1DIWA

The hc fragment of tetanus toxin complexed with galactose
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
441
structure length
441
Chain Sequence
EDIDVILKKSTILNLDINNDIISDISGFNSSVITYPDAQLVPGINGKAIHLVNNEESEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TETANUS TOXIN HC
publication title The structures of the H(C) fragment of tetanus toxin with carbohydrate subunit complexes provide insight into ganglioside binding.
pubmed doi rcsb
source organism Clostridium tetani
molecule tags Toxin
total genus 110
structure length 441
sequence length 441
ec nomenclature ec 3.4.24.68: Tentoxilysin.
pdb deposition date 1999-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07951 Toxin_R_bind_C Clostridium neurotoxin, C-terminal receptor binding
A PF07953 Toxin_R_bind_N Clostridium neurotoxin, N-terminal receptor binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1diwA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1diwA02
3WMUA 3ATGA 2V73A 3A22A 1BJQA 3D7WB 3CRGA 1JOJA 1LECA 1W6NB 1LHUA 4ISQA 3CA6A 4J23B 2GMPA 2NVHA 4PC4A 1W6QA 4HJJA 3NJ5A 4XBQA 4ZGRB 2DUQA 4J2KA 6I1BA 2ZGTA 2Z48A 3MW4A 1C1LA 1S0DA 4AVTA 3V0BA 2TEPA 4QALA 2GNMA 3O5WB 3B69A 1CVNA 1N47A 4FPJA 1YIFA 1QF3A 4Y1ZA 4Y1VA 1GSLA 3ZC9A 1HKDA 1N3PA 2E4MC 5GZEA 1DQ4A 4JP0A 1ZM1A 2DVAA 3INAA 1I3HA 4Q27A 2A70A 3TC2A 4JKQA 1J0SA 4DEPA 1XHBA 1ISYA 3N7MA 2VLCA 4I4OA 4LO7B 2DU1A 1G7YA 4GA9A 2ZGSA 4LO8B 2AGSA 4ZBVB 4Q1PA 1GICA 3B3QE 4GWNA 1FQ9A 1N1TA 1LHVA 1CJPA 3AZWA 3FJHA 5IUQA 2ZZJA 1AX2A 1V6IA 2X2SA 4YW2A 1G86A 1W3FA 1IRAX 4AGRA 4Y22B 5DUWA 3CAHA 1XG6A 5DUXA 2CWMA 4R9CA 4OW4A 3WMVA 2EIGA 4ZLBB 2P39A 1GKBA 3UD8A 1Q8PA 1WW5A 4BQ1A 1WUVA 1GZWA 2CNAA 2E7QA 3WV6A 2DVFA 1CONA 3D5OA 1XQNA 1DFCA 1JYCA 1MS5A 4XTMA 2VW0A 1V6WA 1ISVA 1YI7A 3OJBA 1R8NA 5JLVA 1KJLA 3B01A 4Q91A 1DIWA 1XYFA 2FO1A 2UWCA 1MS0A 2IWTB 4AVSA 3BA7A 4FVVA 5DUYA 3WNXA 41BIA 4XIOA 4Y20B 3WOGA 4Q1RA 3AZVA 2R9KB 1HWNB 4ATEA 3BA4A 4L8QA 3O4OA 2ZMKA 1DQGA 3W9TA 2VUAA 2RHPA 5JMCA 3HBWA 2E4MA 4GOYA 3V79C 1Z2VA 4HANA 2D24A 2D7RA 5CA6A 3PVNA 1DFQA 2OVUA 2L5XA 5FREA 3N0KA 5T55A 4ZXKA 3WO4A 4EB2B 3FJBA 1QDOA 3JUTA 3MW2A 1HQLA 5DZEA 5KXEA 2NMOA 4FOVA 1QXMA 3VSFA 2JDZA 2D3SA 4ZKTB 1GGPB 2DVBA 4BLJA 3VT2A 4X3AA 3AKGA 2QYIB 2JECA 2Q5TA 4IYBA 4J2XA 1BARA 4G6MA 4LBQD 4YGEA 4G1RA 2VW1A 2P37A 1HLCA 4P9WA 5FNWA 2LALA 3ZVXA 1C4RA 2D6PA 2YROA 1G82A 2GDFA 1QDCA 1YYNA 5T5OA 3HALA 2ZMLA 4Y1YA 2D22A 1BA7A 3KQRA 2A6ZA 3AZXA 2HW9A 3A4UA 3BAGA 3CA3A 4I4UA 1BZWA 5E24E 3IKWA 2FMDA 1LOGA 5H9PA 3BRGC 3M1HA 2SLIA 3ZSKA 4Q2FA 1W6QB 4EFPA 1LGCA 5H9QA 5FZZA 1YXWA 1FWVA 3AFKA 5BVPI 2KI6B 4LO0C 3V0BB 2DRZA 3D4KA 4ZFWB 5HPZA 4G9MA 1OQLB 3T2TA 5F90A 3AH2A 21BIA 1K5VA 4GKYA 4I30A 5DG2A 1IS5A 1SCRA 5LK5A 1MS4A 1YRZA 3ZXGA 1IS6A 3AKHA 1FV3A 1WD4A 1GLHA 1Y7BA 5GZDA 2ES3A 3WHTA 4TLPA 4ENDA 3RTJB 4EKXB 4YW5A 4XMAA 1UN1A 5EG6C 1JN2P 3BA5A 5GZFA 1ENRA 1SCSA 5GJ6A 2C5DA 1IJTA 3QLQA 3AP7A 1WBCA 3C9ZA 3AZYA 3F62B 1IILA 1S0EA 2BFHA 1RMLA 4JCKA 4OEFA 4XXAA 3GALA 4OZXA 3WG3A 4IY8A 4U36A 1LOCA 1BFFA 1JYIA 2JJ6A 3PG0A 1DYPA 1SBEA 2Z42A 1FMZA 1DYKA 3OJMA 1N4KA 1JT5A 5GLZA 3FJDA 3WINC 3JU9A 3FUQA 3USUA 4GP0A 1QQKA 1S0GA 2RQ9A 3UDAA 2A6YA 4FP3A 3MPPG 1I1BA 1BKZA 3LCPA 1U0AA 1AX1A 1CR7A 1GZWB 1PUUB 4Q9PA 1DZDA 1CPNA 1QQLA 4FPLA 4Z9WB 4AGGA 1SBFA 3OYWA 4FPCA 2LIEA 2P3IA 2P34A 1IT0A 4XTPA 1MVEA 3WDWA 1R8OA 3AKFA 4XHXA 1PZ7A 5T50A 3SH4A 4W65A 2F8XC 1DBNA 3NBCA 4LO0A 4AN7B 2D7IA 1S0CA 3NV1A 2G4IA 3HSMA 3OBTA 1W0OA 2GMEA 1G9FA 4FOQA 4C1XA 4KEJA 4EEEB 4K21A 1ABRB 3FFZA 2XB6C 4Q8KA 3NBEA 3VKFC 3KM5A 3B00A 3CU1B 3Q7XA 1SFYA 3O4BA 5F8SA 2YUGA 31BIA 4FQZA 3B9CA 4YW4A 1LHWA 3SLIA 5KXCA 3O4DA 3PHZA 3WG4A 3A0NA 4J2YA 2E51A 4K1YA 3FUOA 2D6KA 1ONKB 4I4YA 4SLIA 1II4A 1SZ6B 4ASMB 3VV1A 3M3OA 3FJFA 3UD7A 3ZXLA 2F2FC 2GNBA 2I2SA 3FJAA 4ZA3B 2VSEA 4XHBA 3AH1A 2D43A 3P6JA 4QBCA 1UMZA 3BRFA 1LHNA 3RSJA 2A6VA 4QKSA 3AX4A 2PHTA 1AF9A 3AP6A 1BASA 4FPEA 2A3XA 4I8MA 4QO3A 3WCSA 4M01A 1ULFA 2Y9WC 1A78A 3O4AA 4YZ2A 2Q3NB 3CA1A 4JQ0A 1DQOA 2D23A 5EWSA 3H6RA 2R16A 3FJEA 1A8DA 3WINA 2FFUA 4XFTA 3TAYA 2JE9A 3UJ0A 5D62A 3E8LC 4JKXB 3V0AA 3IAGC 3PJQA 1RG8A 2JE7A 3CA0A 4FPHA 1WBAA 2ARXA 3VWCA 4WVWA 1IKQA 2GZBA 1HWMB 1AZDA 1LOAA 1FN0A 4PBPA 3BRDA 1V6OA 4WZFA 1SLAA 1LGBA 3AKIA 2XG3A 5BXTA 4JC1A 1A3KA 4Y1XA 4UW5A 4C1WA 2CTVA 2X2TA 3CA4A 4R6UB 1CIWA 1P63A 4YZ1A 3M2MA 3OBRA 2AYHA 1YO8A 1LJ7A 3BB2A 2PELA 2PHRA 3WO2A 1O4ZA 1ISWA 4YFWA 1G9DA 1DQ6A 3AJZA 1W6PA 5KXBA 3R05A 2PHWA 1CESA 3O0VA 5B2HA 1DZCA 1AX0A 1MVQA 2AR6A 3WDUA 1HQWA 4R9BA 1BXHA 1UAIA 2DTWA 4U2AA 3UD9A 4I4SA 1CE7B 4ZFUB 1GNHA 3WUDA 1MC9A 2AUYA 4AYUA 4GP3A 1I1EA 1S1AA 4YZ5A 4GWMA 3V64A 3I4IA 2PHFA 4KEIA 1N1SA 3RMYA 3SNVA 4ISRA 1O4YA 1Q8SA 1BLAA 2ERFA 2FGFA 1BLDA 4A7YA 3OGGA 4YLZA 3O44A 1DGLA 1X50A 4PBOA 4NOTA 2OUJA 1FAYA 3F1RA 5F8YA 2VSAA 2R1DA 1W6MA 3USUB 3A0KA 1UPSA 3WCRA 5IK4A 3ILFA 5T5LA 2LTNA 3IPVB 4F83A 1LESA 2QN4A 1NUNA 1YTOA 1VLNA 1S0BA 2E7TA 4QC4A 1WD3A 1N3QA 4TZDA 4Y24A 1V6MA 3APBA 4XFUA 1YF8B 1HCEA 1AVAC 3IIRA 4GALA 5BXRA 5T52A 3O5SA 1HWPB 3VUOA 4MYEA 2ZGUA 2P2KA 1WW4A 4I2SA 5H9SA 1MD6A 1KITA 3UL2A 5BXPA 3BAOA 1DZQA 2R1BA 1JT4A 3IM7A 1RY7A 2D6MA 4FOYA 2W68A 3O12A 4I1BA 1SLTA 3WG1A 1R1ZA 3IN9A 4QD2B 1TIEA 3RRDA 4Q26A 5DZUA 4I4QA 4II0A 2DWRA 4DRRA 1GNZA 4Q8LA 4IZXA 5DXDA 2UU8A 4P9XA 4Y26A 2GN7A 3R4SA 1M2TB 1MR5A 4I4XA 3IM0A 1WBFA 2UUSA 2YMZA 1G9BA 3NV3A 1FV2A 1V6JA 4G6JA 4HA2A 1C57A 1ILR1 1HKNA 3QR5A 3NWKA 1FNYA 4I37A 1HWOB 1SLCA 1SACA 2DURA 3VT0A 1KDMA 3ZPYA 2OUHA 2BQPA 4IY9A 5IK7A 3H6QA 4EFRA 4GAFA 1DLLA 5E89A 2ZQOA 2WT2A 5GLUA 3H6RB 3AH4A 2UWAA 1JLXA 3BAQA 1SLBA 3N7JA 1TWMA 2P3JA 5EC5A 4XJ8A 4XDQA 4XKIA 4WBCA 3L2YA 1LEDA 3O49A 2DTYA 2V5YA 1UZYA 4M00A 3MEPA 2NP0A 1BYHA 3WG2A 2RSTA 1M16A 1K5UA 4R9DA 1IS3A 1LENA 3FBYA 2YZ4A 2DUPA 3BIWE 3BAVA 2Y9FA 3WVJA 4CZSA 1EV2A 4G9NA 3DGTA 3Q9OA 3ZXFA 1Q8QA 1IKPA 4IONA 1LULA 4LO2C 5BQUC 1G8WA 1LU2A 1ULEA 4XJ9A 1FMMS 4DENA 1OQ1A 1LEMA 1LCLA 3IM6A 7I1BA 2P3KA 4X38A 3AP9A 2SBAA 4CRQA 2A3WA 1DQ1A 3NBNA 4OWKA 4LBMA 1V6NA 4BMBA 3AJYA 5CAZA 3FJJA 1W6OA 2W39A 2DS0A 4F34A 2ZHNA 3OY8A 3VKMA 2A71A 1W3AA 1GBGA 4LBQA 1J1TA 2NZ9A 4XYXA 2PHXA 5BXSA 2ZGMA 4YFZA 4Q9GA 3AYDA 2CY6A 3FLPA 2WJSA 1FGAA 1QOTA 5EYYA 1AVWB 1QGLA 3SITA 2EXJA 2ZACA 4CJMA 2ET2A 2ZMNA 4OEEA 1AFCA 4I4RA 1KJRA 1UX6A 4DFSA 1VIWB 2AREA 2NTDA 3HOMA 4YZ3A 4JPZA 2D20A 3W59A 3UJ4A 1W6NA 1W6MB 1AJOA 2EAKA 2IHOA 3A23A 2A6XA 1F31A 1MS3A 2ZR1B 2YY1A 4GXLA 1BFBA 3NBDA 1TFMB 1QNWA 4XILA 1FX5A 5GLTA 4KEKA 3VT1A 3UJQA 4BPZA 3WDTA 2NM1A 1AVUA 5FRAA 3ZSLA 1DJSB 5HCFA 2NYYA 1QU0A 5BP5C 3AJ6A 2D3PA 5BQUA 1VAMA 2AFGA 5DVHA 2H0BA 4DCKC 3LLPA 3R4UA 2JD4A 3LSDA 4LBKA 1S0LA 5FZUA 5JVVA 5EXOA 2R0HA 3CRHA 5GM0A 5CNAA 5DUVA 3NV4A 3WLUA 2AENA 1OKQA 4HR6C 4USPA 3WZ1A 1QMJA 2K8RA 3ENRA 3N7LA 4AWDA 3QYDA 3N35A 3AYCA 4YM1A 3O3QA 3A07A 4BMEA 2DYCA 3RMXA 1CVSA 1S0IA 5GLVA 4I96A 2A75A 4ITCA 1S0JA 5D63A 1SR4C 4LO3C 1APNA 2W08A 1PZ8A 2GALA 2WBCA 3FLRA 5JOWA 3D6EA 3HN1A 3WDYA 1N1VA 1E0OA 4FPYA 2A3YA 2ZABA 3DUIA 3UJOA 5F5QA 1IRPA 1EYLA 2WRYA 2M49A 1WBLA 4FGFA 5E8AA 3ILAA 3FJ9A 4FPFA 2D7FA 1D0HA 2WKKA 2VXTI 1Q8VA 2DU0A 1W3GA 3ILRA 2FHRA 4Y20A 4OUJA 2Y9GA 4FPKA 3TB0A 1AXMA 3M3QA 2ZHLA 1V6LA 3POYA 1V6VA 1Q56A 3CQAA 3RTIB 2D1ZA 3BAHA 2HWMA 5CBLA 5BP5A 3POWA 4ZOTA 2CYFA 3B9UA 4YZ4A 4I0YA 3VKLA 8I1BA 1W6OB 4P6AA 2AAIB 1UKGA 3OY8B 2D44A 3K1XA 2UWBA 4KC3A 1VAVA 4JRAA 1JTCA 5DSSB 2E53A 4PCRA 2WLQA 3ASIA 1F5FA 3POKA 5IK5A 3BX1C 1ITBA 3C2UA 2GNTA 1FNZA 3MALA 1CQ9A 2LIQA 1PZZA 4I3NA 3N7KA 2HWAA 4K1ZA 3T8SA 4PF5A 3P53A 2J3PA 4GOVA 5FZYA 1SR4A 4LO3A 1WLCA 4X39A 5HCBA 3RS6A 3ILNA 2DREA 4R9AA 3ZSJA 4DRVA 3AJ5A 3AK0A 1GANA 2ZGQA 1HIBA 3WO3A 2F2FA 2AH2A 1MS8A 2ZQNA 1DQ5A 1URXA 1TP0A 1AXKA 1LGNA 4GKXA 4H9WA 2EF6A 1EVTA 5DZGA 1KQRA 1TEIA 1PC8B 5BOWA 1AJKA 4D0TA 4OEGA 4UW3A 1IHKA 2XOAA 3RG0A 3VKOA 3BOPA 1V00A 4I7IA 2WT1A 1Q1UA 2UURA 4XXPA 2BEAA 4I1EA 3KMVA 2WT0A 5EHAA 2ARBA 2Q9XA 1QKQA 1IS4A 1MZ6A 2GNDA 3OYWB 2VXRA 4XE9A 3AP5A 2AXMA 4M3CA 3H6SE 2Y9XE 4IZEA 4QBVA 4WV8A 4AGVA 3WDVA 1T9FA 1TWEA 3FJCA 4XIKA 1L2HA 1JW6A 1AXZA 2GMMA 4LBJA 4YM0A 3VEQA 4LBOA 4I6IA 4XJAA 1ULDA 1W0PA 1PWAA 2VH9A 1IOAA 1WLDA 2EXIA 3N36A 2RG9B 1C1FA 1MS9A 3BODA 3WA1A 3T1MA 1SLLA 2D6NA 5L73A 2P23A 2EXKA 3POSA 1LOEA 5AVAA 4BOWA 1VALA 1WW6A 2A5ZA 1HDKA 3BADA 4A7ZA 3SNMA 4XOGA 3JRRA 5T5JA 2Z49A 5GALA 3Q7YA 4Z8SB 2DVDA 1BFCA 1FYUA 4P0KA 4D8HA 2ZBJA 3AXEA 3IM5A 3W58A 1ENQA 3BTAA 3HMYA 2NN8A 5IK8A 5I1BA 1NZKA 4M3CF 1Z78A 2FFVA 4J2SA 1DQ2A 1RZOB 2WSVA 4XZPA 1ULCA 3CRIA 4OWJA 4OWLA 4LBLA 1UL9A 1T4QA 4D0ZA 4YG6A 3I2XA 2ZGOA 1SBDA 2DVGA 4YM3A 5F9TA 2ZAAA 2D6OX 3ZC8A 3ZX7A 3RQ0A 4XBNA 1IOBA 1BQPA 3T1LA 3AYEA 4HL0A 3V0AB 3MW3A 4KBBA 3P6IA 1V6KA 3VKNA 5HCAA 1KDKA 1JT7A 2MIBA 2YV8A 2ZA9A 4XMIA 3U4XA 4QKRA 4YG0A 5DG1A 2WQZC 2ZKNA 3QCWA 4LO7C 2DUOA 5D61A 4FPGA 3ZXDA 4USOA 2ZHMA 5DUUA 4UW6A 1GV9A 1MS1A 4L4HA 2KI4A 3M3CA 4GAIA 4H04A 3FJ8A 1TOOA 4I4PA 4FP2A 4AN6A 1NLSA 4AVVA 1WLWA 1H9PA 1JHNA 5JOZA 1W6PB 3ZYPA 3I2AA 1QOSA 3JUUA 2ZGKA 3ZXKA 2KH2A 1JBCA 2B7YA 4UW4A 2E6VA 4XJZA 1JT3A 3BAUA 1GYKA 5E88A 1QOOA 5CB7A 4ZFYB 2BEBA 3GNEA 4WVVA 4P14A 1S0FA 3PUBA 2FDBM 1JLYA 1B09A 3O0XA 3V65A 3ZXEA 1JY0A 3SH3A 2ENRA 2DRYA 4LO1C 2EALA 2K4AB 5JOYA 2PHUA 4LBNA 4RL7A 5GLWA 4QD2C 5JOXA 4DS0A 1ZA4A 2MC2A 1D2SA 5SV8A 4M3CE 3S8JA 1Q8OA 2GO2A 2A6WA 3O4CA 4H55A 1GZCA 3CNAA 2D3RA 1OFSA 1F9KA 4I4VA 2VY0A 5JDBA 1ISZA 1AXYA 4D69A 5GAQA 3ZYRA 1FATA 3HR9A 5KXDA 3OGFA 4YGCA 3FJKA 3N3HA 4M3CB 1PUMB 1EPWA 3PVOA 1Q03A 1ENSA 2WNEA 1KNMA 1KRIA 1MZ5A 1LODA 1LOFC 4EFQA 4P0JA 1Q04A 3SH5A 4LO2A 2VU9A 3OJVA 3I29B 3LTQA 2ZGLA 3A21A 4YW3A 1UZZA 1N3OA 2KM2A 5IT6A 1V6XA 3PMEA 2R0FA 2MLLB 3H0OA 1CPMA 5DZFA 1AVBA 3IPVA 4CTEA 4DQAA 1WW7A 3WHUA 2OW4A 3OPZA 2ZGNA 2D6LX 3IMNA 3AXDA 5G00A 1JUIA 4YG3A 4ATFA 1VCLA 2VW2A 3CA5A 4Y22A 4XFSA 5FNXA 4PQ9A 4FPOB 3FGMA 3O0WA 1CN1A 1YBIA 3I8TA 3OJ2A 1SLIA 2HZ9A 2AQZA 2ESUA 2DV9A 3M3EA 2KKIA 4Y1UA 4L4IA 4LO1A 3AYAA 3ZXJA 4XJWA 1LU1A 4BM8A 4YW1A 3LSEA 1NXD1 4TYSA 4DPNA 1RIRA 4NO4A 2GN3A 3WDXA 1HCDA 1N1YA 1H9WA 2JKBA 4RA0A 2W52A 2ERMA 5GZCA 2K43A 1DHKB 2C9AA 3EF2A 3Q7WA 4P9YA 4XBLA 5H9RA 5T5PA 4BLIA 3VSZA 4IQPA 1G9CA 1ONAA 9ILBA 1DQ0A 2WSUA 2CL2A 3UK9A 2I1BA 1LOFA 3AZZA 1PZ9A 2ZGPA 4FQ4A 3PVEA 4IHZA 5BYNA 4X37A 5F8WA 2A7AA 2NMNA 1LHOA 1JQZA 1LTEA 1QNYA 3ZSMA 1Z0HA 1LOBA 2R49A 5T54A 3SISA 1AVXB 2HYKA 4YOLA 1V6UA 4Z8BA 4JAWA 1MACA 4LBQB 1XZZA 1RINA 4FOWA 1H30A 4YGBA 3S8KA 3WUCA 2EXHA 2YXSA 4YM2A 1Z4SA 5GZGA 4A7KA 1ULGA 4XJUA 2ZGRA 1JXNA 4K20A 2CWSA 4P0LA 1G9AA 1BFGA 1GZ9A 2KLLA 3FLTA 1RITA 1TTUA 1ISXA 3NV2A 1FWUA 2ZHKA 1WCSA 4YGDA 3FJIA 3AP4A 5EYXA
chains in the Genus database with same CATH superfamily
3THPA 2WO2A 4O65A 3ATGA 2V73A 4CDWC 3WMUA 3A22A 1BJQA 4WM8A 3CJXA 2XJVA 1VP6A 1ZBE3 3WQBA 5BXXA 3D7WB 3EBRA 3CRGA 1JOJA 3EYPA 1LECA 4XF1A 2VE1A 1LHUA 1W6NB 4UFMA 3PIGA 3ZR6A 1O3QA 2XOMA 4ISQA 4N9HA 3CA6A 3IDBB 2XDVA 4Q0VA 2WZ8A 4J23B 2XLFA 4MHRA 3BIEA 2GMPA 5CKQA 1J59A 2NVHA 4PC4A 3O7OA 5FMOL 1W6QA 4IEUA 3BUCA 3NJ5A 2GZWA 4XBQA 1UMHA 2DUQA 1PNGA 3ZFFB 4HJJA 2XH6A 1XPWA 1DGWA 2ZGTA 4J2KA 2Z48A 6I1BA 3JBG2 3MW4A 5FZGA 1C1LA 1CZVA 1S0DA 4ONUA 5CVRA 4C91A 4TSVA 4AVTA 5FBZA 2TEPA 4AVBA 4NUBA 3V0BA 1O91A 4UXAA 4QALA 2RS13 2GNMA 1TME1 1SMVA 4QPIA 2RMU2 3KGLA 3B69A 1VAKA 3UYJA 5ACA1 1CVNA 3O5WB 1N47A 1HRV3 1TVGA 3HQRA 4FPJA 4AEDC 5A1FA 5JUVA 2DBNA 1FOD1 3OUHA 3EJKA 2Z2SB 2GC2A 5JZGC 1YIFA 1QF3A 4Y1ZA 3WW3A 3UETA 4OI2A 4Y1VA 3ZIWA 1OD5A 2X5IC 1GSLA 2ET1A 4LE4A 4XFCA 1HKDA 4S2GA 3VDCA 3ZC9A 3OCPA 1N3PA 4K3UA 5EP9A 4R52A 2E4MC 5GZEA 1DQ4A 5F2SA 4JP0A 5DDJ1 4MGTA 5FZDA 1ZM1A 2RS52 3NO8A 2YC0A 4PLMA 3UGGA 1W28A 4NIGA 1W2NA 2Z69A 4JTNA 2R6QA 4P5HA 4NHKA 2DVAA 2HEVF 3INAA 1I3HA 1S4CA 4MGKE 4Q27A 1F35A 2A70A 4EV0A 3PUBA 3TC2A 4COWA 5FQ0B 2LW8A 4JKQA 2J7MA 5C9AA 1J0SA 5J96B 4DEPA 1XHBA 1ISYA 3N7MA 5I0TA 2VLCA 4I4OA 2E63A 2DU1A 3ZYIB 1G7YA 1W06A 2CV6A 4LO7B 1PVXA 4GA9A 2ZGSA 3RYPA 1PMJX 1QH7A 4LO8B 4Y5SA 3I59B 2JD9A 2VC9A 5A3WA 2CGNA 3X29B 2AGSA 4DUXA 1XE7A 4ZBVB 4Q1PA 4UYBA 3I2OA 1AYM2 1GICA 3B3QE 4GWNA 4IGQA 2XBO3 3GCWA 3OBZA 1SPPB 1Y9MA 4KH9A 5IVBA 2VTFA 4QXHA 2PAEA 3E5UA 4IGPA 3KV6A 1REFA 4Q4X3 4HN0A 5FKCA 2W3JA 3GBGA 4N43B 2WNVB 2BU9A 4COYA 5LEKA 5FP4A 2PXJA 3SCFA 2FDFA 1FQ9A 1N1TA 3J4UH 5AFEA 1LHVA 1CJPA 5C5TA 2VBBA 2WZEA 3AZWA 1PIV3 1YFXA 2WN2A 1ZZ8A 4NAMA 4Q5OA 3ACHA 5IUQA 5HBAA 2ZZJA 3FJHA 3HWJA 1AX2A 1OA2A 4D8MA 1V6IA 5E6HA 4DXTA 2QUOA 4INDA 3LA3A 4O7XA 3LEMA 1EV11 3GJBA 3RYRA 2X2SA 2DF7A 4FCAA 5EZWA 1YI9A 2ZJCA 4YW2A 1V9U1 5DN2A 1RUI3 3AC0A 1MQTB 1VBB3 1G86A 1HV0A 1TE1B 5TSWA 4BYYA 1JI6A 1W3FA 2B46X 4XAEA 4C90A 3E6CC 1IRAX 1TMF1 4AGRA 4BXFA 1COV3 2HJIA 4Y22B 1X82A 5DUWA 5LY2A 3ES1A 1XG6A 4EYUA 2ZEYA 5FY7A 3CAHA 5DUXA 2CWMA 2WA4A 2XKPA 3OGSA 4R9CA 4OW4A 4QX1A 3WMVA 2EIGA 3ZSEA 4CE8A 4ZLBB 3C7FA 5DAVA 5AVPA 5L9RA 3ZXDA 2P39A 2PN5A 3LEIA 4YW6A 1GKBA 1YC61 4OVEA 1WA4A 4XF4A 3TOJA 5DMYA 1OLME 3UD8A 1Q8PA 1WW5A 4IE6A 1PM7A 1RUE1 5F3IA 5FJHA 4BQ1A 1C8M3 4AHXA 2PHLA 4LOSA 5JI9A 1QEXA 5EPAA 3K4DA 4E4HA 1WUVA 1RUH3 1GZWA 4BQ2A 4J25A 2CNAA 5FR3A 4MG2A 2E7QA 3WV6A 2DVFA 4CDWA 3AM2A 1CONA 4EN7B 3D5OA 1NQDA 2CAUA 1NY71 1ZYBA 1XQNA 1ZZ6A 3U1XA 1HV1A 1VBD3 2VBPA 4AQSA 1DFCA 1KS5A 5FPXA 1Y4WA 1JYCA 1KD7A 1MS5A 1TQ5A 2VW0A 3FHAA 2GC0A 3NJXA 4XTMA 5A7PA 1V6WA 4P9JA 1ISVA 1YI7A 1QJU2 4AEMA 3OJBA 5CG9A 2MEV2 1QJX3 4Z2AA 4DUWA 1R8NA 4FO9A 5JLVA 1KJLA 2EA7A 5K7PA 3B01A 4Q91A 4TXWA 5LY1A 5EIYB 1DIWA 1CD3G 1XYOA 4XCBA 4ZZ8A 1XYFA 3VBHB 3PDQA 4UFHA 2XJUA 5IAVA 2RV9A 4CPBD 2KXLA 4GWIA 2FO1A 3BTXA 2UWCA 1E5HA 4PHZA 2JG9B 3ACIA 5L36A 3LIHA 2V4AA 1MS0A 1W9FA 2VUJA 2Y6FA 2IWTB 2YB7A 1ND3B 2Q8EA 2RR12 3OEAA 1PMIA 4AVSA 4FVVA 3BA7A 1I9RA 2RDQA 1TZOA 5DUYA 5FZAA 4P5YA 3VHRA 1XNBA 3WNXA 4XIOA 4Y20B 41BIA 3WOGA 2WR9A 4BWOA 2VVFA 4Q1RA 4COVA 1OQEA 3KVBA 3AZVA 2R9KB 3RPQA 2IXIA 2I07B 4RR3B 1HWNB 4CDQB 4ATEA 4OHXA 4QQOA 5IVVA 5KHGA 3CQOA 1CAUB 3BA4A 4L8QA 1HRI2 5EV7A 4QX2A 3O4OA 2ZMKA 5JZGA 1D4M2 4K9SA 2IXLA 1RUG2 2OQ7A 2Y6KA 4MGSA 4NHYA 2VUAA 4OUSA 2Y33A 4E2GA 2RHPA 2X5IA 4LKSA 3E1F1 4GULA 5JMCA 3HBWA 3MUZ1 2WWUA 4CEYA 3OGVA 2QDNA 1C8NA 2E4MA 4GOYA 3V79C 2O8OA 3VD9A 1Z2VA 4HANA 2D24A 4AXOA 2D7RA 4YYOA 2VUCA 1LR5A 1OF3A 1IPSA 5CA6A 3HT1A 2W94A 3W20A 2FCUA 2HKXA 3PVNA 4B4RA 3W9TA 3VBRB 1DFQA 4RS5B 2OVUA 2L5XA 3GBWA 1W39A 2DDUA 3KCYA 3UKTA 5FREA 3GDBA 3N0KA 3FE5A 2R073 1MEC2 5I0SA 5T55A 1RUD3 4ZXKA 2C24A 5G05L 3O1MA 3WO4A 2QE3A 3DYMA 3OSDA 5JI7A 2XLAA 4EB2B 3CZUA 3FJBA 1R082 1QDOA 2W1QA 2ZX1A 3JUTA 3MW2A 1HQLA 2HWC3 4GMP3 5DZEA 5KXEA 3WP3A 2NMOA 3D0JA 4FOVA 4JGYC 1QXMA 3VSFA 5FBJA 5F8PA 1DYOA 4Y33A 1ZRIA 3B93A 3NMBA 5I93A 3IIAA 1VBE2 3LF7A 1RUC2 2JDZA 2D3SA 3GHNA 4LIUA 1UU6A 4LQRA 4UFKA 3NKGA 4IESA 4MGQA 1UIJA 4ZKTB 1HXS3 2JB8A 1AR73 1GGPB 2E9QA 3WNKA 2DVBA 4BLJA 3FHQA 3U75A 1W8HA 3J8F1 3VT2A 2MHFA 5FUNA 3U0ZA 4X3AA 2XMLA 1A34A 4AQTA 2WQ8A 1FMD3 2WZR3 3VDDC 3AKGA 2QYIB 5FYBA 1X36A 2JECA 2Q5TA 4IYBA 2KA3A 1HIXA 2IVJA 1JZ6A 2XJRA 3MLLA 4J2XA 3VD7A 1F2NA 2H6BA 1BARA 2BOIA 1XC6A 2OPWA 4G6MA 4EN8B 3AMHA 2YBPA 3MLKA 4LBQD 3CF6E 4YGEA 4G1RA 3Q8BA 2WC2A 2VW1A 2J1UA 2P37A 4NHLA 1HLCA 4P9WA 3J7HA 4XFAA 1LNSA 5C3PA 4DEVA 5FNWA 1UQXA 2LALA 2RDRA 1GOFA 3SCHA 3ZVXA 4QHZA 1C4RA 2D6PA 2IXJA 2YROA 1G82A 4AEKA 2GDFA 3SKVA 4QQHA 4XFGA 1QDCA 4NPLA 1YYNA 5T5OA 3WQ1A 3HALA 3O1TA 2ZMLA 4Y1YA 3D0SA 4IEYA 3UESA 2D22A 1BA7A 1HX6A 3KQRA 2VQ0A 2A6ZA 1BCXA 4COZA 1PO13 3AZXA 3A4UA 5FYMA 4A42A 5JPNB 1BZWA 4BIFA 2HW9A 3KV9A 3IKWA 4I4UA 5E24E 1CIYA 4LA2A 3RYKA 3WP5A 3P6BA 2HWE3 3H1WA 4IV1A 3ECQA 4HLTA 1J3RA 2FMDA 3U14A 4Z2WA 4EJRA 4N90A 1LOGA 5H9PA 2JENA 3BRGC 3M1HA 4H7LA 1W9WA 2SLIA 1AR91 2VGDA 3PU3A 4Q2FA 3ZSKA 5F37A 3R6SA 3JBG3 1W6QB 1OA3A 1FPN2 4EFPA 2W87A 1PGSA 1LGCA 4I0BA 2DBIA 5H9QA 1RUOA 4LXLA 1BBT1 1DLCA 2J42A 5FZZA 1REEA 1YXWA 1FWVA 3AFKA 5BVPI 2KI6B 4LO0C 1RHI2 4LA3A 1YFUA 2FZ1A 3V0BB 2DRZA 3D4KA 3PURA 3POGA 4WBBA 4ZFWB 5FPZA 5HPZA 3RZLA 2W1WA 4G9MA 2FZ2A 2J1EA 2ZKLA 4CUCA 2BOJA 1OQLB 4GWJA 3T2TA 5F90A 5BNOA 4C0BA 3AH2A 2XVKA 1K5VA 4XFHA 5FZ8A 21BIA 4QQ2A 4GKYA 2JDKA 3ST7A 1BEV2 1P8JA 4Q0UA 4I30A 5DG2A 2RS53 2HWB1 1S2KA 1IS5A 1SCRA 5LK5A 3D82A 5FPBA 1MS4A 1YRZA 4HN1A 5IVFA 3ZXGA 3RZKA 1IS6A 2HYXA 3DF0A 4Y3OA 4ARXA 3ZDVA 3AKHA 1FV3A 1WD4A 1GLHA 1UY3A 2JG8B 4AI3A 1Y7BA 2DCKA 5GZDA 4E4SA 3RZMA 2ES3A 2VMGA 3NRUA 3WHTA 4TLPA 4ENDA 3RTJB 4EKXB 4YW5A 4XMAA 5DAWA 1UN1A 2PLV3 5EG6C 1YJKA 1RUJ3 2BEOA 4HMZA 1JN2P 1L7QA 5CFDC 1O8SA 4LPLA 1CAVA 3BALA 3BPSA 3H3UA 4O9EA 4CCMA 5CFCA 3BA5A 3T8SA 1ZVFA 3LDBA 4MZUA 5GZFA 5FZOA 1ENRA 1Y9QA 5CADA 3OB8A 1SCSA 5GJ6A 2C5DA 4ES8A 2W1UA 1IJTA 2VZPA 3HT2A 3PHMA 3QLQA 3AP7A 2WAAA 1WBCA 3BOWA 2WAOA 1UXXX 3AZYA 3C9ZA 2ARCA 5FZMA 3F62B 1YQ2A 3K3OA 3T09A 3LOBA 1IILA 1S0EA 1W2AX 1W8OA 2WNOA 1RMLA 2BFHA 4MZFB 4JCKA 2X53S 1AYN1 2B5HA 4OEFA 3VHPA 3FL7A 4FTSA 4XXAA 2WS92 3GALA 1DU3D 2GH2A 4OZXA 3WG3A 4IY8A 3LZZA 4U36A 4AR2A 4JGYA 1LOCA 5LEJA 1BFFA 1EYBA 2OKXA 1JZ5A 1JOPA 3N9PA 1JYIA 5IFTA 2JJ6A 2OIIA 3PG0A 1O3SA 2E32A 5C3RA 5AC93 4D6SA 1UIKA 4R8HA 1DYPA 2EICA 1SBEA 1JMUB 2Z42A 1FMZA 1QXRA 1DYKA 2ZX2A 4RFT0 4CXXA 5KHJA 3OJMA 1N4KA 5C3QA 1X9TA 2OPKA 1JT5A 1UYYA 3KVAA 5KHKA 1H2NA 4LHNA 4QB6A 5GLZA 5L7OC 1X8EA 2VMCA 3VDDA 1QY4A 3P5BA 3FJDA 3N9NA 3WINC 3HOBA 3JU9A 1CWPA 3FUQA 3USUA 4GP0A 2Q4SA 3MPBA 1QQKA 3VBUC 1S0GA 2RDSA 4HONA 3DCQA 5FYVA 2RQ9A 5JAXA 1PK6C 3PJYA 3LFIA 3UDAA 4E4ZA 2VTXJ 2JICA 1ZBA2 4G4FA 2A6YA 4FP3A 4JRLA 3MPPG 1ND2C 2C26A 3CDZB 4L92A 4QKDA 3O1OA 1I1BA 4OULA 1RVF1 1BKZA 3LCPA 4PQQA 1W99A 2XKOA 1NQJA 1U0AA 1AX1A 1CR7A 2H6CA 3DN7A 1GZWB 3LEGA 1PUUB 3CIHA 4K8FA 2GP5A 3ZLIA 4Q9PA 1DZDA 4CDWB 3EO6A 4QGNA 1QJU3 1WMEA 3K4ZA 1CPNA 2MEV3 1QQLA 3ZFGC 4QM9A 3GZEA 4FPLA 4PDWC 4Z9WB 2VTXA 4AGGA 3AKRA 3ZKYA 1IPJA 3IWZA 1SBFA 4QXKA 3OYWA 4PI0A 4MH0E 3RDIA 3WNLA 3K48A 4QDRA 1GOGA 4AFAA 4FPCA 3PMSA 2LIEA 2VNOA 4ZS2A 1IQDC 2P3IA 1OC1A 2P34A 5LBBA 5K0UC 4BMEA 1NE6A 4A4AA 1Z7S3 3TEWA 4LT5A 2RR13 4XTPA 1IT0A 1MVEA 3K75B 3WDWA 1JYNA 2BBVA 1R8OA 3AKFA 4XHXA 2WWSA 1AL21 1PZ7A 1BMV1 3B5LB 3NNFA 3U07A 5T50A 1FI2A 4XFFA 3SH4A 3RVHA 1SG3A 2XL7A 4W65A 2XWJB 2YBSA 1DBNA 2F8XC 4BA6A 3NBCA 2YBKA 4LO0A 1PM4A 4FAGA 4AN7B 4ZS3A 2D7IA 1S0CA 3PUHA 3NV1A 1H6XA 3OEBA 2G4IA 1UZWA 3HSMA 3OBTA 1HRI3 1W0OA 4IEOA 2GMEA 1D4M3 1G9FA 4FOQA 1RUG3 4C1XA 5ACA2 5F1RA 4KEJA 2VZRA 1J84A 4EEEB 2QQWA 3L9JT 3Q8EA 4K21A 1CX1A 1J3PA 1ABRB 2QQVA 1KGYA 3FFZA 2ZOEB 2XB6C 4Q8KA 4V1PA 3NBEA 2Q1MA 2VNGA 4QD2A 2AZ5A 3VKFC 5JZGB 3T0DA 1OA4A 3KM5A 1S55A 2VZUA 4KWKA 3B00A 3CU1B 2X5IB 1YQCA 2YC4A 1SFYA 4CCNA 3Q7XA 5LATA 1T6GC 3O4BA 4CEYB 4YPJA 2Y60A 5IFPA 4AK3A 5F8SA 2YUGA 31BIA 4FQZA 1WGPA 3B9CA 4YW4A 3AL5A 1LHWA 3SLIA 1MEC3 5D8AC 4WVMA 1YFYA 5KXCA 5FYUA 3O4DA 5FFOC 2K0GA 3PHZA 4NROA 5LCWL 3WG4A 4HT1T 3A0NA 4CP0A 4J2YA 5HCHA 1R083 2E51A 4EZHA 4K1YA 1W9SA 3DPRC 3FUOA 3E97A 3PTYA 2D6KA 3OUIA 4DO0A 1ONKB 4I4YA 4SLIA 1II4A 1SZ6B 4ASMB 4A3ZA 4ZXEA 3VV1A 3M3OA 3FJFA 1VBE3 4OZOA 1RUC3 2BGPA 2QCSB 3KB5A 1RC6A 3UD7A 3ZXLA 1K5JA 2VPVA 3OG2A 2F2FC 4TLFA 4XPVA 4HFSA 2GNBA 2I2SA 5I8TA 3BYWA 3FJAA 4ZA3B 1RXFA 2XJQA 1QJZA 3B94A 4LUKA 5FZ4A 2VSEA 2ZX4A 3E5QA 4XHBA 1EAH1 2VG9A 3AH1A 2D43A 3DXTA 1R092 1UMZA 3P6JA 4QBCA 1C3HA 3RFRA 3ZN4A 3BRFA 4XEZA 1LHNA 1F5JA 4B1MA 5FOBB 5KC6A 1EPZA 4P9LA 4NHXA 4XFIA 4LUMA 2XJPA 3RSJA 2A6VA 2XJTA 3N9LA 3ROUA 1UY2A 1OOPC 4RYDA 5F6KA 4QKSA 2IXHA 3AX4A 2PHTA 1AF9A 3AP6A 2ZX3A 1RUF2 2VMEA 1PHMA 4PIYA 1BASA 4FPEA 1ZBE1 4NIHA 3KCCA 4LLOA 2A3XA 4I8MA 4QO3A 5JXIA 4MXVA 3WCSA 4M01A 4XUPA 1POV0 2LRPA 1ULFA 2VQAA 3QACA 1UOJA 3CL1A 2WABA 2Y9WC 1A78A 4HZFA 4JDNA 2WO7A 4RGAA 5F39A 3O4AA 2J1VA 4QKFA 4YZ2A 2O0OA 2Q3NB 3CA1A 3VD4A 1DQOA 4JQ0A 2D23A 5EWSA 5B4NA 4CCLA 3H6RA 3OPWA 3GYDA 4J1XA 1ZRRA 2WNUC 2R16A 1A6CA 3FJEA 5A33A 5L7OA 1UCXA 1A8DA 3JXSA 4TN7A 3KHBA 3LA7A 5CYYA 3WINA 2FFUA 4P9GA 4XFTA 5F2WA 2JE9A 3TAYA 4AHYA 3UJ0A 2JIJA 1DZRA 1J58A 3VBUA 5D62A 2OZ6A 2HWF2 3E8LC 4JKXB 3V0AA 3S5QA 3BB6A 1PK6A 4IV1B 4HKLA 2RS11 3VB9A 1C5HA 3PJQA 4CP9B 1RG8A 2YDEA 1FPN3 3KT4A 1PVC3 3AL6A 4Q4Y2 3VBSC 2QTWB 4BQ5A 2JE7A 1E5RA 3CA0A 1HRV1 4FPHA 2JKXA 3HQUA 3CEWA 4HG6B 4IGOA 5F6LB 2NQYA 1WBAA 2ARXA 5A6ZA 3ITQA 3ZMNA 2ETEA 1ZRCA 3VWCA 5CIRA 3T08A 3I3BA 2BNOA 3WD5A 1NY72 4WVWA 1IKQA 3I3DA 3I2FA 3I2JA 1HWMB 2GZBA 1AZDA 1LOAA 1FN0A 4PBPA 1K42A 3BRDA 1V6OA 3I2GA 4PDWA 4WZFA 5D21A 5D1IA 1SLAA 4S2DA 1LGBA 1H1AA 3AKIA 1PO22 4M0HA 1W2OA 2XG3A 4X8PA 4NJ4A 1BEV3 1A3KA 4JC1A 4Y1XA 5A3OA 5BXTA 4UW5A 4C1WA 3T30A 2N7GA 1SZBA 3VZNA 2CTVA 3A7QA 5BNOB 2X2TA 2H0VA 3CA4A 5K0UA 4R6UB 3THDA 1CIWA 2JWPA 4JVAA 5LRSA 4I0AA 4ZGRB 3GJAA 5F5AA 4QXCA 1P63A 5FLIA 4YZ1A 3M2MA 3OBRA 2AYHA 1YO8A 4S2FA 5G04L 1DG6A 1H1MA 1LJ7A 1UY1A 3PIJA 2J1RA 1ST8A 3U4SA 3BB2A 2PELA 2PHRA 1GWKA 3FX3A 3ME2A 5C4WC 4EQVA 5FAXA 3WO2A 5JWPA 1O4ZA 3MV01 1ISWA 2VD7A 2VZ1A 3THTA 4YFWA 4IE4A 1REDA 3UKVA 2XBO1 5EFUA 1G9DA 1NCRC 1W8NA 1W0NA 4Y5TA 1DQ6A 1U5ZA 3AJZA 1W6PA 3L2HA 2F4PA 3TNQA 3O1UA 5A7SA 4WM7C 4IXLA 4Q4X1 4DXRA 1L7LA 4CEWC 5KXBA 1U12A 1GP4A 2ZX0A 4E9KA 5FYHA 3I2DA 3R05A 4D7SA 4KG8A 1CAVB 4N9IA 2WUHA 2PHWA 1PIV1 1E57A 3LB9A 1VRH2 5CFCB 1CESA 3H9AA 3O0VA 5FZOB 1BK0A 2WQ4A 5B2HA 1R1A2 1DZCA 1XE0A 4W6XA 5F3CA 5C8CA 4CCJA 3BI3A 1AX0A 1MVQA 2AR6A 5D8AA 3WDUA 2FDHA 3C7GA 2WN3A 1HQWA 2AEZA 1BXHA 1UAIA 2DTWA 2QQOA 3ORJA 4R9BA 4U2AA 3UD9A 4AZZA 4I4SA 3NNMA 1UYZA 5BNPA 1RUI1 2R063 2FDGA 2WS93 1CE7B 1VBB1 4ZFUB 1GNHA 1VB4A 3WUDA 1MC9A 2AUYA 4AYUA 5FZCA 2VMIA 2RJLA 1S1AA 1I1EA 2Y34A 4GP3A 4YZ5A 1COV1 1UW8A 1OKOA 4GWMA 3V64A 3I4IA 2PHFA 2BZDA 2JE8A 4KEIA 1N1SA 3TN92 4A2UA 3F95A 3RMYA 4JGYB 4O61A 3D8CA 2XXZA 5L9VA 5FO8B 5JCTA 3I49A 2XJSA 4ISRA 2ZS6B 3SNVA 4IEZA 1H4GA 4NMIA 1O4YA 2XUEA 1HB3A 1Q8SA 4ZONA 1BLAA 2ERFA 1WLTA 2WDBA 2FGFA 5LA2A 4OMCA 3ZYGA 2PTMA 1BLDA 4A7YA 1NA1A 1C8M1 3OGGA 3J8F2 2Y6JA 4YLZA 3O44A 5FUIA 1DGLA 1H8TB 4AI0A 1X50A 2P6HA 2Y6HA 4PBOA 2LROA 4NOTA 1O6UA 2OUJA 2ZEXA 2WLPA 3T2OA 4A6SA 1RUH1 1FAYA 1UNBA 3F1RA 1D0GA 1OOPA 4QQLA 5F8YA 2VSAA 2R1DA 4QAWA 3ZM8A 4E4DX 2O1QA 4LEJA 1W6MA 3USUB 3FZ3A 1PGL2 3DYPA 1QJY2 1VBD1 4IE7A 3A0KA 4MLOA 1UPSA 1O4TA 3TYJA 3WCRA 1B35B 3LIGA 1G6NA 3VZOA 5IK4A 3ILFA 1H2LA 1RB8G 1QJX1 5T5LA 2LTNA 3IPVB 4PI2A 3VBFC 4CYDA 1XYNA 4DB5A 4YVWB 4F83A 1LESA 2QN4A 5FZBA 1NUNA 1YTOA 3POEA 1VBC2 1VLNA 2IFWA 2YHJA 1BVP1 2ZXQA 1IQAA 2V72A 1HJFA 1S0BA 2DCYA 2E7TA 2WNUA 1WD3A 3C7EA 4MGYE 5FZLA 1N3QA 4QC4A 1O5LA 4TZDA 4IV3B 4Y24A 1F4HA 4DINB 5A7NA 3OBAA 2NPIA 1V6MA 2QQJA 4NE9A 4YVSC 4UY4A 3HN3A 1NOVA 1K45A 3APBA 4IW3A 4XFUA 1U5IA 1YF8B 5BNNB 1AVAC 4AL9A 1H1IA 1NCQB 1NLQA 1Y43B 4GALA 4DIQA 5T52A 5A3LA 2QQPA 5BXRA 3O5SA 1HWPB 5FYYA 3ZYFA 4Q4V2 3VBSA 3VUOA 2E26A 1AR92 3HNMA 4MYEA 1JYXA 1ZRFA 3QH7A 3ETQA 4QPGC 2YFUA 2ZGUA 2GC3A 3CZJA 3N9OA 3PU8A 2P2KA 1YJLA 3TEXA 5J09A 3ACLA 1WW4A 1XSRA 4EZ4A 5H9SA 1BBT2 1JYVA 1MD6A 4I2SA 1GP5A 1KITA 2E7AA 2G9GA 2VNRA 3RWKX 1CZTA 3UL2A 3BAOA 5BXPA 2XHKA 1AR63 1GWLA 1DZQA 4D7YA 2R1BA 4Q29A 5FYZA 1H6YA 1W04A 2W9XA 2XWBB 2VOKA 3KT7A 2PAMA 3ZN5A 2OS2A 1JT4A 3MZHA 2BRTA 4EE2A 3IM7A 4V2WA 3CA3A 2WINB 2RM22 1RY7A 2D6MA 5FLHA 3WNOA 1U5XA 4CCOA 4FOYA 2W68A 3O12A 4I1BA 1IGOA 1SLTA 3VD3A 2R071 4DMIA 3WG1A 1R1ZA 1RUD1 3IN9A 4QD2B 1TIEA 2Y8KA 1RJ8A 3RRDA 2VAUA 2I74A 4Q26A 1VE0A 3VZKA 4I4QA 3IAPA 5DZUA 2JDHA 4II0A 2HWD3 3H1YA 4HPKB 2XR4A 2DWRA 2HWC1 4GMP1 4AF9A 5C4WA 2QQMA 3LKJA 3KD4A 5J36A 4DRRA 5C7GA 5K8SA 1GNZA 3LDRA 4Q8LA 4ASKA 4WVMB 5A7WA 1ZZ7A 5DXDA 4IZXA 1QIQA 4FT8A 3FC0A 2UU8A 3WR0A 1W9YA 1YEWA 3HIFA 4P9XA 2GN7A 4XVHA 4Y26A 5IVJA 1NCRA 2QQIA 3R4SA 5FPLA 4FFGA 5FP3A 1ASJ2 1KFXL 1HXS1 3CLPA 1AR71 3IAQA 3LE0A 5EJ1B 1O59A 2CDOA 3E5XA 3K3NA 1M2TB 4KQ7A 4QMAA 1MR5A 2QZ3A 4I4XA 3IM0A 4D6RA 5IATA 2QKDA 1VBA3 1WBFA 3HJRA 4XQWA 2VCMA 2UUSA 1D7PM 2YMZA 1FMD1 3WP6A 1OHFA 2WZR1 4RHV3 4XACA 1G9BA 1FXZA 1OBNA 4LK7A 4K6BA 3WF2A 4IEXA 3WINE 3DL3A 3NV3A 4PJYA 1R093 1FV2A 4AQ6A 3TEZA 1V6JA 5FO7B 4G6JA 3PLQA 4HA2A 2YU1A 4QDSA 1WCKA 4W6YA 1C57A 1ILR1 4AEDA 1XRUA 1HKNA 4UFLA 3QR5A 3NWKA 2VZSA 4MXWA 3WNNA 1FNYA 2BWAA 2R042 4PIXA 4CDXC 4I37A 2PA7A 3FBMA 5J3UA 1RUF3 3HD8B 1HWOB 4W6WA 1SLCA 1SACA 3B7MA 4G3YC 2DURA 5LRRA 5FZ0A 4NWWA 1KDMA 3VT0A 3ZPYA 1O3RA 3H3LA 2WL1A 4JX0A 2OUHA 4TWTA 1H8VA 5FXZA 2BQPA 5F5IA 1UO9A 5FYIA 2OA2A 3ZYBA 4Z1VA 4IY9A 5IK7A 4GB32 1I5ZA 1PO11 2D5FA 4B29A 3IDCB 5J98B 1UZVA 3MYXA 2QQLA 3H6QA 1QQP2 4EFRA 2XVGA 3GXUA 4GAFA 1DLLA 5E89A 4BQ4A 4IE5A 2HWE1 4JKMA 4YWAA 4CPBA 2UYAA 3ZFEB 1RTVA 5BNQA 2ZQOA 2WT2A 5GLUA 3ZFFC 2BVVA 3H6RB 1VPHA 3NAPC 2UWAA 4ARYA 2XL9A 3CU7A 1JLXA 1SLBA 5J37A 3AH4A 3BAQA 3N7JA 1YQ5A 1TWMA 2P3JA 5A33B 2RS32 3JBG1 5I0UA 4E2QA 5A1AA 5L7OB 5EC5A 4XJ8A 5C5UA 4XDQA 4XKIA 2HWF3 4WBCA 3L2YA 4CXWA 1LEDA 3JD73 3O49A 3T4VA 5DAXA 4QM8A 2DTYA 2V5YA 4QGMA 1UZYA 2OX0A 4M00A 4Q4Y3 3MEPA 1C28A 1BYHA 4JHZA 2WYFA 2NP0A 3SXWA 3WG2A 2RSTA 3S7IA 2YU2A 1DP0A 3UNPA 3FFQA 1M16A 1KFUL 2WFF2 1PK6B 4UBHA 2VCBA 4R9DA 1IS3A 1K5UA 5FYSA 1LENA 2BTVC 3VBFA 3FBYA 3KF3A 1TNFA 1NX9A 2YZ4A 4M4PA 4OFGA 2DUPA 3BIWE 2NS2A 4AFCA 4CU9A 2Y9FA 2B42B 3WVJA 3BAVA 3MIEA 5FWEA 4EN6B 4JDOA 4CZSA 3W5MA 1EV2A 3DGTA 4JQTA 4G9NA 2G1MA 5BV6A 2RS51 1SDDB 1UPIA 5FV3A 4DZGA 3Q9OA 1PO23 2E31A 2QZ2A 3ZXFA 1Q8QA 1UOFA 3DXUA 5C3SA 1IKPA 1W8TA 4EROA 1H4HA 5ABJC 4IONA 1LULA 3FN9A 4QB2A 4LO2C 5BQUC 3S7EA 3M3IA 5FIXA 1G8WA 2W0XA 4AFDA 1LU2A 1ULEA 4XJ9A 1FMMS 4DENA 1OQ1A 4CP2A 1LEMA 1LCLA 3OD4A 3RJRA 3WF4A 3IM6A 2G19A 5D2AA 2J1AA 3LEKA 4N53C 3ZN6A 2P3KA 4QPGA 4USOA 4X38A 7I1BA 3AP9A 5FWJA 3AMQA 4WM8B 2PLV1 4XQ4A 3NL1A 2GC1A 2LM3A 2SBAA 1RUJ1 3BN6A 1RMU2 4CRQA 3MF6A 3K51A 4Q0QA 5A7QA 3M7AA 3MLJA 2A3WA 4LO5B 3FHIB 4AFMA 1EY2A 1O3TA 1DQ1A 3Q8CA 4H75A 3R0RA 4OLLA 3NBNA 4UWDA 2WO3A 1OQDA 4N43C 4OWKA 2OT7A 4LBMA 4IDZA 1V6NA 4LKFA 1D4VB 2VCCA 4XQDA 2VQTA 4NIIA 3AJYA 4NPMA 4BMBA 5CAZA 3FJJA 1OPMA 1W6OA 4P08A 3BU0A 1JH5A 4HKWA 1BVVA 1IG3A 1VRH3 2W39A 5LBCA 3KGZA 1IHMA 2WWJA 3SMHA 5C6CA 2DS0A 4AI9A 2ZHNA 3OY8A 1I5PA 1R1A3 3VKMA 4MZHA 1IG0A 2A71A 3ZIXA 1W3AA 1GBGA 5LWBA 2O8QA 2RMU3 4LBQA 2VBDA 1J1TA 2VMHA 2NZ9A 2YC2A 3NJYA 4XYXA 2IZWA 1MQTC 2CU5A 2PHXA 5BXSA 1CGPA 1XU1A 5C8CB 3MGUA 2BJSA 2UYBA 2ZGMA 5D8AB 4QPIB 3VDAA 4UBGA 2QFEA 1OLQA 2X8KA 4YFZA 5AC91 4Q9GA 3AYDA 1OT5A 2CY6A 3FLPA 5BNPB 2VMDA 3LPFA 4NVPA 1DGRN 2VZTA 5KHIA 4UF0A 2RDNA 2WJSA 1FGAA 1OF4A 1QOTA 2XQRA 3TN93 5EYYA 4Q4W2 1AVWB 1AUYA 1QGLA 4NIDA 3SITA 3O1RA 2EXJA 3WSOA 2ZACA 4QGLA 2VOXA 1DCSA 2QNKA 2VVDA 4CJMA 1UYXA 2ET2A 2ZMNA 2HEYF 5EJZB 1H2KA 2D98A 3EHKA 4OEEA 1AFCA 4I4RA 1CZSA 1KJRA 1UX6A 4E27A 4ES9A 5LW9A 1EUTA 3PL0A 5C9AB 1NA1B 4DFSA 1VIWB 2AREA 1NG0A 1PMHX 1QJEA 4HVOA 2NTDA 3HOMA 4CDXA 2EAAA 4YZ3A 4FTEA 3CMGA 5FK8A 4K7JA 5I8YA 4OQ9A 1AYM3 5A80A 2PQQA 2LUWA 2ZTNA 4JPZA 2D20A 3MIHA 3W59A 3UJ4A 1QJU1 1W6NA 3TRSB 1W6MB 1XNCA 1Y3TA 3IMMA 2MEV1 2EIDA 1AJOA 3CKHA 4QQPA 5ANNA 5A6XA 5APAA 4E8DA 1SFNA 2EAKA 1GR3A 3U78A 5FZFA 1AR82 2YYOA 3PUQA 3A23A 4I3GA 2IHOA 3VBHC 3WX5A 1VBC3 2A6XA 3KWVA 5A70A 1CAXA 1F31A 2J1TA 1MS3A 2YGLA 1W8WA 2ZR1B 1W8ZA 3CO2A 2YY1A 5FY9A 1HB4A 5IVEA 3ZFFA 1Z7S1 3KT1A 3NAPA 2RR11 5HV4A 2WNUB 2A1XA 4GXLA 1OI6A 1BFBA 2ADEA 3NBDA 1YLLA 5I0DA 1TFMB 1QNWA 3U37A 3I3MA 1QXPA 3WNMA 1RGSA 4HOOA 2V4VA 4PT6A 4XILA 3C8XA 1RYYA 4CDQC 2W95A 3IIIA 4XZUG 4Q4V3 1FX5A 1JHJA 1W8UA 1JZ3A 4R4ZA 5GLTA 2QQUA 4KEKA 5DUUA 4L99A 2P6CA 1UMIA 1YNAA 4UW6A 3WY6A 4F8AA 3VT1A 5FKBA 1HRI1 3AMNA 3UJQA 4BPZA 1D4M1 2RE9A 3KSCA 1RUG1 1HRV2 2ZEWA 3KLSA 1J83A 1NKGA 1S2EA 3H8UA 4ZU4A 3WDTA 2NM1A 3IDEA 5LZ6A 1D2QA 1AVUA 3AVSA 2JDYA 4JKLA 4X6QB 3MDPA 4XUQA 5FRAA 4KMQA 1X7NA 3ZSLA 1PGW2 1DJSB 3RZGA 5HCFA 2EIBA 2NYYA 2RM23 1QU0A 2KD7A 3I2IA 3VBRC 5BP5C 3AJ6A 1X33A 4MOAA 1LAJA 5FQ0A 5ABJA 4A45A 2X10A 2D3PA 5BQUA 1MEC1 1VAMA 5ISLA 4NWVA 4GJYA 4GZ9A 4ET7A 4IEVA 1MZEA 2AFGA 5DVHA 2H0BA 4DCKC 3LLPA 3I3EA 1R081 1GMMA 3R4UA 1KS4A 5FZ3A 4N53A 2QBXA 2JD4A 3LSDA 2W92A 4LBKA 4QHOA 1S0LA 5FZUA 4BQ3A 1US2A 2GSYA 5EXOA 5JVVA 1NE4A 1T6BX 1VMFA 4I0WB 2R0HA 2IC1A 1UZ0A 5GM0A 5A7OA 3CRHA 1VMHA 1PX4A 1SPPA 1VBE1 3JQWA 5CNAA 1RUC1 5DUVA 3NV4A 3ABZA 4AAXA 2W5FA 3WLUA 2AENA 1ASJ3 2B9UA 4BB3A 2BW8A 1OKQA 2JDNA 4HR6C 2JDMA 5A7WB 2BP6A 3WZ1A 2X09A 4CU8A 1QMJA 5I8SA 3ENRA 3N7LA 4ASLA 3TEYA 5JR2A 2JXAA 2K8RA 1NXMA 2WA3A 3POIA 4ZPIA 4KL1A 2AACA 4A6OA 5DAPA 3ZDSA 4AWDA 5L19A 4RQPC 3LGRA 4JGZC 4JZRA 3BTYA 4AI1A 1GFF2 3QYDA 4HK8A 4BDVB 3N35A 4DEQA 3AYCA 4YM1A 5FY5A 5DAQA 4HETA 4LMFA 3O3QA 3WQ0A 4K8RB 3OF1A 4BK4A 4QKBA 3A07A 3BCWA 1F15A 3NW4A 5FZIA 3FJSA 1H2MA 2K46A 1WMFA 2DYCA 2MNGA 3JB8A 3P3PA 4QKNA 3RMXA 3WW2A 1VR3A 3T3YA 1GQGA 2XQXA 1ZZCA 1TME2 2R043 4WZCA 5FJKA 1AHSA 3T0AA 1CVSA 2JDAA 1FOD2 4AEDB 1RUI2 1S0IA 5C3OA 1XNTA 3O1VA 1WZXA 1VBB2 5GLVA 5IHRA 4I96A 4B1LA 3C7HA 3BU7A 4URAA 3M8LA 4CCEA 2A75A 2F6BA 4UFIA 3TBDA 2JEMA 4GB33 4ITCA 2P1BA 4KU7A 4AHZA 1S0JA 5DDJ2 1VJ2A 1SR4C 4LO3C 1QQP3 5D63A 5HV0A 1APNA 2W08A 1PZ8A 1JOBA 3AMMA 3MO4A 2GALA 2WBCA 3MIFA 3VN4A 4IE0A 5FOJB 3AMPA 4QU2A 3FLRA 5JOWA 2P4EA 3D6EA 3PVBB 3JZVA 1Q43A 2HBTA 3HN1A 3T2QA 2RS33 3WDYA 1N1VA 2VO5A 3H8RA 1E0OA 4FPYA 2A3YA 1FPN1 2OQ6A 1PVC1 4H7MA 4Z92B 1UY4A 4S2HA 3IIRA 2ZABA 3DUIA 1XYPA 1FT9A 5CFDA 2VOTA 1YUDA 3UJOA 3MIBA 5F5QA 1IRPA 4IEQA 1EYLA 5SV5A 3ZYHA 2WRYA 1ULOA 2M49A 2WFF3 1RL3A 1WBLA 4FGFA 2GP3A 3P1IA 5E8AA 3ILAA 2BBAA 4FPFA 2DCJA 3N9MA 3FJ9A 4META 1UKRA 4OHVA 5ERLA 1Q5OA 3VBHA 1M4WA 2D7FA 4BXSV 2BGOA 4CXYA 5C8WA 1BEV1 1D0HA 3VBFB 5JSPA 1OSGA 1UY0A 4X8NA 3J26N 1QWRA 5JMOA 5L9BA 2WKKA 2VXTI 1Q8VA 2DU0A 5J48A 1HN1A 3DKWA 4QX8A 2HEWF 3VDBA 1W3GA 5FMBA 5FP9A 2ORXA 3AFGA 2FHRA 2FDJA 3ILRA 1UU5A 4GAZA 3VBOC 2JG8C 2JX9A 2VZQA 4Y20A 4LHKA 4XCAA 1EV12 2Y9GA 4OUJA 3GZAA 4FPKA 3TNPB 4KU8A 4QHBA 2BERA 3TB0A 1AXMA 1V9U2 2VOVA 3GGLA 3M70A 3M3QA 3MIGA 5BUVA 2FCVA 2XONA 4OI4A 2ARAA 2ZHLA 3VHOA 4AEJA 4B8EA 4TTGA 4PF1A 1V6LA 3ES4A 1TMF2 1RMU3 1JODA 3M4FA 2BFUS 3POYA 1Q56A 1V6VA 3CQAA 3RTIB 5FXVA 2ORZA 1ODMA 4FXGB 4HK9A 1VRBA 4BE3A 2D1ZA 3BAHA 2HWMA 4NRMA 2EIEA 2RJ2A 2RG4A 3RI9A 5CBLA 2FDIA 1GU3A 4HSJA 2K9ZA 1K3IA 4QB1A 1NZIA 3VBRA 5BP5A 4BK5A 3PUAA 3POWA 4B3NA 1RUE2 4I01A 3MUY1 5T3NA 2DFCA 4ZOTA 2B4KA 2VZOA 3JRRA 2CYFA 5FZ7A 3MICA 4YZ4A 3B9UA 4I0YA 2W2IA 3VKLA 2BWCA 1ND2A 3B02A 3TWIA 3P3NA 4BU2A 5CG8A 1GP6A 2DCZA 8I1BA 2R072 4XURA 1W6OB 4OHWA 4P6AA 1QXJA 1RUD2 4LOTA 2R061 5FDBA 3R4DB 1RHI3 2WS91 4OI0A 4M0NA 4QDQA 3RZZA 2TUNA 2AAIB 1TNRA 3E6BA 1UKGA 3OY8B 1O8PA 2D44A 4DNYA 2UWBA 3K1XA 3ZFGA 1W05A 1DZTA 1XOYA 4D7TA 3E6DA 3NKTA 3RGBA 3H6SE 4KC3A 1VAVA 2XPJA 4JRAA 4XW3A 4F7ZA 1JTCA 5DSSB 2B9VA 3VL8A 2ZAHA 3DECA 1OD3A 2E53A 2TNFA 1BHGA 1XU2A 4HKOA 1YCIA 1HXS2 2JDUA 2XVLA 4KI5M 4PCRA 4Q4W3 4RGGA 3LD8A 4RQPA 2WLQA 2C6SA 4JGZA 4UT5A 1QH6A 3ASIA 1F5FA 4CSWA 1OLRA 5IK5A 1YHFA 4AW7A 3POKA 3BX1C 2X29A 2Z4FA 1ITBA 1FMD2 1BLZA 5IJRA 2X05A 3MBWA 1C5IA 5FK7A 5LBEA 1DGWX 3KV5A 4KWUA 5FXXA 3J7LA 3LAGA 4HBNA 3C2UA 5M0TA 1ODNA 2GNTA 1FNZA 3MALA 1CQ9A 3U11A 2LIQA 1PZZA 2PAKA 3K2OA 3N7KA 3N9QA 4I3NA 2HWAA 4YRDA 4K1ZA 3VD5A 4CDXB 4GH4C 4PF5A 3P53A 1GNYA 3KQ4B 1CAWA 2F17A 4UI9L 3USSA 2B39A 4D0QA 2J3PA 3LFMA 4IETA 4GOVA 4OQ8A 3OOXA 3DYOA 4J1WA 1ALYA 5FZYA 1AR83 3MIDA 1TG7A 4I02A 4DY3A 1SR4A 4LO3A 1WLCA 1RXGA 4BCUA 1PO12 2XGXA 3T4HB 5KC5A 1K5MC 3I54A 1O5UA 1W8FA 4LHLA 5KWRA 1POV3 5DPNA 2PYTA 4NHMA 4LNVA 3GZTB 2CHHA 4H2AA 2HWE2 3NJVA 3URFA 4X39A 5HCBA 4NR1A 3RS6A 1E5SA 3DPRA 1CAXB 5FP8A 1X9PA 5KHHA 3WNPA 4XUTA 2Q8OA 3ILNA 4K40A 1STMA 5DQ0A 1OUXA 3NAPB 2DREA 4R9AA 2XLGA 5CZKA 3ZSJA 4DRVA 3AJ5A 3AK0A 4A41A 5LA0A 3Q8AA 2Q0AA 4MHUA 1GANA 4B4QA 2ZGQA 5JDBA 4KGQA 1HIBA 3WO3A 1DDLA 2F2FA 2AH2A 3HPNA 3JCIA 5IAXA 1MS8A 2ZQNA 4OMDA 4TLGA 4PLNA 1AR61 1DQ5A 2B8MA 5A1LA 1URXA 1TP0A 1AXKA 2GU9A 1LGNA 3H1MA 3EQEA 3UKNA 2QDRA 2TBVA 1DF0A 4GKXA 2Y6GA 4L2NA 3DKQA 3J7NA 2EF6A 4P00B 4H9WA 1EVTA 3BGAA 4LKEA 1KQRA 5DZGA 4CEYC 4UFJA 1TEIA 2WFPA 5HPOA 1PC8B 2GAUA 2D93A 3VDDB 1L7RA 4IUGA 1AJKA 5BOWA 3ZR5A 4D0TA 4OEGA 4UW3A 3VBOA 1IHKA 5F5CA 2XOAA 1ZBA3 2JG8A 3RG0A 3GCXA 2HWD1 3VKOA 3BOPA 1V00A 4I7IA 5A3PA 2WT1A 4NPRA 3HBKA 1ZRDA 1Q1UA 2ZCWA 5ABJB 5LASA 5IW0A 4KWLA 1W03A 3KHCA 2UURA 4OUMA 1XXNA 4W4ZA 3AKSA 4A3XA 4XXPA 3ZYJB 2UY9A 4MADA 3W21A 1LB2A 1O7FA 2QQKA 5FZKA 4CA9A 4HVRA 2VVEA 2BEAA 4I1EA 2I45A 4N53B 2Q8CA 2PLV2 4IL7A 3KMVA 1RUJ2 1VMJA 2WT0A 5EHAA 2ARBA 2Q9XA 1QKQA 1VBA1 4J6GA 2W91A 2IXKA 3O1PA 4RHV1 1IS4A 4QX3A 1MZ6A 4V2VA 5KR7A 3QH6A 2OXBA 2GNDA 3CJIC 3OYWB 2VXRA 1R091 4XE9A 4CP1A 2Q1ZB 3AKQA 4CUAA 2Y0OA 4YSFA 3AP5A 4YARA 1ACCA 1ZZBA 1MZFA 4M3CA 4N8MA 4YW7A 1WCQA 5IWFA 3RZHA 2AXMA 2VZVA 2J22A 3OPTA 3AB0A 2Y9XE 4CDUC 3IZOA 1YIPA 4AVAA 4IZEA 1PX3A 4QBVA 1RUF1 1XB9A 2VXJA 4RD7A 4WV8A 5LK7B 4AGVA 3WDVA 1T9FA 1YWKA 1TWEA 3GHMA 1HW5A 1R64A 1TME3 5ACA3 2ADDA 3FJCA 4XIKA 4JAAA 5FMCA 1L2HA 1FOD3 1JW6A 1AXZA 2GMMA 4LBJA 4YM0A 1HJGA 3VEQA 3BKZA 3ELNA 4BJ0A 2P3YA 5AC92 4LBOA 4LHSA 4I6IA 4ZU7A 4XJAA 1POQA 5ANQA 1F4AA 1UXZA 1ULDA 2D97A 5DDJ3 4XF3A 1W0PA 5JR7B 1KXGA 4GMP0 3S57A 1SDWA 4NRQA 4SBVA 4F3JA 2HWB2 2VH9A 1IOAA 5FYCA 4EN9B 1W2UA 4LORA 5CU1A 1PWAA 1UU4A 3OTFA 5F3EA 1WLDA 1HB1A 1HQNA 2EXIA 4DUVA 3I3QA 4WVZA 1K12A 2R32A 4XUNA 3N36A 1E5IA 2RG9B 1C1FA 1NAEA 5K9YA 1MS9A 2HWF1 1PNFA 3BODA 3JD71 4IV1C 5FCCA 3WA1A 4CVUA 3T1MA 1SLLA 3H3ZA 4B7KA 2D6NA 4MV2A 4Q4Y1 5L73A 2LS6A 2AC1A 3H50A 1GOHA 3HAGA 2P23A 2EXKA 3POSA 4WM7A 1LOEA 4ZZ5A 3ZPOA 4CEWA 3FMGA 5FY4A 1A8MA 5AVAA 3UGFA 2NLRA 4GH4A 4LULA 2BVBA 4ZU5A 1VALA 3G6JB 1GWMA 4BQWA 4BOWA 1WW6A 2A5ZA 5CFDB 1HDKA 1YQ8A 4A7ZA 3J7MA 3SNMA 4XOGA 3S0MA 5T5JA 1HCEA 5JXJA 3GM8A 2Z49A 3OUJA 5GALA 5JIAA 3Q7YA 1PO21 2CGOA 4KWJA 4Z8SB 1K5MA 1WCDJ 2DVDA 3HNYM 4MO3M 2E33A 3MFAA 4QX0A 5BNOC 4AQ2A 1BFCA 5HXMA 1FYUA 4P0KA 4BIOA 4FFFA 4D8HA 2QVSB 2F4LA 2GH8A 2ZBJA 3AXEA 2EVXA 1OH3A 3IM5A 3W58A 1ENQA 1UD1A 2ZPXA 4PIZA 1AYN2 3BTAA 3HMYA 2NN8A 1Z7S2 3ETPA 3VLBB 5IK8A 1EV13 1NZKA 5I1BA 3D3AA 4N7UA 4CCCA 1CJDA 4COUA 4M3CF 5FLJA 3BPZA 1V9U3 1Z78A 5J7MA 4JQRA 2JIGA 3ALQA 2HBUA 5FZHA 2FFVA 4J2SA 3H7YA 4FI9A 1DQ2A 2J1SA 1RZOB 2WSVA 5C70A 4XZPA 1ULCA 3QBQA 1TMF3 3CRIA 4OWJA 4RSUA 5CKMA 4OWLA 3SCGA 4F34A 4LBLA 1UL9A 3ZMOA 1T4QA 4D0ZA 2YPDA 1JTZX 2VJXA 2Q30A 3KCXA 4P9IA 4YG6A 1OFNA 2ZGOA 1SBDA 2OYZA 3RI8A 1OVSA 5C71A 3BAGA 5FYTA 3S30A 5FPUA 4LR4A 2HLEA 3JQXA 1Q3EA 5CFCC 1BK1A 3POJA 4ZHNA 1UWWA 1VRH1 2DVGA 1RUE3 4YM3A 4W50A 2ZAAA 5F9TA 2BUKA 2D6OX 3F2ZA 3ZX7A 1R1A1 3ZC8A 5I0RA 1UOBA 2HH9A 3GBFA 3HEIA 1US3A 4OCTA 5FXWA 3RQ0A 4MGZE 4XBNA 3UT0A 1IOBA 3AVRA 1BQPA 2RMU1 1NUKA 3AYEA 5FY0A 1ZZ9A 4HL0A 5HXVA 3T1LA 3VBUB 3V0AB 3MV11 4QT6A 5A3MA 3PTRB 5E1RA 4HSLA 3MW3A 1JZ7A 4L0PA 1ND2B 4QWNA 1RVF2 4OI1A 4KBBA 2IWGB 3P6IA 1V6KA 4EWAA 2VCAA 3IBMA 4FAHA 3C7OA 3QD6A 3PUIA 5BPXA 3VKNA 5HCAA 4NN0A 1KDKA 4AVCA 4QXBA 1JT7A 3TN91 2MIBA 2YV8A 2ZA9A 4XMIA 3WW1A 3ZFGB 3U4XA 4YVSA 2IUWA 4PDWB 3WQ7A 1I6XA 2L9LA 4QKRA 4YG0A 1LKNA 5DG1A 2WQZC 3OGRA 4FXKB 3CJIA 2ZKNA 3QCWA 1H8TC 4LO7C 3I2XA 2DUOA 5D61A 2B45X 3RJ2X 1W3VA 4FPGA 3IB3A 5K0UB 3T2PA 2ILMA 1SEFA 1DGRA 2ZHMA 1WMDA 2BFUL 1GV9A 1MS1A 1XJAA 1GZTA 3I7DA 3NQHA 1AL22 1XE8A 4JGZB 4JTOA 4LK6A 4CDUA 1BMV2 4L4HA 2KI4A 3HNBM 5JXGA 2YPJA 3M3CA 4GAIA 4H04A 2KR2A 4NRPA 1AYM1 1PGL1 1QJY1 3FJ8A 5FUPA 1TOOA 4I4PA 4FP2A 1B35C 3I2HA 4AN6A 1XNAA 1NLSA 2YG0A 4JKKA 4AVVA 1XNKA 5C33A 3J9SA 2K2SA 3POFA 1EUUA 2G9ZA 2WNVC 1WLWA 4YVWC 3THCA 3VL9A 4BQXA 1JZ2A 1H9PA 1VB2A 1JHNA 4UAPA 5JOZA 1W6PB 3ZYPA 3I2AA 1HN0A 1VBC1 2P17A 1QOSA 5F32A 3JUUA 3NNLA 4L97A 2WZPP 4MUVA 2ZGKA 2Y38A 4IV3C 3ZXKA 4BISA 3FWEA 1CAWB 5LA1A 1JBCA 2KH2A 2B7YA 3LQCA 4H14A 3GF6A 5LBFA 4FFHA 5A32A 4UW4A 5HI0A 3SEEA 2BDRA 2FMYA 1ZREA 2XUMA 3ACFA 4H3WA 4QX7A 4FBFA 3WF3A 2E6VA 3T0BA 1WWYA 4CUGA 4XJZA 5BNNC 2DFBA 1NCQC 1JT3A 5FY1A 5DABA 3BAUA 4CP9A 2C1FA 2WIIB 2Q8DA 2RJKA 1GYKA 5J1XA 3NSTA 4OYUA 5E88A 1QOOA 4Q4V1 3SKJE 5FMOS 3WEZA 5CB7A 4CCKA 4ZFYB 1GQPA 1UF2C 2BEBA 3DPRB 4IERA 4DXZA 3RNSA 1PVC2 3GNEA 4WVVA 4P14A 1S0FA 3CBNA 1AL0G 4M4RA 3K77A 2VULA 1ZX5A 4JHTA 3MFCA 1OMIA 3PNAA 1JLYA 1B09A 2FDBM 3O0XA 2CAVA 1CX4A 2VL4A 1RUNA 3V65A 3ZXEA 1JY0A 1X8MA 5EJ3A 3J8F3 3SH3A 1YFWA 2ENRA 2DRYA 4NAOA 4EN0A 3RZJA 2RM21 3EMRA 3EXUA 1EAH2 3WF0A 2AEYA 4LO1C 2EALA 2K4AB 5JOYA 3H8OA 1WMXA 2PHUA 4LBNA 4RL7A 5GLWA 2FD8A 4XETA 4QD2C 5JOXA 4DS0A 1ZA4A 2VNVA 2MC2A 1D2SA 4LKDA 2Y0IA 5SV8A 4QU1A 2FCTA 4M3CE 1WA6X 2OZJA 2WBKA 3DEMA 3S8JA 1QJY3 4L11A 1Q8OA 3KS7A 1OOPB 2ID4A 3QOPA 2GO2A 4IEPA 3VBOB 1ZBE2 4MVTA 1NLRA 2A6WA 3N4MA 3WXPA 3O4CA 1WCUA 4H55A 3KMHA 3VZMA 1GZCA 4LO4B 3PUSA 1LRHA 3NNGA 1ASJ1 3V56A 3CNAA 2D3RA 1OFSA 5EQUA 1F9KA 3EB7A 2JG9C 4D3WA 1L3JA 5A3UA 4I4VA 2WYSA 1JU4A 1RJ7A 1UYPA 1ND3C 1SHWB 2FBEA 2VY0A 3NNJA 4Z82A 5E16A 4ZY9A 5EHDA 4MSVA 1ISZA 1AXYA 1DQGA 2VECA 4OUEA 4L9BA 3VZLA 3H42B 4D69A 5B2GB 4OHYA 2FDKA 4FTBA 5JSOA 5FZ1A 4BHPA 1EP0A 3ZYRA 3SC7X 5GAQA 4RR3C 1QHDA 4BQYA 4JV4A 1AR93 4LE3A 4KBZA 1FATA 2RS12 3HR9A 5JXHA 2G9FA 5KXDA 2R041 3OGFA 3K46A 4YGCA 4Y4YA 3VBSB 3FJKA 1BBT3 3N3HA 4M3CB 2BYVE 4FFIA 1EPWA 3S5AA 3JB4C 4R4XA 5A3TA 1PUMB 1S2BA 2R062 3PVOA 1ENSA 3UGHA 4KG0A 1V70A 2WNEA 4AI2A 4CCDA 5AFBA 1KNMA 1XBFA 1KRIA 3IAGC 1MZ5A 1LODA 5LB6A 1LOFC 4JDMA 4CU6A 4EFQA 4GB31 2BNMA 1ZA7A 4RS5C 3CHXA 1QQP1 4P0JA 2ATFA 1Q04A 4Z07A 3SH5A 4LO2A 2VU9A 3OJVA 4OHZA 4LITA 3ZFEC 3SEPA 3I29B 1UOGA 2VZ3A 4P02B 3LTQA 1XSQA 1H8TA 2ZEZA 4LO7A 4MZGB 2ZGLA 2HWB3 3A21A 4DY5A 4QX5A 5F7UA 3OGJA 4YW3A 4LO8A 5CISA 5FP7A 1UZZA 3VZJA 1N3OA 2RS31 3I59A 4XDPA 3VGIA 4AFBA 2KM2A 2BPA2 5IT6A 4E8CA 1J3QA 3PMEA 1V6XA 2R0FA 5JIUA 2MLLB 2W46A 4AI8A 4AE2A 2PQSA 3H0OA 3W5NA 2C9KA 2VUDA 4GIQA 5C4WB 1B35A 1CPMA 3KF5A 3ACGA 2Y26A 5DZFA 5LA9A 1AVBA 3U10A 3ZKUA 3ZO0B 2VM9A 2WFF1 3IPVA 2XBO2 3Q8FA 4N43A 4XAAA 2IVIB 2WNVA 4YVWA 4DXSA 4CTEA 1NCRB 4DQAA 1WW7A 5FTTC 4Q4X2 3WHUA 1KEXA 2OW4A 4ORFA 4LLFA 4WM7B 3KZ4C 3OPZA 3KV4A 2ZZQA 2ZGNA 3LOIA 4CEWB 4USPA 4B4PA 4IV3A 3DV8A 4GH4B 2D6LX 2V5DA 4LJHA 5FY8A 4C0HA 1NYWA 1PIV2 3WF1A 2CSGA 3IMNA 3RWNA 5CEHA 2QJVA 3IT8A 3AXDA 3I2KA 5G00A 1ENXA 1JUIA 4PLOA 1JYWA 1GQHA 4X6RB 2VMFA 1JU3A 5BNNA 4YG3A 1MQTA 1NCQA 4ATFA 5IVCA 5FZ9A 1VCLA 1K5MB 2VW2A 1JS9A 3K4AA 3CA5A 1AYN3 4B7EA 4EWEA 4Y22A 4MXWB 4XFSA 3OD0A 5FNXA 3HVDA 4WM8C 3IDAA 4PQ9A 3BADA 4FPOB 2W1SA 2C0ZA 2Y6LA 3NVCA 1JZ4A 1RMU1 3O0WA 1COV2 3FGMA 1CN1A 1YBIA 1SQ4A 1W2TA 3I8TA 4QPWA 4KGGA 2DCTA 4Q0SA 3OJ2A 1SLIA 4IEWA 2R30A 2W47A 5K4LA 3SQOA 1XNDA 3MI8A 3ON7A 2HZ9A 2AQZA 2ESUA 1UX7A 2DV9A 1JUHA 2D40A 1F8VA 2IXCA 1OPOA 3M3EA 3VHNA 5I91A 1ZNPA 1AR62 2KKIA 4HXCA 4Y1UA 1C8M2 2VR4A 4BH9A 4L4IA 4LO1A 3ZXAC 3AYAA 3ZXJA 2PMWB 3POBA 5FO9B 4XJWA 3WP4A 1LU1A 5BY5A 1Y9GA 4BM8A 1RUH2 2Z5WA 4C8DA 1OXCA 4HPKA 3H8XA 5FPAA 1RHI1 1W90A 1T2XA 4RGKA 4YW1A 2FQPA 3LSEA 1NXD1 1U5YA 5C8CC 4TYSA 4FSJA 2QQNA 1VBD2 4QPIC 2HWD2 5GKAC 5KBFA 4GJZA 4D6QA 4DPNA 1RIRA 1RVF3 4D94A 5BNPC 5A6QA 3G7DA 4NO4A 2GN3A 1QJX2 4KNCA 3WDXA 2BV4A 1HCDA 1N1YA 4RFRB 4I09A 1H9WA 1QJFA 2JKBA 2BNNA 2JG9A 2C4XA 4Q4W1 1ND3A 3LA2A 3MHZA 4RA0A 2CGPA 2W52A 2PHDA 5JSRA 1SFPA 3BTZA 2ERMA 1OVPA 4GD4A 5GZCA 1OLMA 4A44A 3GZUC 4URTA 1VBA2 3UV9A 2K43A 1DHKB 2C9AA 3EF2A 3Q7WA 4RHV2 1HB2A 3LPGA 1OH4A 2YUEA 2Q1FA 4RR3A 4YVSB 1Q03A 4XC9A 4P9YA 4CDQA 1ULPA 5C9AC 1NA1C 4XBLA 5H9RA 3CJIB 5T5PA 4GQ7A 4BLIA 3VSZA 4IQPA 1CAUA 3C3VA 4XDOA 1G9CA 1ONAA 2VOWA 4CUBA 1AL23 4LTAA 2IFRA 3MF9A 2CDPA 9ILBA 3SHRA 3WT3A 1DQ0A 1JYTA 2WSUA 4XUOA 3ZN6B 4QPGB 2CL2A 4O9GA 4NIAA 4CDUB 1IPKA 1NT0A 3AKPA 5JPMB 5FZEA 3WW4A 3UK9A 4LO6B 2I1BA 1LOFA 1W9TA 1PZ9A 3AZZA 1MPXA 2ZGPA 4FQ4A 3LDKA 3PVEA 4IHZA 5BYNA 5IYYA 1AR81 3I97A 4QPYA 4RS5A 4X37A 4W8JA 2A7AA 3LWCA 3NJZA 5F8WA 2NMNA 4G9SB 1LHOA 4XABA 4BZ4A 1V0AA 1OURA 1YQ6A 2JB4A 3O14A 1JQZA 4AAPA 1LTEA 1QNYA 3S6PA 3ZFEA 5FPVA 1GUIA 1POV1 2MPFA 4DOUA 4EWDA 1WKYA 3ZSMA 1Z0HA 1LOBA 2R49A 2V09A 5T54A 4AHWA 4E2SA 2RVAA 2VQUA 3SISA 4Y5Z0 2Z79A 4RN5A 5CKNA 3HQXA 2P5BA 2HYKA 1AVXB 4YOLA 4MGIE 1V6UA 5A32B 4Z8BA 4JAWA 1MACA 4LBQB 1H0BA 2HWC2 3H7JA 4XF9A 1XZZA 1RINA 4MX3A 1M06G 2YGMA 4FOWA 3JD72 4RQPB 1H30A 4YGBA 5FZ6A 2BGCA 3S8KA 3WUCA 4XF0A 2EXHA 5B4XA 5FMDA 1NZCA 2YXSA 3BVCA 3B9IA 2XHNA 4YM2A 5IVYA 4Q0PA 4I3PA 4AG4A 1Z4SA 3W9AA 1AR72 1OUSA 4A7KA 5GZGA 1ULGA 2A73B 4XJUA 4HVQA 2ZGRA 1JXNA 4XFBA 2YFZA 4K20A 4UF0B 2JDPA 2CWSA 2O14A 4YNIA 1G9AA 4P0LA 2D5HA 1BFGA 3AKTA 5F3GA 1GZ9A 5A3NA 3FLTA 1RITA 1PGW1 2WZR2 2KLLA 1TTUA 4Y4RA 4AOCA 2WO1A 1W3XA 1EAH3 4CU7A 4UOJA 4N7IA 1ISXA 3NV2A 3O1SA 2PFWA 4LIVA 2UY8A 1ZBA1 1FWUA 2ZHKA 1JZ8A 2R7EB 1WCSA 4YGDA 5A6YA 2Y64A 1J1LA 3HBZA 3ZOIA 4I2OA 3FJIA 2WRAA 3AP4A 1IZ3A 5EYXA 2ET7A
chains in the Genus database with same CATH topology
3THPA 3WMUA 3ATGA 2V73A 4CDWC 3A22A 1BJQA 4WM8A 3CJXA 2XJVA 1VP6A 1ZBE3 5BXXA 3D7WB 3EBRA 3CRGA 1JOJA 1LECA 4XF1A 1LHUA 1W6NB 1O3QA 4ISQA 4N9HA 3CA6A 3IDBB 4Q0VA 4J23B 2XLFA 1J59A 2GMPA 2NVHA 4PC4A 3O7OA 5FMOL 1W6QA 4IEUA 4HJJA 3NJ5A 2GZWA 4XBQA 2DUQA 3ZFFB 1PNGA 4ZGRB 2XH6A 4J2KA 1DGWA 2ZGTA 6I1BA 2Z48A 3JBG2 3MW4A 1C1LA 1S0DA 4ONUA 5CVRA 4C91A 4TSVA 4AVTA 5FBZA 2TEPA 4AVBA 3V0BA 1O91A 4UXAA 4QALA 2RS13 2GNMA 1TME1 1SMVA 4QPIA 2RMU2 3KGLA 3B69A 1VAKA 5ACA1 3O5WB 1CVNA 1N47A 1HRV3 4FPJA 4AEDC 1FOD1 3EJKA 2Z2SB 2GC2A 5JZGC 1YIFA 1QF3A 4Y1ZA 3WW3A 4OI2A 4Y1VA 3ZIWA 1OD5A 2X5IC 1GSLA 2ET1A 4LE4A 4XFCA 1HKDA 4S2GA 3ZC9A 3OCPA 1N3PA 4K3UA 4R52A 2E4MC 5GZEA 1DQ4A 4JP0A 5DDJ1 1ZM1A 2RS52 3NO8A 2YC0