNZA 1PZ8A 4H9WA 4Q8KA 4Q1PA 1BYHA 1AX1A 2D1ZA 3FJIA 4XDQA 2HW9A 3M3EA 2V5YA 3CA4A 4LO1A 3FGMA 1PWAA 2CWSA 3ZXKA 3R4UA 1QNWA 5FNWA 1V6VA 4OW4A 4ASMB 3L2YA 1XHBA 3FLRA 5I1BA 3WDUA 1UMZA 2DUQA 2D6PA 1ISXA 3IN9A 3V65A 1LTEA 4XHXA 1YBIA 5E88A 4KEJA 5G00A 4Y1UA 1VAVA 4DFSA 2CYFA 3TC2A 2ZGTA 1HWMB 4U36A 3V79C 1W6PA 3N7JA 3P6IA 3TAYA 4BPZA 4LBOA 4OEGA 2VY0A 3INAA 1JT5A 2DU1A 1IHKA 3U4XA 1QF3A 1AXMA 2D22A 2WRYA 3RSJA 3FJ8A 3QCWA 2LIEA 4JRAA 4Q9GA 2GNTA 3HALA 3BA7A 4BQ1A 3O5SA 3VEQA 1M2TB 1SLTA 5GZEA 3FJKA 3GALA 5KXDA 1DQ6A 4I7IA 2M49A 3PMEA 3OBTA 4GP3A 8I1BA 3POWA 1DJSB 4P6AA 2WSUA 3OBRA 3LTQA 4RL7A 1J1TA 4Y24A 3OJVA 2ZR1B 3UDAA 3KQRA 3V0AA 5HPZA 1W0OA 2W52A 4XIOA 3TB0A 3OGGA 4Q26A 2EF6A 4TYSA 2K4AB 4J23B 4YW4A 3QLQA 5JOWA 1ISYA 2J3PA 4FOVA 1G9BA 2GN7A 5F8YA 4GXLA 4YGCA 3ZYPA 4QC4A 3NBNA 4XHBA 4UW3A 2UU8A 1RMLA 4I30A 1JT7A 2GZBA 3HBWA 5T5LA 1LECA 3VKOA 1URXA 1CONA 5JOYA 1C4RA 3CA3A 1HCDA 2GNDA 3HR9A 3AP9A 3ZYRA 2E7QA 5D63A 3N36A 3NWKA 3LCPA 3WHTA 3CA6A 1LJ7A 3POKA 1WUVA 3OY8B 3NV2A 1XQNA 1KJRA 1S0BA 3D5OA 3WCSA 1WBAA 1AVAC 1KJLA 4YZ1A 1MS8A 2ZACA 4QD2C 4XJWA 4L8QA 1LGNA 5H9RA 4K1YA 2ET2A 4KEIA 1S0JA 3N3HA 2K8RA 2NYYA 4I2SA 3CRIA 1FV2A 1DQ2A 1N1YA 1DZQA 3FJCA 2SBAA 2I1BA 2EXJA 2AQZA 1QQKA 1TWMA 4OZXA 3NV4A 1LOCA 1NLSA 3ZSKA 2BQPA 2DVDA 2DTWA 1G9CA 1HLCA 1CJPA 1W6MB 2OUJA 1S1AA 2GMEA 3M3QA 4IONA 2GNMA 3RMYA 5KXCA 2UUSA 3VT0A 3O4AA 3T1LA 4NO4A 5DZEA 5DZFA 4FPCA 3ZXDA 2A6ZA 1W0PA 5E8AA 4Y20A 3JU9A 3O49A 3WINC 1SLCA 4R9AA 3VKMA 5GZCA 1YRZA 2R0FA 3VKNA 1AVXB 3AXEA 2NMNA 2D3SA 4LO2A 5EG6C 2ZGPA 4GA9A 2OUHA 1IOBA 1MS9A 2P3KA 4YLZA 3AZVA 5DZGA 2FDBM 4I96A 1SLLA 3VKFC 1AVWB 3FJAA 4FPOB 2P37A 2VU9A 2YY1A 1MS4A 1V6WA 1S0DA 2GALA 4P9WA 3VKLA 3PVOA 2VW2A 1FQ9A 4AVSA 1CVNA 4WZFA 1JY0A 2NP0A 2JE9A 4YFWA 4FPEA 1TOOA 2PHWA 3CRGA 4I4UA 4XBQA 1QU0A 2WSVA 1W3GA 1VLNA 1K5UA 3FBYA 3BRFA 1BKZA 1MS1A 1IS5A 3NBEA 3ZX7A 5HCFA 3BA5A 1OFSA 4PQ9A 2A70A 4PBOA 1CE7B 3A21A 1TP0A 2ARBA 4GWNA 4I4SA 1DZCA 3OJBA 3KM5A 1P63A 1G86A 3FJ9A 2WNEA 1ULGA 1LCLA 5CAZA 4XJ9A 1LODA 3VT2A 1MS3A 1JYIA 5HCBA 2LTNA 3BB2A 3BAGA 1G82A 1W6QB 2AUYA 1UZYA 2UURA 1MZ6A 1M16A 1II4A 1AF9A 3SITA 2AREA 5FNXA 5F90A 4EFPA 4ISRA 3PG0A 4QKSA 4EKXB 5KXEA 3VSZA 3HSMA 2EIGA 1LHWA 1IRPA 2WT0A 1G7YA 3AP6A 2YZ4A 5DUVA 2R1DA 2D6NA 2YV8A 2QN4A 1FATA 2LALA 1V6IA 2AENA 5GZGA 2EAKA 1SACA 2ZHMA 2D20A 3Q7XA 1ITBA 3F1RA 3M3CA 5JOZA 5BP5C 1E0OA 2R9KB 4G6MA 2UWAA 1S0CA 4XJZA 1H9PA 4XE9A 2ZHLA 3IM6A 3I2AA 5H9PA 3O3QA 1C1LA 4FQ4A 4XIKA 3WO3A 1CVSA 1V6NA 3NV1A 3BAHA 5GLWA 3I2XA 5JDBA 3WINA 1S0LA 1F5FA 3OJ2A 1SBDA 4M3CB 1WLWA 1Q1UA 4Q27A 5GZFA 2HZ9A 1JBCA 2A6XA 1LOFC 4I4VA 1V6LA 3RTJB 3BADA 4OUJA 2OVUA 1AXYA 1KRIA 1PZ9A 2UWBA 2GNBA 1BA7A 3WUDA 4XXAA 3C2UA 3O4DA 5FRAA 4ZFUB 5CBLA 2F2FA 1XZZA 5DUYA 3WO4A 3WLUA 2ZAAA 3M3OA 9ILBA 1SZ6B 4FOWA 4FOQA 5LK5A 2D6OX 4I4XA 1FWUA 1NUNA 1HKDA 3CNAA 3AYDA 2XG3A 1C57A 2W08A 2HWAA 3IMNA 4BMEA 1LULA 2HWMA 2P39A 4TLPA 5BQUC 5DG2A 1MC9A 1Q8SA 1DIWA 5IK4A 2LIQA 2FMDA 2ZKNA 1ZA4A 4II0A 4R9CA 1UL9A 2E7TA 2GMMA 1YIFA 4AGGA 2ZGLA 5DVHA 3WG1A 4LO7B 1HWPB 4XBLA 2G4IA 1ULEA 2E4MA 3FJJA 5BXPA 3WDVA 3AYAA 4C1XA 1PZ7A 4FPHA 2P3JA 3BAQA 3BA4A 1W6OA 1WW6A 4FP2A 4WVWA 3WHUA 4L4IA 1RY7A 4YGDA 4J2XA 3W58A 4A7ZA 1UN1A 4YW2A 2B7YA 2MIBA 3AJZA 1W3FA 1MVEA 2MC2A 4LO7C 1GV9A 1EYLA 3B9CA 2FHRA 3AH4A 4Q2FA 2ZZJA 3DUIA 4BLIA 4KEKA 4PBPA 1ONKB 1ISZA 5GAQA 1YYNA 4UW4A 3D4KA 3M2MA 2Q9XA 2YMZA 4XILA 2JECA 3CA1A 1IKPA 2UWCA 3RTIB 3RG0A 4I6IA 2Q5TA 3BOPA 3V0BA 4CJMA 3O4BA 4U2AA 4ENDA 1IOAA 4TZDA 1W3AA 1UPSA
chains in the Genus database with same CATH superfamily
1ENSA 1DGLA 3O14A 1D0GA 2XLFA 2OZJA 4XJ8A 2MHFA 1BFGA 3FWEA 2WAAA 4J1XA 1NE6A 2R063 1N3QA 3K4ZA 2R042 4N7UA 2E7AA 4HL0A 2VZ1A 4CDUB 4CCJA 5DABA 1XYFA 3AMPA 3H3UA 2VMEA 4GKYA 4XUTA 2BVBA 5JOXA 2XJRA 4LXLA 2KXLA 4OQ8A 5F5QA 5DAVA 4IV3B 1RJ8A 1NXD1 2PHFA 2BNNA 5AVPA 1ZREA 5FZ9A 2ZQOA 1BQPA 2IHOA 4X6QB 2WN2A 2E31A 2HWD2 1AL0G 3O1OA 1JU4A 2QQKA 3VL9A 3OEBA 1SLIA 2ARAA 3ZM8A 1TMF2 1POV0 2R043 2IXKA 4NHMA 1LOFA 1W04A 3BUCA 1PUUB 2XXZA 5F8PA 1W8HA 5HV0A 5DZUA 5B2HA 1IG3A 2J1AA 3CA0A 4EWDA 1JYNA 2D7IA 1NCQA 5BNPB 1JW6A 4OUSA 5DUUA 1BXHA 5FQ0B 2VQUA 5K8SA 4ZGRB 3WSOA 5JI9A 5FY9A 3LDBA 4IE4A 3LFMA 5JXIA 4HLTA 3RZMA 1U5IA 4LO3A 4P5YA 2HWD3 2WQZC 3MW3A 3R4DB 5KHJA 1Q8VA 4JKQA 2TEPA 2ZGRA 1TMF3 3CQOA 1BCXA 5BPXA 3ZN4A 4XF1A 1FPN2 2BP6A 3GJBA 2VMCA 2AH2A 3ST7A 4DUVA 4XUQA 1X50A 3JUUA 4K8FA 5C8CA 1S4CA 4XYXA 3I7DA 5FMOS 4GKXA 5LBFA 2JJ6A 3KV6A 4MLOA 4FPFA 3FHAA 2VZVA 3IZOA 2E33A 4UT5A 5FKCA 4CDUC 3T09A 2FCVA 3AKFA 1LEMA 4R52A 4IZXA 3GZEA 3WY6A 2MLLB 2A5ZA 1MVQA 2ADEA 1QJX1 3KVBA 3O1UA 1W6NB 5FPBA 1Q8OA 3GZTB 3TRSB 1FPN3 4FFGA 2F8XC 5L73A 2PFWA 4PIXA 2BFHA 1FNZA 4ARXA 2R1BA 2DWRA 3T8SA 3K46A 4QQHA 5FOBB 1V9U1 4Y1YA 5FZ6A 5FDBA 3UJ0A 1YI7A 2WKKA 1Z78A 3H6RA 4HN1A 2JICA 4KU7A 4LKSA 1LAJA 5F6LB 1O6UA 5BQUA 3KS7A 3DXUA 3VZMA 4AVBA 4GOYA 5FYCA 3FJDA 1H8TA 2WZEA 4H7LA 5BNPC 3H6SE 2ET1A 5L36A 2XVGA 3HVDA 3ZFGA 2ARXA 4E8CA 4OEFA 2D43A 2OW4A 1MQTA 2KR2A 5LBEA 4LO0C 1Q56A 1VBE1 3B5LB 3UESA 1HB1A 4LO4B 2JDPA 3A23A 1GU3A 3PDQA 1YQ8A 3LEGA 3FLTA 4LBQB 3DKWA 1N1VA 5D8AA 3WUCA 4QHOA 2Y0OA 4EFQA 2Y9GA 3URFA 4XBNA 1XG6A 1SLAA 3VT1A 2RG4A 5GLVA 3ZR6A 3LA3A 4I8MA 2RJLA 4X39A 1TEIA 4YVSB 3KT1A 4QX0A 5F5AA 1RUC2 3KCYA 4OZOA 5IAVA 2A1XA 1QJFA 1AYN1 3IBMA 4S2FA 3USSA 1GKBA 1QQP1 4Z2WA 4OEEA 4KGQA 5T5PA 2B8MA 3MLJA 4I0YA 4JQTA 4H55A 4BJ0A 1QH7A 4FPKA 5EHDA 4WBCA 2QYIB 1PVXA 1EAH2 1GANA 3RMXA 4F83A 5LEKA 3AKGA 4GJYA 4QKBA 5BNNA 2LUWA 4P0LA 1ULFA 2RE9A 1AR81 3CBNA 5B2GB 1AYM1 4Z2AA 1R8NA 5EWSA 2Y9XE 3PTRB 1ENQA 1ZM1A 1RUC3 4BM8A 1OH3A 1GGPB 1J3QA 1ZRRA 2V4AA 2HKXA 2ZQNA 3H1YA 1OKQA 1W8OA 4K3UA 2JG9C 2O14A 3VBRB 2X5IA 2J22A 2WAOA 2IZWA 3KCXA 1HX6A 1DFQA 1ND3B 1R1A2 1EAH3 2W1WA 1GNHA 4DO0A 5BNOB 2BWAA 2W1UA 2ZKLA 4CXXA 4URAA 3AKIA 1V6UA 3WA1A 5JVVA 2IWGB 3H7JA 1ENXA 4X38A 4TN7A 4XVHA 3B02A 2YC2A 3Q8BA 3GHNA 4CCCA 3BTYA 3RS6A 1RVF2 3N9OA 4A3ZA 5J96B 4PT6A 1BLDA 2ZGUA 4ZFYB 4FGFA 3LEIA 3H1MA 3HBKA 4O61A 2HEWF 2JDAA 3SNMA 2BOJA 1WMFA 3T0BA 1GZWB 2VMGA 3ME2A 1CAXB 4COYA 1R1A3 3K4DA 4W6WA 4BIFA 4AI2A 1AZDA 4ZA3B 3IB3A 2VW1A 3USUB 3WNOA 2XUMA 3BRGC 1W9TA 2NLRA 1DFCA 1XNKA 2XBO1 3S5QA 2Y9WC 1I3HA 1PNFA 4RS5B 3ZIWA 2WNVA 5AFBA 1RVF3 4OFGA 1CWPA 2OXBA 4LR4A 1SMVA 2TNFA 3RZLA 1PZZA 2MNGA 3ZDSA 3FUOA 1X36A 4AEJA 4EZHA 2VUJA 2WN3A 1JS9A 4CXWA 2ZGKA 3N7KA 4UAPA 1CD3G 2VZTA 3KF5A 4AZZA 1VCLA 1DBNA 3ZC8A 2JB8A 3AC0A 4S2GA 4OVEA 4UF0A 5FZOA 4XF0A 2VD7A 2XONA 3D0JA 1ND3C 5BNOC 4AN6A 3CJIA 5F3GA 3MIBA 5D2AA 4GP0A 4ITCA 4D0ZA 4YM3A 1UYZA 2WFF2 1M06G 4HOOA 2JEMA 1LHOA 1YXWA 1UIJA 2HBUA 1H6YA 1RUE1 2J1SA 2WIIB 5FYBA 4JC1A 3POGA 2XB6C 1W39A 1T6BX 4UW5A 4DZGA 5C3RA 3K3NA 3ZYGA 1B35A 5KWRA 4AGVA 4CPBD 4OI0A 1DQ5A 1G9FA 4YARA 4K8RB 1JOPA 4AVTA 4QX8A 1NLQA 4QX7A 3WF1A 5H9SA 1HKNA 3ZFEB 3QYDA 1XJAA 4DCKC 4JX0A 3VD5A 4COVA 3T1MA 2WFF3 4USPA 1LKNA 3WMVA 5CG9A 3HT2A 2D97A 4E8DA 3C7OA 4UXAA 1JH5A 2Q8OA 5F5CA 1Q8QA 4RS5C 1OVPA 4JP0A 2E26A 5EHAA 2W91A 2NM1A 3UL2A 2Z4FA 5A80A 3JCIA 2ZZQA 1DQ1A 3A4UA 1BVP1 1N1SA 3FJFA 1JLXA 1HIXA 4QHZA 4JQ0A 4P0JA 3W9TA 4DNYA 2GU9A 1OA4A 5FIXA 5FXVA 4AG4A 3THDA 1A8DA 2CGOA 1YFUA 1WWYA 4Q29A 1RC6A 3JZVA 4H2AA 2YROA 4LLFA 2VOXA 3DGTA 1VRH1 1T6GC 3SLIA 1UOGA 5T50A 1DYKA 3LIHA 5FZ0A 3VBUB 1F9KA 3FUQA 4CDQB 1QJY1 5K0UB 4GB32 1YQ2A 3T2TA 1F31A 3HNBM 4HG6B 2W46A 2BEBA 4XMIA 1N1TA 2GP5A 2VC9A 2ZX1A 3D8CA 4QB2A 1ZNPA 3I2FA 3OYWB 4LITA 1GBGA 4GQ7A 4HK8A 4H7MA 1VALA 3Q8FA 5JMCA 4A4AA 1NCRB 1JOJA 1UD1A 3VBHB 2PA7A 3ZFEC 3NMBA 4FQZA 1ASJ2 4BMBA 4ZLBB 4FI9A 1RUI1 4EN8B 4Y1ZA 5BV6A 2RM22 4RN5A 4ASKA 4AAPA 3AZXA 4QO3A 1UY2A 4GB33 3RZKA 4MYEA 3IKWA 5I91A 1GSLA 2YGLA 3ALQA 1BFFA 1KFXL 3ORJA 3OOXA 1PO12 3T08A 4EYUA 4QBVA 2D98A 2XWJB 4AVVA 4UFIA 5FZYA 3HMYA 2Q4SA 4Y1XA 2VSAA 1ASJ3 1BASA 4IEUA 3GNEA 5SV5A 2XR4A 3IDCB 2HWB1 2EAAA 2RM23 3AMHA 3ZKYA 5D61A 1OQ1A 4GZ9A 1WBFA 1WW5A 3K75B 1N3PA 3V79C 4YG6A 4CDUA 4JDNA 3GF6A 4RR3B 1A34A 5HXVA 4MGKE 5BVPI 2O8OA 3O0WA 2DREA 3MGUA 1PO13 1PVC1 3LD8A 4DXTA 3VBUC 2CV6A 3WXPA 4XUNA 3UJ4A 1AFCA 3NBDA 2FO1A 5T5OA 4NJ4A 2AFGA 4Y5TA 1APNA 1GLHA 4HONA 1YWKA 2WQ4A 1XE8A 5C33A 1V0AA 3N35A 2CL2A 4BXSV 2VCCA 2CDPA 4XACA 5HPOA 1Q04A 5JMOA 1NCRC 3VBHC 5DAPA 1V6KA 3G7DA 2QQMA 2D93A 2HWC2 4GMP1 1V6XA 4E4HA 1NZKA 3AKTA 2J42A 2WJSA 4N7IA 4AE2A 4XW3A 1GP5A 2E6VA 1MR5A 3BU7A 4AEDC 1JTCA 4AR2A 2QUOA 2VQ0A 3ACFA 4HN0A 2HLEA 1Z0HA 2W1SA 5LASA 3SCHA 4DXRA 1JYTA 2F17A 2DS0A 1ZBE1 4AVAA 4QT6A 4QXHA 3P6JA 1VBA2 4C91A 5DAQA 3MO4A 3IDEA 1ILR1 1OQEA 1IPKA 2VZQA 4IESA 3VDBA 4QDRA 3PUBA 4ZFWB 4AHZA 2HWC3 4DPNA 2CHHA 3L2HA 2XJVA 3BGAA 4PIZA 4B1LA 1GICA 1W99A 3E6DA 4WVVA 4Y3OA 3C9ZA 1OA2A 1CPNA 1VPHA 3PVEA 2VZ3A 4ONUA 4CEWC 3AM2A 4RGGA 1XYNA 1GWKA 1H1IA 4YW1A 4IEPA 1VBD1 5C7GA 5FZUA 3ZFFB 2NTDA 1RMU1 1VBA3 3ZYBA 1RIRA 2PYTA 1JYWA 3X29B 3MEPA 4XMAA 5C5TA 1AXZA 1O91A 1W03A 2CNAA 2VVEA 4W6XA 1WMXA 3N9NA 5FY4A 1ZRFA 1Q03A 2YU1A 4AK3A 3I2GA 2YHJA 1HQWA 3IIRA 1CAWA 1D2SA 1IILA 1SCRA 5FPZA 3NJVA 1W6PB 5GJ6A 1S0IA 5EP9A 4XCBA 5FZKA 3U0ZA 2ZEWA 4GALA 4KBZA 6I1BA 1Y9GA 3HN1A 1QOOA 3KCCA 5DQ0A 4OHYA 2V73A 4PLOA 4W4ZA 2DRZA 4NHLA 1WLTA 2JG9A 4GULA 3SCFA 3WV6A 4DUWA 4XKIA 4LBKA 2QKDA 1FNYA 4LO1C 4RHV1 2XQXA 3THTA 5E89A 4BOWA 5C4WC 1CIWA 5JXGA 3IM5A 3B69A 5A3MA 4XF9A 1LOAA 2BBAA 1W0NA 2BVVA 2HEYF 2JE7A 3E5UA 4RQPC 4D0TA 2P5BA 4PCRA 5I8TA 3H8OA 4CPBA 4UFLA 4CUGA 2BFUL 2DVBA 1QKQA 5DPNA 3U4SA 4CDWC 5JZGA 3OY8A 5LCWL 2QQVA 3GZAA 3PJQA 5BXTA 5CZKA 1ALYA 2Q1FA 1VE0A 4MHUA 1U5XA 4IE6A 3U14A 5M0TA 2NVHA 2J1RA 2W94A 1H2MA 1PGW1 3J8F1 5BNQA 4K20A 4NHYA 5CKQA 3NAPA 4ZKTB 3ZR5A 2Q8CA 3ZFFC 4MZFB 3BAOA 2ZMNA 2GC3A 2OQ6A 4FO9A 2SLIA 4LE3A 1ISWA 1KDKA 5FZZA 1GP4A 5FLHA 2Y8KA 4LA2A 4GAIA 3UJOA 4Z8BA 3TN91 1OKOA 4YGEA 3B7MA 3ZYJB 3I49A 1UO9A 3AZYA 4BLJA 3ZSLA 1FOD1 2W39A 1O4TA 3ES4A 3WDWA 2XJTA 4HSLA 5LA9A 4EB2B 3ECQA 3KB5A 4LEJA 3HPNA 3LOBA 5FYUA 3AP7A 2WT1A 4Z9WB 4L92A 3O12A 4Q1RA 5C3SA 3OCPA 2DRYA 4MSVA 3RRDA 4BQYA 4FPJA 4LNVA 4XFHA 4FOYA 3KV5A 4JGYB 1J59A 3V0AB 2ZBJA 4QQPA 4XTPA 5ISLA 1ZRDA 1CX1A 3CQAA 2D6LX 4RA0A 4XJAA 1F35A 2AAIB 4R6UB 5FZEA 2WWJA 5IUQA 3C7EA 1EYBA 5FFOC 1B09A 3TEYA 1HRV2 1BJQA 1REFA 2ZGQA 3ENRA 4E4SA 2ORZA 1K12A 1D4M2 3K77A 3MYXA 4QPYA 2VBPA 4RFT0 3ACHA 1Z7S1 4A6SA 2VLCA 2PHUA 4MGZE 2PMWB 1N3OA 1GNYA 3MF9A 3ZPYA 1OLMA 2JDHA 4JAAA 1YIPA 3OD4A 5LATA 2RDRA 2A3WA 5IT6A 2A6VA 2YGMA 2ZGSA 4JQRA 4DY5A 1W6MA 3WNXA 3WMUA 3RVHA 4N53B 5CFCA 1RG8A 4RS5A 4HVQA 1ISVA 1DDLA 4QU2A 5BXRA 1S55A 1HRV3 2OYZA 4JKXB 2CTVA 2XQRA 1D4M3 1E5RA 4A41A 1XOYA 2DU0A 3POSA 1WD3A 3A0NA 3ZXEA 4I1BA 4QALA 3OGFA 4IEWA 5GLZA 4BDVB 4DQAA 1DQGA 3WDTA 1CR7A 3QACA 4DS0A 2ZGOA 3GJAA 4XFGA 3RFRA 2E53A 5T55A 5A7WB 1WCDJ 4IY8A 1OA3A 1QOTA 2Z69A 4P5HA 5LBBA 2XOMA 3SC7X 1OLQA 4FTBA 1UOFA 4LIVA 3OSDA 3W21A 4XQ4A 3LLPA 5I0RA 5IHRA 3ILNA 3B9UA 4JGYC 4QB6A 2EALA 3D0SA 4DENA 3F62B 4JV4A 3QD6A 4I0AA 4ET7A 1CAUB 5GLTA 3WF4A 3PUSA 1LHVA 2NPIA 5A3LA 1YQ5A 3W59A 3O44A 4P08A 3Q7WA 2BGCA 4H14A 3NKTA 4YZ3A 5JIUA 1UIKA 3FJEA 4LT5A 1PIV1 5GALA 5A6ZA 3LAGA 5FWJA 4R8HA 5CB7A 3AP5A 4QPIB 3UETA 4XJUA 4K40A 5IATA 1AR62 4CP9B 4CCKA 1V9U2 2JG8B 3I4IA 2PHXA 4LUMA 5FMCA 3NJZA 2WZPP 4G9SB 5T54A 2XHKA 4XEZA 5C3QA 3KSCA 2JWPA 1Y3TA 2P34A 3JUTA 5E6HA 2QE3A 1HXS1 4GAFA 5L9BA 4LBLA 8I1BA 3GBGA 5HV4A 3J7HA 4YVWB 1XNAA 1DGRN 2GDFA 3UKTA 2DCJA 4BHPA 4Q91A 4SLIA 3BAUA 2Y6JA 3IWZA 1G8WA 1AR63 2QFEA 3K4AA 4MOAA 4W65A 1JQZA 2Z79A 3A07A 1V9U3 1AR71 1RINA 3VBOB 2D23A 4I4RA 4J2YA 4QBCA 4LPLA 4I3NA 2FDIA 2ERFA 2W2IA 2Z48A 3ILRA 1CZVA 4Q0PA 2DTYA 1YLLA 5G04L 5T5JA 4TXWA 2QZ2A 5CADA 3K48A 3EXUA 3ZXGA 4QU1A 4HANA 2V4VA 2F4LA 5JSOA 5IK7A 3FE5A 4LBMA 3ZXJA 3AJYA 2B42B 5BOWA 4YWAA 2V72A 1AYN2 1QQP2 2VNOA 1TME1 2G9ZA 2K46A 4AQ2A 2CWMA 3LA7A 31BIA 2KI6B 3U10A 3BAVA 4CCOA 3BALA 4A3XA 1LOBA 1QWRA 1W06A 2PTMA 4OWLA 4QPIC 4TWTA 5FMBA 3VHNA 1IS4A 4P9XA 2FFVA 4Q8LA 1AR82 1PX4A 3VDDB 1DQOA 3EF2A 4LO8B 1DGWX 2BJSA 4KWJA 4AEDA 1UZZA 3HWJA 1VMJA 4KU8A 2DUPA 4WVMB 4C1WA 3I29B 4BYYA 5FBZA 3C7HA 5L7OA 1AYN3 4MZHA 4JPZA 3LEKA 1QQP3 4MADA 1COV1 1RUG1 4O9GA 2RR11 4K1ZA 4QQOA 1H0BA 1XRUA 5APAA 3WR0A 2HWE1 4YVWC 1NE4A 4ES9A 3WO2A 3VUOA 3PU3A 3I3MA 3R05A 3IT8A 1SFYA 1UMHA 4HBNA 4KI5M 1K5JA 1HWNB 1AR83 1VBB2 4AQTA 4G1RA 4OLLA 4CEWA 1IT0A 2Y64A 5KHHA 2W1QA 4CUAA 3VBOC 5FLJA 1RHI2 4Q4V2 3WOGA 2XJUA 5GM0A 2WINB 4FFFA 2FDKA 3BTXA 4Z8SB 4YZ2A 1J83A 3CDZB 4BZ4A 5I8YA 1X8EA 2D7RA 3HOMA 5H9QA 5I93A 4JAWA 2E63A 1UPIA 3BVCA 3N9PA 1OQDA 1WD4A 3NBCA 4CDXA 5BXSA 4KL1A 4NPMA 2YYOA 4LO0A 4Y20B 2RS52 3NV3A 1VBB3 2XBO2 3MW2A 4A7YA 1FMMS 2H0VA 5D21A 4M01A 5DUWA 3BRDA 4YW3A 1RHI3 4Q4V3 5DG1A 5CU1A 1WW7A 1NLRA 1S0GA 2ZA9A 4EEEB 4P02B 1JYVA 2FZ2A 2W9XA 2JIJA 3BB6A 3VDDC 4AFAA 5C9AB 1N47A 1OPMA 4Y22B 1J84A 3H50A 1Z2VA 3FJBA 1POV1 3WQ1A 4CRQA 2WRAA 4XDOA 5FJKA 3O7OA 5C4WA 4EN0A 1AJKA 1ND2C 2R49A 3LIGA 2RS53 1RZOB 1TIEA 1CJDA 1SCSA 5LRRA 2WYSA 5FYSA 4RQPA 1W6QA 1VB2A 2VQTA 3HT1A 1YNAA 1XE0A 4NIAA 4OUEA 2Y38A 4Q4W1 4QWNA 1YO8A 4CDWA 1JZ8A 1BLAA 4LQRA 4YOLA 1H9WA 1WZXA 4NR1A 4MZUA 1KGYA 1L7LA 1WBLA 1RUE2 2RVAA 2JDMA 1Y4WA 4LKFA 2Q1MA 2CAVA 3LKJA 3MIDA 4JRLA 3T0DA 3NJYA 3Q8EA 4MGSA 1YFYA 5BP5A 2WBCA 3NSTA 3RPQA 2FD8A 3O5WB 5FP9A 4HJJA 5IYYA 4QDQA 1JT4A 4YM2A 5EYYA 2XJQA 1OLME 2RJKA 4AW7A 3UNPA 2BYVE 2K43A 3OBAA 4HR6C 4BIOA 3QH6A 2VTXJ 2XL7A 4I1EA 4TTGA 4IE5A 2UYAA 1UU5A 2PLV2 2RS11 4D7SA 3OJMA 4GOVA 1UZ0A 4DIQA 2IVIB 1LB2A 21BIA 3AMMA 4O9EA 2PHLA 4AYUA 3ZC9A 3S8JA 1JUHA 4UWDA 3HAGA 4W50A 5JIAA 4BQ5A 5AVAA 3UV9A 4I01A 4P0KA 1QNYA 1LU2A 1O4ZA 3GZUC 2WWSA 2A7AA 1TZOA 3EHKA 3AH2A 2K0GA 5K4LA 3TNPB 4G9MA 3JD72 4DEPA 5EC5A 1MS0A 4AI8A 5J1XA 1JT3A 2Q8EA 1LENA 1HJFA 2PLV3 4LO2C 1U12A 3LPGA 4OMCA 4CP0A 5ABJA 1HIBA 4AHWA 1VRH2 1RJ7A 5A3NA 4XPVA 1SR4C 3D7WB 4ZZ5A 3H9AA 1WLCA 3WNPA 1JZ3A 1QJY2 3ZXLA 1VP6A 2JENA 1A78A 4TSVA 4LULA 1Y9QA 5F8WA 4Q4X2 1DP0A 2VOKA 3JD73 1YJLA 4IHZA 2MPFA 3AJ5A 2PAKA 1HB2A 4I4YA 2QQOA 4UBHA 1VIWB 1RUF1 5EYXA 5A7SA 3UD8A 3IPVB 1ZBA1 1VRH3 2YXSA 1RUI2 1O4YA 1OOPB 2GMPA 2C9AA 2W5FA 3OPZA 2Q1ZB 4M3CF 1QH6A 2QTWB 5IK8A 1JXNA 1QJY3 3RWKX 1CN1A 4COZA 1R081 2WLPA 3S6PA 4AI3A 3DECA 2JX9A 4BK5A 1ZA7A 3B93A 4Q4X3 5FMDA 4J2SA 2A6YA 1H30A 5CNAA 3FFZA 1LESA 4IEXA 2HWF2 4LBNA 4WVZA 3JQXA 4CCEA 4I0BA 3CZUA 3E5XA 3OGJA 3VV1A 1OH4A 5T52A 2IWTB 4B4PA 3O4OA 5F3IA 1AXKA 3SH5A 2WA4A 3WW1A 1TTUA 1P8JA 1RUI3 2HWB2 5EJZB 1H1AA 5J37A 1IKQA 5IWFA 2DCTA 5FZIA 4IV3C 2IC1A 1I1BA 2A75A 3H0OA 2L9LA 3POJA 4KC3A 3SH3A 3AL6A 4PDWB 5C3PA 1RB8G 4M3CA 2IXCA 3ZXAC 2HWF3 3D3AA 1MZFA 4QPGB 4LBJA 4FPLA 4COUA 4GH4B 1IS3A 5F2WA 3V64A 4YG0A 3HQRA 3AP4A 3H7YA 2HWB3 4Q0VA 5FY0A 3WCRA 4G6JA 1SPPA 1UNBA 3SQOA 4JKMA 1BFCA 4LTAA 5LA1A 1DF0A 1IQAA 4PF5A 5FZ8A 3UGGA 3EMRA 2NZ9A 3NNMA 3HN3A 1PK6B 3SEPA 1OOPC 1C28A 1VBC2 4V1PA 5KXBA 2X2TA 2Y9FA 3U75A 4A44A 2ERMA 3FJ9A 4Q4Y2 1IRAX 1ULDA 2MEV1 3AL5A 41BIA 1YHFA 2I2SA 2IXJA 4AGRA 4QD2B 1EY2A 4D7TA 5GLUA 3NJ5A 4AAXA 4IEVA 5A7WA 1ZBE2 1R091 4A7KA 2FCTA 5F37A 3FLPA 2BW8A 4AXOA 4X37A 1K5MA 3OF1A 4I0WB 2DVAA 3GCXA 2R6QA 2R0HA 3LA2A 1OPOA 1VBC3 4PIYA 2BUKA 4UFMA 4P9YA 3WG3A 1N4KA 2RSTA 3B00A 3B01A 3ZMNA 2ZXQA 4Q4Y3 1PUMB 1CAUA 3RJ2X 2XOAA 2DUOA 3FMGA 1QOSA 4IV1B 2VXTI 4WBBA 4PDWC 4XF3A 1ZBE3 1HDKA 1TFMB 1Q8PA 3PHZA 4QPGC 4UYBA 5FYHA 3VBFB 4GH4C 4KNCA 5J48A 4HA2A 2YPJA 5JXJA 5EFUA 3DPRA 2ENRA 1STMA 1U5ZA 1GZ9A 3DF0A 1XNDA 5CFDB 1QDCA 4QKDA 5ACA1 1FMZA 4OYUA 2NS2A 4YZ5A 2P39A 2CAUA 5LA2A 2DYCA 4IETA 3P3NA 4JGZB 1DZTA 1PK6C 1EV11 1LGBA 2DF7A 2JE8A 5A3TA 5AC91 4FPYA 1QJU2 4KGGA 5DDJ2 3TNQA 1U5YA 4XTMA 1T4QA 3KHCA 1WMDA 2ZGMA 4NIIA 4E9KA 3RWNA 3O0VA 1HJGA 2ZS6B 3NNGA 2VH9A 2AC1A 1MEC1 2ZX2A 3ACIA 4RHV2 4YGBA 4QXCA 1ZRCA 3ILAA 1GYKA 2VTFA 4HPKA 5FK7A 4Z07A 3TYJA 5TSWA 1K5VA 2GN3A 3O1PA 1FYUA 3IAQA 4YVSC 1FN0A 4Y33A 4P14A 4NAOA 5DN2A 3BKZA 4QKFA 1QJU3 5DDJ3 2EIBA 3MV11 1BHGA 5FWEA 2BEAA 3Q7YA 2JDZA 5FUPA 4DRVA 1X33A 1YFWA 2Y6HA 5LW9A 1Z4SA 4H75A 1SBFA 3KLSA 4LO7A 4RHV3 4D69A 1LRHA 1NQDA 4IV1C 1KQRA 4YM1A 1PC8B 3SHRA 2C0ZA 4Z1VA 1MPXA 4B4RA 1HCEA 1PNGA 1R1ZA 2WBKA 4P00B 1W28A 2ZHNA 3P1IA 3RI8A 5CVRA 4DB5A 2BRTA 2XJSA 3DYMA 1HQLA 2C1FA 4EJRA 2X2SA 4OHZA 1JZ4A 2YFUA 2WR9A 3N7MA 1NY71 3VDDA 4OHVA 3JB4C 1PGL1 1ONAA 2O1QA 3MPBA 1WW4A 4LO8A 3VZKA 5A7OA 5BUVA 5CFDC 3VWCA 1XNTA 4GWMA 4AN7B 2DDUA 3VBRC 2VUAA 3MW4A 1MD6A 2LRPA 3WDXA 4RGKA 4JGZC 5FCCA 4FPGA 1ND2A 1O59A 1OT5A 1QQLA 1ACCA 1ABRB 2P6HA 4C8DA 4NRPA 1AR92 2LM3A 4NOTA 1NZIA 5JI7A 3IIIA 2BV4A 1GP6A 4QGMA 4C0BA 2KLLA 2RS32 1JTZX 2KD7A 3S8KA 1BZWA 4LBQD 1W3XA 1MZEA 1GWMA 3PURA 4WM7A 2XHNA 3ON7A 4FAGA 1IS6A 3ATGA 2V09A 1CESA 5CISA 3UD7A 1XE7A 4L4HA 4QKRA 4IE7A 3WW2A 1Y7BA 4Q5OA 1LR5A 2YBPA 5LRSA 3A22A 5A33A 3OGVA 1AR93 1Z7S2 1BARA 4L97A 3RQ0A 3N0KA 3LOIA 2G1MA 4JCKA 4M00A 3SMHA 2KI4A 2W68A 3CRHA 1AVBA 2D44A 2OZ6A 2RS33 4J6GA 1GFF2 4PLNA 1VB4A 1PHMA 3I59B 3QR5A 4H04A 1J0SA 3BTAA 3S5AA 3RJRA 4DEQA 4M4RA 1V6MA 3AFGA 3FJHA 2R061 1DZDA 4JHZA 4MGTA 4Y22A 4G4FA 4EE2A 1J3RA 1WCSA 2Z5WA 2DFCA 3H8UA 1Z7S3 5FXWA 1FT9A 5IK5A 2E51A 3MIGA 2A3XA 1CIYA 3EO6A 3HEIA 4YZ4A 1UKRA 3GM8A 2NN8A 5FO7B 3WX5A 4CEYB 2R16A 5A6XA 2CGPA 2ZMKA 3OD0A 4X8PA 4YW5A 3T0AA 2BNOA 4B8EA 3AKHA 4AFBA 3ASIA 3JBG1 2WL1A 4R4ZA 2D3RA 4MXWB 3BI3A 5FUIA 3AH1A 4WV8A 3I8TA 3LSEA 5JLVA 5LY2A 5JAXA 5D62A 2VG9A 3LZZA 1IPJA 2AR6A 4XC9A 2R041 5I8SA 4AHXA 1SR4A 4I4OA 2YC4A 3CIHA 2ORXA 4R9BA 2DURA 4MGIE 3DKQA 3ZDVA 2Y6LA 1IZ3A 1PO22 1PGSA 4XZPA 2O0OA 4CP1A 2F2FC 2GO2A 3F2ZA 4CCNA 2AYHA 4QGLA 3I2OA 3H6QA 1LNSA 3AFKA 1IJTA 4M3CE 3MPPG 5JUVA 1PMHX 2CY6A 3WF3A 1UOBA 1WCQA 2ADDA 1FWVA 1PIV2 2HWD1 4ZU4A 5A7NA 4EN7B 1TWEA 4XFSA 3KV9A 3OTFA 3KMVA 5E24E 4AOCA 4D8HA 1S2BA 4XXPA 1XSRA 1MZ5A 2D3PA 2A71A 5T3NA 4FVVA 1SBEA 1AVUA 3T2OA 1PO23 2KH2A 3MZHA 5FZ3A 3SKJE 1LGCA 3TWIA 4LIUA 3O0XA 1JODA 1TG7A 3WP3A 2FGFA 5FREA 4I3PA 1DU3D 5CYYA 4DXSA 1PIV3 1DLLA 1UKGA 5F32A 1HQNA 3Q9OA 3SCGA 1RTVA 3AZZA 1CZTA 1ZVFA 4MXVA 4CZSA 1I1EA 1JYCA 1FPN1 4CDQC 5K0UC 1NA1B 1NOVA 2D7FA 4IV3A 1RUOA 1Q5OA 4QX2A 5FZHA 3ZN6B 2JKXA 1Q3EA 2ES3A 2DCZA 1ULCA 3SISA 3CO2A 1RITA 1W6OB 2C5DA 1AX0A 3DEMA 1JUIA 3ZSMA 7I1BA 4YPJA 1RUD1 1CQ9A 2BDRA 1TVGA 3UJQA 2IFWA 1UY3A 3ZSEA 3ROUA 2ZX0A 3PLQA 3BX1C 2ILMA 4MZGB 4XFTA 1AX2A 3GDBA 4HT1T 3CAHA 1WMEA 3IAPA 3WDYA 5BNPA 2VO5A 5A6QA 3LSDA 4OWKA 1MS5A 4M0NA 1SDWA 3MDPA 1KEXA 4F7ZA 5FQ0A 3N9MA 2UY9A 4IEOA 3SH4A 4AVCA 5F7UA 3IPVA 4I02A 2VXRA 3BN6A 2Y6GA 3A0KA 4M0HA 1FMD1 2A3YA 4HXCA 3WVJA 2D24A 2BGPA 3PVNA 4LUKA 1AL22 1YCIA 2WNUB 1C8M1 1JZ6A 1KXGA 4ZS3A 1R8OA 1ZRIA 3GCWA 3KT4A 3MUY1 3S7IA 2J7MA 1TNFA 1BK0A 2B4KA 2A6WA 1DYOA 1EPWA 1WLDA 1LOEA 2VW0A 4JKLA 4XFCA 1FAYA 3N7LA 4GIQA 1COV2 1S0EA 1O5LA 5GZDA 3RGBA 5C6CA 5F9TA 3GGLA 2E4MC 2I45A 5EIYB 5K9YA 3O4CA 4ZBVB 1UAIA 4RR3C 2D5HA 2WS92 1NKGA 3ZSJA 3HD8B 4QB1A 1W6NA 2P23A 2X29A 1AL23 1NA1C 1W3VA 2OIIA 4YYOA 4NWVA 2P2KA 3ZOIA 1EV2A 1JHNA 1FGAA 3C7GA 2Y26A 5FPXA 2XDVA 1COV3 4QPGA 3W5MA 5FYTA 4AFMA 3RZGA 1FI2A 3CLPA 3CL1A 3VGIA 3R4SA 4YW7A 2WS93 3QH7A 2RHPA 2G9FA 2C9KA 5FYYA 5IVJA 1SFNA 2EXKA 4FAHA 3CJXA 1EAH1 1TNRA 2PN5A 2VR4A 1XU2A 3V0BB 2X09A 2YUGA 1PK6A 4I09A 2XGXA 5FYMA 2P3IA 2B9VA 4J2KA 5FPUA 5FZMA 4AWDA 4FSJA 1DYPA 3VZNA 2HEVF 5CA6A 1G6NA 2D6MA 5FYVA 4LBQA 5A1FA 1GQHA 1DQ4A 1EVTA 1VJ2A 2VM9A 3VHPA 3OBZA 4HVOA 1SQ4A 1QGLA 3I2DA 4PC4A 5C71A 4NIGA 1R1A1 5C5UA 5FPLA 4QPWA 2BGOA 1KITA 4OCTA 4YVSA 2Q3NB 3LWCA 3PIGA 5FYZA 4Q4W2 3P3PA 4CU7A 3D6EA 1HV0A 2R072 2VZPA 1PM4A 1HB3A 4CTEA 5L9VA 1GZCA 5FKBA 4X3AA 1NQJA 2BFUS 4CYDA 1C1FA 1POV3 1H4HA 1RVF1 2WT2A 1UX6A 2ZGNA 3ZPOA 4M4PA 1QXMA 1S0FA 2R32A 2AGSA 4JDOA 3WNKA 2DFBA 2JDKA 1VRBA 3POYA 3CU7A 3VD4A 4PF1A 2AEYA 5SV8A 3FL7A 1SLBA 4Q4W3 2R073 5JR2A 1LHUA 1AJOA 1SHWB 1OMIA 2JD4A 5CFDA 3VD9A 1A6CA 3GYDA 2CU5A 2X53S 2Y0IA 2RS12 2OT7A 3VBRA 5J09A 3CHXA 1ND3A 5BNOA 2DVGA 1JN2P 2PHTA 3K2OA 3W20A 1WCKA 2XUEA 3HQXA 1H1MA 4FP3A 1Y43B 1NCQB 2AACA 4K21A 4R4XA 4Y26A 1YF8B 1GWLA 4YG3A 2YBSA 3WNMA 1RXGA 2YBKA 4NPRA 5DUXA 3RI9A 4F3JA 2Z49A 2VMFA 1JZ2A 2N7GA 1DQ0A 1K3IA 1LEDA 2E9QA 2ZMLA 1DCSA 4IEQA 3WG4A 2BPA2 2FDHA 2J1VA 1L3JA 2VUCA 1CPMA 1KNMA 3IIAA 1GZWA 2RS13 1CAXA 2FMYA 2WZR1 3O1VA 2WFF1 1ENRA 1VAKA 4ARYA 1OF3A 5C8CB 4F34A 3I2JA 3USUA 1QXJA 4XDPA 3K3OA 3WZ1A 1C5IA 1YUDA 4W8JA 3MALA 5A3OA 2WLQA 3PUAA 3PVBB 5FOJB 4B29A 2PQSA 3E8LC 3AYEA 3T2PA 1BEV1 1DHKB 4IY9A 3SKVA 3MIFA 3POIA 4WM8B 3CZJA 4YFZA 5A1LA 2ESUA 3IDBB 1GOGA 4E4ZA 4HSJA 4B3NA 3ACLA 1ZBA2 3P53A 4OWJA 1FX5A 5DXDA 4CU6A 4KG8A 3EJKA 2OPWA 5FZDA 2RG9B 2RQ9A 4XF4A 3H6RB 2EXIA 3VBSB 4ZXEA 1D0HA 3I3BA 4Y1VA 2GC2A 1V00A 5HCAA 3S0MA 2DV9A 5HXMA 1H8TB 2JKBA 3GBFA 5J36A 2BERA 4PQQA 3ZFGB 1RUH1 4ATFA 1J58A 4GD4A 4Q0QA 3AZWA 1MQTB 4FCAA 4LO3C 3EQEA 1W8TA 2YUEA 1ZBA3 2K2SA 1T9FA 3K1XA 3JRRA 1QJX2 1X8MA 2ARCA 3UK9A 2KM2A 1R64A 3VDAA 2L5XA 3WD5A 4R9DA 3ZFEA 2ZABA 5D8AB 5JCTA 1XBFA 1X7NA 2BU9A 2C4XA 4JTOA 4KBBA 5IFTA 4LK6A 4DRRA 1O3RA 1ODMA 1KDMA 2Z42A 1U0AA 4N53C 4Y5SA 4XCAA 4YM0A 1FV3A 2D6KA 3CU1B 4ZOTA 1H2NA 2ZHKA 1W8FA 4TLFA 1V6JA 4BQXA 1QJX3 3ZXFA 5C70A 4WM8C 1ASJ1 5FZ7A 3ILFA 4UW6A 1AHSA 2NMOA 4QQLA 5BNNB 1E5HA 2FFUA 5F8SA 3VSFA 1VAMA 2RDSA 2TBVA 3ZVXA 1JLYA 1VBE2 2HYKA 2KKIA 3IAGC 2P1BA 4ZXKA 4ATEA 3AK0A 1LHNA 3VBSC 1BFBA 5DSSB 3EB7A 2H0BA 3IM7A 2BBVA 4KWKA 1HN0A 1WA6X 4CU8A 1H8TC 1XNBA 2DVFA 2VCAA 4S2HA 4USOA 1V6OA 3BIWE 5FTTC 5K0UA 2X5IB 4INDA 3VBUA 4CDQA 4EFRA 4XFFA 4ISQA 1HRI1 1MQTC 3WG2A 1MACA 1QJEA 2OS2A 4EROA 1IHMA 4OULA 1VBE3 4IGQA 5HI0A 3CMGA 3OYWA 2AXMA 1LU1A 3T4HB 5FZGA 1C8NA 3SNVA 1NCRA 4IQPA 3VBHA 4NIHA 2EXHA 3B94A 2BNMA 4IZEA 3AYCA 3HIFA 1W8NA 1UY1A 2IVJA 3THPA 4CP2A 1XC6A 3KV4A 4O65A 4S2DA 1G9DA 2PELA 3AJ6A 2JG8C 1AYM2 4XURA 3WP5A 1G9AA 5FZAA 5DMYA 4I4PA 3CA5A 2ZPXA 3AXDA 1YTOA 4A45A 3H8RA 3N9LA 1A3KA 2QJVA 1GR3A 3M1HA 1OQLB 4X8NA 4NPLA 1US2A 5EXOA 1UWWA 2HWC1 3AMQA 1UMIA 2WNVB 1BMV1 1QDOA 2WO7A 5BNNC 3S57A 4XFUA 3HOBA 4E2GA 1IPSA 1EV12 1Q43A 3AX4A 3IM0A 5FO9B 2PHRA 2XKPA 3T30A 3OUIA 3JB8A 1AYM3 3RYKA 4D7YA 4RR3A 1HWOB 1MEC2 1DLCA 2EIDA 4I4QA 4I37A 2IXIA 2YFZA 4IYBA 1UXXX 3UD9A 5BYNA 4Q9PA 1REEA 1WGPA 1ZZ6A 2QDNA 1NA1A 2X5IC 3EYPA 4RD7A 4UF0B 5FZOB 1QMJA 3APBA 5JPNB 1LOGA 5KR7A 2VSEA 1W8UA 5A3UA 4IERA 3B3QE 4NIDA 2X8KA 3BODA 4LOSA 2YU2A 1EV13 4AHYA 4BWOA 2YDEA 4SBVA 5J3UA 4XOGA 2G9GA 4UI9L 3KF3A 1GNZA 1PZ8A 4H9WA 4ES8A 4Q1PA 4Q8KA 1BYHA 1AX1A 3DYOA 1B35B 2D1ZA 3FJIA 4XDQA 5EV7A 2HW9A 1WCUA 3MBWA 1HV1A 3M3EA 2V5YA 3NVCA 5CEHA 5JWPA 5IVFA 2EICA 3CA4A 1JI6A 3BYWA 3LF7A 3OB8A 3C7FA 4LO1A 3I2HA 3FGMA 1PWAA 2HBTA 2CWSA 3MV01 5ERLA 3ZXKA 1NG0A 3R4UA 1QNWA 3G6JB 2I74A 5FNWA 1W2UA 4XAEA 2XBO3 4K7JA 2WYFA 5F3CA 1V6VA 1NXMA 2WNVC 5FO8B 3GHMA 1D2QA 4OW4A 3U1XA 4DXZA 4ASMB 2XPJA 3L2YA 2VMHA 3KWVA 2FCUA 1D4VB 1XHBA 3RYRA 5ANNA 5A3PA 1X9TA 2JXAA 4D3WA 3FLRA 5I1BA 3WDUA 1UMZA 1K42A 2DUQA 2D6PA 1ISXA 4OI4A 4OI2A 4BH9A 3ZFFA 3IN9A 4IGOA 5LZ6A 1XU1A 3V65A 3MICA 1LTEA 4XHXA 1YBIA 4CA9A 3POFA 3A7QA 3QOPA 4YRDA 1GZTA 5E88A 4KEJA 5G00A 4Y1UA 1VAVA 4DFSA 2FDGA 5KBFA 4QX3A 4DOUA 2CYFA 3PL0A 5KHKA 4YW6A 3TC2A 2ZJCA 1RUE3 2A73B 2QQJA 1NYWA 2ZGTA 3ACGA 2WO2A 1K45A 1W6PA 3FN9A 4U36A 1HWMB 3N7JA 2VMDA 2ET7A 2VAUA 3K51A 1BK1A 3P6IA 1NUKA 5C9AC 2ZX4A 2XMLA 2QBXA 4IGPA 2F4PA 5I0DA 1W2NA 3TAYA 1UOJA 4BPZA 4NRMA 2GP3A 5C3OA 4LBOA 5FR3A 4OEGA 1NZCA 2VY0A 3INAA 4FTEA 1JT5A 2DU1A 5FZ4A 1IHKA 2E32A 2AZ5A 5FUNA 4LJHA 3N9QA 4LHLA 4LKEA 3U4XA 4CCLA 1QF3A 1AXMA 2D22A 2WRYA 5I0TA 3RSJA 3FJ8A 2FBEA 1BBT1 3QCWA 3S7EA 2LIEA 3JBG2 4JRAA 3LGRA 2WDBA 4IDZA 1FXZA 4Q9GA 4LOTA 5D1IA 2VPVA 2GNTA 3WQBA 2DCYA 1Y9MA 5KC5A 3BA7A 3FHQA 3HALA 3VZLA 3O5SA 4LK7A 4P9IA 4BQ1A 3VEQA 1M2TB 1JHJA 3E5QA 1HRV1 1UF2C 2EVXA 5IVVA 1D4M1 1KD7A 1SLTA 5GZEA 4EV0A 3O1SA 2VGDA 4C0HA 3FJKA 3GALA 4QXKA 1ZZ9A 1H2LA 2ZEXA 3JBG3 5KXDA 1DQ6A 4I7IA 3FZ3A 3VN4A 2M49A 3PMEA 3OBTA 2VE1A 4HZFA 1HB4A 2P3YA 5FXZA 2JD9A 4Q0UA 3EBRA 1O3QA 4GP3A 2UYBA 1PMIA 2Q30A 3POWA 2ZX3A 3WEZA 2XLGA 2JDUA 2AEZA 1DJSB 4P6AA 3C3VA 2P17A 2WSUA 4H3WA 3OBRA 2BWCA 3LTQA 4RL7A 1J1TA 5ANQA 2GSYA 2Q0AA 4QM8A 4Y24A 5FBJA 2ZR1B 3OJVA 4JGYA 3UDAA 3KQRA 1W9FA 2VNVA 3V0AA 3BPZA 5HPZA 5DAWA 2OQ7A 5FMOL 4HVRA 1PX3A 1JZ5A 4QX5A 1W0OA 2VQAA 2W52A 2HYXA 4XIOA 3TB0A 2DBNA 3OGGA 3UGFA 2OX0A 4Q26A 4ZY9A 2EF6A 1ZZ7A 2WFPA 5FLIA 1GOHA 1PVC2 4HMZA 2LROA 4TYSA 3ZKUA 2K4AB 4J23B 1QY4A 4OMDA 4YW4A 3QLQA 3ITQA 4L11A 4NUBA 3VDCA 5JOWA 1H2KA 4QDSA 5CKMA 5F5IA 1ISYA 2J3PA 1ST8A 3MLKA 4ZHNA 4XQWA 1RUD2 2VTXA 2BOIA 2YG0A 4FOVA 1G9BA 2B9UA 4N53A 1W9YA 4CCMA 1RUJ1 2PHDA 3KZ4C 5JSRA 1W05A 2XJPA 2GN7A 4QGNA 3TEZA 5F8YA 3E6BA 4GXLA 4YGCA 3ZYPA 1PVC3 4WM8A 4QC4A 2V5DA 2W3JA 3NBNA 4XHBA 2BZDA 1IG0A 3KGZA 2WZ8A 4AI1A 1AR61 4ZU5A 4UW3A 2O8QA 2UU8A 1RMLA 1FMD2 4I30A 1JT7A 2XWBB 1CAWB 2GZBA 3HBWA 1RUD3 3DCQA 3VBSA 1C8M2 5T5LA 1LECA 3OGRA 1URXA 3VKOA 1EUUA 1CONA 5FZFA 2GAUA 3I2KA 1S2KA 5JOYA 3NNJA 2JG9B 4GMP3 1C4RA 2QCSB 4OI1A 3CA3A 1HCDA 2GNDA 2RMU1 4IL7A 1JOBA 3OPWA 4XABA 3HR9A 3AP9A 3ZYRA 2E7QA 1VBD2 5D63A 1W9WA 4V2WA 4UOJA 3N36A 1FMD3 3NWKA 5EPAA 5IAXA 4MG2A 1C8M3 1RMU2 2F6BA 1AUYA 3LCPA 3WHTA 4BXFA 3CA6A 1LJ7A 3POKA 3J26N 1WUVA 5JZGB 1W90A 4D94A 3OY8B 4QPIA 5IVBA 1UYXA 2VJXA 1GMMA 3NV2A 4CP9A 2XL9A 3O1TA 5EJ1B 2VZOA 2JG8A 1XQNA 1KJRA 5J98B 1UZVA 1XB9A 2VZRA 5KHIA 3NAPB 3Q8CA 4MX3A 3U37A 5A32B 5LEJA 1VBD3 2J1UA 3UKNA 1S0BA 3D5OA 3WCSA 1WBAA 2QNKA 2VVDA 1AVAC 1KJLA 4YVWA 4YZ1A 1RMU3 1MS8A 2B5HA 2ZACA 3PHMA 4NMIA 5A7PA 4QD2C 4BQWA 5HBAA 4XJWA 3HBZA 3OUHA 1IOBA 4L8QA 3PMSA 3VHOA 1CAVB 1LGNA 1RYYA 2TUNA 2OKXA 3VBOA 4NHKA 3ES1A 5H9RA 2XH6A 4D8MA 3VB9A 2FZ1A 4LO6B 4N9HA 4K1YA 2KA3A 2ET2A 1DZRA 4KEIA 4KQ7A 1S0JA 2VUDA 3N3HA 1ZYBA 1IGOA 4J1WA 2K8RA 2PXJA 4BISA 2NYYA 3M8LA 5FY7A 4I2SA 1C5HA 3CRIA 2FDJA 1FV2A 1PGW2 5IW0A 1DQ2A 1N1YA 1YQCA 1DZQA 3J8F2 3FJCA 1NX9A 1VBB1 4Y4RA 2SBAA 4AQSA 4UY4A 1F2NA 3H42B 2I1BA 1QEXA 1RHI1 2EXJA 3OG2A 3PU8A 4Q4V1 4GWJA 5IVYA 3P6BA 2W0XA 4A42A 1QQKA 1TWMA 2B46X 2AQZA 3VBFC 4OZXA 4ZZ8A 5JZGC 3NV4A 1LOCA 1O5UA 1NLSA 2EIEA 3WNLA 3TN92 3ZSKA 2OA2A 2GH8A 1QHDA 2BQPA 2DVDA 3MLLA 4NE9A 1WBCA 1FOD2 4LA3A 4MH0E 3MF6A 2DTWA 1G9CA 1WA4A 4WVMA 2RS51 3NAPC 1OD5A 2FQPA 3FX3A 3J8F3 4IUGA 4L99A 3VZJA 3WQ7A 1HLCA 4NAMA 4PI0A 1CGPA 1CJPA 1W6MB 2OUJA 1S1AA 1EPZA 2GMEA 3M3QA 5CFCB 1POQA 1X9PA 5JR7B 3FJSA 2GNMA 4IONA 3RMYA 5KXCA 2UUSA 3VT0A 3VZOA 1GQPA 1ZZBA 2ZEYA 4XETA 2B45X 3TN93 3N4MA 3O4AA 5LB6A 3O1MA 3RZJA 1FOD3 2QQIA 4B4QA 5FY5A 4IW3A 5I0UA 4NO4A 3T1LA 3BU0A 5DZEA 1XNCA 3WF0A 4EN9B 2PAMA 5DZFA 5A6YA 4FPCA 4JTNA 4MGQA 4QXBA 3ZXDA 3WT3A 2A6ZA 2X10A 1SZBA 2H6BA 1I5PA 3PNAA 4P9LA 3VL8A 2WZR2 1W0PA 5E8AA 3LB9A 3JU9A 3NQHA 4Y20A 3O49A 4CSWA 3WINC 1YI9A 1SLCA 3IDAA 2JB4A 4R9AA 4IEZA 2WO3A 4XZUG 4EQVA 3VKMA 5GZCA 2EA7A 4ZPIA 3MIHA 2VMIA 1YRZA 2R0FA 3TOJA 4CU9A 1BEV2 4HKLA 5LWBA 5C9AA 4IE0A 3VKNA 1X82A 4NN0A 4QMAA 1W8WA 1AVXB 1L2HA 2WUHA 4EWEA 4I3GA 3AXEA 3S30A 2WZR3 2NMNA 2D3SA 1SFPA 2PLV1 2GH2A 2VZSA 3HNMA 4LO2A 5CFCC 4UFKA 1DGRA 4UFHA 5EG6C 2ZGPA 4GA9A 2HJIA 2OUHA 4CUCA 1MS9A 1SG3A 1UCXA 4ZU7A 2P3KA 4GJZA 2R7EB 3ETQA 2XVLA 3IMMA 3UT0A 2WQ8A 1US3A 4BA6A 4GWIA 1BEV3 4IXLA 4YLZA 5KC6A 3AZVA 1RUH2 3AKSA 5DZGA 5LY1A 2FDBM 3F95A 4I96A 3JD71 3TEXA 5FXXA 4EWAA 2VBBA 1UU4A 2VCMA 4BU2A 1RGSA 1SLLA 4LE4A 3VKFC 5JSPA 1AVWB 5FAXA 3TBDA 4XFIA 4FT8A 2CSGA 1I5ZA 3FJAA 4FPOB 2P37A 4HKWA 4D0QA 3H1WA 3DXTA 1TMF1 1OXCA 4D6QA 1T2XA 2VU9A 4JDMA 1RUH3 1A8MA 2YY1A 3WP4A 1MS4A 1V6WA 4Q4X1 5JXHA 4FTSA 1S0DA 1L7QA 1W2OA 4META 4FBFA 2GALA 4MV2A 5BY5A 4X6RB 4HETA 4P9WA 2QDRA 1HXS2 2C6SA 4XQDA 5FV3A 3RDIA 3OUJA 4N43B 5FP8A 3VKLA 2PAEA 3O1RA 3BTZA 3T4VA 1DGWA 4CEYC 3PVOA 5CKNA 3AKPA 4NVPA 1I6XA 2VW2A 4OHWA 3P5BA 1OD3A 3DL3A 1FQ9A 3MIEA 1YEWA 1YC61 4AEDB 2JDYA 4ZONA 1CVNA 5F6KA 3CF6E 4AVSA 1XSQA 4WZFA 1JY0A 1AR72 1O8SA 2NP0A 1UXZA 2JE9A 3UYJA 5L7OB 1JYXA 4YFWA 3H8XA 2DCKA 2HWF1 1SDDB 2VCBA 4FPEA 1TOOA 1YQ6A 2VNRA 2PHWA 3NRUA 1HXS3 3CRGA 4KWUA 4I4UA 4XBQA 1QU0A 2WSVA 1W3GA 1HRI2 2XKOA 1VLNA 3AB0A 4JHTA 4BE3A 3FBYA 1K5UA 1OC1A 1CZSA 1YFXA 3GBWA 4P9JA 5A3WA 3PIJA 3DV8A 1BKZA 3BRFA 4CEWB 1MS1A 1TME2 1IS5A 3AVSA 3NBEA 1AR73 1PMJX 3HJRA 5HCFA 3NO8A 3ZX7A 1OFSA 3I2IA 3AKQA 2QQNA 4V2VA 3T2QA 3KD4A 4AFDA 4PQ9A 2A70A 1OOPA 2P6CA 4PBOA 1CE7B 3POBA 4AEKA 3A21A 4KMQA 1TP0A 4CDXB 3MUZ1 2ARBA 1HRI3 4C90A 1VR3A 4GWNA 3Q8AA 5IVEA 4I4SA 2RDQA 4LKDA 4BQ2A 1DZCA 3OJBA 1J3PA 1TME3 3KM5A 4G3YC 5B4XA 1RUG2 4N43C 2RR12 4BB3A 4OQ9A 1P63A 3E6CC 2HWE2 5A7QA 1BMV2 4MGYE 4JZRA 1G86A 1VBC1 4EN6B 2WNEA 3J7LA 1ULGA 1LCLA 2WC2A 5FZBA 5CAZA 4XJ9A 1LODA 4Q4Y1 1JU3A 1QIQA 5FK8A 4LORA 5IJRA 3KT7A 4AQ6A 3VT2A 1MS3A 4JVAA 5A1AA 1RL3A 5C4WB 4G9NA 5L7OC 3FFQA 2C26A 1O3TA 5HCBA 4HFSA 4Z92B 2LTNA 1JYIA 3BB2A 3BAGA 4PDWA 1ZX5A 4XFAA 4RQPB 1HN1A 1W6QB 3MHZA 4XUOA 2AUYA 3FBMA 1G82A 3J4UH 1RUG3 2RR13 2ATFA 1RUC1 3LPFA 4QAWA 1UZYA 4GH4A 2HWE3 4KWLA 4UBGA 4XAAA 3ZLIA 4CDWB 3RZHA 2UURA 2VNGA 3OEAA 4PI2A 1XYOA 3M4FA 3C8XA 1VMHA 1MZ6A 1M16A 1II4A 5FP4A 1AF9A 3SITA 2AREA 4QHBA 5FNXA 5F90A 4PJYA 3R6SA 2QQLA 1TQ5A 4EFPA 4ISRA 4A6OA 2WNUC 3H3ZA 3PG0A 4CDXC 4LO5B 4QD2A 5FZLA 4CE8A 4QKSA 4EKXB 2GC0A 5KXEA 3VSZA 3HSMA 2EIGA 1LHWA 3DYPA 4UFJA 2WT0A 1G7YA 1IRPA 4J25A 1NAEA 5FZCA 4L0PA 4QQ2A 4B1MA 1KFUL 4D6SA 4BQ3A 3AP6A 1OUXA 1QJU1 3J9SA 5DDJ1 2YZ4A 3AVRA 5DUVA 2R1DA 2XLAA 1QXRA 1IQDC 1W2AX 3WF2A 2D6NA 2YV8A 4NROA 5FPVA 1WKYA 2VECA 3ZYIB 2QN4A 5IFPA 1FATA 4AI0A 4DUXA 4IV1A 1VMFA 2LALA 1V6IA 3V56A 2AENA 2Y33A 3VHRA 5GZGA 2EAKA 1SACA 2ZHMA 3VBFA 3ZIXA 2BEOA 5ABJB 4ORFA 2D20A 1ODNA 3NL1A 1ITBA 4GMP0 3Q7XA 1OF4A 4TLPA 4E4DX 4N8MA 3THCA 4QX1A 5F3EA 5HCHA 3F1RA 2WNOA 1H8VA 1UYPA 3FHIB 3HNYM 3LEMA 3M3CA 4AF9A 5JOZA 3ZMOA 4AEMA 5BP5C 5A32A 4JGZA 5LK7B 3MFAA 1E0OA 2UY8A 2IFRA 5FJHA 2Q8DA 3PUQA 4D6RA 2R9KB 2Y6FA 4G6MA 1D7PM 4AFCA 4AL9A 2OPKA 3W5NA 2UWAA 4WZCA 3QBQA 1S0CA 1EP0A 3E97A 1W2TA 4URTA 4PLMA 3BOWA 4XJZA 1H9PA 4XE9A 2ZHLA 4ASLA 1F4AA 3I2AA 2CDOA 3IM6A 1CAVA 5H9PA 2D5FA 3LDRA 3O3QA 3L9JT 4MO3M 1OURA 3VD3A 1C1LA 1O3SA 3BA5A 2GC1A 2QVSB 4FQ4A 1CX4A 4W6YA 1H4GA 4XIKA 4NWWA 1CVSA 3WO3A 1V6NA 2WABA 1AR91 3NV1A 4BCUA 1BBT2 2WWUA 3PUHA 4Q0SA 3LDKA 1EUTA 2W95A 4FXKB 4LHKA 2ZAHA 1W9SA 3BAHA 1ZZCA 2RS31 1O7FA 1SEFA 3I3EA 4KG0A 5GLWA 3I2XA 4RFRB 5A70A 5JDBA 4CVUA 1M4WA 4FXGB 3WINA 5E1RA 1OI6A 3U11A 1ULPA 2IUWA 3KMHA 5ABJC 3ZYHA 1S0LA 1F5FA 1OFNA 1RUF2 3OJ2A 1SBDA 2ETEA 4M3CB 2J1TA 1UQXA 1WLWA 1BBT3 1Q1UA 1GQGA 3D82A 3J7NA 4Q27A 5GZFA 1L7RA 2LW8A 4LLOA 3NKGA 3JXSA 2HZ9A 1JBCA 2A6XA 1O8PA 1LOFC 1R082 1E5IA 1V6LA 4FFHA 4I4VA 1XPWA 3RTJB 1OVSA 3E1F1 1NCQC 1SPPB 2YPDA 3BADA 2RJ2A 4OUJA 5FZ1A 3I3DA 1JZ7A 2OVUA 1AXYA 1KRIA 1PZ9A 2UWBA 3ZYFA 5EJ3A 1GUIA 1RUF3 2GNBA 3RZZA 2Y60A 1PM7A 2W92A 4Y4YA 4XXAA 3C2UA 3WUDA 1BA7A 3UKVA 3O4DA 2ID4A 5GKAC 2W47A 4LHNA 2VBDA 2K9ZA 4Z82A 5FRAA 1E57A 2RDNA 2RV9A 3W9AA 5CBLA 1YJKA 4ZFUB 3WW4A 2F2FA 1R083 3NJXA 1XZZA 5DUYA 4IEYA 5C8CC 2VOWA 4KH9A 4GB31 4DEVA 3WO4A 3WLUA 1KS5A 2ZEZA 5DAXA 4LHSA 1K5MB 2XVKA 2ZAAA 2CGNA 3M3OA 9ILBA 4I2OA 4NHXA 3ETPA 1SZ6B 4RYDA 4FOWA 1XYPA 3I59A 4FOQA 5LK5A 1E5SA 1PO21 3J7MA 1OSGA 4OUMA 3M3IA 1RUJ2 2D6OX 2QQWA 4I4XA 2RM21 4AI9A 1RUNA 1FWUA 1NUNA 1HKDA 2IXLA 4GAZA 3CNAA 3KGLA 3AYDA 2XG3A 2C24A 5C8WA 1C57A 2W08A 2HWAA 4CCDA 2H6CA 2MEV2 2Y34A 1LULA 3DPRB 3IMNA 4O7XA 4BMEA 4CEYA 5KHGA 5DG2A 1PO11 2J1EA 5FP7A 1MC9A 5F39A 5BQUC 5BXXA 1Q8SA 1DIWA 1V70A 3H3LA 1R092 5IK4A 2LIQA 2FMDA 3ZFGC 1OUSA 1QJZA 4MXWA 2QQUA 5F2SA 4CXYA 1RUJ3 2FDFA 1S2EA 5L19A 2HWMA 3WW3A 1F8VA 4RSUA 5AFEA 2ZKNA 3SXWA 2RMU2 1ZA4A 1W8ZA 2VULA 3GXUA 4II0A 5CG8A 2MEV3 3ABZA 4F8AA 1C3HA 3MFCA 3MI8A 5D8AC 4HPKB 2VOVA 5G05L 4E2SA 4N9IA 4R9CA 4K9SA 1R093 1NT0A 1UL9A 3BCWA 1UU6A 3CEWA 4YNIA 2E7TA 2GMMA 1K5MC 4HK9A 1YIFA 3I3QA 3OGSA 4TLGA 4AGGA 1UYYA 1OBNA 2VL4A 2ZGLA 3SEEA 3WQ0A 5DVHA 1REDA 2R30A 2PQQA 5FYIA 3VLBB 2B39A 2GZWA 2RMU3 3WG1A 2I07B 5ACA2 1QXPA 4LMFA 4LO7B 2YC0A 1BLZA 2LS6A 1HWPB 4YSFA 1BVVA 2BTVC 2G4IA 2NQYA 1TE1B 4XBLA 5EQUA 5AC92 4N43A 1ULEA 4DINB 4COWA 4XFBA 2E4MA 4L2NA 1GOFA 3DPRC 4NRQA 3POEA 3WDVA 5IVCA 3FJJA 1UW8A 3AYAA 3NNLA 4BK4A 5BXPA 2QZ3A 4OHXA 1F4HA 3RYPA 1AL21 5L9RA 3NW4A 1VBA1 1JMUB 4MUVA 4Y5Z0 2QQPA 4C1XA 5CIRA 1PZ7A 4FPHA 5I0SA 3I97A 2VZUA 5ACA3 2P3JA 3BAQA 3B9IA 3CJIB 3ZN6A 1ND2B 2DBIA 3BA4A 3AKRA 2WA3A 3AMNA 1W6OA 1WW6A 4P9GA 4FP2A 4WVWA 2Z2SB 5AC93 1H6XA 4E27A 3OPTA 2D40A 2VVFA 2WS91 3PUIA 4E2QA 3WHUA 5B4NA 4A2UA 4K6BA 4L4IA 1MEC3 2VOTA 4WM7B 1RY7A 1UY4A 4YGDA 3R0RA 4J2XA 3W58A 4DY3A 4HKOA 4RGAA 4A7ZA 3RNSA 3DN7A 1UN1A 1DG6A 4YW2A 2WO1A 2B7YA 5A33B 1NY72 3AJZA 2MIBA 1PGL2 1W3FA 3CKHA 1MVEA 1XXNA 2WNUA 3KQ4B 3LE0A 3LFIA 2MC2A 4CUBA 4LO7C 1GV9A 4QM9A 1KS4A 3ZN5A 1EYLA 3B9CA 1OHFA 4JKKA 3FC0A 2P4EA 1UZWA 4BQ4A 2FHRA 3AH4A 4ZS2A 4FFIA 4Q2FA 3T3YA 2ZZJA 3DUIA 5LBCA 2ZTNA 2HH9A 4B7EA 1ULOA 2IXHA 4BLIA 4KEKA 3WP6A 4B7KA 1HW5A 2JDNA 4XUPA 3NNFA 3M7AA 3CJIC 4PBPA 5K7PA 3UGHA 3ELNA 3BIEA 1ONKB 1ISZA 5GAQA 1YYNA 4UW4A 5FP3A 4PHZA 5E16A 2G19A 5JPMB 3D4KA 3M2MA 3KHBA 5FY1A 4DMIA 2YMZA 4N90A 4XILA 2JECA 1IKPA 2UWCA 2R071 2ZOEB 2Q9XA 3CA1A 5F1RA 3KVAA 3RTIB 3VD7A 1B35C 2JIGA 3PJYA 1I9RA 5EZWA 5FPAA 3RG0A 1ZZ8A 3BPSA 4WM7C 4I6IA 1F5JA 2YB7A 1J1LA 2Q5TA 3WINE 3U78A 3BOPA 3M70A 1UX7A 1UY0A 1F15A 4QKNA 2W87A 3HQUA 3V0BA 4CJMA 4MVTA 2ZCWA 3I54A 4MHRA 5LA0A 2R062 3TEWA 2X05A 3O4BA 4U2AA 3PTYA 4ENDA 1IOAA 5J7MA 1RXFA 3WNNA 5FY8A 2VXJA 4TZDA 3U07A 1OLRA 4L9BA 4EZ4A 3ZO0B 2Y6KA 3JQWA 1W3AA 1UPSA 3LQCA
chains in the Genus database with same CATH topology
1ENSA 1DGLA 3O14A 1D0GA 2XLFA 2OZJA 4XJ8A 2MHFA 1BFGA 3FWEA 4J1XA 1NE6A 2R063 1N3QA 2R042 4N7UA 2E7AA 4HL0A 4CDUB 1XYFA 3AMPA 3H3UA 4GKYA 5JOXA 2BVBA 2XJRA 2KXLA 5F5QA 4IV3B 1RJ8A 1NXD1 2PHFA 2BNNA 5AVPA 1ZREA 2ZQOA 1BQPA 2IHOA 4X6QB 2HWD2 1AL0G 3VL9A 1SLIA 1TMF2 1POV0 2R043 2IXKA 4NHMA 1LOFA 1PUUB 5DZUA 5B2HA 3CA0A 4EWDA 2D7IA 1NCQA 5BNPB 1JW6A 4OUSA 5DUUA 1BXHA 5FQ0B 5K8SA 4ZGRB 5JI9A 4HLTA 4LO3A 1U5IA 2HWD3 2WQZC 3MW3A 3R4DB 5KHJA 1Q8VA 4JKQA 2TEPA 2ZGRA 1TMF3 5BPXA 1BCXA 3ZN4A 4XF1A 1FPN2 2AH2A 3ST7A 1X50A 3JUUA 4K8FA 5C8CA 4XYXA 3I7DA 5FMOS 4GKXA 2JJ6A 4MLOA 4FPFA 4CDUC 3AKFA 1LEMA 4R52A 4IZXA 3WY6A 2MLLB 2A5ZA 1MVQA 1QJX1 1W6NB 1Q8OA 3GZTB 3TRSB 1FPN3 2F8XC 5L73A 2PFWA 4PIXA 2BFHA