1DJ9A

Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto-8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). the enzyme of biotin biosynthetic pathway.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
383
structure length
383
Chain Sequence
SWQEKINAALDARGAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTGIRPPTVPAGIARLRLTLTAAHEMQDIDRLLEVLHGNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of 8-amino-7-oxononanoate synthase: spectroscopic, kinetic, and crystallographic studies.
pubmed doi rcsb
molecule tags Transferase
molecule keywords 8-AMINO-7-OXONONANOATE SYNTHASE
total genus 140
structure length 383
sequence length 383
ec nomenclature ec 2.3.1.47: 8-amino-7-oxononanoate synthase.
pdb deposition date 1999-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1dj9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1dj9A01
2QLRA 1ASEA 3WZFA 1W7MA 3RI6A 4TN4A 1IX7A 1OHVA 1G4XA 4LNLA 1ASCA 1UKJA 3A2BA 1IJIA 1RVYA 1LW4A 2O0RA 1FC4A 2D61A 3AEJC 1AAWA 3EZSA 3FFHA 3WKSA 3ACZA 1N2TA 3KKIA 3FVSA 1C9CA 3NNKA 4DQ6A 2AY9A 2VGWA 1AY8A 4ADEA 3HQTA 3JWAA 2DR1A 1GCKA 3WLXA 3H7FA 7AATA 1O62A 1YNUA 4ZAHA 1DGDA 4GEBA 4K2MA 3ELEA 3NYUA 2AEUA 2ZSMA 2AY8A 3QHXA 3ISLA 2HUFA 4KAMA 3DR4A 1BQAA 3ZRQA 3D6KA 4KYOA 1GC2A 3DU4A 4MQRA 2X3LA 1IAYA 1QJ3A 3FFRA 4XEWA 4ATQA 2VMXA 2CANA 1UU2A 4WBTA 4ITGA 3CQ6A 3LWSA 4WLHA 2BI3A 2EH6A 4WYFA 3CBFA 4JEZA 1E5EA 1KMJA 2VMVA 4CXRA 4JEYA 4AZKA 3A8UX 4ZM3A 4MKKA 1AMRA 2VMTA 3DXWA 3B46A 1GC3A 1IBJA 2DKJA 4W1WA 1MAQA 4CXQA 3ECDA 3HBXA 3AEMC 2VIBA 4Q76A 2GMSA 2FNUA 2R5EA 4Q6RA 4XJMA 1KL1A 3II0A 2W7IA 3BWNA 3WY7A 3FDBA 1QIRA 1AMQA 1GDEA 3DYDA 3FD0A 3GETA 2Z1ZA 1MGVA 5FT8A 1IUGA 4MSOA 4A6UA 2VI9A 2V0YA 2VMQA 2DGLA 4W8IA 1J32A 3AEPA 3OKSA 3AEJA 3EUCA 4BQ0A 3KGXA 1TOJA 4K2BA 4MY5A 2AY2A 4F5LA 5IWQA 2ZY3A 4N0BA 4GE4A 2CJDA 4K2IA 2W8JA 1AIAA 3OP7A 4KXKA 5HHYA 5J8QA 4WXGA 4FFCA 1RVUA 2W7DA 5HDMA 4GRXA 3PDBB 2EGYA 1DTYA 2PO3A 3VK2A 4O6ZA 1LW5A 3FKDA 3FDDA 2GMUA 2NMPA 4JF0A 3GZCA 3LVMA 4AO4A 2JJGA 3ZZJA 3DC1A 1MDZA 4Y0IA 4WB0A 4RJ0A 4W5KA 1CZCA 4ATPA 1O69A 3NUIA 1AIBA 4JEXA 2X5FA 3JWBA 4GE7A 1RV3A 3BS8A 2YOBA 3DZZA 1KKPA 4A72A 1AHYA 4BHDA 2E7IA 3HVYA 2ZJGA 2VLHA 3BC8A 4XK1A 4RKCA 2CH2A 3B1DA 1G7WA 1AY5A 3EIAA 3N0LA 3MC6C 3FQAA 1V2EA 3RBFA 1W3UA 3NYTA 3BN1A 4UHMA 3T32A 4LNMA 2VMYA 3PPLA 1BJWA 1W7NA 4EMYA 4ADDA 3E9KA 1T3IA 3A9YA 5EAAA 3LV2A 1C4KA 3PDXA 2C7TA 3MKJA 1AKCA 2HUIA 4RLGA 3AENA 3LVLB 4W1XA 2C0RA 3RCHA 2ZUKA 2ZSLA 4IYOA 4R5FA 1M0PA 1C7GA 5M49A 3DR7A 1V72A 2GSAA 2ZYJA 3ZRPA 3F0HA 3WCNA 2PB0A 3F6TA 3G0TA 4A0FA 1ELUA 2D5YA 4U1TA 4GE9A 3WGCA 4PFNA 2CFBA 2FQ6A 1E5FA 5DX5A 1M0NA 4H51A 2O1BA 2VGUA 2OKJA 3FZ6A 1FG7A 4R5ZA 1ECXA 3FZ7A 4F5MA 4ZASA 1AJSA 2CINA 3MADA 1EJIA 1VJOA 2BI1A 2O7CA 4UHNA 2CJHA 3K7YA 4JEVA 2ORDA 2V1PA 3ZZKA 4Y0DA 4UOYA 3NRAA 2Z67A 2WK8A 5G2PA 1AKAA 2HOXA 4ZWMA 1AJSB 2ZP7A 3PD6A 1FG3A 3VK4A 1CQ8A 3FCRA 1QITA 1JS3A 2Z9XA 1YJSA 1TASA 1U08A 3QI6A 2YCNA 1OATA 3COGA 1CJ0A 2Z9VA 1YIZA 1TOIA 4F5IA 3HDOA 4GSAA 3NU8A 2BWOA 1B4XA 5EUDA 5G0AA 1SVVA 4RAEA 1N8PA 4F5FA 3R9AA 2AY5A 3F9TA 1WYVA 3RBLA 3EI9A 2QB2A 1IVRA 1ASFA 4CBSA 1V2FA 4U2HA 4HF8A 1MDXA 4ISYA 3WKRA 1KMKA 4E1OA 2BWPA 1GEYA 2E7UA 3E77A 1PMOA 1ASMA 2C44A 3HLMA 1JG8A 3QGUA 4PIWA 3K28A 2FYFA 4MGRA 3P1TA 1OXOA 3ASBA 1O4SA 8AATA 1TARA 1LC5A 4FL0A 2D63A 2YKYA 1ARSA 1BQDA 1MAPA 1RV4A 4J8LA 4I8AA 1ORDA 2Z20A 3ATHA 4LW4A 3K40A 4LNJA 1DJUA 1LC7A 1OXPA 4A0GA 1ELQA 1B9HA 1WKGA 3AENB 4XJLA 2AY7A 5HXXA 4ADCA 1XI9A 3EZ1A 3FQ7A 2W8VA 3MAFB 3NTJA 3MBBA 4WB0B 3G7QA 1ASBA 1DGEA 4OYTA 1GEXA 3E2ZB 1X29A 2BYLA 1D7UA 3AELA 3GBXA 2Z9WA 4XAUA 3W1JA 3PDBA 3AOVA 4ZSWA 3JU7A 3ASAA 4M2MA 3UAKA 1V2DA 2HZPA 2R0TA 1LKCA 1CQ6A 3FVXA 1BJOA 3LG0A 4MQPA 4OTLA 1C7NA 1YIYA 2W7KA 2EO5A 4ZWVA 3E2YA 2QA3A 3FZ8A 1ARHA 3FSLA 2YCPA 1WYTB 1MDOA 2YRRA 4BA5A 3BCAA 3CQ4A 2JJHA 3EI7A 3RQ1A 2AY6A 2R2NA 5EIGA 1KKJA 3QN6A 2YKXA 1MLZA 5M4BA 3GSBA 1SF2A 1J04A 3VAXA 1G7XA 1S08A 4P7YA 1ARTA 5F9SA 4GDYA 2CH1A 2JG2A 2VIAA 5FT5A 5K8BA 3PAAA 1AHXA 4F5JA 3FTBA 4RIZA 2AY3A 5EUNA 1CZEA 4W1VA 5EAVA 4JE5D 3A9XA 1AMSA 1TOEA 1LK9A 2HOYA 3AOWA 1IX8A 2W7JA 4WYCA 1X0MA 3N5MA 2BYJA 2DKBA 1BJ4A 2Z1YA 3QBOA 2OGEA 1G4VA 1TPLA 1DJEA 4ADBA 4BA4A 1SPAA 4Q75A 2YKVA 1TATA 2BIGA 1BJNA 2E7JA 4F5HA 1VP4A 2W8UA 4MKJA 1D7SA 2JJFA 2BIAA 1IAXA 3UWCA 4A6RA 2WK9A 1S09A 1DJ9A 3EI6A 4M2KA 5FT4A 3NYSA 1S06A 4OBVA 1GD9A 4J5UA 4RM1A 3W1IA 4A0RA 3R4TA 3WGBA 3WCOA 5D95A 5E3KA 5FT6A 4B9BA 2C81A 2EZ1A 3JW9A 3AEOA 1AKBA 3B8XA 1MLYA 4L0OA 4OT8A 1TOKA 5DB5A 3G8MA 1AHFA 1I29A 1JF9A 3MEBA 3NX3A 1TOGA 3CQ5A 2CJGA 9AATA 2AEVA 2AY4A 5LHAA 1M0QA 2W7GA 3VK3A 4WP0A 2AY1A 1VEFA 1YJZA 4EB7A 2HORA 4RKDA 3UE8A 1S0AA 5BJ4A 3MAUA 4OBUA 5M46A 3EIBA 4XQ2A 1YAAA 3LVJA 3QPGA 1OHWA 1AJRA 4N0WA 4TV7A 2HOZA 1DKAA 2BKWA 4R8DA 1XEYA 2D65A 1IX6A 1D7RA 3PJ0A 1C7OA 3USFA 4A6TA 4QGRA 4CVQA 4F5GA 5C6UA 4UQVA 1B9IA 1WYTA 1S07A 1M6SA 2Q7WA 3LVKA 1EG5A 2D66A 3DODA 3EI5A 1ASLA 4XJOA 3TQXA 2BI2A 2JISA 1GEWA 3TATA 2VMRA 2YHKA 3RUYA 1BJOB 2BI9A 1AICA 4PFFA 5AX8A 4EFFA 3MC6A 1M4NA 3CAIA 1YJYA 2VI8A 4WYEA 4ZSYA 5G2QA 5TF5A 2HUUA 3TFUA 2VGTA 3Q8NA 2BI5A 1ASGA 1I48A 5EIGB 4IY7A 1D2FA 2YRIA 1AMAA 3E2ZA 2VLFA 5M4DA 3JZLA 3BCXA 2CB1A 3MAFA 1KL2A 3M5UA 2TPLA 3HL2A 1Z3ZA 2VGVA 1W23A 1WYUB 1CS1A 3FQ8A 3KGWA 4IXSA 5D5SA 2ZC0A 1UU1A 1AAMA 1LS3A 2WK7A 2XH1A 3FRKA 4JEWA 1ZODA 4OMAA 2PB2A 4W91A 4DBCA 1SZKA 1BKGA 4RJYA 1CL1A 1AHGA 3QM2A 4F4EA 2ZY5A 2R5CB 2FN6A 2VMUA 1B5PA 4Q31A 2GB3A 2WKAA 1BS0A 2VMWA 3NUBA 1AHEA 3I4JA 4ZDPA 1SZUA 1ARIA 4UHOA 2QBTA 4LC3A 1YOOA 1PG8A 2VGZA 2OATA 3BWNC 1QZ9A 2HP2A 2W8WA 1BW0A 2AATA 2W7LA 4IX8A 5EQCA 2BHXA 2XBNA 1M32A 4WYDA 4AOAA 1OHYA 1EQBA 2RFVA 4E3RA 1UU0A 2CY8A 2W7FA 4WYAA 1H0CA 4NOGA 1I41A 3PIUA 1W7LA 4E77A 3GJUA 3FVUA 3N75A 5DJ1A 5EFSA 5JAYA 4WLJA 1QJ5A 3E2FA 3VP6A 2JJEA 1M7YA 3ELPA 3A9ZA 4CBRA 3BB8A 1WYVB 3P6KA 3GZDC 2VMSA 1O61A 3IHJA 3HT4A 3I16A 2X5DA 1AX4A 2F8JA 1ASAA 1B8GA 4P3MA 2G6WA 2OKKA 2EZ2A 2VYCA 3NDNA 5E4ZA 3B1EA 5G4IA 3AV7A 5LH9A 1I43A 1QISA 2W7EA 2EPJA 1GBNA 3GWPA 4R2NA 4E3QA 4HVKA 3JTXA 4XJPA 5G09A 4DGTA 1ZC9A 2QB3A 2YKUA 2GQNA 3E6GA 1SFFA 4AZJA 2CSTA 4WD2A 5DJ9A 3VOMA 3BCBA 3PD6B 1M0OA 3NU7A 4B98A 2VMZA 2BIEA 2ZY4A 1LC8A 1X28A 1ZOBA 4EU1A 2DGKA 2VGSA 2W8TA 3ZRRA 2YCTA 2ZY2A 4IYOB 1BT4A 2VMOA 1ARGA 4BMKA 2BWNA 1X2AA 1P3WA 5E5IA 4AH3A 4MQQA 1Y4IA 4ZDOA 1D7VA 1PMMA 1PFFA 2JGTA 2X8UA 3L8AA 4PVFA 1QGNA 4A00A 2D64A 1GC0A 5BJ3A 4RITA 3L44A 4EB5A 2VMNA 2D7ZA 4IXOA 2FM1A 2Z9UA 3B1CA 4LW2A 2D7YA 2FNIA 3GR9A 3HMUA 1AY4A 2HP1A 4IXZA 1B5OA 1Z7DA 3H14A 4ZM4A 2QMAA 1ASDA 3RCHB 1WSTA 3EI8A 3I5TA 4ITXA 4WXFA 4JE5A 3TFTA 2R5CA 5EUEA 4ZDLA 1DFOA 2E54A 5G4JA 4OCAA 4JF1A 1GC4A 2W7HA 3DXVA 1WKHA 3BV0A 3BWOA 1SZSA 3IF2A 3KE3A 3WX9A 4WYGA 4A0HA 3AATA 3DRDA 1N31A 3PGYA 2VMPA 1CQ7A 5F8VA 4WXBA 3TCMA 1CL2A 2OGAA 2OQXA 2CTZA 2DOUA 1WYUA 3AEMA 4M2JA 5I92A 1H1CA 3LY1A 2DGMA 1C0NA 4F5KA 3GZDA 1ASNA 4TMRA 2Z61A 4IW7A 3W1HA 4OC9A 4Y0HA 4AO9A 2W7MA 4ZLVA 3PA9A 1JS6A
chains in the Genus database with same CATH superfamily
2QLRA 1ASEA 3WZFA 1W7MA 3RI6A 4TN4A 1IX7A 1OHVA 1G4XA 4LNLA 1ASCA 1UKJA 3A2BA 1IJIA 1RVYA 1LW4A 2O0RA 1FC4A 2D61A 3AEJC 1AAWA 3EZSA 3FFHA 3WKSA 3ACZA 1N2TA 3KKIA 3FVSA 1C9CA 3NNKA 4DQ6A 2AY9A 2VGWA 1AY8A 4ADEA 3HQTA 3JWAA 2DR1A 1GCKA 3WLXA 3H7FA 7AATA 1O62A 1YNUA 4ZAHA 1DGDA 4GEBA 4K2MA 3ELEA 3NYUA 2AEUA 2ZSMA 2AY8A 3QHXA 3ISLA 2HUFA 4KAMA 3DR4A 1BQAA 3ZRQA 3D6KA 4KYOA 1GC2A 3DU4A 4MQRA 2X3LA 1IAYA 1QJ3A 3FFRA 4XEWA 4ATQA 2VMXA 2CANA 1UU2A 4WBTA 4ITGA 3CQ6A 3LWSA 4WLHA 2BI3A 2EH6A 4WYFA 3CBFA 4JEZA 1E5EA 1KMJA 2VMVA 4CXRA 4JEYA 4AZKA 3A8UX 4ZM3A 4MKKA 1AMRA 2VMTA 3DXWA 3B46A 1GC3A 1IBJA 2DKJA 4W1WA 1MAQA 4CXQA 3ECDA 3HBXA 3AEMC 2VIBA 4Q76A 2GMSA 2FNUA 2R5EA 4Q6RA 4XJMA 1KL1A 3II0A 2W7IA 3BWNA 3WY7A 3FDBA 1QIRA 1AMQA 1GDEA 3DYDA 3FD0A 3GETA 2Z1ZA 1MGVA 5FT8A 3N4RA 1IUGA 4MSOA 4A6UA 2VI9A 2V0YA 2VMQA 2DGLA 4W8IA 1J32A 3AEPA 3OKSA 3AEJA 3EUCA 4BQ0A 3KGXA 1TOJA 4K2BA 4MY5A 2AY2A 4F5LA 5IWQA 2ZY3A 4N0BA 4GE4A 2CJDA 4K2IA 2W8JA 1AIAA 3OP7A 4KXKA 5HHYA 5J8QA 4WXGA 4FFCA 1RVUA 2W7DA 5HDMA 4GRXA 3PDBB 2EGYA 1DTYA 2PO3A 3VK2A 4O6ZA 1LW5A 3FKDA 3FDDA 2GMUA 2NMPA 4JF0A 3GZCA 3LVMA 4AO4A 2JJGA 3ZZJA 3DC1A 1MDZA 4Y0IA 4WB0A 4RJ0A 4W5KA 1CZCA 4ATPA 1O69A 3NUIA 1AIBA 4JEXA 2X5FA 3JWBA 4GE7A 1RV3A 3BS8A 2YOBA 3DZZA 1KKPA 4A72A 1AHYA 4BHDA 2E7IA 3HVYA 2ZJGA 2VLHA 3BC8A 4XK1A 4RKCA 2CH2A 3B1DA 1G7WA 1AY5A 3EIAA 3N0LA 3MC6C 3FQAA 1V2EA 3RBFA 1W3UA 3NYTA 3BN1A 4UHMA 3T32A 4LNMA 2WB6A 2VMYA 3PPLA 1BJWA 1W7NA 4EMYA 4ADDA 3E9KA 1T3IA 3A9YA 5EAAA 3LV2A 1C4KA 1KAFA 3PDXA 2C7TA 3MKJA 1AKCA 2HUIA 4RLGA 3AENA 3LVLB 4W1XA 2C0RA 3RCHA 2ZUKA 2ZSLA 4IYOA 4R5FA 1M0PA 1C7GA 5M49A 3DR7A 1V72A 2GSAA 2ZYJA 3ZRPA 3F0HA 3WCNA 2PB0A 3F6TA 3G0TA 4A0FA 1ELUA 2D5YA 4U1TA 4GE9A 3WGCA 4PFNA 2CFBA 2FQ6A 1E5FA 5DX5A 1M0NA 4H51A 2O1BA 2VGUA 2OKJA 3FZ6A 1FG7A 2EYQA 4R5ZA 1ECXA 3FZ7A 4F5MA 4ZASA 1AJSA 2CINA 3MADA 1EJIA 1VJOA 2BI1A 2O7CA 4UHNA 2CJHA 3K7YA 4JEVA 2ORDA 2V1PA 3ZZKA 4Y0DA 4UOYA 3NRAA 2Z67A 2WK8A 5G2PA 1AKAA 2HOXA 4ZWMA 1AJSB 2ZP7A 3PD6A 1FG3A 3VK4A 1CQ8A 3FCRA 1QITA 1JS3A 2Z9XA 1YJSA 1TASA 1U08A 3QI6A 2YCNA 1OATA 3COGA 1CJ0A 2Z9VA 1YIZA 1TOIA 4F5IA 3HDOA 3N4SA 4GSAA 3NU8A 2BWOA 1B4XA 5EUDA 5G0AA 1SVVA 4RAEA 1N8PA 4F5FA 3R9AA 2AY5A 3F9TA 1WYVA 3RBLA 3EI9A 2QB2A 1IVRA 1ASFA 4CBSA 1V2FA 4U2HA 4HF8A 1MDXA 4ISYA 3WKRA 1KMKA 4E1OA 2BWPA 1GEYA 2E7UA 3E77A 1PMOA 1ASMA 2C44A 3HLMA 1JG8A 3QGUA 4PIWA 3K28A 2FYFA 4MGRA 3P1TA 1OXOA 3ASBA 1O4SA 8AATA 1TARA 1LC5A 4FL0A 2D63A 2YKYA 1ARSA 1BQDA 1MAPA 1RV4A 4J8LA 4I8AA 1ORDA 2Z20A 3ATHA 4LW4A 3K40A 4LNJA 1DJUA 1LC7A 1OXPA 4A0GA 1ELQA 1B9HA 1WKGA 3AENB 4XJLA 2AY7A 5HXXA 4ADCA 1XI9A 3EZ1A 3FQ7A 2W8VA 3MAFB 3NTJA 3MBBA 4WB0B 3G7QA 1ASBA 1DGEA 4OYTA 1GEXA 3E2ZB 1X29A 2BYLA 1D7UA 3AELA 3GBXA 2Z9WA 4XAUA 3W1JA 3PDBA 3AOVA 4ZSWA 3JU7A 3ASAA 4M2MA 3UAKA 1V2DA 2HZPA 2R0TA 1LKCA 1CQ6A 3FVXA 1BJOA 3LG0A 4MQPA 4OTLA 1C7NA 1YIYA 2W7KA 2EO5A 4ZWVA 3E2YA 2QA3A 3FZ8A 1ARHA 3FSLA 2QSRA 2YCPA 1WYTB 1MDOA 2YRRA 4BA5A 3BCAA 3CQ4A 2JJHA 3EI7A 3RQ1A 2AY6A 2R2NA 5EIGA 1KKJA 3QN6A 2YKXA 1MLZA 5M4BA 3GSBA 1SF2A 1J04A 3VAXA 1G7XA 1S08A 4P7YA 1ARTA 2FKIA 5F9SA 4GDYA 2CH1A 2JG2A 2VIAA 5FT5A 5K8BA 3PAAA 1AHXA 3N7NA 4F5JA 3FTBA 4RIZA 2AY3A 5EUNA 1CZEA 4W1VA 5EAVA 4JE5D 3A9XA 1AMSA 1TOEA 1LK9A 2HOYA 3AOWA 1IX8A 2W7JA 4WYCA 1X0MA 3N5MA 2BYJA 2DKBA 1BJ4A 2Z1YA 3QBOA 2OGEA 1G4VA 1TPLA 1DJEA 4ADBA 4BA4A 1SPAA 4Q75A 2YKVA 1TATA 2BIGA 1BJNA 2E7JA 4F5HA 1VP4A 2W8UA 4MKJA 3H9XA 1D7SA 2JJFA 2BIAA 1IAXA 3UWCA 4A6RA 2WK9A 1S09A 1DJ9A 3EI6A 4M2KA 5FT4A 3NYSA 1S06A 4OBVA 1GD9A 4J5UA 4RM1A 3W1IA 4A0RA 3R4TA 3WGBA 3WCOA 5D95A 5E3KA 5FT6A 4B9BA 2C81A 2EZ1A 4H63Q 3JW9A 3AEOA 1AKBA 3B8XA 1MLYA 4L0OA 4OT8A 1TOKA 5DB5A 3G8MA 1AHFA 1I29A 1JF9A 3MEBA 3NX3A 1TOGA 3CQ5A 2CJGA 9AATA 2AEVA 2AY4A 5LHAA 1M0QA 2W7GA 3VK3A 4WP0A 2AY1A 1VEFA 1YJZA 4EB7A 2HORA 4RKDA 3UE8A 1S0AA 5BJ4A 3MAUA 4OBUA 5M46A 3EIBA 4XQ2A 1YAAA 3LVJA 3QPGA 2G7JA 1OHWA 1AJRA 4N0WA 4TV7A 2HOZA 1DKAA 2BKWA 4R8DA 1XEYA 2D65A 1IX6A 1D7RA 3PJ0A 1C7OA 3USFA 4A6TA 4QGRA 4CVQA 4F5GA 5C6UA 4UQVA 2A1VA 1B9IA 1WYTA 1S07A 1M6SA 2Q7WA 3LVKA 1EG5A 2D66A 3DODA 3EI5A 1ASLA 4XJOA 3TQXA 2BI2A 2JISA 3N4XA 1GEWA 3TATA 2VMRA 2YHKA 3RUYA 1BJOB 2BI9A 1AICA 4PFFA 5AX8A 4EFFA 3MC6A 1M4NA 3CAIA 1YJYA 2VI8A 4WYEA 4ZSYA 5G2QA 5TF5A 2HUUA 3TFUA 2VGTA 3Q8NA 2BI5A 1ASGA 1I48A 5EIGB 4IY7A 1D2FA 2YRIA 1AMAA 3E2ZA 2VLFA 5M4DA 3JZLA 3BCXA 2CB1A 3MAFA 1KL2A 3M5UA 2TPLA 3HL2A 1Z3ZA 2VGVA 1W23A 1WYUB 1CS1A 3FQ8A 3KGWA 4IXSA 5D5SA 2ZC0A 1UU1A 1AAMA 1LS3A 2WK7A 2XH1A 3FRKA 4JEWA 1ZODA 4OMAA 2PB2A 4W91A 4DBCA 1SZKA 1BKGA 4RJYA 1CL1A 2KFPA 1AHGA 3QM2A 4F4EA 2ZY5A 2R5CB 2FN6A 2VMUA 1B5PA 4Q31A 2GB3A 2WKAA 1BS0A 2VMWA 3NUBA 1AHEA 3I4JA 4ZDPA 1SZUA 1ARIA 4UHOA 2QBTA 4LC3A 1YOOA 1PG8A 2VGZA 2OATA 3BWNC 1QZ9A 2HP2A 2W8WA 1BW0A 2AATA 2W7LA 4IX8A 5EQCA 2BHXA 2XBNA 1M32A 4WYDA 4AOAA 1OHYA 1EQBA 2RFVA 4E3RA 1UU0A 2CY8A 2W7FA 4WYAA 1H0CA 4NOGA 1I41A 3PIUA 1W7LA 4E77A 3GJUA 3FVUA 3N75A 5DJ1A 5EFSA 5JAYA 4WLJA 1QJ5A 3E2FA 3VP6A 2JJEA 1M7YA 3ELPA 3A9ZA 4CBRA 3BB8A 1WYVB 3P6KA 3GZDC 2VMSA 1O61A 3IHJA 3HT4A 3I16A 2X5DA 1AX4A 2F8JA 1ASAA 1B8GA 4P3MA 2G6WA 2OKKA 2EZ2A 2VYCA 3NDNA 5E4ZA 3B1EA 5G4IA 3AV7A 5LH9A 1I43A 1QISA 2W7EA 2EPJA 1GBNA 3GWPA 4R2NA 4E3QA 4HVKA 3JTXA 4XJPA 5G09A 4DGTA 1ZC9A 2QB3A 2YKUA 2GQNA 3E6GA 1SFFA 4AZJA 2CSTA 4WD2A 5DJ9A 3VOMA 3BCBA 3PD6B 1M0OA 3NU7A 4B98A 2VMZA 2BIEA 2ZY4A 1LC8A 1X28A 1ZOBA 4EU1A 2DGKA 2VGSA 2W8TA 3ZRRA 2YCTA 2ZY2A 4IYOB 1BT4A 2VMOA 1ARGA 4BMKA 2BWNA 1X2AA 1P3WA 5KTBA 5E5IA 4AH3A 4MQQA 1Y4IA 4ZDOA 1D7VA 1PMMA 1PFFA 2JGTA 2X8UA 3L8AA 4PVFA 1QGNA 4A00A 2D64A 1GC0A 5BJ3A 4RITA 3L44A 4EB5A 2VMNA 2D7ZA 4IXOA 2FM1A 2Z9UA 3B1CA 4LW2A 2D7YA 2FNIA 3GR9A 3HMUA 1AY4A 2HP1A 4IXZA 1B5OA 1Z7DA 3H14A 4ZM4A 2QMAA 1ASDA 3RCHB 1WSTA 3EI8A 3I5TA 4ITXA 4WXFA 4JE5A 3TFTA 2R5CA 5EUEA 4ZDLA 1DFOA 2E54A 5G4JA 4OCAA 4JF1A 1GC4A 2W7HA 3DXVA 1WKHA 3BV0A 3BWOA 1SZSA 3IF2A 3KE3A 3WX9A 4WYGA 4A0HA 3AATA 3DRDA 1N31A 3PGYA 4K05A 2VMPA 1CQ7A 5F8VA 4WXBA 3TCMA 1CL2A 2OGAA 2OQXA 2CTZA 2DOUA 1WYUA 3AEMA 4M2JA 5I92A 1H1CA 3LY1A 2DGMA 1C0NA 4F5KA 3GZDA 1ASNA 4TMRA 2Z61A 4IW7A 3W1HA 4OC9A 4Y0HA 4AO9A 2W7MA 4ZLVA 3PA9A 1JS6A
chains in the Genus database with same CATH topology
2QLRA 1ASEA 3WZFA 1W7MA 3RI6A 4TN4A 1IX7A 1OHVA 1G4XA 4LNLA 1ASCA 1UKJA 3A2BA 1IJIA 1RVYA 1LW4A 2O0RA 1FC4A 2D61A 3AEJC 1AAWA 3EZSA 3FFHA 3WKSA 3ACZA 1N2TA 3KKIA 3FVSA 1C9CA 3NNKA 4DQ6A 2AY9A 2VGWA 1AY8A 4ADEA 3HQTA 3JWAA 2DR1A 1GCKA 3WLXA 3H7FA 7AATA 1O62A 1YNUA 4ZAHA 1DGDA 4GEBA 4K2MA 3ELEA 3NYUA 2AEUA 2ZSMA 2AY8A 3QHXA 3ISLA 2HUFA 4KAMA 3DR4A 1BQAA 3ZRQA 3D6KA 4KYOA 1GC2A 3DU4A 4MQRA 2X3LA 1IAYA 1QJ3A 3FFRA 4XEWA 4ATQA 2VMXA 2CANA 1UU2A 4WBTA 4ITGA 3CQ6A 3LWSA 4WLHA 2BI3A 2EH6A 4WYFA 3CBFA 4JEZA 1E5EA 1KMJA 2VMVA 4CXRA 4JEYA 4AZKA 3A8UX 4ZM3A 4MKKA 1AMRA 2VMTA 3DXWA 3B46A 1GC3A 1IBJA 2DKJA 4W1WA 1MAQA 4CXQA 3ECDA 3HBXA 3AEMC 2VIBA 4Q76A 2GMSA 2FNUA 2R5EA 4Q6RA 4XJMA 1KL1A 3II0A 2W7IA 3BWNA 3WY7A 3FDBA 1QIRA 1AMQA 1GDEA 3DYDA 3FD0A 3GETA 2Z1ZA 1MGVA 5FT8A 3N4RA 1IUGA 4MSOA 4A6UA 2VI9A 2V0YA 2VMQA 2DGLA 4W8IA 1J32A 3AEPA 3OKSA 3AEJA 3EUCA 4BQ0A 3KGXA 1TOJA 4K2BA 4MY5A 2AY2A 4F5LA 5IWQA 2ZY3A 4N0BA 4GE4A 2CJDA 4K2IA 2W8JA 1AIAA 3OP7A 4KXKA 5HHYA 5J8QA 4WXGA 4FFCA 1RVUA 2W7DA 5HDMA 4GRXA 3PDBB 2EGYA 1DTYA 2PO3A 3VK2A 4O6ZA 1LW5A 3FKDA 3FDDA 2GMUA 2NMPA 4JF0A 3GZCA 3LVMA 4AO4A 2JJGA 3ZZJA 3DC1A 1MDZA 4Y0IA 4WB0A 4RJ0A 4W5KA 1CZCA 4ATPA 1O69A 3NUIA 1AIBA 4JEXA 2X5FA 3JWBA 4GE7A 1RV3A 3BS8A 2YOBA 3DZZA 1KKPA 4A72A 1AHYA 4BHDA 2E7IA 3HVYA 2ZJGA 2VLHA 3BC8A 4XK1A 4RKCA 2CH2A 3B1DA 1G7WA 1AY5A 3EIAA 3N0LA 3MC6C 3FQAA 1V2EA 3RBFA 1W3UA 3NYTA 3BN1A 4UHMA 3T32A 4LNMA 2WB6A 2VMYA 3PPLA 1BJWA 1W7NA 4EMYA 4ADDA 3E9KA 1T3IA 3A9YA 5EAAA 3LV2A 1C4KA 3PDXA 2C7TA 3MKJA 1AKCA 2HUIA 4RLGA 3AENA 3LVLB 4W1XA 2C0RA 3RCHA 2ZUKA 2ZSLA 4IYOA 4R5FA 1M0PA 1C7GA 5M49A 3DR7A 1V72A 2GSAA 2ZYJA 3ZRPA 3F0HA 3WCNA 2PB0A 3F6TA 3G0TA 4A0FA 1ELUA 2D5YA 4U1TA 4GE9A 3WGCA 4PFNA 2CFBA 2FQ6A 1E5FA 5DX5A 1M0NA 4H51A 2O1BA 2VGUA 2OKJA 3FZ6A 1FG7A 2EYQA 4R5ZA 1ECXA 3FZ7A 4F5MA 4ZASA 1AJSA 2CINA 3MADA 1EJIA 1VJOA 2BI1A 2O7CA 4UHNA 2CJHA 3K7YA 4JEVA 2ORDA 2V1PA 3ZZKA 4Y0DA 4UOYA 3NRAA 2Z67A 2WK8A 5G2PA 1AKAA 2HOXA 4ZWMA 1AJSB 2ZP7A 3PD6A 1FG3A 3VK4A 1CQ8A 3FCRA 1QITA 1JS3A 2Z9XA 1YJSA 1TASA 1U08A 3QI6A 2YCNA 1OATA 3COGA 1CJ0A 2Z9VA 1YIZA 1TOIA 4F5IA 3HDOA 3N4SA 4GSAA 3NU8A 2BWOA 1B4XA 5EUDA 5G0AA 1SVVA 4RAEA 1N8PA 4F5FA 3R9AA 2AY5A 3F9TA 1WYVA 3RBLA 3EI9A 2QB2A 1IVRA 1ASFA 4CBSA 1V2FA 4U2HA 4HF8A 1MDXA 4ISYA 3WKRA 1KMKA 4E1OA 2BWPA 1GEYA 2E7UA 3E77A 1PMOA 1ASMA 2C44A 3HLMA 1JG8A 3QGUA 4PIWA 3K28A 2FYFA 4MGRA 3P1TA 1OXOA 3ASBA 1O4SA 8AATA 1TARA 1LC5A 4FL0A 2D63A 2YKYA 1ARSA 1BQDA 1MAPA 1RV4A 4J8LA 4I8AA 1ORDA 2Z20A 3ATHA 4LW4A 3K40A 4LNJA 1DJUA 1LC7A 1OXPA 4A0GA 1ELQA 1B9HA 1WKGA 3AENB 4XJLA 2AY7A 5HXXA 4ADCA 1XI9A 3EZ1A 3FQ7A 2W8VA 3MAFB 3NTJA 3MBBA 4WB0B 3G7QA 1ASBA 1DGEA 4OYTA 1GEXA 3E2ZB 1X29A 2BYLA 1D7UA 3AELA 3GBXA 2Z9WA 4XAUA 3W1JA 3PDBA 3AOVA 4ZSWA 3JU7A 3ASAA 4M2MA 3UAKA 1V2DA 2HZPA 2R0TA 1LKCA 1CQ6A 3FVXA 1BJOA 3LG0A 4MQPA 4OTLA 1C7NA 1YIYA 2W7KA 2EO5A 4ZWVA 3E2YA 2QA3A 3FZ8A 1ARHA 3FSLA 2QSRA 2YCPA 1WYTB 1MDOA 2YRRA 4BA5A 3BCAA 3CQ4A 2JJHA 3EI7A 3RQ1A 2AY6A 2R2NA 5EIGA 1KKJA 3QN6A 2YKXA 1MLZA 5M4BA 3GSBA 1SF2A 1J04A 3VAXA 1G7XA 1S08A 4P7YA 1ARTA 2FKIA 5F9SA 4GDYA 2CH1A 2JG2A 2VIAA 5FT5A 5K8BA 3PAAA 1AHXA 3N7NA 4F5JA 3FTBA 4RIZA 2AY3A 5EUNA 1CZEA 4W1VA 5EAVA 4JE5D 3A9XA 1AMSA 1TOEA 1LK9A 2HOYA 3AOWA 1IX8A 2W7JA 4WYCA 1X0MA 3N5MA 2BYJA 2DKBA 1BJ4A 2Z1YA 3QBOA 2OGEA 1G4VA 1TPLA 1DJEA 4ADBA 4BA4A 1SPAA 4Q75A 2YKVA 1TATA 2BIGA 1BJNA 2E7JA 4F5HA 1VP4A 2W8UA 4MKJA 3H9XA 1D7SA 2JJFA 2BIAA 1IAXA 3UWCA 4A6RA 2WK9A 1S09A 1DJ9A 3EI6A 4M2KA 5FT4A 3NYSA 1S06A 4OBVA 1GD9A 4J5UA 4RM1A 3W1IA 4A0RA 3R4TA 3WGBA 3WCOA 5D95A 5E3KA 5FT6A 4B9BA 2C81A 2EZ1A 4H63Q 3JW9A 3AEOA 1AKBA 3B8XA 1MLYA 4L0OA 4OT8A 1TOKA 5DB5A 3G8MA 1AHFA 1I29A 1JF9A 3MEBA 3NX3A 1TOGA 3CQ5A 2CJGA 9AATA 2AEVA 2AY4A 5LHAA 1M0QA 2W7GA 3VK3A 4WP0A 2AY1A 1VEFA 1YJZA 4EB7A 2HORA 4RKDA 3UE8A 1S0AA 5BJ4A 3MAUA 4OBUA 5M46A 3EIBA 4XQ2A 1YAAA 3LVJA 3QPGA 2G7JA 1OHWA 1AJRA 4N0WA 4TV7A 2HOZA 1DKAA 2BKWA 4R8DA 1XEYA 2D65A 1IX6A 1D7RA 3PJ0A 1C7OA 3USFA 4A6TA 4QGRA 4CVQA 4F5GA 5C6UA 4UQVA 2A1VA 1B9IA 1WYTA 1S07A 1M6SA 2Q7WA 3LVKA 1EG5A 2D66A 3DODA 3EI5A 1ASLA 4XJOA 3TQXA 2BI2A 2JISA 3N4XA 1GEWA 3TATA 2VMRA 2YHKA 3RUYA 1BJOB 2BI9A 1AICA 4PFFA 5AX8A 4EFFA 3MC6A 1M4NA 3CAIA 1YJYA 2VI8A 4WYEA 4ZSYA 5G2QA 5TF5A 2HUUA 3TFUA 2VGTA 3Q8NA 2BI5A 1ASGA 1I48A 5EIGB 4IY7A 1D2FA 2YRIA 1AMAA 3E2ZA 2VLFA 5M4DA 3JZLA 3BCXA 2CB1A 3MAFA 1KL2A 3M5UA 2TPLA 3HL2A 1Z3ZA 2VGVA 1W23A 1WYUB 1CS1A 3FQ8A 3KGWA 4IXSA 5D5SA 2ZC0A 1UU1A 1AAMA 1LS3A 2WK7A 2XH1A 3FRKA 4JEWA 1ZODA 4OMAA 2PB2A 4W91A 4DBCA 1SZKA 1BKGA 4RJYA 1CL1A 2KFPA 1AHGA 3QM2A 4F4EA 2ZY5A 2R5CB 2FN6A 2VMUA 1B5PA 4Q31A 2GB3A 2WKAA 1BS0A 2VMWA 3NUBA 1AHEA 3I4JA 4ZDPA 1SZUA 1ARIA 4UHOA 2QBTA 4LC3A 1YOOA 1PG8A 2VGZA 2OATA 3BWNC 1QZ9A 2HP2A 2W8WA 1BW0A 2AATA 2W7LA 4IX8A 5EQCA 2BHXA 2XBNA 1M32A 4WYDA 4AOAA 1OHYA 1EQBA 2RFVA 4E3RA 1UU0A 2CY8A 2W7FA 4WYAA 1H0CA 4NOGA 1I41A 3PIUA 1W7LA 4E77A 3GJUA 3FVUA 3N75A 5DJ1A 5EFSA 5JAYA 4WLJA 1QJ5A 3E2FA 3VP6A 2JJEA 1M7YA 3ELPA 3A9ZA 4CBRA 3BB8A 1WYVB 3P6KA 3GZDC 2VMSA 1O61A 3IHJA 3HT4A 3I16A 2X5DA 1AX4A 2F8JA 1ASAA 1B8GA 4P3MA 2G6WA 2OKKA 2EZ2A 2VYCA 3NDNA 5E4ZA 3B1EA 5G4IA 3AV7A 5LH9A 1I43A 1QISA 2W7EA 2EPJA 1GBNA 3GWPA 4R2NA 4E3QA 4HVKA 3JTXA 4XJPA 5G09A 4DGTA 1ZC9A 2QB3A 2YKUA 2GQNA 3E6GA 1SFFA 4AZJA 2CSTA 4WD2A 5DJ9A 3VOMA 3BCBA 3PD6B 1M0OA 3NU7A 4B98A 2VMZA 2BIEA 2ZY4A 1LC8A 1X28A 1ZOBA 4EU1A 2DGKA 2VGSA 2W8TA 3ZRRA 2YCTA 2ZY2A 4IYOB 1BT4A 2VMOA 1ARGA 4BMKA 2BWNA 1X2AA 1P3WA 5KTBA 5E5IA 4AH3A 4MQQA 1Y4IA 4ZDOA 1D7VA 1PMMA 1PFFA 2JGTA 2X8UA 3L8AA 4PVFA 1QGNA 4A00A 2D64A 1GC0A 5BJ3A 4RITA 3L44A 4EB5A 2VMNA 2D7ZA 4IXOA 2FM1A 2Z9UA 3B1CA 4LW2A 2D7YA 2FNIA 3GR9A 3HMUA 1AY4A 2HP1A 4IXZA 1B5OA 1Z7DA 3H14A 4ZM4A 2QMAA 1ASDA 3RCHB 1WSTA 3EI8A 3I5TA 4ITXA 4WXFA 4JE5A 3TFTA 2R5CA 5EUEA 4ZDLA 1DFOA 2E54A 5G4JA 4OCAA 4JF1A 1GC4A 2W7HA 3DXVA 1WKHA 3BV0A 3BWOA 1SZSA 3IF2A 3KE3A 3WX9A 4WYGA 4A0HA 3AATA 3DRDA 1N31A 3PGYA 4K05A 2VMPA 1CQ7A 5F8VA 4WXBA 3TCMA 1CL2A 2OGAA 2OQXA 2CTZA 2DOUA 1WYUA 3AEMA 4M2JA 5I92A 1H1CA 3LY1A 2DGMA 1C0NA 4F5KA 3GZDA 1ASNA 4TMRA 2Z61A 4IW7A 3W1HA 4OC9A 4Y0HA 4AO9A 2W7MA 4ZLVA 3PA9A 1JS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLR A;  1ASE A;  3WZF A;  1W7M A;  3RI6 A;  4TN4 A;  1IX7 A;  1OHV A;  1G4X A;  4LNL A;  1ASC A;  1UKJ A;  3A2B A;  1IJI A;  1RVY A;  1LW4 A;  2O0R A;  1FC4 A;  2D61 A;  3AEJ C;  1AAW A;  3EZS A;  3FFH A;  3WKS A;  3ACZ A;  1N2T A;  3KKI A;  3FVS A;  1C9C A;  3NNK A;  4DQ6 A;  2AY9 A;  2VGW A;  1AY8 A;  4ADE A;  3HQT A;  3JWA A;  2DR1 A;  1GCK A;  3WLX A;  3H7F A;  7AAT A;  1O62 A;  1YNU A;  4ZAH A;  1DGD A;  4GEB A;  4K2M A;  3ELE A;  3NYU A;  2AEU A;  2ZSM A;  2AY8 A;  3QHX A;  3ISL A;  2HUF A;  4KAM A;  3DR4 A;  1BQA A;  3ZRQ A;  3D6K A;  4KYO A;  1GC2 A;  3DU4 A;  4MQR A;  2X3L A;  1IAY A;  1QJ3 A;  3FFR A;  4XEW A;  4ATQ A;  2VMX A;  2CAN A;  1UU2 A;  4WBT A;  4ITG A;  3CQ6 A;  3LWS A;  4WLH A;  2BI3 A;  2EH6 A;  4WYF A;  3CBF A;  4JEZ A;  1E5E A;  1KMJ A;  2VMV A;  4CXR A;  4JEY A;  4AZK A;  3A8U X;  4ZM3 A;  4MKK A;  1AMR A;  2VMT A;  3DXW A;  3B46 A;  1GC3 A;  1IBJ A;  2DKJ A;  4W1W A;  1MAQ A;  4CXQ A;  3ECD A;  3HBX A;  3AEM C;  2VIB A;  4Q76 A;  2GMS A;  2FNU A;  2R5E A;  4Q6R A;  4XJM A;  1KL1 A;  3II0 A;  2W7I A;  3BWN A;  3WY7 A;  3FDB A;  1QIR A;  1AMQ A;  1GDE A;  3DYD A;  3FD0 A;  3GET A;  2Z1Z A;  1MGV A;  5FT8 A;  1IUG A;  4MSO A;  4A6U A;  2VI9 A;  2V0Y A;  2VMQ A;  2DGL A;  4W8I A;  1J32 A;  3AEP A;  3OKS A;  3AEJ A;  3EUC A;  4BQ0 A;  3KGX A;  1TOJ A;  4K2B A;  4MY5 A;  2AY2 A;  4F5L A;  5IWQ A;  2ZY3 A;  4N0B A;  4GE4 A;  2CJD A;  4K2I A;  2W8J A;  1AIA A;  3OP7 A;  4KXK A;  5HHY A;  5J8Q A;  4WXG A;  4FFC A;  1RVU A;  2W7D A;  5HDM A;  4GRX A;  3PDB B;  2EGY A;  1DTY A;  2PO3 A;  3VK2 A;  4O6Z A;  1LW5 A;  3FKD A;  3FDD A;  2GMU A;  2NMP A;  4JF0 A;  3GZC A;  3LVM A;  4AO4 A;  2JJG A;  3ZZJ A;  3DC1 A;  1MDZ A;  4Y0I A;  4WB0 A;  4RJ0 A;  4W5K A;  1CZC A;  4ATP A;  1O69 A;  3NUI A;  1AIB A;  4JEX A;  2X5F A;  3JWB A;  4GE7 A;  1RV3 A;  3BS8 A;  2YOB A;  3DZZ A;  1KKP A;  4A72 A;  1AHY A;  4BHD A;  2E7I A;  3HVY A;  2ZJG A;  2VLH A;  3BC8 A;  4XK1 A;  4RKC A;  2CH2 A;  3B1D A;  1G7W A;  1AY5 A;  3EIA A;  3N0L A;  3MC6 C;  3FQA A;  1V2E A;  3RBF A;  1W3U A;  3NYT A;  3BN1 A;  4UHM A;  3T32 A;  4LNM A;  2VMY A;  3PPL A;  1BJW A;  1W7N A;  4EMY A;  4ADD A;  3E9K A;  1T3I A;  3A9Y A;  5EAA A;  3LV2 A;  1C4K A;  3PDX A;  2C7T A;  3MKJ A;  1AKC A;  2HUI A;  4RLG A;  3AEN A;  3LVL B;  4W1X A;  2C0R A;  3RCH A;  2ZUK A;  2ZSL A;  4IYO A;  4R5F A;  1M0P A;  1C7G A;  5M49 A;  3DR7 A;  1V72 A;  2GSA A;  2ZYJ A;  3ZRP A;  3F0H A;  3WCN A;  2PB0 A;  3F6T A;  3G0T A;  4A0F A;  1ELU A;  2D5Y A;  4U1T A;  4GE9 A;  3WGC A;  4PFN A;  2CFB A;  2FQ6 A;  1E5F A;  5DX5 A;  1M0N A;  4H51 A;  2O1B A;  2VGU A;  2OKJ A;  3FZ6 A;  1FG7 A;  4R5Z A;  1ECX A;  3FZ7 A;  4F5M A;  4ZAS A;  1AJS A;  2CIN A;  3MAD A;  1EJI A;  1VJO A;  2BI1 A;  2O7C A;  4UHN A;  2CJH A;  3K7Y A;  4JEV A;  2ORD A;  2V1P A;  3ZZK A;  4Y0D A;  4UOY A;  3NRA A;  2Z67 A;  2WK8 A;  5G2P A;  1AKA A;  2HOX A;  4ZWM A;  1AJS B;  2ZP7 A;  3PD6 A;  1FG3 A;  3VK4 A;  1CQ8 A;  3FCR A;  1QIT A;  1JS3 A;  2Z9X A;  1YJS A;  1TAS A;  1U08 A;  3QI6 A;  2YCN A;  1OAT A;  3COG A;  1CJ0 A;  2Z9V A;  1YIZ A;  1TOI A;  4F5I A;  3HDO A;  4GSA A;  3NU8 A;  2BWO A;  1B4X A;  5EUD A;  5G0A A;  1SVV A;  4RAE A;  1N8P A;  4F5F A;  3R9A A;  2AY5 A;  3F9T A;  1WYV A;  3RBL A;  3EI9 A;  2QB2 A;  1IVR A;  1ASF A;  4CBS A;  1V2F A;  4U2H A;  4HF8 A;  1MDX A;  4ISY A;  3WKR A;  1KMK A;  4E1O A;  2BWP A;  1GEY A;  2E7U A;  3E77 A;  1PMO A;  1ASM A;  2C44 A;  3HLM A;  1JG8 A;  3QGU A;  4PIW A;  3K28 A;  2FYF A;  4MGR A;  3P1T A;  1OXO A;  3ASB A;  1O4S A;  8AAT A;  1TAR A;  1LC5 A;  4FL0 A;  2D63 A;  2YKY A;  1ARS A;  1BQD A;  1MAP A;  1RV4 A;  4J8L A;  4I8A A;  1ORD A;  2Z20 A;  3ATH A;  4LW4 A;  3K40 A;  4LNJ A;  1DJU A;  1LC7 A;  1OXP A;  4A0G A;  1ELQ A;  1B9H A;  1WKG A;  3AEN B;  4XJL A;  2AY7 A;  5HXX A;  4ADC A;  1XI9 A;  3EZ1 A;  3FQ7 A;  2W8V A;  3MAF B;  3NTJ A;  3MBB A;  4WB0 B;  3G7Q A;  1ASB A;  1DGE A;  4OYT A;  1GEX A;  3E2Z B;  1X29 A;  2BYL A;  1D7U A;  3AEL A;  3GBX A;  2Z9W A;  4XAU A;  3W1J A;  3PDB A;  3AOV A;  4ZSW A;  3JU7 A;  3ASA A;  4M2M A;  3UAK A;  1V2D A;  2HZP A;  2R0T A;  1LKC A;  1CQ6 A;  3FVX A;  1BJO A;  3LG0 A;  4MQP A;  4OTL A;  1C7N A;  1YIY A;  2W7K A;  2EO5 A;  4ZWV A;  3E2Y A;  2QA3 A;  3FZ8 A;  1ARH A;  3FSL A;  2YCP A;  1WYT B;  1MDO A;  2YRR A;  4BA5 A;  3BCA A;  3CQ4 A;  2JJH A;  3EI7 A;  3RQ1 A;  2AY6 A;  2R2N A;  5EIG A;  1KKJ A;  3QN6 A;  2YKX A;  1MLZ A;  5M4B A;  3GSB A;  1SF2 A;  1J04 A;  3VAX A;  1G7X A;  1S08 A;  4P7Y A;  1ART A;  5F9S A;  4GDY A;  2CH1 A;  2JG2 A;  2VIA A;  5FT5 A;  5K8B A;  3PAA A;  1AHX A;  4F5J A;  3FTB A;  4RIZ A;  2AY3 A;  5EUN A;  1CZE A;  4W1V A;  5EAV A;  4JE5 D;  3A9X A;  1AMS A;  1TOE A;  1LK9 A;  2HOY A;  3AOW A;  1IX8 A;  2W7J A;  4WYC A;  1X0M A;  3N5M A;  2BYJ A;  2DKB A;  1BJ4 A;  2Z1Y A;  3QBO A;  2OGE A;  1G4V A;  1TPL A;  1DJE A;  4ADB A;  4BA4 A;  1SPA A;  4Q75 A;  2YKV A;  1TAT A;  2BIG A;  1BJN A;  2E7J A;  4F5H A;  1VP4 A;  2W8U A;  4MKJ A;  1D7S A;  2JJF A;  2BIA A;  1IAX A;  3UWC A;  4A6R A;  2WK9 A;  1S09 A;  1DJ9 A;  3EI6 A;  4M2K A;  5FT4 A;  3NYS A;  1S06 A;  4OBV A;  1GD9 A;  4J5U A;  4RM1 A;  3W1I A;  4A0R A;  3R4T A;  3WGB A;  3WCO A;  5D95 A;  5E3K A;  5FT6 A;  4B9B A;  2C81 A;  2EZ1 A;  3JW9 A;  3AEO A;  1AKB A;  3B8X A;  1MLY A;  4L0O A;  4OT8 A;  1TOK A;  5DB5 A;  3G8M A;  1AHF A;  1I29 A;  1JF9 A;  3MEB A;  3NX3 A;  1TOG A;  3CQ5 A;  2CJG A;  9AAT A;  2AEV A;  2AY4 A;  5LHA A;  1M0Q A;  2W7G A;  3VK3 A;  4WP0 A;  2AY1 A;  1VEF A;  1YJZ A;  4EB7 A;  2HOR A;  4RKD A;  3UE8 A;  1S0A A;  5BJ4 A;  3MAU A;  4OBU A;  5M46 A;  3EIB A;  4XQ2 A;  1YAA A;  3LVJ A;  3QPG A;  1OHW A;  1AJR A;  4N0W A;  4TV7 A;  2HOZ A;  1DKA A;  2BKW A;  4R8D A;  1XEY A;  2D65 A;  1IX6 A;  1D7R A;  3PJ0 A;  1C7O A;  3USF A;  4A6T A;  4QGR A;  4CVQ A;  4F5G A;  5C6U A;  4UQV A;  1B9I A;  1WYT A;  1S07 A;  1M6S A;  2Q7W A;  3LVK A;  1EG5 A;  2D66 A;  3DOD A;  3EI5 A;  1ASL A;  4XJO A;  3TQX A;  2BI2 A;  2JIS A;  1GEW A;  3TAT A;  2VMR A;  2YHK A;  3RUY A;  1BJO B;  2BI9 A;  1AIC A;  4PFF A;  5AX8 A;  4EFF A;  3MC6 A;  1M4N A;  3CAI A;  1YJY A;  2VI8 A;  4WYE A;  4ZSY A;  5G2Q A;  5TF5 A;  2HUU A;  3TFU A;  2VGT A;  3Q8N A;  2BI5 A;  1ASG A;  1I48 A;  5EIG B;  4IY7 A;  1D2F A;  2YRI A;  1AMA A;  3E2Z A;  2VLF A;  5M4D A;  3JZL A;  3BCX A;  2CB1 A;  3MAF A;  1KL2 A;  3M5U A;  2TPL A;  3HL2 A;  1Z3Z A;  2VGV A;  1W23 A;  1WYU B;  1CS1 A;  3FQ8 A;  3KGW A;  4IXS A;  5D5S A;  2ZC0 A;  1UU1 A;  1AAM A;  1LS3 A;  2WK7 A;  2XH1 A;  3FRK A;  4JEW A;  1ZOD A;  4OMA A;  2PB2 A;  4W91 A;  4DBC A;  1SZK A;  1BKG A;  4RJY A;  1CL1 A;  1AHG A;  3QM2 A;  4F4E A;  2ZY5 A;  2R5C B;  2FN6 A;  2VMU A;  1B5P A;  4Q31 A;  2GB3 A;  2WKA A;  1BS0 A;  2VMW A;  3NUB A;  1AHE A;  3I4J A;  4ZDP A;  1SZU A;  1ARI A;  4UHO A;  2QBT A;  4LC3 A;  1YOO A;  1PG8 A;  2VGZ A;  2OAT A;  3BWN C;  1QZ9 A;  2HP2 A;  2W8W A;  1BW0 A;  2AAT A;  2W7L A;  4IX8 A;  5EQC A;  2BHX A;  2XBN A;  1M32 A;  4WYD A;  4AOA A;  1OHY A;  1EQB A;  2RFV A;  4E3R A;  1UU0 A;  2CY8 A;  2W7F A;  4WYA A;  1H0C A;  4NOG A;  1I41 A;  3PIU A;  1W7L A;  4E77 A;  3GJU A;  3FVU A;  3N75 A;  5DJ1 A;  5EFS A;  5JAY A;  4WLJ A;  1QJ5 A;  3E2F A;  3VP6 A;  2JJE A;  1M7Y A;  3ELP A;  3A9Z A;  4CBR A;  3BB8 A;  1WYV B;  3P6K A;  3GZD C;  2VMS A;  1O61 A;  3IHJ A;  3HT4 A;  3I16 A;  2X5D A;  1AX4 A;  2F8J A;  1ASA A;  1B8G A;  4P3M A;  2G6W A;  2OKK A;  2EZ2 A;  2VYC A;  3NDN A;  5E4Z A;  3B1E A;  5G4I A;  3AV7 A;  5LH9 A;  1I43 A;  1QIS A;  2W7E A;  2EPJ A;  1GBN A;  3GWP A;  4R2N A;  4E3Q A;  4HVK A;  3JTX A;  4XJP A;  5G09 A;  4DGT A;  1ZC9 A;  2QB3 A;  2YKU A;  2GQN A;  3E6G A;  1SFF A;  4AZJ A;  2CST A;  4WD2 A;  5DJ9 A;  3VOM A;  3BCB A;  3PD6 B;  1M0O A;  3NU7 A;  4B98 A;  2VMZ A;  2BIE A;  2ZY4 A;  1LC8 A;  1X28 A;  1ZOB A;  4EU1 A;  2DGK A;  2VGS A;  2W8T A;  3ZRR A;  2YCT A;  2ZY2 A;  4IYO B;  1BT4 A;  2VMO A;  1ARG A;  4BMK A;  2BWN A;  1X2A A;  1P3W A;  5E5I A;  4AH3 A;  4MQQ A;  1Y4I A;  4ZDO A;  1D7V A;  1PMM A;  1PFF A;  2JGT A;  2X8U A;  3L8A A;  4PVF A;  1QGN A;  4A00 A;  2D64 A;  1GC0 A;  5BJ3 A;  4RIT A;  3L44 A;  4EB5 A;  2VMN A;  2D7Z A;  4IXO A;  2FM1 A;  2Z9U A;  3B1C A;  4LW2 A;  2D7Y A;  2FNI A;  3GR9 A;  3HMU A;  1AY4 A;  2HP1 A;  4IXZ A;  1B5O A;  1Z7D A;  3H14 A;  4ZM4 A;  2QMA A;  1ASD A;  3RCH B;  1WST A;  3EI8 A;  3I5T A;  4ITX A;  4WXF A;  4JE5 A;  3TFT A;  2R5C A;  5EUE A;  4ZDL A;  1DFO A;  2E54 A;  5G4J A;  4OCA A;  4JF1 A;  1GC4 A;  2W7H A;  3DXV A;  1WKH A;  3BV0 A;  3BWO A;  1SZS A;  3IF2 A;  3KE3 A;  3WX9 A;  4WYG A;  4A0H A;  3AAT A;  3DRD A;  1N31 A;  3PGY A;  2VMP A;  1CQ7 A;  5F8V A;  4WXB A;  3TCM A;  1CL2 A;  2OGA A;  2OQX A;  2CTZ A;  2DOU A;  1WYU A;  3AEM A;  4M2J A;  5I92 A;  1H1C A;  3LY1 A;  2DGM A;  1C0N A;  4F5K A;  3GZD A;  1ASN A;  4TMR A;  2Z61 A;  4IW7 A;  3W1H A;  4OC9 A;  4Y0H A;  4AO9 A;  2W7M A;  4ZLV A;  3PA9 A;  1JS6 A; 
#chains in the Genus database with same CATH topology
 2QLR A;  1ASE A;  3WZF A;  1W7M A;  3RI6 A;  4TN4 A;  1IX7 A;  1OHV A;  1G4X A;  4LNL A;  1ASC A;  1UKJ A;  3A2B A;  1IJI A;  1RVY A;  1LW4 A;  2O0R A;  1FC4 A;  2D61 A;  3AEJ C;  1AAW A;  3EZS A;  3FFH A;  3WKS A;  3ACZ A;  1N2T A;  3KKI A;  3FVS A;  1C9C A;  3NNK A;  4DQ6 A;  2AY9 A;  2VGW A;  1AY8 A;  4ADE A;  3HQT A;  3JWA A;  2DR1 A;  1GCK A;  3WLX A;  3H7F A;  7AAT A;  1O62 A;  1YNU A;  4ZAH A;  1DGD A;  4GEB A;  4K2M A;  3ELE A;  3NYU A;  2AEU A;  2ZSM A;  2AY8 A;  3QHX A;  3ISL A;  2HUF A;  4KAM A;  3DR4 A;  1BQA A;  3ZRQ A;  3D6K A;  4KYO A;  1GC2 A;  3DU4 A;  4MQR A;  2X3L A;  1IAY A;  1QJ3 A;  3FFR A;  4XEW A;  4ATQ A;  2VMX A;  2CAN A;  1UU2 A;  4WBT A;  4ITG A;  3CQ6 A;  3LWS A;  4WLH A;  2BI3 A;  2EH6 A;  4WYF A;  3CBF A;  4JEZ A;  1E5E A;  1KMJ A;  2VMV A;  4CXR A;  4JEY A;  4AZK A;  3A8U X;  4ZM3 A;  4MKK A;  1AMR A;  2VMT A;  3DXW A;  3B46 A;  1GC3 A;  1IBJ A;  2DKJ A;  4W1W A;  1MAQ A;  4CXQ A;  3ECD A;  3HBX A;  3AEM C;  2VIB A;  4Q76 A;  2GMS A;  2FNU A;  2R5E A;  4Q6R A;  4XJM A;  1KL1 A;  3II0 A;  2W7I A;  3BWN A;  3WY7 A;  3FDB A;  1QIR A;  1AMQ A;  1GDE A;  3DYD A;  3FD0 A;  3GET A;  2Z1Z A;  1MGV A;  5FT8 A;  3N4R A;  1IUG A;  4MSO A;  4A6U A;  2VI9 A;  2V0Y A;  2VMQ A;  2DGL A;  4W8I A;  1J32 A;  3AEP A;  3OKS A;  3AEJ A;  3EUC A;  4BQ0 A;  3KGX A;  1TOJ A;  4K2B A;  4MY5 A;  2AY2 A;  4F5L A;  5IWQ A;  2ZY3 A;  4N0B A;  4GE4 A;  2CJD A;  4K2I A;  2W8J A;  1AIA A;  3OP7 A;  4KXK A;  5HHY A;  5J8Q A;  4WXG A;  4FFC A;  1RVU A;  2W7D A;  5HDM A;  4GRX A;  3PDB B;  2EGY A;  1DTY A;  2PO3 A;  3VK2 A;  4O6Z A;  1LW5 A;  3FKD A;  3FDD A;  2GMU A;  2NMP A;  4JF0 A;  3GZC A;  3LVM A;  4AO4 A;  2JJG A;  3ZZJ A;  3DC1 A;  1MDZ A;  4Y0I A;  4WB0 A;  4RJ0 A;  4W5K A;  1CZC A;  4ATP A;  1O69 A;  3NUI A;  1AIB A;  4JEX A;  2X5F A;  3JWB A;  4GE7 A;  1RV3 A;  3BS8 A;  2YOB A;  3DZZ A;  1KKP A;  4A72 A;  1AHY A;  4BHD A;  2E7I A;  3HVY A;  2ZJG A;  2VLH A;  3BC8 A;  4XK1 A;  4RKC A;  2CH2 A;  3B1D A;  1G7W A;  1AY5 A;  3EIA A;  3N0L A;  3MC6 C;  3FQA A;  1V2E A;  3RBF A;  1W3U A;  3NYT A;  3BN1 A;  4UHM A;  3T32 A;  4LNM A;  2WB6 A;  2VMY A;  3PPL A;  1BJW A;  1W7N A;  4EMY A;  4ADD A;  3E9K A;  1T3I A;  3A9Y A;  5EAA A;  3LV2 A;  1C4K A;  1KAF A;  3PDX A;  2C7T A;  3MKJ A;  1AKC A;  2HUI A;  4RLG A;  3AEN A;  3LVL B;  4W1X A;  2C0R A;  3RCH A;  2ZUK A;  2ZSL A;  4IYO A;  4R5F A;  1M0P A;  1C7G A;  5M49 A;  3DR7 A;  1V72 A;  2GSA A;  2ZYJ A;  3ZRP A;  3F0H A;  3WCN A;  2PB0 A;  3F6T A;  3G0T A;  4A0F A;  1ELU A;  2D5Y A;  4U1T A;  4GE9 A;  3WGC A;  4PFN A;  2CFB A;  2FQ6 A;  1E5F A;  5DX5 A;  1M0N A;  4H51 A;  2O1B A;  2VGU A;  2OKJ A;  3FZ6 A;  1FG7 A;  2EYQ A;  4R5Z A;  1ECX A;  3FZ7 A;  4F5M A;  4ZAS A;  1AJS A;  2CIN A;  3MAD A;  1EJI A;  1VJO A;  2BI1 A;  2O7C A;  4UHN A;  2CJH A;  3K7Y A;  4JEV A;  2ORD A;  2V1P A;  3ZZK A;  4Y0D A;  4UOY A;  3NRA A;  2Z67 A;  2WK8 A;  5G2P A;  1AKA A;  2HOX A;  4ZWM A;  1AJS B;  2ZP7 A;  3PD6 A;  1FG3 A;  3VK4 A;  1CQ8 A;  3FCR A;  1QIT A;  1JS3 A;  2Z9X A;  1YJS A;  1TAS A;  1U08 A;  3QI6 A;  2YCN A;  1OAT A;  3COG A;  1CJ0 A;  2Z9V A;  1YIZ A;  1TOI A;  4F5I A;  3HDO A;  3N4S A;  4GSA A;  3NU8 A;  2BWO A;  1B4X A;  5EUD A;  5G0A A;  1SVV A;  4RAE A;  1N8P A;  4F5F A;  3R9A A;  2AY5 A;  3F9T A;  1WYV A;  3RBL A;  3EI9 A;  2QB2 A;  1IVR A;  1ASF A;  4CBS A;  1V2F A;  4U2H A;  4HF8 A;  1MDX A;  4ISY A;  3WKR A;  1KMK A;  4E1O A;  2BWP A;  1GEY A;  2E7U A;  3E77 A;  1PMO A;  1ASM A;  2C44 A;  3HLM A;  1JG8 A;  3QGU A;  4PIW A;  3K28 A;  2FYF A;  4MGR A;  3P1T A;  1OXO A;  3ASB A;  1O4S A;  8AAT A;  1TAR A;  1LC5 A;  4FL0 A;  2D63 A;  2YKY A;  1ARS A;  1BQD A;  1MAP A;  1RV4 A;  4J8L A;  4I8A A;  1ORD A;  2Z20 A;  3ATH A;  4LW4 A;  3K40 A;  4LNJ A;  1DJU A;  1LC7 A;  1OXP A;  4A0G A;  1ELQ A;  1B9H A;  1WKG A;  3AEN B;  4XJL A;  2AY7 A;  5HXX A;  4ADC A;  1XI9 A;  3EZ1 A;  3FQ7 A;  2W8V A;  3MAF B;  3NTJ A;  3MBB A;  4WB0 B;  3G7Q A;  1ASB A;  1DGE A;  4OYT A;  1GEX A;  3E2Z B;  1X29 A;  2BYL A;  1D7U A;  3AEL A;  3GBX A;  2Z9W A;  4XAU A;  3W1J A;  3PDB A;  3AOV A;  4ZSW A;  3JU7 A;  3ASA A;  4M2M A;  3UAK A;  1V2D A;  2HZP A;  2R0T A;  1LKC A;  1CQ6 A;  3FVX A;  1BJO A;  3LG0 A;  4MQP A;  4OTL A;  1C7N A;  1YIY A;  2W7K A;  2EO5 A;  4ZWV A;  3E2Y A;  2QA3 A;  3FZ8 A;  1ARH A;  3FSL A;  2QSR A;  2YCP A;  1WYT B;  1MDO A;  2YRR A;  4BA5 A;  3BCA A;  3CQ4 A;  2JJH A;  3EI7 A;  3RQ1 A;  2AY6 A;  2R2N A;  5EIG A;  1KKJ A;  3QN6 A;  2YKX A;  1MLZ A;  5M4B A;  3GSB A;  1SF2 A;  1J04 A;  3VAX A;  1G7X A;  1S08 A;  4P7Y A;  1ART A;  2FKI A;  5F9S A;  4GDY A;  2CH1 A;  2JG2 A;  2VIA A;  5FT5 A;  5K8B A;  3PAA A;  1AHX A;  3N7N A;  4F5J A;  3FTB A;  4RIZ A;  2AY3 A;  5EUN A;  1CZE A;  4W1V A;  5EAV A;  4JE5 D;  3A9X A;  1AMS A;  1TOE A;  1LK9 A;  2HOY A;  3AOW A;  1IX8 A;  2W7J A;  4WYC A;  1X0M A;  3N5M A;  2BYJ A;  2DKB A;  1BJ4 A;  2Z1Y A;  3QBO A;  2OGE A;  1G4V A;  1TPL A;  1DJE A;  4ADB A;  4BA4 A;  1SPA A;  4Q75 A;  2YKV A;  1TAT A;  2BIG A;  1BJN A;  2E7J A;  4F5H A;  1VP4 A;  2W8U A;  4MKJ A;  3H9X A;  1D7S A;  2JJF A;  2BIA A;  1IAX A;  3UWC A;  4A6R A;  2WK9 A;  1S09 A;  1DJ9 A;  3EI6 A;  4M2K A;  5FT4 A;  3NYS A;  1S06 A;  4OBV A;  1GD9 A;  4J5U A;  4RM1 A;  3W1I A;  4A0R A;  3R4T A;  3WGB A;  3WCO A;  5D95 A;  5E3K A;  5FT6 A;  4B9B A;  2C81 A;  2EZ1 A;  4H63 Q;  3JW9 A;  3AEO A;  1AKB A;  3B8X A;  1MLY A;  4L0O A;  4OT8 A;  1TOK A;  5DB5 A;  3G8M A;  1AHF A;  1I29 A;  1JF9 A;  3MEB A;  3NX3 A;  1TOG A;  3CQ5 A;  2CJG A;  9AAT A;  2AEV A;  2AY4 A;  5LHA A;  1M0Q A;  2W7G A;  3VK3 A;  4WP0 A;  2AY1 A;  1VEF A;  1YJZ A;  4EB7 A;  2HOR A;  4RKD A;  3UE8 A;  1S0A A;  5BJ4 A;  3MAU A;  4OBU A;  5M46 A;  3EIB A;  4XQ2 A;  1YAA A;  3LVJ A;  3QPG A;  2G7J A;  1OHW A;  1AJR A;  4N0W A;  4TV7 A;  2HOZ A;  1DKA A;  2BKW A;  4R8D A;  1XEY A;  2D65 A;  1IX6 A;  1D7R A;  3PJ0 A;  1C7O A;  3USF A;  4A6T A;  4QGR A;  4CVQ A;  4F5G A;  5C6U A;  4UQV A;  2A1V A;  1B9I A;  1WYT A;  1S07 A;  1M6S A;  2Q7W A;  3LVK A;  1EG5 A;  2D66 A;  3DOD A;  3EI5 A;  1ASL A;  4XJO A;  3TQX A;  2BI2 A;  2JIS A;  3N4X A;  1GEW A;  3TAT A;  2VMR A;  2YHK A;  3RUY A;  1BJO B;  2BI9 A;  1AIC A;  4PFF A;  5AX8 A;  4EFF A;  3MC6 A;  1M4N A;  3CAI A;  1YJY A;  2VI8 A;  4WYE A;  4ZSY A;  5G2Q A;  5TF5 A;  2HUU A;  3TFU A;  2VGT A;  3Q8N A;  2BI5 A;  1ASG A;  1I48 A;  5EIG B;  4IY7 A;  1D2F A;  2YRI A;  1AMA A;  3E2Z A;  2VLF A;  5M4D A;  3JZL A;  3BCX A;  2CB1 A;  3MAF A;  1KL2 A;  3M5U A;  2TPL A;  3HL2 A;  1Z3Z A;  2VGV A;  1W23 A;  1WYU B;  1CS1 A;  3FQ8 A;  3KGW A;  4IXS A;  5D5S A;  2ZC0 A;  1UU1 A;  1AAM A;  1LS3 A;  2WK7 A;  2XH1 A;  3FRK A;  4JEW A;  1ZOD A;  4OMA A;  2PB2 A;  4W91 A;  4DBC A;  1SZK A;  1BKG A;  4RJY A;  1CL1 A;  2KFP A;  1AHG A;  3QM2 A;  4F4E A;  2ZY5 A;  2R5C B;  2FN6 A;  2VMU A;  1B5P A;  4Q31 A;  2GB3 A;  2WKA A;  1BS0 A;  2VMW A;  3NUB A;  1AHE A;  3I4J A;  4ZDP A;  1SZU A;  1ARI A;  4UHO A;  2QBT A;  4LC3 A;  1YOO A;  1PG8 A;  2VGZ A;  2OAT A;  3BWN C;  1QZ9 A;  2HP2 A;  2W8W A;  1BW0 A;  2AAT A;  2W7L A;  4IX8 A;  5EQC A;  2BHX A;  2XBN A;  1M32 A;  4WYD A;  4AOA A;  1OHY A;  1EQB A;  2RFV A;  4E3R A;  1UU0 A;  2CY8 A;  2W7F A;  4WYA A;  1H0C A;  4NOG A;  1I41 A;  3PIU A;  1W7L A;  4E77 A;  3GJU A;  3FVU A;  3N75 A;  5DJ1 A;  5EFS A;  5JAY A;  4WLJ A;  1QJ5 A;  3E2F A;  3VP6 A;  2JJE A;  1M7Y A;  3ELP A;  3A9Z A;  4CBR A;  3BB8 A;  1WYV B;  3P6K A;  3GZD C;  2VMS A;  1O61 A;  3IHJ A;  3HT4 A;  3I16 A;  2X5D A;  1AX4 A;  2F8J A;  1ASA A;  1B8G A;  4P3M A;  2G6W A;  2OKK A;  2EZ2 A;  2VYC A;  3NDN A;  5E4Z A;  3B1E A;  5G4I A;  3AV7 A;  5LH9 A;  1I43 A;  1QIS A;  2W7E A;  2EPJ A;  1GBN A;  3GWP A;  4R2N A;  4E3Q A;  4HVK A;  3JTX A;  4XJP A;  5G09 A;  4DGT A;  1ZC9 A;  2QB3 A;  2YKU A;  2GQN A;  3E6G A;  1SFF A;  4AZJ A;  2CST A;  4WD2 A;  5DJ9 A;  3VOM A;  3BCB A;  3PD6 B;  1M0O A;  3NU7 A;  4B98 A;  2VMZ A;  2BIE A;  2ZY4 A;  1LC8 A;  1X28 A;  1ZOB A;  4EU1 A;  2DGK A;  2VGS A;  2W8T A;  3ZRR A;  2YCT A;  2ZY2 A;  4IYO B;  1BT4 A;  2VMO A;  1ARG A;  4BMK A;  2BWN A;  1X2A A;  1P3W A;  5KTB A;  5E5I A;  4AH3 A;  4MQQ A;  1Y4I A;  4ZDO A;  1D7V A;  1PMM A;  1PFF A;  2JGT A;  2X8U A;  3L8A A;  4PVF A;  1QGN A;  4A00 A;  2D64 A;  1GC0 A;  5BJ3 A;  4RIT A;  3L44 A;  4EB5 A;  2VMN A;  2D7Z A;  4IXO A;  2FM1 A;  2Z9U A;  3B1C A;  4LW2 A;  2D7Y A;  2FNI A;  3GR9 A;  3HMU A;  1AY4 A;  2HP1 A;  4IXZ A;  1B5O A;  1Z7D A;  3H14 A;  4ZM4 A;  2QMA A;  1ASD A;  3RCH B;  1WST A;  3EI8 A;  3I5T A;  4ITX A;  4WXF A;  4JE5 A;  3TFT A;  2R5C A;  5EUE A;  4ZDL A;  1DFO A;  2E54 A;  5G4J A;  4OCA A;  4JF1 A;  1GC4 A;  2W7H A;  3DXV A;  1WKH A;  3BV0 A;  3BWO A;  1SZS A;  3IF2 A;  3KE3 A;  3WX9 A;  4WYG A;  4A0H A;  3AAT A;  3DRD A;  1N31 A;  3PGY A;  4K05 A;  2VMP A;  1CQ7 A;  5F8V A;  4WXB A;  3TCM A;  1CL2 A;  2OGA A;  2OQX A;  2CTZ A;  2DOU A;  1WYU A;  3AEM A;  4M2J A;  5I92 A;  1H1C A;  3LY1 A;  2DGM A;  1C0N A;  4F5K A;  3GZD A;  1ASN A;  4TMR A;  2Z61 A;  4IW7 A;  3W1H A;  4OC9 A;  4Y0H A;  4AO9 A;  2W7M A;  4ZLV A;  3PA9 A;  1JS6 A; 
#chains in the Genus database with same CATH homology
 2QLR A;  1ASE A;  3WZF A;  1W7M A;  3RI6 A;  4TN4 A;  1IX7 A;  1OHV A;  1G4X A;  4LNL A;  1ASC A;  1UKJ A;  3A2B A;  1IJI A;  1RVY A;  1LW4 A;  2O0R A;  1FC4 A;  2D61 A;  3AEJ C;  1AAW A;  3EZS A;  3FFH A;  3WKS A;  3ACZ A;  1N2T A;  3KKI A;  3FVS A;  1C9C A;  3NNK A;  4DQ6 A;  2AY9 A;  2VGW A;  1AY8 A;  4ADE A;  3HQT A;  3JWA A;  2DR1 A;  1GCK A;  3WLX A;  3H7F A;  7AAT A;  1O62 A;  1YNU A;  4ZAH A;  1DGD A;  4GEB A;  4K2M A;  3ELE A;  3NYU A;  2AEU A;  2ZSM A;  2AY8 A;  3QHX A;  3ISL A;  2HUF A;  4KAM A;  3DR4 A;  1BQA A;  3ZRQ A;  3D6K A;  4KYO A;  1GC2 A;  3DU4 A;  4MQR A;  2X3L A;  1IAY A;  1QJ3 A;  3FFR A;  4XEW A;  4ATQ A;  2VMX A;  2CAN A;  1UU2 A;  4WBT A;  4ITG A;  3CQ6 A;  3LWS A;  4WLH A;  2BI3 A;  2EH6 A;  4WYF A;  3CBF A;  4JEZ A;  1E5E A;  1KMJ A;  2VMV A;  4CXR A;  4JEY A;  4AZK A;  3A8U X;  4ZM3 A;  4MKK A;  1AMR A;  2VMT A;  3DXW A;  3B46 A;  1GC3 A;  1IBJ A;  2DKJ A;  4W1W A;  1MAQ A;  4CXQ A;  3ECD A;  3HBX A;  3AEM C;  2VIB A;  4Q76 A;  2GMS A;  2FNU A;  2R5E A;  4Q6R A;  4XJM A;  1KL1 A;  3II0 A;  2W7I A;  3BWN A;  3WY7 A;  3FDB A;  1QIR A;  1AMQ A;  1GDE A;  3DYD A;  3FD0 A;  3GET A;  2Z1Z A;  1MGV A;  5FT8 A;  3N4R A;  1IUG A;  4MSO A;  4A6U A;  2VI9 A;  2V0Y A;  2VMQ A;  2DGL A;  4W8I A;  1J32 A;  3AEP A;  3OKS A;  3AEJ A;  3EUC A;  4BQ0 A;  3KGX A;  1TOJ A;  4K2B A;  4MY5 A;  2AY2 A;  4F5L A;  5IWQ A;  2ZY3 A;  4N0B A;  4GE4 A;  2CJD A;  4K2I A;  2W8J A;  1AIA A;  3OP7 A;  4KXK A;  5HHY A;  5J8Q A;  4WXG A;  4FFC A;  1RVU A;  2W7D A;  5HDM A;  4GRX A;  3PDB B;  2EGY A;  1DTY A;  2PO3 A;  3VK2 A;  4O6Z A;  1LW5 A;  3FKD A;  3FDD A;  2GMU A;  2NMP A;  4JF0 A;  3GZC A;  3LVM A;  4AO4 A;  2JJG A;  3ZZJ A;  3DC1 A;  1MDZ A;  4Y0I A;  4WB0 A;  4RJ0 A;  4W5K A;  1CZC A;  4ATP A;  1O69 A;  3NUI A;  1AIB A;  4JEX A;  2X5F A;  3JWB A;  4GE7 A;  1RV3 A;  3BS8 A;  2YOB A;  3DZZ A;  1KKP A;  4A72 A;  1AHY A;  4BHD A;  2E7I A;  3HVY A;  2ZJG A;  2VLH A;  3BC8 A;  4XK1 A;  4RKC A;  2CH2 A;  3B1D A;  1G7W A;  1AY5 A;  3EIA A;  3N0L A;  3MC6 C;  3FQA A;  1V2E A;  3RBF A;  1W3U A;  3NYT A;  3BN1 A;  4UHM A;  3T32 A;  4LNM A;  2WB6 A;  2VMY A;  3PPL A;  1BJW A;  1W7N A;  4EMY A;  4ADD A;  3E9K A;  1T3I A;  3A9Y A;  5EAA A;  3LV2 A;  1C4K A;  3PDX A;  2C7T A;  3MKJ A;  1AKC A;  2HUI A;  4RLG A;  3AEN A;  3LVL B;  4W1X A;  2C0R A;  3RCH A;  2ZUK A;  2ZSL A;  4IYO A;  4R5F A;  1M0P A;  1C7G A;  5M49 A;  3DR7 A;  1V72 A;  2GSA A;  2ZYJ A;  3ZRP A;  3F0H A;  3WCN A;  2PB0 A;  3F6T A;  3G0T A;  4A0F A;  1ELU A;  2D5Y A;  4U1T A;  4GE9 A;  3WGC A;  4PFN A;  2CFB A;  2FQ6 A;  1E5F A;  5DX5 A;  1M0N A;  4H51 A;  2O1B A;  2VGU A;  2OKJ A;  3FZ6 A;  1FG7 A;  2EYQ A;  4R5Z A;  1ECX A;  3FZ7 A;  4F5M A;  4ZAS A;  1AJS A;  2CIN A;  3MAD A;  1EJI A;  1VJO A;  2BI1 A;  2O7C A;  4UHN A;  2CJH A;  3K7Y A;  4JEV A;  2ORD A;  2V1P A;  3ZZK A;  4Y0D A;  4UOY A;  3NRA A;  2Z67 A;  2WK8 A;  5G2P A;  1AKA A;  2HOX A;  4ZWM A;  1AJS B;  2ZP7 A;  3PD6 A;  1FG3 A;  3VK4 A;  1CQ8 A;  3FCR A;  1QIT A;  1JS3 A;  2Z9X A;  1YJS A;  1TAS A;  1U08 A;  3QI6 A;  2YCN A;  1OAT A;  3COG A;  1CJ0 A;  2Z9V A;  1YIZ A;  1TOI A;  4F5I A;  3HDO A;  3N4S A;  4GSA A;  3NU8 A;  2BWO A;  1B4X A;  5EUD A;  5G0A A;  1SVV A;  4RAE A;  1N8P A;  4F5F A;  3R9A A;  2AY5 A;  3F9T A;  1WYV A;  3RBL A;  3EI9 A;  2QB2 A;  1IVR A;  1ASF A;  4CBS A;  1V2F A;  4U2H A;  4HF8 A;  1MDX A;  4ISY A;  3WKR A;  1KMK A;  4E1O A;  2BWP A;  1GEY A;  2E7U A;  3E77 A;  1PMO A;  1ASM A;  2C44 A;  3HLM A;  1JG8 A;  3QGU A;  4PIW A;  3K28 A;  2FYF A;  4MGR A;  3P1T A;  1OXO A;  3ASB A;  1O4S A;  8AAT A;  1TAR A;  1LC5 A;  4FL0 A;  2D63 A;  2YKY A;  1ARS A;  1BQD A;  1MAP A;  1RV4 A;  4J8L A;  4I8A A;  1ORD A;  2Z20 A;  3ATH A;  4LW4 A;  3K40 A;  4LNJ A;  1DJU A;  1LC7 A;  1OXP A;  4A0G A;  1ELQ A;  1B9H A;  1WKG A;  3AEN B;  4XJL A;  2AY7 A;  5HXX A;  4ADC A;  1XI9 A;  3EZ1 A;  3FQ7 A;  2W8V A;  3MAF B;  3NTJ A;  3MBB A;  4WB0 B;  3G7Q A;  1ASB A;  1DGE A;  4OYT A;  1GEX A;  3E2Z B;  1X29 A;  2BYL A;  1D7U A;  3AEL A;  3GBX A;  2Z9W A;  4XAU A;  3W1J A;  3PDB A;  3AOV A;  4ZSW A;  3JU7 A;  3ASA A;  4M2M A;  3UAK A;  1V2D A;  2HZP A;  2R0T A;  1LKC A;  1CQ6 A;  3FVX A;  1BJO A;  3LG0 A;  4MQP A;  4OTL A;  1C7N A;  1YIY A;  2W7K A;  2EO5 A;  4ZWV A;  3E2Y A;  2QA3 A;  3FZ8 A;  1ARH A;  3FSL A;  2QSR A;  2YCP A;  1WYT B;  1MDO A;  2YRR A;  4BA5 A;  3BCA A;  3CQ4 A;  2JJH A;  3EI7 A;  3RQ1 A;  2AY6 A;  2R2N A;  5EIG A;  1KKJ A;  3QN6 A;  2YKX A;  1MLZ A;  5M4B A;  3GSB A;  1SF2 A;  1J04 A;  3VAX A;  1G7X A;  1S08 A;  4P7Y A;  1ART A;  2FKI A;  5F9S A;  4GDY A;  2CH1 A;  2JG2 A;  2VIA A;  5FT5 A;  5K8B A;  3PAA A;  1AHX A;  3N7N A;  4F5J A;  3FTB A;  4RIZ A;  2AY3 A;  5EUN A;  1CZE A;  4W1V A;  5EAV A;  4JE5 D;  3A9X A;  1AMS A;  1TOE A;  1LK9 A;  2HOY A;  3AOW A;  1IX8 A;  2W7J A;  4WYC A;  1X0M A;  3N5M A;  2BYJ A;  2DKB A;  1BJ4 A;  2Z1Y A;  3QBO A;  2OGE A;  1G4V A;  1TPL A;  1DJE A;  4ADB A;  4BA4 A;  1SPA A;  4Q75 A;  2YKV A;  1TAT A;  2BIG A;  1BJN A;  2E7J A;  4F5H A;  1VP4 A;  2W8U A;  4MKJ A;  3H9X A;  1D7S A;  2JJF A;  2BIA A;  1IAX A;  3UWC A;  4A6R A;  2WK9 A;  1S09 A;  1DJ9 A;  3EI6 A;  4M2K A;  5FT4 A;  3NYS A;  1S06 A;  4OBV A;  1GD9 A;  4J5U A;  4RM1 A;  3W1I A;  4A0R A;  3R4T A;  3WGB A;  3WCO A;  5D95 A;  5E3K A;  5FT6 A;  4B9B A;  2C81 A;  2EZ1 A;  4H63 Q;  3JW9 A;  3AEO A;  1AKB A;  3B8X A;  1MLY A;  4L0O A;  4OT8 A;  1TOK A;  5DB5 A;  3G8M A;  1AHF A;  1I29 A;  1JF9 A;  3MEB A;  3NX3 A;  1TOG A;  3CQ5 A;  2CJG A;  9AAT A;  2AEV A;  2AY4 A;  5LHA A;  1M0Q A;  2W7G A;  3VK3 A;  4WP0 A;  2AY1 A;  1VEF A;  1YJZ A;  4EB7 A;  2HOR A;  4RKD A;  3UE8 A;  1S0A A;  5BJ4 A;  3MAU A;  4OBU A;  5M46 A;  3EIB A;  4XQ2 A;  1YAA A;  3LVJ A;  3QPG A;  2G7J A;  1OHW A;  1AJR A;  4N0W A;  4TV7 A;  2HOZ A;  1DKA A;  2BKW A;  4R8D A;  1XEY A;  2D65 A;  1IX6 A;  1D7R A;  3PJ0 A;  1C7O A;  3USF A;  4A6T A;  4QGR A;  4CVQ A;  4F5G A;  5C6U A;  4UQV A;  2A1V A;  1B9I A;  1WYT A;  1S07 A;  1M6S A;  2Q7W A;  3LVK A;  1EG5 A;  2D66 A;  3DOD A;  3EI5 A;  1ASL A;  4XJO A;  3TQX A;  2BI2 A;  2JIS A;  3N4X A;  1GEW A;  3TAT A;  2VMR A;  2YHK A;  3RUY A;  1BJO B;  2BI9 A;  1AIC A;  4PFF A;  5AX8 A;  4EFF A;  3MC6 A;  1M4N A;  3CAI A;  1YJY A;  2VI8 A;  4WYE A;  4ZSY A;  5G2Q A;  5TF5 A;  2HUU A;  3TFU A;  2VGT A;  3Q8N A;  2BI5 A;  1ASG A;  1I48 A;  5EIG B;  4IY7 A;  1D2F A;  2YRI A;  1AMA A;  3E2Z A;  2VLF A;  5M4D A;  3JZL A;  3BCX A;  2CB1 A;  3MAF A;  1KL2 A;  3M5U A;  2TPL A;  3HL2 A;  1Z3Z A;  2VGV A;  1W23 A;  1WYU B;  1CS1 A;  3FQ8 A;  3KGW A;  4IXS A;  5D5S A;  2ZC0 A;  1UU1 A;  1AAM A;  1LS3 A;  2WK7 A;  2XH1 A;  3FRK A;  4JEW A;  1ZOD A;  4OMA A;  2PB2 A;  4W91 A;  4DBC A;  1SZK A;  1BKG A;  4RJY A;  1CL1 A;  2KFP A;  1AHG A;  3QM2 A;  4F4E A;  2ZY5 A;  2R5C B;  2FN6 A;  2VMU A;  1B5P A;  4Q31 A;  2GB3 A;  2WKA A;  1BS0 A;  2VMW A;  3NUB A;  1AHE A;  3I4J A;  4ZDP A;  1SZU A;  1ARI A;  4UHO A;  2QBT A;  4LC3 A;  1YOO A;  1PG8 A;  2VGZ A;  2OAT A;  3BWN C;  1QZ9 A;  2HP2 A;  2W8W A;  1BW0 A;  2AAT A;  2W7L A;  4IX8 A;  5EQC A;  2BHX A;  2XBN A;  1M32 A;  4WYD A;  4AOA A;  1OHY A;  1EQB A;  2RFV A;  4E3R A;  1UU0 A;  2CY8 A;  2W7F A;  4WYA A;  1H0C A;  4NOG A;  1I41 A;  3PIU A;  1W7L A;  4E77 A;  3GJU A;  3FVU A;  3N75 A;  5DJ1 A;  5EFS A;  5JAY A;  4WLJ A;  1QJ5 A;  3E2F A;  3VP6 A;  2JJE A;  1M7Y A;  3ELP A;  3A9Z A;  4CBR A;  3BB8 A;  1WYV B;  3P6K A;  3GZD C;  2VMS A;  1O61 A;  3IHJ A;  3HT4 A;  3I16 A;  2X5D A;  1AX4 A;  2F8J A;  1ASA A;  1B8G A;  4P3M A;  2G6W A;  2OKK A;  2EZ2 A;  2VYC A;  3NDN A;  5E4Z A;  3B1E A;  5G4I A;  3AV7 A;  5LH9 A;  1I43 A;  1QIS A;  2W7E A;  2EPJ A;  1GBN A;  3GWP A;  4R2N A;  4E3Q A;  4HVK A;  3JTX A;  4XJP A;  5G09 A;  4DGT A;  1ZC9 A;  2QB3 A;  2YKU A;  2GQN A;  3E6G A;  1SFF A;  4AZJ A;  2CST A;  4WD2 A;  5DJ9 A;  3VOM A;  3BCB A;  3PD6 B;  1M0O A;  3NU7 A;  4B98 A;  2VMZ A;  2BIE A;  2ZY4 A;  1LC8 A;  1X28 A;  1ZOB A;  4EU1 A;  2DGK A;  2VGS A;  2W8T A;  3ZRR A;  2YCT A;  2ZY2 A;  4IYO B;  1BT4 A;  2VMO A;  1ARG A;  4BMK A;  2BWN A;  1X2A A;  1P3W A;  5KTB A;  5E5I A;  4AH3 A;  4MQQ A;  1Y4I A;  4ZDO A;  1D7V A;  1PMM A;  1PFF A;  2JGT A;  2X8U A;  3L8A A;  4PVF A;  1QGN A;  4A00 A;  2D64 A;  1GC0 A;  5BJ3 A;  4RIT A;  3L44 A;  4EB5 A;  2VMN A;  2D7Z A;  4IXO A;  2FM1 A;  2Z9U A;  3B1C A;  4LW2 A;  2D7Y A;  2FNI A;  3GR9 A;  3HMU A;  1AY4 A;  2HP1 A;  4IXZ A;  1B5O A;  1Z7D A;  3H14 A;  4ZM4 A;  2QMA A;  1ASD A;  3RCH B;  1WST A;  3EI8 A;  3I5T A;  4ITX A;  4WXF A;  4JE5 A;  3TFT A;  2R5C A;  5EUE A;  4ZDL A;  1DFO A;  2E54 A;  5G4J A;  4OCA A;  4JF1 A;  1GC4 A;  2W7H A;  3DXV A;  1WKH A;  3BV0 A;  3BWO A;  1SZS A;  3IF2 A;  3KE3 A;  3WX9 A;  4WYG A;  4A0H A;  3AAT A;  3DRD A;  1N31 A;  3PGY A;  4K05 A;  2VMP A;  1CQ7 A;  5F8V A;  4WXB A;  3TCM A;  1CL2 A;  2OGA A;  2OQX A;  2CTZ A;  2DOU A;  1WYU A;  3AEM A;  4M2J A;  5I92 A;  1H1C A;  3LY1 A;  2DGM A;  1C0N A;  4F5K A;  3GZD A;  1ASN A;  4TMR A;  2Z61 A;  4IW7 A;  3W1H A;  4OC9 A;  4Y0H A;  4AO9 A;  2W7M A;  4ZLV A;  3PA9 A;  1JS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...