1DJCA

Structure of beta-lactamase precursor, s70a mutant, at 120k
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 91
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djcA00
4R3JA 3LO7A 4FH4A 1NRFA 1FSWA 3TSGA 1IKIA 1QMFA 1TDLA 1WE4A 3G35A 2X01A 1K6RA 5CECA 1IYQA 5GHZA 1I2WA 3LCEA 3MZEA 3W8KA 1DJBA 3A3IA 4EBLA 4GN2A 2XGNA 3A3EA 3A3JA 4YINA 1ZG6A 3C7UA 1K55C 3BFGA 3Q7ZA 4KQOA 1S6RA 2XD5A 4P6BA 1KVLA 2Q9MA 1L0GA 4F94A 4U3TA 2Z2MB 3WS5A 1BSGA 4OLDA 5CHMA 5FQMA 1ERQA 3UPPA 5FI7A 4OPRA 1E4DA 3IH8A 3HLFA 4OPZA 4BLMA 2ZM2A 4EQIA 3S4XA 3LY3A 4PMAA 1MWRA 4OKPA 4DDYA 3ZFZA 3MFDA 1NYMA 4PM8A 1PYYA 4JBFA 5CGSA 4KZ9A 5FQQA 2H10A 3Q07A 3W4OA 1L0FA 3ZG0A 3D4FA 4U0TA 3OPHA 5J8XA 1FCNA 4OOLA 3FV7A 3E2LA 5FASA 4KZ7A 3WS4A 4DXBA 3ZCZA 2XLNA 2ZM8A 2P9VA 4R1GA 3HLDA 2ZC6B 4YFMA 2ZC5B 1L0EA 3BECA 3IF6C 5GHXA 1DJAA 1LL9A 2Y2KA 3BLMA 4OQIA 2ZQ9A 5EVIA 5GLCA 2EXBA 1PW8A 5FSRA 1S0WA 3WWXA 1XXMA 3FKWA 1NY0A 2ZJ9A 3OCNA 1ESIA 3QHYA 4WYYA 4X69A 1G68A 2EX9A 2DRWA 1H8YA 2OLUA 5KSCA 5HX9A 1FSYA 3O3VA 1HVBA 4QHCA 5KZHA 4KG6A 4LCLA 2XQZA 2ZQAA 2ZD8A 1YLZA 4P85A 3SOIA 1JWPA 5DF9A 1VQQA 1LI9A 5CRFA 4S2OA 3N4IA 1L2SA 5JYPA 1BLCA 4BL3A 1W5DA 1IYOA 1JTDA 3IXGA 4QY5A 4S2PA 1M6KA 4LENA 4UA9A 2RL3A 4KQQA 1YM1A 4M3KA 1MWSA 3GRJA 1YQSA 3PAEA 1RGYA 5JYOA 1OMEA 5HFOA 2GDNA 4EBNA 3IF6B 4E3IA 2HPBA 4GD6A 3S1YA 2B5RA 2WGWB 2Y2IA 3IWOA 5DTTA 3VSLA 4JLFA 2WADA 3BFCA 3ZNTA 1HZOA 4FH2A 2WGVA 3RXWA 2JBFA 1NJ4A 3GR2A 3ZNYA 4Y0UA 4ZJ1A 3OZHA 4UA6A 4RX3A 1O07A 4DE0A 4E3LA 4OPQA 2WKEA 3ZVWA 5A90A 1NXYA 1BTLA 5EUAA 4BD1A 2EFXA 4PPRA 5CTMA 4PM5A 3WS1A 4S2IA 3G34A 3GMWA 2ZM0A 1BLHA 1W7FA 1M40A 3A3DA 3M2JA 1FOFA 3MXSA 3QNBA 4XUXA 3Q7VA 3V5MA 1LHYA 4MBHA 2ZMAA 4B88A 5DF7A 5I94A 4JF5A 2J8YA 5F83A 3NCKA 5A92A 3HL9A 5M18A 3MBZA 4XUZA 3E2KA 3SH8A 3SS4A 1XX2A 5HAIA 4JPMA 1AXBA 2XH9A 3W4PA 5F1FA 1KGGA 4E3JA 1XGJA 4JXGA 4LV1A 3SS3A 4WEJA 2IWDA 5GLDA 1H5XA 4DE2A 5DTKA 4LV3A 5EVIC 4ZJ3A 4K91A 4DE1A 1BLSA 3BFFA 2V2FF 3DW0A 3EQUA 1GHPA 4QJGA 4P0MA 5EECA 3ZDJA 2Q9NA 2PU2A 4IBXA 1SDEA 2XK1A 2ZQDA 4S2MA 1FR1A 5AQ9A 4JXWA 2QMIA 2Y2PA 3O86A 5CGXA 4E6WA 5G18A 3BRMA 3WS2A 1IYSA 1N4OA 4MLLA 1MWUA 1BZAA 3P98A 1ERMA 1ES5A 1ESUA 3DWZA 1GHIA 5CXWA 1VM1A 3UDFA 3G4PA 2FFFB 3V3RA 4DE3A 3GQZA 4D2OA 3N8RA 2EX2A 4NK3A 1CEFA 2WUQA 4MNRA 2Y55A 2WZZA 5CERA 4N9LA 4WZ5C 4OVDA 4MEZA 2XF3A 3IF5A 4PM9A 4Y0TA 2XFTA 3NC8A 4RYEA 1N9BA 5A91A 1ZC2A 1IYPA 2HDUA 5AQAA 2E8IA 2J7VA 4RVAA 2DNSA 3C4OA 4BENA 4OLGA 2X71A 4K0XA 1FCOA 5EOOA 1TVFA 4RX2A 4GB7A 4L0LA 4QB8A 4GKUA 1HTZA 4S2NA 4OQGA 1CI8A 4GZBA 3IXDA 1KE4A 2Y2LA 5CGWA 3AGDA 3PBSA 1ONGA 3W4QA 3ITBA 3TOIA 1K56D 4PM6A 4FSFA 2JC7A 2WYXA 3VP1A 5D3OA 5HAQA 5FATA 4ID4A 3SH9A 3HREA 2UWXA 1GCEA 2OLVA 5TR7A 4KG2A 1I2SA 4B4ZA 3CJMA 4P87A 3LEZA 4HEFA 4OOMA 2IWCA 1K57A 4DXCA 1K6SA 3ZG5A 1IKGA 5EE8A 1SHVA 5DTSA 2XFSA 3O88A 4NETA 1K54A 1XP4A 4WMCD 3GVBA 3BFEA 3CZDA 3IXBA 4E6XA 1RGZA 3ITAA 1EWZA 1PI5A 1YMXA 3BFDA 3UE3A 4MBKA 4WBGA 4S2LA 3HBRA 3VFFA 3Q1FA 3A3FA 3P09A 1MPLA 4U0XA 2QZ6A 1JTGA 1O7EA 3BLSA 3RJUA 4WMCA 3V3SA 5A93A 2OSUA 3CMZA 4LCMA 1MKIA 4WM9A 1JWVA 2EX6A 4QY6A 2XEPA 4KZBA 1PWGA 4QU3A 4WEKA 3NI9A 3PBNA 1KVMA 1PIOA 2BLSA 2I72A 3FZCA 4KG5A 4A5RA 5CTNA 1YLYA 2VGJA 3G31A 3ZGAB 1KGEA 1NZUA 4QD4A 1MY8A 4KENB 1YT4A 5CEDA 5U47A 4IEDA 2H0TA 3C4PA 3N8LA 1PI4A 2Y59A 4DDSA 3MXRA 5FAPA 3IHBA 3AGFA 1LL5A 1W8QA 4ZAMA 2EFUA 5DVAA 3BEBA 3GTCA 4R23A 1YLJA 1IEMA 3M2KA 1Z6FA 3HLEA 4LV0A 4E3MA 4JKTA 3DTMA 3UE0A 3PBTA 1H8ZA 3M6BA 1G6AA 4S2NC 3QNCA 4HBUA 4DRTA 5CEBA 5FI6A 4GDBA 1L0DA 4ZTKA 5DF8A 4JXVA 3HUOA 3IWQA 5FQ9A 1HD8A 3G2ZA 3OPLA 3UNWA 3WS0A 2Y2HA 4KZ5A 3UPOA 1SCWA 1ALQA 1MBLA 3PBRA 4UHUA 2ZC3B 1JWZA 1ZKJA 1KDSA 3MZDA 3NIAA 4C75A 5E43A 5FA7A 1K25A 1FQGA 3FWLA 1GA0A 1WYCA 4KQRA 5F1GA 2G2UA 1FCMA 3PAGA 4CJNA 1GA9A 4E3OA 5CHJA 2JE5A 3NY4A 5E2EA 4PM7A 2DCFA 3IF6A 4JF6A 3PTEA 2WGWA 1DY6A 3C7VA 5GL9A 2R9WA 1RCJA 3WRTA 4X55A 1E3UD 2RCXA 4X53A 5FDHA 3VFHA 4BD0A 4O7DA 3N6IA 5CHUA 4DF6A 3TG9A 2WZXA 1YLWA 1KE0A 4BJPA 3VOZA 3CG5A 2JCHA 3ZG7B 3AGEA 1PZPA 3LY4A 4Q8IA 1IELA 1XKZA 1CK3A 2P9VB 3OCLA 3V39A 1EROA 1SKFA 2P74A 3IHAA 1ZG4A 2EXAA 1U60A 2Y2QA 3NBLA 5M1AA 2ZQ8A 3UO9A 2EX8A 5FQIA 4BL2A 4ZDXA 1PW1A 4EWFA 1JVJA 1GHMA 4Y7PA 5EVIB 3S22A 1ES4A 1CEGA 2HP6A 4OQ0A 2ZC7A 1MWTA 5GLBA 4ZBEA 1TEMA 4JXSA 4RA7A 3WRZA 4CPKA 2PBYA 1ONHA 3VMAA 3OPRA 1XA1A 3ZG8B 4UAAA 2V20A 4X56A 2WAEA 2Y2GA 5HL1A 5KMWA 5HAPA 3UY6A 3NDGA 3OC2A 3HLGA 2BG1A 3IH9A 1KGFA 4R4SA 5E2HA 4EUZA 1MXOA 1WYBA 4K0WA 3BM6A 5HARA 3HVFA 3MKEA 3HLWA 3HLBA 3MKFA 4E3KA 1K56A 1SDNA 4R3BA 5E2GA 5F82A 1I5QA 3O87A 3M6HA 2WAFA 4R0QA 2OV5A 2X02A 3SS5A 5HW3A 2Y91A 5EPHA 1YLPA 2Z2LB 2XR0A 5EVID 2H0YA 2J9OA 2ZC4B 2C6WB 1RP5A 2Y2OA 4GOGA 2HDSA 5FI2A 4MBFA 5GLAA 3ZHHA 5BOHA 1BULA 2J9PA 2Y2MA 4LV2A 1XA7A 1J9MA 3ZVTA 5IHVA 4UA7A 4XXRA 1XPBA 1K4FA 2WKIA 3IQAA 3PBOA 5AQBA 3RXXA 4N9KA 1CI9A 1W8YA 2A49A 4GD8A 2C5WB 4B4XA 3VSKA 2CC1A 3VP3A 3MZFA 4BQMA 3ZG9B 3GSGA 1K4EA 5L2FA 1FR6A 1LLBA 3Q7VB 4N92A 3UDXA 5TFQA 5FAQA 4C3QA 5M19A 2HDRA 4OONA 2FFYA 3HUMA 3OPPA 5FQJA 3V50A 1EI5A 5EVLA 3N7WA 1ES2A 1K38A 4N1HA 5AQ7A 3UN7A 1PZOA 4WZ4A 5KSHA 2ZQ7A 3VP0A 1BT5A 3C5AA 1KE3A 2Y2JA 2H5SA 2HP5A 1K55A 4JF4A 4OQHA 4WZ5A 4DKIA 3HLCA 3Q82A 3FYZA 4FD8A 1C3BA 2V1ZA 4N1XA 3DWKA 3ISGA 4GNUA 4OP8A 2HP9A 2XD1A 1TDGA 2HDQA 3NDEA 2Y2NA 3G2YA 1Q2PA 4X68A 4EV4A 4FCFA 4Z9QA 1DJCA 4ZJ2A 4S2KA 4KZ4A 3N8SA 1BLPA 4HBTA 2WGIA 2WK0A 1ES3A 5GHYA 3G32A 4WELA 3IT9A 1YLTA 1NZOA 1PWDA 3JYIA 4KZ8A 5FQKA 3SH7A 2A3UA 4GDNA 4IBRA 5TGFA 1K57C 3FKVA 4H8RA 1YMSA 4HESA 3B3XA 2QPNA 2IWBA 4OPYA 1K54C 2VGKA 2Y4AA 4Y0OA 3Q81A 3UDIA 2G2WA 4X6TA 2ZLYA 1BUEA 4KZ3A 2ZQCA 5FAOA 1W79A 1XGIA 3VOYA 1PWCA 2R9XA 5EOEA 4R4RA 1LI0A 3UE1A 1NYYA 4C6YA 1Q2QA 1KDWA 5E2FA 3BYDA 4IVIA 4KZ6A 4E3NA 1QMEA 1Y54A 4EBPA 4OP5A 3I7JA 4KZAA 3G30A 4IVKA 2XDMA 1E3UA 3UPNA 3IXHA 4OOYA 2WKHA 3GV9A 1E25A 3HUNA 4OH0A 2PU4A 3VP2A 3VP4A 3PBQA 3EQVA 4S2JA 3IWIA
chains in the Genus database with same CATH superfamily
3LO7A 4FH4A 1TDLA 3G35A 2X01A 1K6RA 1IYQA 3A3IA 5HL6A 1ZG6A 4G3KA 3C7UA 4KQOA 2W27A 4P6BA 1KVLA 4F94A 1L0GA 4U3TA 4F3LB 4OLDA 1ERQA 1TS6A 3LY3A 1MWRA 1NYMA 3ZG0A 5J8XA 2GZAA 4OOLA 4LRXC 2B95A 3FV7A 2XSSA 2GX5A 2ZMVA 4DXBA 3TE8A 2GJ3A 1G28A 3BECA 3IF6C 1DJAA 1LL9A 4OQIA 5FSRA 3WWXA 3FKWA 3OCNA 3QHYA 4WYYA 2EX9A 2DRWA 5KSCA 5HX9A 4LRZE 4QHCA 2VKSA 4LCLA 2W3FA 4P85A 3SOIA 1JWPA 4I39A 1VQQA 3T1XA 1LI9A 5CRFA 4S2OA 1BLCA 1W5DA 1JTDA 1YAXA 4KUOA 3H82A 4K08A 4I5SA 1MWSA 5HWVA 2OAQ1 2GDNA 4E3IA 2B5RA 2WGWB 3E4PA 3G6OA 4I38A 4JLFA 3BFCA 3ZNTA 1YKDA 5HPFA 3CPTB 3RXWA 3PR6A 5DKLA 2JBFA 4EU0A 5A90A 2WKEA 1NXYA 1BTLA 5EUAA 3ZYTA 4PM5A 5L10A 4XT2A 3MXSA 1M40A 3BQ8A 3LR0A 4R6LA 5DF7A 3CAXA 3S7QA 2ZBBA 4JF5A 3NCKA 5A92A 3HL9A 5M18A 4XUZA 3E2KA 3SS4A 5FEGA 3T1QB 2P7JA 4JXGA 3SS3A 4NXBA 1BLSA 3EQUA 1GHPA 3ZDJA 2XK1A 2J3TD 4E6WA 5G18A 1N4OA 3B33A 4MLLA 1XJ3A 1MWUA 4Q0IA 1VM1A 5EM1A 3N8RA 3UB8A 2WUQA 2Y55A 5CERA 4MEZA 2XFTA 3NC8A 4RYEA 2HDUA 2J7VA 4BENA 4OLGA 3A0SA 5FEFA 1ONGA 2WYXA 4X1LA 3LIEA 5HAQA 4NEED 2UWXA 4KG2A 4FUWA 3LEZA 1P0ZA 4HEFA 4OOMA 4DXCA 1K6SA 2W0NA 4O8GA 1RGZA 4ME4A 4ESPA 3BFDA 4F3LA 4Y17A 2A24B 1MPLA 1JTGA 1O7EA 3RJUA 4WMCA 1JWVA 1PWGA 4QU3A 3NI9A 1DRMA 3CHWP 1PIOA 2BLSA 3G31A 3P01A 4QD4A 1NLYA 3RFBA 3KSHA 4IEDA 2ZL1B 4QPRA 4EEPA 2Y59A 1LL5A 4L9FA 3GTCA 1YLJA 4E3MA 1VHMA 4KUKA 3UE0A 3PBTA 1G6AA 2PBDP 4S2NC 2OOLA 5CEBA 5FI6A 4ZTKA 4JXVA 3HUOA 5FQ9A 3G2ZA 3UNWA 4KZ5A 1ALQA 3CLOA 4II7A 1VETB 2ZC3B 1ZKJA 2PR5A 4R38A 3MZDA 3NIAA 3JVUA 2J80A 1WYCA 1XFQA 4E3OA 2WGWA 5GL9A 2R9WA 1E3UD 2K31A 4O7DA 3CPTA 3F1OB 5CHUA 2ZOIA 2XRNA 5HDCA 3VOZA 3OOVA 1PZPA 3LY4A 2E8JA 1XKZA 2XA7S 2HF6A 2G7UA 3NBLA 1JVJA 4FTXA 4Y7PA 2K2NA 1ES4A 2HP6A 4YOFA 5GLBA 1DP6A 3BY8A 3OPRA 3L9KA 4GLQA 2WAEA 4UEYA 3NDGA 2JKTM 3HLGA 3K3DA 1KGFA 4R4SA 5HZHA 1MXOA 3BM6A 3HVFA 3HLBA 1K56A 1PNEA 1I5QA 3PYPA 2OV5A 4M4XA 3LIBA 5HW3A 2Y91A 5EPHA 5DFYA 2V9AA 2ZC4B 2O9CA 2HDSA 2V1BA 3NOPC 3ZHHA 2JKRI 1XA7A 1S1YA 4UA7A 4XXRA 2UV0E 5IT5A 2WKIA 4N9KA 3U2AA 4GD8A 2C5WB 4DMZA 2VEAA 3T4SA 5M19A 2HDRA 2PD7A 2R78A 3OPPA 5EVLA 3UN7A 1ZTUA 1K55A 4OQHA 4Y5FA 1NLZA 2ZOHA 4N1XA 5HDDA 3DWKA 4OP8A 1V9ZA 2XD1A 2A24A 4KZ4A 1DP8A 3O5YA 3N8SA 1BLPA 1N9NA 3IT9A 1F98A 1PFLA 1NZOA 1PWDA 3SH7A 1YMSA 3IBJA 2XA7M 2QPNA 1K54C 2VGKA 2G2WA 4X6TA 2ZLYA 1BUEA 5FAOA 2ZQCA 3HJIA 1PWCA 3CUEC 1LI0A 2L0WA 1QMEA 1Y54A 2QJ7A 4P6ZS 4IVKA 5TBMB 4OOYA 1E25A 4G3VA 2PU4A 3VP2A 3PBQA 4LLOB 3EQVA 4S2JA 4CLCB 3IWIA 2PR6A 1VETA 1UGUA 5CECA 4EBLA 4GN2A 2J3WA 2XGNA 4YINA 3Q7ZA 2Q9MA 2Z2MB 1BSGA 3EWKA 3KYZA 5CHMA 3UPPA 2PHYA 5G4YA 5FI7A 4OPRA 4BLMA 2ZM2A 4EQIA 5J7EA 4OKPA 1TF1A 3F1OA 4JBFA 5I5LA 5FQQA 1L0FA 3D4FA 4U0TA 2KDKA 3OPHA 1FCNA 2KOIA 1OTBA 5FASA 4KZ7A 4YWZA 2XLNA 4HJ4A 4YFMA 2ZC5B 4H6JB 4O01A 4HH2A 2INWA 4O0PA 5GLCA 5LBRA 3A0RA 2ZJ9A 1G68A 2OLUA 1HVBA 1S4RA 1TD5A 3VV4A 3N4IA 1G5UA 1LL8A 4HIAA 4BL3A 3SZTA 1IYOA 4S2PA 4UA9A 1YM1A 1FILA 3SW1A 1YQSA 1P9WA 3PAEA 1RGYA 3MR0A 3IF6B 4GD6A 2Y2IA 4CQHA 5DJUA 1HZOA 2KX6A 4EESA 1NJ4A 1GSWA 4ZJ1A 2WKRA 4UA6A 4RX3A 4E3LA 2BTFP 4P6ZM 4BD1A 4PPRA 3F1PB 4HNBA 1W7FA 3NHQA 1LHYA 3LICA 1YSQA 4AFIA 5HAIA 2XH9A 3NECA 4LV1A 4WEJA 2Y79A 5DTKA 4LV3A 4ZJ3A 1PRQA 4QJGA 4P0MA 5EECA 4I3IA 2Q9NA 4IBXA 2ZQDA 3A0VA 3BRMA 2OAP1 2MJ6A 1OPXA 1ES5A 5HSQA 4Y3IA 5CXWA 2Z6CA 3D3OA 1NRJA 3V3RA 2EX2A 4MN5A 4Y0TA 5A91A 1ZC2A 3PXPA 2DNSA 3C4OA 2X71A 1FCOA 3IBRA 5EOOA 1OTDA 4RX2A 3LUQA 3NOTC 3K2NA 4GKUA 4GZBA 5CGWA 3AGDA 3NJAA 4R3AA 3ITBA 5TBMA 1K56D 4PM6A 4FSFA 5D3OA 5FATA 4ID4A 3SH9A 4CLCA 3HREA 1GCEA 4NXEA 1I2SA 4HY8A 3CJMA 3CI6A 5C5KA 3UE6A 2IWCA 1K57A 3MQ0A 2VX8A 3ZG5A 1JNUA 2V1AA 3CZDA 5HWTA 5HD3A 1EWZA 1STZA 1PI5A 1YMXA 4MBKA 4S2LA 3VFFA 3Q1FA 3A3FA 1V9YA 4U0XA 5A93A 3V3SA 1MC0A 3CMZA 1MKIA 4WM9A 2EX6A 4QY6A 1KVMA 2NUPC 2I72A 5CTNA 1YLYA 3ZGAB 3UB9A 2EWVA 5CEDA 5U47A 1S67L 3N8LA 4H6JA 2Y8HA 4DDSA 2PT7A 3AGFA 4ZAMA 3C2WA 2B02A 3BEBA 1Z6FA 3HLEA 4JKTA 4EUVA 1DP9A 2W3DA 3CWFA 3OPLA 1T1CA 3T1SA 4UHUA 4YNRA 2O0YA 3MSHA 5E43A 1SKOB 5FA7A 1XJ6A 1K25A 5J4EA 1FQGA 1TS0A 4CJNA 1GA9A 3D72A 5CHJA 4PM7A 3IF6A 2NUTC 3QP4A 2VK3A 3N6IA 4DF6A 3KSIA 4D60A 4MN6A 4BJPA 2JCHA 3ZG7B 3AGEA 3F1PA 3BJNA 1CK3A 1EROA 2P74A 1ZG4A 1H3QA 5M1AA 1XJ4A 4EWFA 3QP8A 1GHMA 5EVIB 3MS6A 2HGVA 4OQ0A 2ZC7A 3LIAA 1MWTA 4I3JA 4ZBEA 4RA7A 1ONHA 1GSVA 4Z1WA 2VA0A 3VMAA 1H0MA 3QP6A 4X56A 5HL1A 1CF0A 3OC2A 5F6AA 3FPWA 1WYBA 5HARA 4R3BA 3O87A 2WAFA 3DTIA 3VE3A 2X02A 4PKYG 3U4LP 2H0YA 2J9OA 3FG8A 2C6WB 4UQIS 3LFVA 2J9PA 2Y2MA 1J9MA 1OTIA 2M1CA 3PBOA 2A49A 3ICYA 3BQAA 2CC1A 4CLCE 5TJJA 1FR6A 1LLBA 4N92A 4B9OA 3UDXA 4X1MA 3N7WA 4GHIB 3UMEA 1K38A 2PDRA 2VLGA 3C5AA 2Y2JA 4GS9B 5DKKA 3Q82A 4FD8A 1C3BA 2V1ZA 2H28A 4PAUA 2HP9A 4ARZB 2Y2NA 3G2YA 4FCFA 4ZJ2A 1F2KA 3L7HA 5J3WA 1ES3A 2JN7A 3P7NA 1YLTA 3DAVA 1S1ZA 4GDNA 2HJ9C 4H8RA 4HESA 3B3XA 5KIZA 2IWBA 1Y4OA 2A2LA 2PD8A 2PAVP 1W79A 4HP9A 3F1NB 3UE1A 4C6YA 3BYDA 4IVIA 4OP5A 3I7JA 4KZAA 2XDMA 3UPNA 2WKHA 3HUNA 3RH8B 1VEUB 4R3JA 1NRFA 1VB6A 1WE4A 2HJEA 1SKOA 5GHZA 1I2WA 3MZEA 3W8KA 1IFQA 3A3EA 4WN5A 3KSGA 1K55C 2P08A 3BFGA 1S6RA 2XD5A 4UQIM 3WS5A 5G4ZA 4HJ6A 3T4LA 4BBVA 1E4DA 1F9IA 3HLFA 4PMAA 4DDYA 3MFDA 4PM8A 3D9YA 3LR4A 3Q07A 3HJKA 1OT9A 3PHYA 2QJ5A 3E2LA 2ZM8A 5HWWA 2ZC6B 4NXGA 3MF0A 1L0EA 5GHXA 2Y2KA 5EVIA 1XJ2A 2ZQ9A 1NY0A 1ESIA 4X69A 4MCWA 4GCZA 5HPIA 4KG6A 2XQZA 1Z09A 2ZD8A 2ZQAA 3LI9A 1YLZA 3OBFA 1L2SA 1W63Q 4PHTA 3IXGA 4BWIA 4KQQA 2W3EA 5DFXA 4JGRA 2V0UA 5JYOA 3H7WB 1OMEA 5HFOA 4EBNA 2HPBA 3S1YA 3VSLA 2JHEA 4FH2A 2WGVA 3GR2A 4LFUA 1FIKA 4B93A 1O07A 4OPQA 2EFXA 5CTMA 3WS1A 4S2IA 3G34A 3GMWA 2ZM0A 1BLHA 1FOFA 1W63M 4MBHA 4B88A 2HZ5A 2ZL1A 5I94A 2J8YA 5F83A 4GHIA 5EVEA 1XX2A 4JPMA 3W4PA 5F1FA 4GS9A 1XGJA 4GW9A 5GLDA 3VE4A 4K91A 3BFFA 2V2FF 3CITA 3S7PA 2FH5A 4ARZA 4HQAA 4LRYC 2QMIA 5CGXA 3T12B 1AWIA 1WA9A 3UDFA 4DE3A 4HJ3A 4NK3A 1CEFA 5EV0A 3C30A 2WZZA 2JKGA 4WZ5C 2XF3A 3IF5A 4PM9A 1N9BA 3LYXA 5L8MA 3EOIA 1TVFA 1G6OA 4GB7A 1CJFA 4L0LA 1HTZA 3F1NA 2QYBA 3IXDA 1KE4A 3T1RA 3EEAA 3PBSA 4KQDA 2JC7A 2Z6DA 4L9GA 1VEUA 3R4KA 2OLVA 4P87A 1Y28A 4E04A 2K7SA 5EE8A 1SHVA 1BYWA 5DTSA 4NETA 1K54A 1XP4A 4WMCD 2OWHA 3GVBA 3IXBA 4E6XA 3ITAA 3HBRA 4ETXA 2QZ6A 2OSUA 1XFNA 2XEPA 1D06A 4KZBA 4WEKA 4NG2A 3C8CA 3FZCA 4KG5A 4WL9A 4JGOA 1YT4A 3R7WB 2H0TA 3W2ZA 3C4PA 1TS7A 1PI4A 3MXRA 5FAPA 3IHBA 2XROA 4MN7A 2ACGA 3BWLA 2EFUA 1IEMA 3M2KA 4LV0A 3DTMA 1ODVA 2IA2A 4DRTA 1L0DA 5DF8A 1HD8A 2Y2HA 2VV8A 3H9WA 3MJQA 2O99A 2JKRM 5FL3A 1KDSA 4CLCC 4C75A 2VV6A 3T4QA 3FWLA 4RQ9A 1GA0A 4G3WA 4KQRA 4X25A 5F1GA 4EETB 2G2UA 1FCMA 4FOFA 2O9BA 2JE5A 3H7WA 3NY4A 5E2EA 2DCFA 4LGWA 3WRTA 4X55A 2V8FA 3TG9A 2WZXA 2OWJA 1YLWA 3JPUA 1KE0A 4Q8IA 1S66L 2P9VB 3FPVA 3FC7A 3OCLA 2W3GA 3IHAA 3T4KA 4BL2A 5FQIA 1H8MA 1PW1A 1YPRA 3DTEA 3OLOA 1CEGA 1TEMA 3WRZA 4CPKA 2PBYA 3ZG8B 3S7NA 3ULFA 1EW0A 3UY6A 3VOLA 5E2HA 3NOUC 1LSVA 4EUZA 3B42A 4E3KA 3HLWA 1SDNA 2ZMFA 5F82A 4R0QA 3M6HA 3SS5A 4ZRRA 1YLPA 5EVID 3V67A 2YKHA 1N9OA 1RP5A 4GOGA 5GLAA 5BOHA 2W1RA 1BULA 4LV2A 3ZVTA 2EA9A 1XPBA 3IQAA 1ACFA 1CI9A 1W8YA 4HOIA 4B4XA 2WKQA 3EGDC 3BW6A 3Q7VB 4JGQA 4R70A 5FAQA 2FFYA 5FQJA 1PZOA 2PYPA 4WZ4A 3VP0A 2HP5A 4DKIA 3HLCA 3NULA 4GNUA 4GJ4A 3S7OA 3EEHA 1UWNX 2HDQA 3NDEA 1LSWA 4X68A 1HLUP 4EV4A 1DJCA 4S2KA 2P04A 1T1AA 2WGIA 3MQOA 5GHYA 1GSXA 4IBRA 3FKVA 5F5YA 4BBUA 3MQQA 3UDIA 3R7WA 2JKTI 1XGIA 5EOEA 1Q2QA 4EQ1A 3KX0X 2D02A 4KZ6A 4E3NA 1TS8A 4EBPA 3G30A 3KO6A 3T50A 1FSWA 3TSGA 1IKIA 1QMFA 1D7EA 3T4TA 3LCEA 1DJBA 3A3JA 1SZVA 5AJGA 3LEQA 3E0YA 5FQMA 3IH8A 4OPZA 2Q0OA 3GECA 3S4XA 3C38A 2O9AA 3ZFZA 1K0KA 1P97A 1PYYA 5CGSA 4KZ9A 2LB5A 1N9LA 2H10A 4WLAA 3W4OA 3RTYA 2M7VA 1UWPX 3WS4A 4WUJA 5F68A 3ZCZA 1J3WA 2P9VA 4R1GA 3HLDA 3LIDA 3IS2B 3BLMA 2EXBA 1S4SA 1PW8A 4JGPA 4HHDA 4EERA 1S0WA 1XXMA 1X0OA 1H8YA 1FSYA 5HD5A 3O3VA 5KZHA 3E98A 3ZQ5A 5DF9A 5JYPA 2CMNA 4QY5A 1M6KA 4LENA 1NWZA 2RL3A 4M3KA 3GRJA 2QWSA 3QP5A 2I9VA 5IU1A 5L07A 4L9EA 3KSFA 4I3AA 3IWOA 5DTTA 2WADA 1D1JA 3ZNYA 4Y0UA 3OZHA 4DE0A 3ZVWA 1OJ5A 1OTAA 3QNBA 3A3DA 3M2JA 2GNXA 4XUXA 2W1TB 3Q7VA 3V5MA 5CX7A 3BY9A 2ZMAA 4IHQA 3MMHA 4Y2FA 3MBZA 2VJWA 3SH8A 5K5BA 1AXBA 5L09A 1KGGA 4E3JA 2VZWA 2IWDA 3K3CA 4DJ3A 1H5XA 4DE2A 5EVIC 4NXFA 4DE1A 3DW0A 3T4JA 2PU2A 2VV7A 1SDEA 4S2MA 1FR1A 3QP1A 4JXWA 5AQ9A 2Y2PA 3O86A 2JKFA 3WS2A 1IYSA 3UMDA 3MFXA 1BZAA 3P98A 1ERMA 1ESUA 3DWZA 1GHIA 3UB6A 3G4PA 1L3LA 2FFFB 3GQZA 2V0WA 4D2OA 1MZUA 4MNRA 4N9LA 4OVDA 3LR5A 4EEUA 1IYPA 4DJ2A 2AVXA 5AQAA 2E8IA 4RVAA 2DMWA 4K0XA 1F5MA 3TW8A 3GDIA 2PRFA 4QB8A 4Y13A 4S2NA 4Q0HA 4OQGA 1CI8A 5DJTA 4CLCD 4NKPA 1T19A 2Y2LA 3W4QA 5AVEA 3TOIA 1YSPA 5IS1A 3VP1A 5TR7A 3DBAA 4IJGA 4B4ZA 3E4QA 2KLIA 2W3HA 1IKGA 2XFSA 3O88A 1T1BA 1OTEA 3BFEA 3LI8A 3UE3A 4WBGA 3JVVA 1LSXA 3P09A 3BLSA 2B18A 3TRCA 5EM0A 4LCMA 3PBNA 4A5RA 2VGJA 1KGEA 1NZUA 3QP2A 1MY8A 2L1MA 4KENB 2BASA 2J3TC 2PYRA 2L4RA 3EGXC 3IS2A 1W8QA 1CQAA 5DVAA 4R23A 1H8ZA 3M6BA 3QNCA 4HBUA 3IX3A 4GDBA 4DN0A 5MC7A 3IWQA 1P9RA 3WS0A 3UPOA 3KYEA 4IUKA 1SCWA 1MBLA 3PBRA 1JWZA 4WF0A 1LT0A 2WKPA 3PAGA 4HP4A 4JF6A 3PTEA 4HH3A 1DY6A 3C7VA 1RCJA 2RCXA 5FDHA 4X53A 3VFHA 4BD0A 4HI4A 1IOUA 3CG5A 1IELA 4BMWA 2W1TA 3V39A 4MMNA 1SKFA 2EXAA 1U60A 2Y2QA 2VGLS 2ZQ8A 2M7UA 3UO9A 2EX8A 4ZDXA 3HCYA 3S22A 3TJZC 3KYQA 4JXSA 2QKPA 4QWOA 1XA1A 4UAAA 2V20A 2Y2GA 2YKFA 5KMWA 5HAPA 4IUHA 4BBTA 2BG1A 3IH9A 2HV1A 3UB7A 3DTKA 4K0WA 3MKFA 3MKEA 5F69A 5E2GA 1OJGA 2QHKA 3LR3A 5AVFA 3H82B 5EFWA 2Z2LB 2XR0A 2Y2OA 5FI2A 1ZHHB 3CUEA 4MBFA 2V8CA 5IHVA 1K4FA 5AQBA 3RXXA 3MXQA 3B47A 3VSKA 3VP3A 3MZFA 4XT2B 4BQMA 4EW7A 3ZG9B 3GSGA 1K4EA 5L2FA 4EXOA 5TFQA 4C3QA 4OONA 3HUMA 3V50A 1EI5A 1ES2A 4N1HA 5KSHA 5AQ7A 2ZQ7A 1BT5A 1KE3A 4JF4A 1KOUA 2H5SA 4WZ5A 1T18A 1MKMA 3IX8A 3FYZA 3ISGA 4LPZA 3E4OA 4Q0JA 1TDGA 2FZ0A 1OT6A 3T4OA 1Q2PA 2D01A 4Z9QA 4HBTA 2WK0A 5A8BA 3G32A 4WELA 3JYIA 4KZ8A 5FQKA 5FDSA 2EWWA 2A3UA 5TGFA 1K57C 4OPYA 2Y4AA 4Y0OA 3Q81A 4MDZA 3LIFA 2VGLM 4KZ3A 4PKYA 3VOYA 2R9XA 4R4RA 4ETZA 3LGOA 5HDSA 1NYYA 1KDWA 5E2FA 1E3UA 3IXHA 4Y15A 3GV9A 4OH0A 3VP4A 3IX4A 2LB9A 1A0KA 3UB5P
chains in the Genus database with same CATH topology
4R3JA 3LO7A 4FH4A 1NRFA 1FSWA 3TSGA 1IKIA 1QMFA 1TDLA 1WE4A 3G35A 2X01A 1K6RA 5CECA 1IYQA 5GHZA 1I2WA 3LCEA 3MZEA 3W8KA 1DJBA 3A3IA 4EBLA 4GN2A 2XGNA 3A3EA 3A3JA 4YINA 1ZG6A 3C7UA 1K55C 3BFGA 3Q7ZA 4KQOA 1S6RA 2XD5A 4P6BA 1KVLA 2Q9MA 1L0GA 4F94A 4U3TA 2Z2MB 3WS5A 1BSGA 4OLDA 5CHMA 5FQMA 1ERQA 3UPPA 5FI7A 4OPRA 1E4DA 3IH8A 3HLFA 4OPZA 4BLMA 2ZM2A 4EQIA 3S4XA 3LY3A 4PMAA 1MWRA 4OKPA 4DDYA 3ZFZA 3MFDA 1NYMA 4PM8A 1PYYA 4JBFA 5CGSA 4KZ9A 5FQQA 2H10A 3Q07A 3W4OA 1L0FA 3ZG0A 3D4FA 4U0TA 3OPHA 5J8XA 1FCNA 4OOLA 3FV7A 3E2LA 5FASA 4KZ7A 3WS4A 4DXBA 3ZCZA 2XLNA 2ZM8A 2P9VA 4R1GA 3HLDA 2ZC6B 4YFMA 2ZC5B 1L0EA 3BECA 3IF6C 5GHXA 1DJAA 1LL9A 2Y2KA 3BLMA 4OQIA 2ZQ9A 5EVIA 5GLCA 2EXBA 1PW8A 5FSRA 1S0WA 3WWXA 1XXMA 3FKWA 1NY0A 2ZJ9A 3OCNA 1ESIA 3QHYA 4WYYA 4X69A 1G68A 2EX9A 2DRWA 1H8YA 2OLUA 5KSCA 5HX9A 1FSYA 3O3VA 1HVBA 4QHCA 5KZHA 4KG6A 4LCLA 2XQZA 2ZQAA 2ZD8A 1YLZA 4P85A 3SOIA 1JWPA 5DF9A 1VQQA 1LI9A 5CRFA 4S2OA 3N4IA 1L2SA 5JYPA 1BLCA 4BL3A 1W5DA 1IYOA 1JTDA 3IXGA 4QY5A 4S2PA 1M6KA 4LENA 4UA9A 2RL3A 4KQQA 1YM1A 4M3KA 1MWSA 3GRJA 1YQSA 3PAEA 1RGYA 5JYOA 1OMEA 5HFOA 2GDNA 4EBNA 3IF6B 4E3IA 2HPBA 4GD6A 3S1YA 2B5RA 2WGWB 2Y2IA 3IWOA 5DTTA 3VSLA 4JLFA 2WADA 3BFCA 3ZNTA 1HZOA 4FH2A 2WGVA 3RXWA 2JBFA 1NJ4A 3GR2A 3ZNYA 4Y0UA 4ZJ1A 3OZHA 4UA6A 4RX3A 1O07A 4DE0A 4E3LA 4OPQA 2WKEA 3ZVWA 5A90A 1NXYA 1BTLA 5EUAA 4BD1A 2EFXA 4PPRA 5CTMA 4PM5A 3WS1A 4S2IA 3G34A 3GMWA 2ZM0A 1BLHA 1W7FA 1M40A 3A3DA 3M2JA 1FOFA 3MXSA 3QNBA 4XUXA 3Q7VA 3V5MA 1LHYA 4MBHA 2ZMAA 4B88A 5DF7A 5I94A 4JF5A 2J8YA 5F83A 3NCKA 5A92A 3HL9A 5M18A 3MBZA 4XUZA 3E2KA 3SH8A 3SS4A 1XX2A 5HAIA 4JPMA 1AXBA 2XH9A 3W4PA 5F1FA 1KGGA 4E3JA 1XGJA 4JXGA 4LV1A 3SS3A 4WEJA 2IWDA 5GLDA 1H5XA 4DE2A 5DTKA 4LV3A 5EVIC 4ZJ3A 4K91A 4DE1A 1BLSA 3BFFA 2V2FF 3DW0A 3EQUA 1GHPA 4QJGA 4P0MA 5EECA 3ZDJA 2Q9NA 2PU2A 4IBXA 1SDEA 2XK1A 2ZQDA 4S2MA 1FR1A 5AQ9A 4JXWA 2QMIA 2Y2PA 3O86A 5CGXA 4E6WA 5G18A 3BRMA 3WS2A 1IYSA 1N4OA 4MLLA 1MWUA 1BZAA 3P98A 1ERMA 1ES5A 1ESUA 3DWZA 1GHIA 5CXWA 1VM1A 3UDFA 3G4PA 2FFFB 3V3RA 4DE3A 3GQZA 4D2OA 3N8RA 2EX2A 4NK3A 1CEFA 2WUQA 4MNRA 2Y55A 2WZZA 5CERA 4N9LA 4WZ5C 4OVDA 4MEZA 2XF3A 3IF5A 4PM9A 4Y0TA 2XFTA 3NC8A 4RYEA 1N9BA 5A91A 1ZC2A 1IYPA 2HDUA 5AQAA 2E8IA 2J7VA 4RVAA 2DNSA 3C4OA 4BENA 4OLGA 2X71A 4K0XA 1FCOA 5EOOA 1TVFA 4RX2A 4GB7A 4L0LA 4QB8A 4GKUA 1HTZA 4S2NA 4OQGA 1CI8A 4GZBA 3IXDA 1KE4A 2Y2LA 5CGWA 3AGDA 3PBSA 1ONGA 3W4QA 3ITBA 3TOIA 1K56D 4PM6A 4FSFA 2JC7A 2WYXA 3VP1A 5D3OA 5HAQA 5FATA 4ID4A 3SH9A 3HREA 2UWXA 1GCEA 2OLVA 5TR7A 4KG2A 1I2SA 4B4ZA 3CJMA 4P87A 3LEZA 4HEFA 4OOMA 2IWCA 1K57A 4DXCA 1K6SA 3ZG5A 1IKGA 5EE8A 1SHVA 5DTSA 2XFSA 3O88A 4NETA 1K54A 1XP4A 4WMCD 3GVBA 3BFEA 3CZDA 3IXBA 4E6XA 1RGZA 3ITAA 1EWZA 1PI5A 1YMXA 3BFDA 3UE3A 4MBKA 4WBGA 4S2LA 3HBRA 3VFFA 3Q1FA 3A3FA 3P09A 1MPLA 4U0XA 2QZ6A 1JTGA 1O7EA 3BLSA 3RJUA 4WMCA 3V3SA 5A93A 2OSUA 3CMZA 4LCMA 1MKIA 4WM9A 1JWVA 2EX6A 4QY6A 2XEPA 4KZBA 1PWGA 4QU3A 4WEKA 3NI9A 3PBNA 1KVMA 1PIOA 2BLSA 2I72A 3FZCA 4KG5A 4A5RA 5CTNA 1YLYA 2VGJA 3G31A 3ZGAB 1KGEA 1NZUA 4QD4A 1MY8A 4KENB 1YT4A 5CEDA 5U47A 4IEDA 2H0TA 3C4PA 3N8LA 1PI4A 2Y59A 4DDSA 3MXRA 5FAPA 3IHBA 3AGFA 1LL5A 1W8QA 4ZAMA 2EFUA 5DVAA 3BEBA 3GTCA 4R23A 1YLJA 1IEMA 3M2KA 1Z6FA 3HLEA 4LV0A 4E3MA 4JKTA 3DTMA 3UE0A 3PBTA 1H8ZA 3M6BA 1G6AA 4S2NC 3QNCA 4HBUA 4DRTA 5CEBA 5FI6A 4GDBA 1L0DA 4ZTKA 5DF8A 4JXVA 3HUOA 3IWQA 5FQ9A 1HD8A 3G2ZA 3OPLA 3UNWA 3WS0A 2Y2HA 4KZ5A 3UPOA 1SCWA 1ALQA 1MBLA 3PBRA 4UHUA 2ZC3B 1JWZA 1ZKJA 1KDSA 3MZDA 3NIAA 4C75A 5E43A 5FA7A 1K25A 1FQGA 3FWLA 1GA0A 1WYCA 4KQRA 5F1GA 2G2UA 1FCMA 3PAGA 4CJNA 1GA9A 4E3OA 5CHJA 2JE5A 3NY4A 5E2EA 4PM7A 2DCFA 3IF6A 4JF6A 3PTEA 2WGWA 1DY6A 3C7VA 5GL9A 2R9WA 1RCJA 3WRTA 4X55A 1E3UD 2RCXA 4X53A 5FDHA 3VFHA 4BD0A 4O7DA 3N6IA 5CHUA 4DF6A 3TG9A 2WZXA 1YLWA 1KE0A 4BJPA 3VOZA 3CG5A 2JCHA 3ZG7B 3AGEA 1PZPA 3LY4A 4Q8IA 1IELA 1XKZA 1CK3A 2P9VB 3OCLA 3V39A 1EROA 1SKFA 2P74A 3IHAA 1ZG4A 2EXAA 1U60A 2Y2QA 3NBLA 5M1AA 2ZQ8A 3UO9A 2EX8A 5FQIA 4BL2A 4ZDXA 1PW1A 4EWFA 1JVJA 1GHMA 4Y7PA 5EVIB 3S22A 1ES4A 1CEGA 2HP6A 4OQ0A 2ZC7A 1MWTA 5GLBA 4ZBEA 1TEMA 4JXSA 4RA7A 3WRZA 4CPKA 2PBYA 1ONHA 3VMAA 3OPRA 1XA1A 3ZG8B 4UAAA 2V20A 4X56A 2WAEA 2Y2GA 5HL1A 5KMWA 5HAPA 3UY6A 3NDGA 3OC2A 3HLGA 2BG1A 3IH9A 1KGFA 4R4SA 5E2HA 4EUZA 1MXOA 1WYBA 4K0WA 3BM6A 5HARA 3HVFA 3MKEA 3HLWA 3HLBA 3MKFA 4E3KA 1K56A 1SDNA 4R3BA 5E2GA 5F82A 1I5QA 3O87A 3M6HA 2WAFA 4R0QA 2OV5A 2X02A 3SS5A 5HW3A 2Y91A 5EPHA 1YLPA 2Z2LB 2XR0A 5EVID 2H0YA 2J9OA 2ZC4B 2C6WB 1RP5A 2Y2OA 4GOGA 2HDSA 5FI2A 4MBFA 5GLAA 3ZHHA 5BOHA 1BULA 2J9PA 2Y2MA 4LV2A 1XA7A 1J9MA 3ZVTA 5IHVA 4UA7A 4XXRA 1XPBA 1K4FA 2WKIA 3IQAA 3PBOA 5AQBA 3RXXA 4N9KA 1CI9A 1W8YA 2A49A 4GD8A 2C5WB 4B4XA 3VSKA 2CC1A 3VP3A 3MZFA 4BQMA 3ZG9B 3GSGA 1K4EA 5L2FA 1FR6A 1LLBA 3Q7VB 4N92A 3UDXA 5TFQA 5FAQA 4C3QA 5M19A 2HDRA 4OONA 2FFYA 3HUMA 3OPPA 5FQJA 3V50A 1EI5A 5EVLA 3N7WA 1ES2A 1K38A 4N1HA 5AQ7A 3UN7A 1PZOA 4WZ4A 5KSHA 2ZQ7A 3VP0A 1BT5A 3C5AA 1KE3A 2Y2JA 2H5SA 2HP5A 1K55A 4JF4A 4OQHA 4WZ5A 4DKIA 3HLCA 3Q82A 3FYZA 4FD8A 1C3BA 2V1ZA 4N1XA 3DWKA 3ISGA 4GNUA 4OP8A 2HP9A 2XD1A 1TDGA 2HDQA 3NDEA 2Y2NA 3G2YA 1Q2PA 4X68A 4EV4A 4FCFA 4Z9QA 1DJCA 4ZJ2A 4S2KA 4KZ4A 3N8SA 1BLPA 4HBTA 2WGIA 2WK0A 1ES3A 5GHYA 3G32A 4WELA 3IT9A 1YLTA 1NZOA 1PWDA 3JYIA 4KZ8A 5FQKA 3SH7A 2A3UA 4GDNA 4IBRA 5TGFA 1K57C 3FKVA 4H8RA 1YMSA 4HESA 3B3XA 2QPNA 2IWBA 4OPYA 1K54C 2VGKA 2Y4AA 4Y0OA 3Q81A 3UDIA 2G2WA 4X6TA 2ZLYA 1BUEA 4KZ3A 2ZQCA 5FAOA 1W79A 1XGIA 3VOYA 1PWCA 2R9XA 5EOEA 4R4RA 1LI0A 3UE1A 1NYYA 4C6YA 1Q2QA 1KDWA 5E2FA 3BYDA 4IVIA 4KZ6A 4E3NA 1QMEA 1Y54A 4EBPA 4OP5A 3I7JA 4KZAA 3G30A 4IVKA 2XDMA 1E3UA 3UPNA 3IXHA 4OOYA 2WKHA 3GV9A 1E25A 3HUNA 4OH0A 2PU4A 3VP2A 3VP4A 3PBQA 3EQVA 4S2JA 3IWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3J A;  3LO7 A;  4FH4 A;  1NRF A;  1FSW A;  3TSG A;  1IKI A;  1QMF A;  1TDL A;  1WE4 A;  3G35 A;  2X01 A;  1K6R A;  5CEC A;  1IYQ A;  5GHZ A;  1I2W A;  3LCE A;  3MZE A;  3W8K A;  1DJB A;  3A3I A;  4EBL A;  4GN2 A;  2XGN A;  3A3E A;  3A3J A;  4YIN A;  1ZG6 A;  3C7U A;  1K55 C;  3BFG A;  3Q7Z A;  4KQO A;  1S6R A;  2XD5 A;  4P6B A;  1KVL A;  2Q9M A;  1L0G A;  4F94 A;  4U3T A;  2Z2M B;  3WS5 A;  1BSG A;  4OLD A;  5CHM A;  5FQM A;  1ERQ A;  3UPP A;  5FI7 A;  4OPR A;  1E4D A;  3IH8 A;  3HLF A;  4OPZ A;  4BLM A;  2ZM2 A;  4EQI A;  3S4X A;  3LY3 A;  4PMA A;  1MWR A;  4OKP A;  4DDY A;  3ZFZ A;  3MFD A;  1NYM A;  4PM8 A;  1PYY A;  4JBF A;  5CGS A;  4KZ9 A;  5FQQ A;  2H10 A;  3Q07 A;  3W4O A;  1L0F A;  3ZG0 A;  3D4F A;  4U0T A;  3OPH A;  5J8X A;  1FCN A;  4OOL A;  3FV7 A;  3E2L A;  5FAS A;  4KZ7 A;  3WS4 A;  4DXB A;  3ZCZ A;  2XLN A;  2ZM8 A;  2P9V A;  4R1G A;  3HLD A;  2ZC6 B;  4YFM A;  2ZC5 B;  1L0E A;  3BEC A;  3IF6 C;  5GHX A;  1DJA A;  1LL9 A;  2Y2K A;  3BLM A;  4OQI A;  2ZQ9 A;  5EVI A;  5GLC A;  2EXB A;  1PW8 A;  5FSR A;  1S0W A;  3WWX A;  1XXM A;  3FKW A;  1NY0 A;  2ZJ9 A;  3OCN A;  1ESI A;  3QHY A;  4WYY A;  4X69 A;  1G68 A;  2EX9 A;  2DRW A;  1H8Y A;  2OLU A;  5KSC A;  5HX9 A;  1FSY A;  3O3V A;  1HVB A;  4QHC A;  5KZH A;  4KG6 A;  4LCL A;  2XQZ A;  2ZQA A;  2ZD8 A;  1YLZ A;  4P85 A;  3SOI A;  1JWP A;  5DF9 A;  1VQQ A;  1LI9 A;  5CRF A;  4S2O A;  3N4I A;  1L2S A;  5JYP A;  1BLC A;  4BL3 A;  1W5D A;  1IYO A;  1JTD A;  3IXG A;  4QY5 A;  4S2P A;  1M6K A;  4LEN A;  4UA9 A;  2RL3 A;  4KQQ A;  1YM1 A;  4M3K A;  1MWS A;  3GRJ A;  1YQS A;  3PAE A;  1RGY A;  5JYO A;  1OME A;  5HFO A;  2GDN A;  4EBN A;  3IF6 B;  4E3I A;  2HPB A;  4GD6 A;  3S1Y A;  2B5R A;  2WGW B;  2Y2I A;  3IWO A;  5DTT A;  3VSL A;  4JLF A;  2WAD A;  3BFC A;  3ZNT A;  1HZO A;  4FH2 A;  2WGV A;  3RXW A;  2JBF A;  1NJ4 A;  3GR2 A;  3ZNY A;  4Y0U A;  4ZJ1 A;  3OZH A;  4UA6 A;  4RX3 A;  1O07 A;  4DE0 A;  4E3L A;  4OPQ A;  2WKE A;  3ZVW A;  5A90 A;  1NXY A;  1BTL A;  5EUA A;  4BD1 A;  2EFX A;  4PPR A;  5CTM A;  4PM5 A;  3WS1 A;  4S2I A;  3G34 A;  3GMW A;  2ZM0 A;  1BLH A;  1W7F A;  1M40 A;  3A3D A;  3M2J A;  1FOF A;  3MXS A;  3QNB A;  4XUX A;  3Q7V A;  3V5M A;  1LHY A;  4MBH A;  2ZMA A;  4B88 A;  5DF7 A;  5I94 A;  4JF5 A;  2J8Y A;  5F83 A;  3NCK A;  5A92 A;  3HL9 A;  5M18 A;  3MBZ A;  4XUZ A;  3E2K A;  3SH8 A;  3SS4 A;  1XX2 A;  5HAI A;  4JPM A;  1AXB A;  2XH9 A;  3W4P A;  5F1F A;  1KGG A;  4E3J A;  1XGJ A;  4JXG A;  4LV1 A;  3SS3 A;  4WEJ A;  2IWD A;  5GLD A;  1H5X A;  4DE2 A;  5DTK A;  4LV3 A;  5EVI C;  4ZJ3 A;  4K91 A;  4DE1 A;  1BLS A;  3BFF A;  2V2F F;  3DW0 A;  3EQU A;  1GHP A;  4QJG A;  4P0M A;  5EEC A;  3ZDJ A;  2Q9N A;  2PU2 A;  4IBX A;  1SDE A;  2XK1 A;  2ZQD A;  4S2M A;  1FR1 A;  5AQ9 A;  4JXW A;  2QMI A;  2Y2P A;  3O86 A;  5CGX A;  4E6W A;  5G18 A;  3BRM A;  3WS2 A;  1IYS A;  1N4O A;  4MLL A;  1MWU A;  1BZA A;  3P98 A;  1ERM A;  1ES5 A;  1ESU A;  3DWZ A;  1GHI A;  5CXW A;  1VM1 A;  3UDF A;  3G4P A;  2FFF B;  3V3R A;  4DE3 A;  3GQZ A;  4D2O A;  3N8R A;  2EX2 A;  4NK3 A;  1CEF A;  2WUQ A;  4MNR A;  2Y55 A;  2WZZ A;  5CER A;  4N9L A;  4WZ5 C;  4OVD A;  4MEZ A;  2XF3 A;  3IF5 A;  4PM9 A;  4Y0T A;  2XFT A;  3NC8 A;  4RYE A;  1N9B A;  5A91 A;  1ZC2 A;  1IYP A;  2HDU A;  5AQA A;  2E8I A;  2J7V A;  4RVA A;  2DNS A;  3C4O A;  4BEN A;  4OLG A;  2X71 A;  4K0X A;  1FCO A;  5EOO A;  1TVF A;  4RX2 A;  4GB7 A;  4L0L A;  4QB8 A;  4GKU A;  1HTZ A;  4S2N A;  4OQG A;  1CI8 A;  4GZB A;  3IXD A;  1KE4 A;  2Y2L A;  5CGW A;  3AGD A;  3PBS A;  1ONG A;  3W4Q A;  3ITB A;  3TOI A;  1K56 D;  4PM6 A;  4FSF A;  2JC7 A;  2WYX A;  3VP1 A;  5D3O A;  5HAQ A;  5FAT A;  4ID4 A;  3SH9 A;  3HRE A;  2UWX A;  1GCE A;  2OLV A;  5TR7 A;  4KG2 A;  1I2S A;  4B4Z A;  3CJM A;  4P87 A;  3LEZ A;  4HEF A;  4OOM A;  2IWC A;  1K57 A;  4DXC A;  1K6S A;  3ZG5 A;  1IKG A;  5EE8 A;  1SHV A;  5DTS A;  2XFS A;  3O88 A;  4NET A;  1K54 A;  1XP4 A;  4WMC D;  3GVB A;  3BFE A;  3CZD A;  3IXB A;  4E6X A;  1RGZ A;  3ITA A;  1EWZ A;  1PI5 A;  1YMX A;  3BFD A;  3UE3 A;  4MBK A;  4WBG A;  4S2L A;  3HBR A;  3VFF A;  3Q1F A;  3A3F A;  3P09 A;  1MPL A;  4U0X A;  2QZ6 A;  1JTG A;  1O7E A;  3BLS A;  3RJU A;  4WMC A;  3V3S A;  5A93 A;  2OSU A;  3CMZ A;  4LCM A;  1MKI A;  4WM9 A;  1JWV A;  2EX6 A;  4QY6 A;  2XEP A;  4KZB A;  1PWG A;  4QU3 A;  4WEK A;  3NI9 A;  3PBN A;  1KVM A;  1PIO A;  2BLS A;  2I72 A;  3FZC A;  4KG5 A;  4A5R A;  5CTN A;  1YLY A;  2VGJ A;  3G31 A;  3ZGA B;  1KGE A;  1NZU A;  4QD4 A;  1MY8 A;  4KEN B;  1YT4 A;  5CED A;  5U47 A;  4IED A;  2H0T A;  3C4P A;  3N8L A;  1PI4 A;  2Y59 A;  4DDS A;  3MXR A;  5FAP A;  3IHB A;  3AGF A;  1LL5 A;  1W8Q A;  4ZAM A;  2EFU A;  5DVA A;  3BEB A;  3GTC A;  4R23 A;  1YLJ A;  1IEM A;  3M2K A;  1Z6F A;  3HLE A;  4LV0 A;  4E3M A;  4JKT A;  3DTM A;  3UE0 A;  3PBT A;  1H8Z A;  3M6B A;  1G6A A;  4S2N C;  3QNC A;  4HBU A;  4DRT A;  5CEB A;  5FI6 A;  4GDB A;  1L0D A;  4ZTK A;  5DF8 A;  4JXV A;  3HUO A;  3IWQ A;  5FQ9 A;  1HD8 A;  3G2Z A;  3OPL A;  3UNW A;  3WS0 A;  2Y2H A;  4KZ5 A;  3UPO A;  1SCW A;  1ALQ A;  1MBL A;  3PBR A;  4UHU A;  2ZC3 B;  1JWZ A;  1ZKJ A;  1KDS A;  3MZD A;  3NIA A;  4C75 A;  5E43 A;  5FA7 A;  1K25 A;  1FQG A;  3FWL A;  1GA0 A;  1WYC A;  4KQR A;  5F1G A;  2G2U A;  1FCM A;  3PAG A;  4CJN A;  1GA9 A;  4E3O A;  5CHJ A;  2JE5 A;  3NY4 A;  5E2E A;  4PM7 A;  2DCF A;  3IF6 A;  4JF6 A;  3PTE A;  2WGW A;  1DY6 A;  3C7V A;  5GL9 A;  2R9W A;  1RCJ A;  3WRT A;  4X55 A;  1E3U D;  2RCX A;  4X53 A;  5FDH A;  3VFH A;  4BD0 A;  4O7D A;  3N6I A;  5CHU A;  4DF6 A;  3TG9 A;  2WZX A;  1YLW A;  1KE0 A;  4BJP A;  3VOZ A;  3CG5 A;  2JCH A;  3ZG7 B;  3AGE A;  1PZP A;  3LY4 A;  4Q8I A;  1IEL A;  1XKZ A;  1CK3 A;  2P9V B;  3OCL A;  3V39 A;  1ERO A;  1SKF A;  2P74 A;  3IHA A;  1ZG4 A;  2EXA A;  1U60 A;  2Y2Q A;  3NBL A;  5M1A A;  2ZQ8 A;  3UO9 A;  2EX8 A;  5FQI A;  4BL2 A;  4ZDX A;  1PW1 A;  4EWF A;  1JVJ A;  1GHM A;  4Y7P A;  5EVI B;  3S22 A;  1ES4 A;  1CEG A;  2HP6 A;  4OQ0 A;  2ZC7 A;  1MWT A;  5GLB A;  4ZBE A;  1TEM A;  4JXS A;  4RA7 A;  3WRZ A;  4CPK A;  2PBY A;  1ONH A;  3VMA A;  3OPR A;  1XA1 A;  3ZG8 B;  4UAA A;  2V20 A;  4X56 A;  2WAE A;  2Y2G A;  5HL1 A;  5KMW A;  5HAP A;  3UY6 A;  3NDG A;  3OC2 A;  3HLG A;  2BG1 A;  3IH9 A;  1KGF A;  4R4S A;  5E2H A;  4EUZ A;  1MXO A;  1WYB A;  4K0W A;  3BM6 A;  5HAR A;  3HVF A;  3MKE A;  3HLW A;  3HLB A;  3MKF A;  4E3K A;  1K56 A;  1SDN A;  4R3B A;  5E2G A;  5F82 A;  1I5Q A;  3O87 A;  3M6H A;  2WAF A;  4R0Q A;  2OV5 A;  2X02 A;  3SS5 A;  5HW3 A;  2Y91 A;  5EPH A;  1YLP A;  2Z2L B;  2XR0 A;  5EVI D;  2H0Y A;  2J9O A;  2ZC4 B;  2C6W B;  1RP5 A;  2Y2O A;  4GOG A;  2HDS A;  5FI2 A;  4MBF A;  5GLA A;  3ZHH A;  5BOH A;  1BUL A;  2J9P A;  2Y2M A;  4LV2 A;  1XA7 A;  1J9M A;  3ZVT A;  5IHV A;  4UA7 A;  4XXR A;  1XPB A;  1K4F A;  2WKI A;  3IQA A;  3PBO A;  5AQB A;  3RXX A;  4N9K A;  1CI9 A;  1W8Y A;  2A49 A;  4GD8 A;  2C5W B;  4B4X A;  3VSK A;  2CC1 A;  3VP3 A;  3MZF A;  4BQM A;  3ZG9 B;  3GSG A;  1K4E A;  5L2F A;  1FR6 A;  1LLB A;  3Q7V B;  4N92 A;  3UDX A;  5TFQ A;  5FAQ A;  4C3Q A;  5M19 A;  2HDR A;  4OON A;  2FFY A;  3HUM A;  3OPP A;  5FQJ A;  3V50 A;  1EI5 A;  5EVL A;  3N7W A;  1ES2 A;  1K38 A;  4N1H A;  5AQ7 A;  3UN7 A;  1PZO A;  4WZ4 A;  5KSH A;  2ZQ7 A;  3VP0 A;  1BT5 A;  3C5A A;  1KE3 A;  2Y2J A;  2H5S A;  2HP5 A;  1K55 A;  4JF4 A;  4OQH A;  4WZ5 A;  4DKI A;  3HLC A;  3Q82 A;  3FYZ A;  4FD8 A;  1C3B A;  2V1Z A;  4N1X A;  3DWK A;  3ISG A;  4GNU A;  4OP8 A;  2HP9 A;  2XD1 A;  1TDG A;  2HDQ A;  3NDE A;  2Y2N A;  3G2Y A;  1Q2P A;  4X68 A;  4EV4 A;  4FCF A;  4Z9Q A;  1DJC A;  4ZJ2 A;  4S2K A;  4KZ4 A;  3N8S A;  1BLP A;  4HBT A;  2WGI A;  2WK0 A;  1ES3 A;  5GHY A;  3G32 A;  4WEL A;  3IT9 A;  1YLT A;  1NZO A;  1PWD A;  3JYI A;  4KZ8 A;  5FQK A;  3SH7 A;  2A3U A;  4GDN A;  4IBR A;  5TGF A;  1K57 C;  3FKV A;  4H8R A;  1YMS A;  4HES A;  3B3X A;  2QPN A;  2IWB A;  4OPY A;  1K54 C;  2VGK A;  2Y4A A;  4Y0O A;  3Q81 A;  3UDI A;  2G2W A;  4X6T A;  2ZLY A;  1BUE A;  4KZ3 A;  2ZQC A;  5FAO A;  1W79 A;  1XGI A;  3VOY A;  1PWC A;  2R9X A;  5EOE A;  4R4R A;  1LI0 A;  3UE1 A;  1NYY A;  4C6Y A;  1Q2Q A;  1KDW A;  5E2F A;  3BYD A;  4IVI A;  4KZ6 A;  4E3N A;  1QME A;  1Y54 A;  4EBP A;  4OP5 A;  3I7J A;  4KZA A;  3G30 A;  4IVK A;  2XDM A;  1E3U A;  3UPN A;  3IXH A;  4OOY A;  2WKH A;  3GV9 A;  1E25 A;  3HUN A;  4OH0 A;  2PU4 A;  3VP2 A;  3VP4 A;  3PBQ A;  3EQV A;  4S2J A;  3IWI A; 
#chains in the Genus database with same CATH topology
 3LO7 A;  4FH4 A;  1TDL A;  3G35 A;  2X01 A;  1K6R A;  1IYQ A;  3A3I A;  5HL6 A;  1ZG6 A;  4G3K A;  3C7U A;  4KQO A;  2W27 A;  4P6B A;  1KVL A;  4F94 A;  1L0G A;  4U3T A;  4F3L B;  4OLD A;  1ERQ A;  1TS6 A;  3LY3 A;  1MWR A;  1NYM A;  3ZG0 A;  5J8X A;  2GZA A;  4OOL A;  4LRX C;  2B95 A;  3FV7 A;  2XSS A;  2GX5 A;  2ZMV A;  4DXB A;  3TE8 A;  2GJ3 A;  1G28 A;  3BEC A;  3IF6 C;  1DJA A;  1LL9 A;  4OQI A;  5FSR A;  3WWX A;  3FKW A;  3OCN A;  3QHY A;  4WYY A;  2EX9 A;  2DRW A;  5KSC A;  5HX9 A;  4LRZ E;  4QHC A;  2VKS A;  4LCL A;  2W3F A;  4P85 A;  3SOI A;  1JWP A;  4I39 A;  1VQQ A;  3T1X A;  1LI9 A;  5CRF A;  4S2O A;  1BLC A;  1W5D A;  1JTD A;  1YAX A;  4KUO A;  3H82 A;  4K08 A;  4I5S A;  1MWS A;  5HWV A;  2OAQ 1;  2GDN A;  4E3I A;  2B5R A;  2WGW B;  3E4P A;  3G6O A;  4I38 A;  4JLF A;  3BFC A;  3ZNT A;  1YKD A;  5HPF A;  3CPT B;  3RXW A;  3PR6 A;  5DKL A;  2JBF A;  4EU0 A;  5A90 A;  2WKE A;  1NXY A;  1BTL A;  5EUA A;  3ZYT A;  4PM5 A;  5L10 A;  4XT2 A;  3MXS A;  1M40 A;  3BQ8 A;  3LR0 A;  4R6L A;  5DF7 A;  3CAX A;  3S7Q A;  2ZBB A;  4JF5 A;  3NCK A;  5A92 A;  3HL9 A;  5M18 A;  4XUZ A;  3E2K A;  3SS4 A;  5FEG A;  3T1Q B;  2P7J A;  4JXG A;  3SS3 A;  4NXB A;  1BLS A;  3EQU A;  1GHP A;  3ZDJ A;  2XK1 A;  2J3T D;  4E6W A;  5G18 A;  1N4O A;  3B33 A;  4MLL A;  1XJ3 A;  1MWU A;  4Q0I A;  1VM1 A;  5EM1 A;  3N8R A;  3UB8 A;  2WUQ A;  2Y55 A;  5CER A;  4MEZ A;  2XFT A;  3NC8 A;  4RYE A;  2HDU A;  2J7V A;  4BEN A;  4OLG A;  3A0S A;  5FEF A;  1ONG A;  2WYX A;  4X1L A;  3LIE A;  5HAQ A;  4NEE D;  2UWX A;  4KG2 A;  4FUW A;  3LEZ A;  1P0Z A;  4HEF A;  4OOM A;  4DXC A;  1K6S A;  2W0N A;  4O8G A;  1RGZ A;  4ME4 A;  4ESP A;  3BFD A;  4F3L A;  4Y17 A;  2A24 B;  1MPL A;  1JTG A;  1O7E A;  3RJU A;  4WMC A;  1JWV A;  1PWG A;  4QU3 A;  3NI9 A;  1DRM A;  3CHW P;  1PIO A;  2BLS A;  3G31 A;  3P01 A;  4QD4 A;  1NLY A;  3RFB A;  3KSH A;  4IED A;  2ZL1 B;  4QPR A;  4EEP A;  2Y59 A;  1LL5 A;  4L9F A;  3GTC A;  1YLJ A;  4E3M A;  1VHM A;  4KUK A;  3UE0 A;  3PBT A;  1G6A A;  2PBD P;  4S2N C;  2OOL A;  5CEB A;  5FI6 A;  4ZTK A;  4JXV A;  3HUO A;  5FQ9 A;  3G2Z A;  3UNW A;  4KZ5 A;  1ALQ A;  3CLO A;  4II7 A;  1VET B;  2ZC3 B;  1ZKJ A;  2PR5 A;  4R38 A;  3MZD A;  3NIA A;  3JVU A;  2J80 A;  1WYC A;  1XFQ A;  4E3O A;  2WGW A;  5GL9 A;  2R9W A;  1E3U D;  2K31 A;  4O7D A;  3CPT A;  3F1O B;  5CHU A;  2ZOI A;  2XRN A;  5HDC A;  3VOZ A;  3OOV A;  1PZP A;  3LY4 A;  2E8J A;  1XKZ A;  2XA7 S;  2HF6 A;  2G7U A;  3NBL A;  1JVJ A;  4FTX A;  4Y7P A;  2K2N A;  1ES4 A;  2HP6 A;  4YOF A;  5GLB A;  1DP6 A;  3BY8 A;  3OPR A;  3L9K A;  4GLQ A;  2WAE A;  4UEY A;  3NDG A;  2JKT M;  3HLG A;  3K3D A;  1KGF A;  4R4S A;  5HZH A;  1MXO A;  3BM6 A;  3HVF A;  3HLB A;  1K56 A;  1PNE A;  1I5Q A;  3PYP A;  2OV5 A;  4M4X A;  3LIB A;  5HW3 A;  2Y91 A;  5EPH A;  5DFY A;  2V9A A;  2ZC4 B;  2O9C A;  2HDS A;  2V1B A;  3NOP C;  3ZHH A;  2JKR I;  1XA7 A;  1S1Y A;  4UA7 A;  4XXR A;  2UV0 E;  5IT5 A;  2WKI A;  4N9K A;  3U2A A;  4GD8 A;  2C5W B;  4DMZ A;  2VEA A;  3T4S A;  5M19 A;  2HDR A;  2PD7 A;  2R78 A;  3OPP A;  5EVL A;  3UN7 A;  1ZTU A;  1K55 A;  4OQH A;  4Y5F A;  1NLZ A;  2ZOH A;  4N1X A;  5HDD A;  3DWK A;  4OP8 A;  1V9Z A;  2XD1 A;  2A24 A;  4KZ4 A;  1DP8 A;  3O5Y A;  3N8S A;  1BLP A;  1N9N A;  3IT9 A;  1F98 A;  1PFL A;  1NZO A;  1PWD A;  3SH7 A;  1YMS A;  3IBJ A;  2XA7 M;  2QPN A;  1K54 C;  2VGK A;  2G2W A;  4X6T A;  2ZLY A;  1BUE A;  5FAO A;  2ZQC A;  3HJI A;  1PWC A;  3CUE C;  1LI0 A;  2L0W A;  1QME A;  1Y54 A;  2QJ7 A;  4P6Z S;  4IVK A;  5TBM B;  4OOY A;  1E25 A;  4G3V A;  2PU4 A;  3VP2 A;  3PBQ A;  4LLO B;  3EQV A;  4S2J A;  4CLC B;  3IWI A;  2PR6 A;  1VET A;  1UGU A;  5CEC A;  4EBL A;  4GN2 A;  2J3W A;  2XGN A;  4YIN A;  3Q7Z A;  2Q9M A;  2Z2M B;  1BSG A;  3EWK A;  3KYZ A;  5CHM A;  3UPP A;  2PHY A;  5G4Y A;  5FI7 A;  4OPR A;  4BLM A;  2ZM2 A;  4EQI A;  5J7E A;  4OKP A;  1TF1 A;  3F1O A;  4JBF A;  5I5L A;  5FQQ A;  1L0F A;  3D4F A;  4U0T A;  2KDK A;  3OPH A;  1FCN A;  2KOI A;  1OTB A;  5FAS A;  4KZ7 A;  4YWZ A;  2XLN A;  4HJ4 A;  4YFM A;  2ZC5 B;  4H6J B;  4O01 A;  4HH2 A;  2INW A;  4O0P A;  5GLC A;  5LBR A;  3A0R A;  2ZJ9 A;  1G68 A;  2OLU A;  1HVB A;  1S4R A;  1TD5 A;  3VV4 A;  3N4I A;  1G5U A;  1LL8 A;  4HIA A;  4BL3 A;  3SZT A;  1IYO A;  4S2P A;  4UA9 A;  1YM1 A;  1FIL A;  3SW1 A;  1YQS A;  1P9W A;  3PAE A;  1RGY A;  3MR0 A;  3IF6 B;  4GD6 A;  2Y2I A;  4CQH A;  5DJU A;  1HZO A;  2KX6 A;  4EES A;  1NJ4 A;  1GSW A;  4ZJ1 A;  2WKR A;  4UA6 A;  4RX3 A;  4E3L A;  2BTF P;  4P6Z M;  4BD1 A;  4PPR A;  3F1P B;  4HNB A;  1W7F A;  3NHQ A;  1LHY A;  3LIC A;  1YSQ A;  4AFI A;  5HAI A;  2XH9 A;  3NEC A;  4LV1 A;  4WEJ A;  2Y79 A;  5DTK A;  4LV3 A;  4ZJ3 A;  1PRQ A;  4QJG A;  4P0M A;  5EEC A;  4I3I A;  2Q9N A;  4IBX A;  2ZQD A;  3A0V A;  3BRM A;  2OAP 1;  2MJ6 A;  1OPX A;  1ES5 A;  5HSQ A;  4Y3I A;  5CXW A;  2Z6C A;  3D3O A;  1NRJ A;  3V3R A;  2EX2 A;  4MN5 A;  4Y0T A;  5A91 A;  1ZC2 A;  3PXP A;  2DNS A;  3C4O A;  2X71 A;  1FCO A;  3IBR A;  5EOO A;  1OTD A;  4RX2 A;  3LUQ A;  3NOT C;  3K2N A;  4GKU A;  4GZB A;  5CGW A;  3AGD A;  3NJA A;  4R3A A;  3ITB A;  5TBM A;  1K56 D;  4PM6 A;  4FSF A;  5D3O A;  5FAT A;  4ID4 A;  3SH9 A;  4CLC A;  3HRE A;  1GCE A;  4NXE A;  1I2S A;  4HY8 A;  3CJM A;  3CI6 A;  5C5K A;  3UE6 A;  2IWC A;  1K57 A;  3MQ0 A;  2VX8 A;  3ZG5 A;  1JNU A;  2V1A A;  3CZD A;  5HWT A;  5HD3 A;  1EWZ A;  1STZ A;  1PI5 A;  1YMX A;  4MBK A;  4S2L A;  3VFF A;  3Q1F A;  3A3F A;  1V9Y A;  4U0X A;  5A93 A;  3V3S A;  1MC0 A;  3CMZ A;  1MKI A;  4WM9 A;  2EX6 A;  4QY6 A;  1KVM A;  2NUP C;  2I72 A;  5CTN A;  1YLY A;  3ZGA B;  3UB9 A;  2EWV A;  5CED A;  5U47 A;  1S67 L;  3N8L A;  4H6J A;  2Y8H A;  4DDS A;  2PT7 A;  3AGF A;  4ZAM A;  3C2W A;  2B02 A;  3BEB A;  1Z6F A;  3HLE A;  4JKT A;  4EUV A;  1DP9 A;  2W3D A;  3CWF A;  3OPL A;  1T1C A;  3T1S A;  4UHU A;  4YNR A;  2O0Y A;  3MSH A;  5E43 A;  1SKO B;  5FA7 A;  1XJ6 A;  1K25 A;  5J4E A;  1FQG A;  1TS0 A;  4CJN A;  1GA9 A;  3D72 A;  5CHJ A;  4PM7 A;  3IF6 A;  2NUT C;  3QP4 A;  2VK3 A;  3N6I A;  4DF6 A;  3KSI A;  4D60 A;  4MN6 A;  4BJP A;  2JCH A;  3ZG7 B;  3AGE A;  3F1P A;  3BJN A;  1CK3 A;  1ERO A;  2P74 A;  1ZG4 A;  1H3Q A;  5M1A A;  1XJ4 A;  4EWF A;  3QP8 A;  1GHM A;  5EVI B;  3MS6 A;  2HGV A;  4OQ0 A;  2ZC7 A;  3LIA A;  1MWT A;  4I3J A;  4ZBE A;  4RA7 A;  1ONH A;  1GSV A;  4Z1W A;  2VA0 A;  3VMA A;  1H0M A;  3QP6 A;  4X56 A;  5HL1 A;  1CF0 A;  3OC2 A;  5F6A A;  3FPW A;  1WYB A;  5HAR A;  4R3B A;  3O87 A;  2WAF A;  3DTI A;  3VE3 A;  2X02 A;  4PKY G;  3U4L P;  2H0Y A;  2J9O A;  3FG8 A;  2C6W B;  4UQI S;  3LFV A;  2J9P A;  2Y2M A;  1J9M A;  1OTI A;  2M1C A;  3PBO A;  2A49 A;  3ICY A;  3BQA A;  2CC1 A;  4CLC E;  5TJJ A;  1FR6 A;  1LLB A;  4N92 A;  4B9O A;  3UDX A;  4X1M A;  3N7W A;  4GHI B;  3UME A;  1K38 A;  2PDR A;  2VLG A;  3C5A A;  2Y2J A;  4GS9 B;  5DKK A;  3Q82 A;  4FD8 A;  1C3B A;  2V1Z A;  2H28 A;  4PAU A;  2HP9 A;  4ARZ B;  2Y2N A;  3G2Y A;  4FCF A;  4ZJ2 A;  1F2K A;  3L7H A;  5J3W A;  1ES3 A;  2JN7 A;  3P7N A;  1YLT A;  3DAV A;  1S1Z A;  4GDN A;  2HJ9 C;  4H8R A;  4HES A;  3B3X A;  5KIZ A;  2IWB A;  1Y4O A;  2A2L A;  2PD8 A;  2PAV P;  1W79 A;  4HP9 A;  3F1N B;  3UE1 A;  4C6Y A;  3BYD A;  4IVI A;  4OP5 A;  3I7J A;  4KZA A;  2XDM A;  3UPN A;  2WKH A;  3HUN A;  3RH8 B;  1VEU B;  4R3J A;  1NRF A;  1VB6 A;  1WE4 A;  2HJE A;  1SKO A;  5GHZ A;  1I2W A;  3MZE A;  3W8K A;  1IFQ A;  3A3E A;  4WN5 A;  3KSG A;  1K55 C;  2P08 A;  3BFG A;  1S6R A;  2XD5 A;  4UQI M;  3WS5 A;  5G4Z A;  4HJ6 A;  3T4L A;  4BBV A;  1E4D A;  1F9I A;  3HLF A;  4PMA A;  4DDY A;  3MFD A;  4PM8 A;  3D9Y A;  3LR4 A;  3Q07 A;  3HJK A;  1OT9 A;  3PHY A;  2QJ5 A;  3E2L A;  2ZM8 A;  5HWW A;  2ZC6 B;  4NXG A;  3MF0 A;  1L0E A;  5GHX A;  2Y2K A;  5EVI A;  1XJ2 A;  2ZQ9 A;  1NY0 A;  1ESI A;  4X69 A;  4MCW A;  4GCZ A;  5HPI A;  4KG6 A;  2XQZ A;  1Z09 A;  2ZD8 A;  2ZQA A;  3LI9 A;  1YLZ A;  3OBF A;  1L2S A;  1W63 Q;  4PHT A;  3IXG A;  4BWI A;  4KQQ A;  2W3E A;  5DFX A;  4JGR A;  2V0U A;  5JYO A;  3H7W B;  1OME A;  5HFO A;  4EBN A;  2HPB A;  3S1Y A;  3VSL A;  2JHE A;  4FH2 A;  2WGV A;  3GR2 A;  4LFU A;  1FIK A;  4B93 A;  1O07 A;  4OPQ A;  2EFX A;  5CTM A;  3WS1 A;  4S2I A;  3G34 A;  3GMW A;  2ZM0 A;  1BLH A;  1FOF A;  1W63 M;  4MBH A;  4B88 A;  2HZ5 A;  2ZL1 A;  5I94 A;  2J8Y A;  5F83 A;  4GHI A;  5EVE A;  1XX2 A;  4JPM A;  3W4P A;  5F1F A;  4GS9 A;  1XGJ A;  4GW9 A;  5GLD A;  3VE4 A;  4K91 A;  3BFF A;  2V2F F;  3CIT A;  3S7P A;  2FH5 A;  4ARZ A;  4HQA A;  4LRY C;  2QMI A;  5CGX A;  3T12 B;  1AWI A;  1WA9 A;  3UDF A;  4DE3 A;  4HJ3 A;  4NK3 A;  1CEF A;  5EV0 A;  3C30 A;  2WZZ A;  2JKG A;  4WZ5 C;  2XF3 A;  3IF5 A;  4PM9 A;  1N9B A;  3LYX A;  5L8M A;  3EOI A;  1TVF A;  1G6O A;  4GB7 A;  1CJF A;  4L0L A;  1HTZ A;  3F1N A;  2QYB A;  3IXD A;  1KE4 A;  3T1R A;  3EEA A;  3PBS A;  4KQD A;  2JC7 A;  2Z6D A;  4L9G A;  1VEU A;  3R4K A;  2OLV A;  4P87 A;  1Y28 A;  4E04 A;  2K7S A;  5EE8 A;  1SHV A;  1BYW A;  5DTS A;  4NET A;  1K54 A;  1XP4 A;  4WMC D;  2OWH A;  3GVB A;  3IXB A;  4E6X A;  3ITA A;  3HBR A;  4ETX A;  2QZ6 A;  2OSU A;  1XFN A;  2XEP A;  1D06 A;  4KZB A;  4WEK A;  4NG2 A;  3C8C A;  3FZC A;  4KG5 A;  4WL9 A;  4JGO A;  1YT4 A;  3R7W B;  2H0T A;  3W2Z A;  3C4P A;  1TS7 A;  1PI4 A;  3MXR A;  5FAP A;  3IHB A;  2XRO A;  4MN7 A;  2ACG A;  3BWL A;  2EFU A;  1IEM A;  3M2K A;  4LV0 A;  3DTM A;  1ODV A;  2IA2 A;  4DRT A;  1L0D A;  5DF8 A;  1HD8 A;  2Y2H A;  2VV8 A;  3H9W A;  3MJQ A;  2O99 A;  2JKR M;  5FL3 A;  1KDS A;  4CLC C;  4C75 A;  2VV6 A;  3T4Q A;  3FWL A;  4RQ9 A;  1GA0 A;  4G3W A;  4KQR A;  4X25 A;  5F1G A;  4EET B;  2G2U A;  1FCM A;  4FOF A;  2O9B A;  2JE5 A;  3H7W A;  3NY4 A;  5E2E A;  2DCF A;  4LGW A;  3WRT A;  4X55 A;  2V8F A;  3TG9 A;  2WZX A;  2OWJ A;  1YLW A;  3JPU A;  1KE0 A;  4Q8I A;  1S66 L;  2P9V B;  3FPV A;  3FC7 A;  3OCL A;  2W3G A;  3IHA A;  3T4K A;  4BL2 A;  5FQI A;  1H8M A;  1PW1 A;  1YPR A;  3DTE A;  3OLO A;  1CEG A;  1TEM A;  3WRZ A;  4CPK A;  2PBY A;  3ZG8 B;  3S7N A;  3ULF A;  1EW0 A;  3UY6 A;  3VOL A;  5E2H A;  3NOU C;  1LSV A;  4EUZ A;  3B42 A;  4E3K A;  3HLW A;  1SDN A;  2ZMF A;  5F82 A;  4R0Q A;  3M6H A;  3SS5 A;  4ZRR A;  1YLP A;  5EVI D;  3V67 A;  2YKH A;  1N9O A;  1RP5 A;  4GOG A;  5GLA A;  5BOH A;  2W1R A;  1BUL A;  4LV2 A;  3ZVT A;  2EA9 A;  1XPB A;  3IQA A;  1ACF A;  1CI9 A;  1W8Y A;  4HOI A;  4B4X A;  2WKQ A;  3EGD C;  3BW6 A;  3Q7V B;  4JGQ A;  4R70 A;  5FAQ A;  2FFY A;  5FQJ A;  1PZO A;  2PYP A;  4WZ4 A;  3VP0 A;  2HP5 A;  4DKI A;  3HLC A;  3NUL A;  4GNU A;  4GJ4 A;  3S7O A;  3EEH A;  1UWN X;  2HDQ A;  3NDE A;  1LSW A;  4X68 A;  1HLU P;  4EV4 A;  1DJC A;  4S2K A;  2P04 A;  1T1A A;  2WGI A;  3MQO A;  5GHY A;  1GSX A;  4IBR A;  3FKV A;  5F5Y A;  4BBU A;  3MQQ A;  3UDI A;  3R7W A;  2JKT I;  1XGI A;  5EOE A;  1Q2Q A;  4EQ1 A;  3KX0 X;  2D02 A;  4KZ6 A;  4E3N A;  1TS8 A;  4EBP A;  3G30 A;  3KO6 A;  3T50 A;  1FSW A;  3TSG A;  1IKI A;  1QMF A;  1D7E A;  3T4T A;  3LCE A;  1DJB A;  3A3J A;  1SZV A;  5AJG A;  3LEQ A;  3E0Y A;  5FQM A;  3IH8 A;  4OPZ A;  2Q0O A;  3GEC A;  3S4X A;  3C38 A;  2O9A A;  3ZFZ A;  1K0K A;  1P97 A;  1PYY A;  5CGS A;  4KZ9 A;  2LB5 A;  1N9L A;  2H10 A;  4WLA A;  3W4O A;  3RTY A;  2M7V A;  1UWP X;  3WS4 A;  4WUJ A;  5F68 A;  3ZCZ A;  1J3W A;  2P9V A;  4R1G A;  3HLD A;  3LID A;  3IS2 B;  3BLM A;  2EXB A;  1S4S A;  1PW8 A;  4JGP A;  4HHD A;  4EER A;  1S0W A;  1XXM A;  1X0O A;  1H8Y A;  1FSY A;  5HD5 A;  3O3V A;  5KZH A;  3E98 A;  3ZQ5 A;  5DF9 A;  5JYP A;  2CMN A;  4QY5 A;  1M6K A;  4LEN A;  1NWZ A;  2RL3 A;  4M3K A;  3GRJ A;  2QWS A;  3QP5 A;  2I9V A;  5IU1 A;  5L07 A;  4L9E A;  3KSF A;  4I3A A;  3IWO A;  5DTT A;  2WAD A;  1D1J A;  3ZNY A;  4Y0U A;  3OZH A;  4DE0 A;  3ZVW A;  1OJ5 A;  1OTA A;  3QNB A;  3A3D A;  3M2J A;  2GNX A;  4XUX A;  2W1T B;  3Q7V A;  3V5M A;  5CX7 A;  3BY9 A;  2ZMA A;  4IHQ A;  3MMH A;  4Y2F A;  3MBZ A;  2VJW A;  3SH8 A;  5K5B A;  1AXB A;  5L09 A;  1KGG A;  4E3J A;  2VZW A;  2IWD A;  3K3C A;  4DJ3 A;  1H5X A;  4DE2 A;  5EVI C;  4NXF A;  4DE1 A;  3DW0 A;  3T4J A;  2PU2 A;  2VV7 A;  1SDE A;  4S2M A;  1FR1 A;  3QP1 A;  4JXW A;  5AQ9 A;  2Y2P A;  3O86 A;  2JKF A;  3WS2 A;  1IYS A;  3UMD A;  3MFX A;  1BZA A;  3P98 A;  1ERM A;  1ESU A;  3DWZ A;  1GHI A;  3UB6 A;  3G4P A;  1L3L A;  2FFF B;  3GQZ A;  2V0W A;  4D2O A;  1MZU A;  4MNR A;  4N9L A;  4OVD A;  3LR5 A;  4EEU A;  1IYP A;  4DJ2 A;  2AVX A;  5AQA A;  2E8I A;  4RVA A;  2DMW A;  4K0X A;  1F5M A;  3TW8 A;  3GDI A;  2PRF A;  4QB8 A;  4Y13 A;  4S2N A;  4Q0H A;  4OQG A;  1CI8 A;  5DJT A;  4CLC D;  4NKP A;  1T19 A;  2Y2L A;  3W4Q A;  5AVE A;  3TOI A;  1YSP A;  5IS1 A;  3VP1 A;  5TR7 A;  3DBA A;  4IJG A;  4B4Z A;  3E4Q A;  2KLI A;  2W3H A;  1IKG A;  2XFS A;  3O88 A;  1T1B A;  1OTE A;  3BFE A;  3LI8 A;  3UE3 A;  4WBG A;  3JVV A;  1LSX A;  3P09 A;  3BLS A;  2B18 A;  3TRC A;  5EM0 A;  4LCM A;  3PBN A;  4A5R A;  2VGJ A;  1KGE A;  1NZU A;  3QP2 A;  1MY8 A;  2L1M A;  4KEN B;  2BAS A;  2J3T C;  2PYR A;  2L4R A;  3EGX C;  3IS2 A;  1W8Q A;  1CQA A;  5DVA A;  4R23 A;  1H8Z A;  3M6B A;  3QNC A;  4HBU A;  3IX3 A;  4GDB A;  4DN0 A;  5MC7 A;  3IWQ A;  1P9R A;  3WS0 A;  3UPO A;  3KYE A;  4IUK A;  1SCW A;  1MBL A;  3PBR A;  1JWZ A;  4WF0 A;  1LT0 A;  2WKP A;  3PAG A;  4HP4 A;  4JF6 A;  3PTE A;  4HH3 A;  1DY6 A;  3C7V A;  1RCJ A;  2RCX A;  5FDH A;  4X53 A;  3VFH A;  4BD0 A;  4HI4 A;  1IOU A;  3CG5 A;  1IEL A;  4BMW A;  2W1T A;  3V39 A;  4MMN A;  1SKF A;  2EXA A;  1U60 A;  2Y2Q A;  2VGL S;  2ZQ8 A;  2M7U A;  3UO9 A;  2EX8 A;  4ZDX A;  3HCY A;  3S22 A;  3TJZ C;  3KYQ A;  4JXS A;  2QKP A;  4QWO A;  1XA1 A;  4UAA A;  2V20 A;  2Y2G A;  2YKF A;  5KMW A;  5HAP A;  4IUH A;  4BBT A;  2BG1 A;  3IH9 A;  2HV1 A;  3UB7 A;  3DTK A;  4K0W A;  3MKF A;  3MKE A;  5F69 A;  5E2G A;  1OJG A;  2QHK A;  3LR3 A;  5AVF A;  3H82 B;  5EFW A;  2Z2L B;  2XR0 A;  2Y2O A;  5FI2 A;  1ZHH B;  3CUE A;  4MBF A;  2V8C A;  5IHV A;  1K4F A;  5AQB A;  3RXX A;  3MXQ A;  3B47 A;  3VSK A;  3VP3 A;  3MZF A;  4XT2 B;  4BQM A;  4EW7 A;  3ZG9 B;  3GSG A;  1K4E A;  5L2F A;  4EXO A;  5TFQ A;  4C3Q A;  4OON A;  3HUM A;  3V50 A;  1EI5 A;  1ES2 A;  4N1H A;  5KSH A;  5AQ7 A;  2ZQ7 A;  1BT5 A;  1KE3 A;  4JF4 A;  1KOU A;  2H5S A;  4WZ5 A;  1T18 A;  1MKM A;  3IX8 A;  3FYZ A;  3ISG A;  4LPZ A;  3E4O A;  4Q0J A;  1TDG A;  2FZ0 A;  1OT6 A;  3T4O A;  1Q2P A;  2D01 A;  4Z9Q A;  4HBT A;  2WK0 A;  5A8B A;  3G32 A;  4WEL A;  3JYI A;  4KZ8 A;  5FQK A;  5FDS A;  2EWW A;  2A3U A;  5TGF A;  1K57 C;  4OPY A;  2Y4A A;  4Y0O A;  3Q81 A;  4MDZ A;  3LIF A;  2VGL M;  4KZ3 A;  4PKY A;  3VOY A;  2R9X A;  4R4R A;  4ETZ A;  3LGO A;  5HDS A;  1NYY A;  1KDW A;  5E2F A;  1E3U A;  3IXH A;  4Y15 A;  3GV9 A;  4OH0 A;  3VP4 A;  3IX4 A;  2LB9 A;  1A0K A;  3UB5 P; 
#chains in the Genus database with same CATH homology
 4R3J A;  3LO7 A;  4FH4 A;  1NRF A;  1FSW A;  3TSG A;  1IKI A;  1QMF A;  1TDL A;  1WE4 A;  3G35 A;  2X01 A;  1K6R A;  5CEC A;  1IYQ A;  5GHZ A;  1I2W A;  3LCE A;  3MZE A;  3W8K A;  1DJB A;  3A3I A;  4EBL A;  4GN2 A;  2XGN A;  3A3E A;  3A3J A;  4YIN A;  1ZG6 A;  3C7U A;  1K55 C;  3BFG A;  3Q7Z A;  4KQO A;  1S6R A;  2XD5 A;  4P6B A;  1KVL A;  2Q9M A;  1L0G A;  4F94 A;  4U3T A;  2Z2M B;  3WS5 A;  1BSG A;  4OLD A;  5CHM A;  5FQM A;  1ERQ A;  3UPP A;  5FI7 A;  4OPR A;  1E4D A;  3IH8 A;  3HLF A;  4OPZ A;  4BLM A;  2ZM2 A;  4EQI A;  3S4X A;  3LY3 A;  4PMA A;  1MWR A;  4OKP A;  4DDY A;  3ZFZ A;  3MFD A;  1NYM A;  4PM8 A;  1PYY A;  4JBF A;  5CGS A;  4KZ9 A;  5FQQ A;  2H10 A;  3Q07 A;  3W4O A;  1L0F A;  3ZG0 A;  3D4F A;  4U0T A;  3OPH A;  5J8X A;  1FCN A;  4OOL A;  3FV7 A;  3E2L A;  5FAS A;  4KZ7 A;  3WS4 A;  4DXB A;  3ZCZ A;  2XLN A;  2ZM8 A;  2P9V A;  4R1G A;  3HLD A;  2ZC6 B;  4YFM A;  2ZC5 B;  1L0E A;  3BEC A;  3IF6 C;  5GHX A;  1DJA A;  1LL9 A;  2Y2K A;  3BLM A;  4OQI A;  2ZQ9 A;  5EVI A;  5GLC A;  2EXB A;  1PW8 A;  5FSR A;  1S0W A;  3WWX A;  1XXM A;  3FKW A;  1NY0 A;  2ZJ9 A;  3OCN A;  1ESI A;  3QHY A;  4WYY A;  4X69 A;  1G68 A;  2EX9 A;  2DRW A;  1H8Y A;  2OLU A;  5KSC A;  5HX9 A;  1FSY A;  3O3V A;  1HVB A;  4QHC A;  5KZH A;  4KG6 A;  4LCL A;  2XQZ A;  2ZQA A;  2ZD8 A;  1YLZ A;  4P85 A;  3SOI A;  1JWP A;  5DF9 A;  1VQQ A;  1LI9 A;  5CRF A;  4S2O A;  3N4I A;  1L2S A;  5JYP A;  1BLC A;  4BL3 A;  1W5D A;  1IYO A;  1JTD A;  3IXG A;  4QY5 A;  4S2P A;  1M6K A;  4LEN A;  4UA9 A;  2RL3 A;  4KQQ A;  1YM1 A;  4M3K A;  1MWS A;  3GRJ A;  1YQS A;  3PAE A;  1RGY A;  5JYO A;  1OME A;  5HFO A;  2GDN A;  4EBN A;  3IF6 B;  4E3I A;  2HPB A;  4GD6 A;  3S1Y A;  2B5R A;  2WGW B;  2Y2I A;  3IWO A;  5DTT A;  3VSL A;  4JLF A;  2WAD A;  3BFC A;  3ZNT A;  1HZO A;  4FH2 A;  2WGV A;  3RXW A;  2JBF A;  1NJ4 A;  3GR2 A;  3ZNY A;  4Y0U A;  4ZJ1 A;  3OZH A;  4UA6 A;  4RX3 A;  1O07 A;  4DE0 A;  4E3L A;  4OPQ A;  2WKE A;  3ZVW A;  5A90 A;  1NXY A;  1BTL A;  5EUA A;  4BD1 A;  2EFX A;  4PPR A;  5CTM A;  4PM5 A;  3WS1 A;  4S2I A;  3G34 A;  3GMW A;  2ZM0 A;  1BLH A;  1W7F A;  1M40 A;  3A3D A;  3M2J A;  1FOF A;  3MXS A;  3QNB A;  4XUX A;  3Q7V A;  3V5M A;  1LHY A;  4MBH A;  2ZMA A;  4B88 A;  5DF7 A;  5I94 A;  4JF5 A;  2J8Y A;  5F83 A;  3NCK A;  5A92 A;  3HL9 A;  5M18 A;  3MBZ A;  4XUZ A;  3E2K A;  3SH8 A;  3SS4 A;  1XX2 A;  5HAI A;  4JPM A;  1AXB A;  2XH9 A;  3W4P A;  5F1F A;  1KGG A;  4E3J A;  1XGJ A;  4JXG A;  4LV1 A;  3SS3 A;  4WEJ A;  2IWD A;  5GLD A;  1H5X A;  4DE2 A;  5DTK A;  4LV3 A;  5EVI C;  4ZJ3 A;  4K91 A;  4DE1 A;  1BLS A;  3BFF A;  2V2F F;  3DW0 A;  3EQU A;  1GHP A;  4QJG A;  4P0M A;  5EEC A;  3ZDJ A;  2Q9N A;  2PU2 A;  4IBX A;  1SDE A;  2XK1 A;  2ZQD A;  4S2M A;  1FR1 A;  5AQ9 A;  4JXW A;  2QMI A;  2Y2P A;  3O86 A;  5CGX A;  4E6W A;  5G18 A;  3BRM A;  3WS2 A;  1IYS A;  1N4O A;  4MLL A;  1MWU A;  1BZA A;  3P98 A;  1ERM A;  1ES5 A;  1ESU A;  3DWZ A;  1GHI A;  5CXW A;  1VM1 A;  3UDF A;  3G4P A;  2FFF B;  3V3R A;  4DE3 A;  3GQZ A;  4D2O A;  3N8R A;  2EX2 A;  4NK3 A;  1CEF A;  2WUQ A;  4MNR A;  2Y55 A;  2WZZ A;  5CER A;  4N9L A;  4WZ5 C;  4OVD A;  4MEZ A;  2XF3 A;  3IF5 A;  4PM9 A;  4Y0T A;  2XFT A;  3NC8 A;  4RYE A;  1N9B A;  5A91 A;  1ZC2 A;  1IYP A;  2HDU A;  5AQA A;  2E8I A;  2J7V A;  4RVA A;  2DNS A;  3C4O A;  4BEN A;  4OLG A;  2X71 A;  4K0X A;  1FCO A;  5EOO A;  1TVF A;  4RX2 A;  4GB7 A;  4L0L A;  4QB8 A;  4GKU A;  1HTZ A;  4S2N A;  4OQG A;  1CI8 A;  4GZB A;  3IXD A;  1KE4 A;  2Y2L A;  5CGW A;  3AGD A;  3PBS A;  1ONG A;  3W4Q A;  3ITB A;  3TOI A;  1K56 D;  4PM6 A;  4FSF A;  2JC7 A;  2WYX A;  3VP1 A;  5D3O A;  5HAQ A;  5FAT A;  4ID4 A;  3SH9 A;  3HRE A;  2UWX A;  1GCE A;  2OLV A;  5TR7 A;  4KG2 A;  1I2S A;  4B4Z A;  3CJM A;  4P87 A;  3LEZ A;  4HEF A;  4OOM A;  2IWC A;  1K57 A;  4DXC A;  1K6S A;  3ZG5 A;  1IKG A;  5EE8 A;  1SHV A;  5DTS A;  2XFS A;  3O88 A;  4NET A;  1K54 A;  1XP4 A;  4WMC D;  3GVB A;  3BFE A;  3CZD A;  3IXB A;  4E6X A;  1RGZ A;  3ITA A;  1EWZ A;  1PI5 A;  1YMX A;  3BFD A;  3UE3 A;  4MBK A;  4WBG A;  4S2L A;  3HBR A;  3VFF A;  3Q1F A;  3A3F A;  3P09 A;  1MPL A;  4U0X A;  2QZ6 A;  1JTG A;  1O7E A;  3BLS A;  3RJU A;  4WMC A;  3V3S A;  5A93 A;  2OSU A;  3CMZ A;  4LCM A;  1MKI A;  4WM9 A;  1JWV A;  2EX6 A;  4QY6 A;  2XEP A;  4KZB A;  1PWG A;  4QU3 A;  4WEK A;  3NI9 A;  3PBN A;  1KVM A;  1PIO A;  2BLS A;  2I72 A;  3FZC A;  4KG5 A;  4A5R A;  5CTN A;  1YLY A;  2VGJ A;  3G31 A;  3ZGA B;  1KGE A;  1NZU A;  4QD4 A;  1MY8 A;  4KEN B;  1YT4 A;  5CED A;  5U47 A;  4IED A;  2H0T A;  3C4P A;  3N8L A;  1PI4 A;  2Y59 A;  4DDS A;  3MXR A;  5FAP A;  3IHB A;  3AGF A;  1LL5 A;  1W8Q A;  4ZAM A;  2EFU A;  5DVA A;  3BEB A;  3GTC A;  4R23 A;  1YLJ A;  1IEM A;  3M2K A;  1Z6F A;  3HLE A;  4LV0 A;  4E3M A;  4JKT A;  3DTM A;  3UE0 A;  3PBT A;  1H8Z A;  3M6B A;  1G6A A;  4S2N C;  3QNC A;  4HBU A;  4DRT A;  5CEB A;  5FI6 A;  4GDB A;  1L0D A;  4ZTK A;  5DF8 A;  4JXV A;  3HUO A;  3IWQ A;  5FQ9 A;  1HD8 A;  3G2Z A;  3OPL A;  3UNW A;  3WS0 A;  2Y2H A;  4KZ5 A;  3UPO A;  1SCW A;  1ALQ A;  1MBL A;  3PBR A;  4UHU A;  2ZC3 B;  1JWZ A;  1ZKJ A;  1KDS A;  3MZD A;  3NIA A;  4C75 A;  5E43 A;  5FA7 A;  1K25 A;  1FQG A;  3FWL A;  1GA0 A;  1WYC A;  4KQR A;  5F1G A;  2G2U A;  1FCM A;  3PAG A;  4CJN A;  1GA9 A;  4E3O A;  5CHJ A;  2JE5 A;  3NY4 A;  5E2E A;  4PM7 A;  2DCF A;  3IF6 A;  4JF6 A;  3PTE A;  2WGW A;  1DY6 A;  3C7V A;  5GL9 A;  2R9W A;  1RCJ A;  3WRT A;  4X55 A;  1E3U D;  2RCX A;  4X53 A;  5FDH A;  3VFH A;  4BD0 A;  4O7D A;  3N6I A;  5CHU A;  4DF6 A;  3TG9 A;  2WZX A;  1YLW A;  1KE0 A;  4BJP A;  3VOZ A;  3CG5 A;  2JCH A;  3ZG7 B;  3AGE A;  1PZP A;  3LY4 A;  4Q8I A;  1IEL A;  1XKZ A;  1CK3 A;  2P9V B;  3OCL A;  3V39 A;  1ERO A;  1SKF A;  2P74 A;  3IHA A;  1ZG4 A;  2EXA A;  1U60 A;  2Y2Q A;  3NBL A;  5M1A A;  2ZQ8 A;  3UO9 A;  2EX8 A;  5FQI A;  4BL2 A;  4ZDX A;  1PW1 A;  4EWF A;  1JVJ A;  1GHM A;  4Y7P A;  5EVI B;  3S22 A;  1ES4 A;  1CEG A;  2HP6 A;  4OQ0 A;  2ZC7 A;  1MWT A;  5GLB A;  4ZBE A;  1TEM A;  4JXS A;  4RA7 A;  3WRZ A;  4CPK A;  2PBY A;  1ONH A;  3VMA A;  3OPR A;  1XA1 A;  3ZG8 B;  4UAA A;  2V20 A;  4X56 A;  2WAE A;  2Y2G A;  5HL1 A;  5KMW A;  5HAP A;  3UY6 A;  3NDG A;  3OC2 A;  3HLG A;  2BG1 A;  3IH9 A;  1KGF A;  4R4S A;  5E2H A;  4EUZ A;  1MXO A;  1WYB A;  4K0W A;  3BM6 A;  5HAR A;  3HVF A;  3MKE A;  3HLW A;  3HLB A;  3MKF A;  4E3K A;  1K56 A;  1SDN A;  4R3B A;  5E2G A;  5F82 A;  1I5Q A;  3O87 A;  3M6H A;  2WAF A;  4R0Q A;  2OV5 A;  2X02 A;  3SS5 A;  5HW3 A;  2Y91 A;  5EPH A;  1YLP A;  2Z2L B;  2XR0 A;  5EVI D;  2H0Y A;  2J9O A;  2ZC4 B;  2C6W B;  1RP5 A;  2Y2O A;  4GOG A;  2HDS A;  5FI2 A;  4MBF A;  5GLA A;  3ZHH A;  5BOH A;  1BUL A;  2J9P A;  2Y2M A;  4LV2 A;  1XA7 A;  1J9M A;  3ZVT A;  5IHV A;  4UA7 A;  4XXR A;  1XPB A;  1K4F A;  2WKI A;  3IQA A;  3PBO A;  5AQB A;  3RXX A;  4N9K A;  1CI9 A;  1W8Y A;  2A49 A;  4GD8 A;  2C5W B;  4B4X A;  3VSK A;  2CC1 A;  3VP3 A;  3MZF A;  4BQM A;  3ZG9 B;  3GSG A;  1K4E A;  5L2F A;  1FR6 A;  1LLB A;  3Q7V B;  4N92 A;  3UDX A;  5TFQ A;  5FAQ A;  4C3Q A;  5M19 A;  2HDR A;  4OON A;  2FFY A;  3HUM A;  3OPP A;  5FQJ A;  3V50 A;  1EI5 A;  5EVL A;  3N7W A;  1ES2 A;  1K38 A;  4N1H A;  5AQ7 A;  3UN7 A;  1PZO A;  4WZ4 A;  5KSH A;  2ZQ7 A;  3VP0 A;  1BT5 A;  3C5A A;  1KE3 A;  2Y2J A;  2H5S A;  2HP5 A;  1K55 A;  4JF4 A;  4OQH A;  4WZ5 A;  4DKI A;  3HLC A;  3Q82 A;  3FYZ A;  4FD8 A;  1C3B A;  2V1Z A;  4N1X A;  3DWK A;  3ISG A;  4GNU A;  4OP8 A;  2HP9 A;  2XD1 A;  1TDG A;  2HDQ A;  3NDE A;  2Y2N A;  3G2Y A;  1Q2P A;  4X68 A;  4EV4 A;  4FCF A;  4Z9Q A;  1DJC A;  4ZJ2 A;  4S2K A;  4KZ4 A;  3N8S A;  1BLP A;  4HBT A;  2WGI A;  2WK0 A;  1ES3 A;  5GHY A;  3G32 A;  4WEL A;  3IT9 A;  1YLT A;  1NZO A;  1PWD A;  3JYI A;  4KZ8 A;  5FQK A;  3SH7 A;  2A3U A;  4GDN A;  4IBR A;  5TGF A;  1K57 C;  3FKV A;  4H8R A;  1YMS A;  4HES A;  3B3X A;  2QPN A;  2IWB A;  4OPY A;  1K54 C;  2VGK A;  2Y4A A;  4Y0O A;  3Q81 A;  3UDI A;  2G2W A;  4X6T A;  2ZLY A;  1BUE A;  4KZ3 A;  2ZQC A;  5FAO A;  1W79 A;  1XGI A;  3VOY A;  1PWC A;  2R9X A;  5EOE A;  4R4R A;  1LI0 A;  3UE1 A;  1NYY A;  4C6Y A;  1Q2Q A;  1KDW A;  5E2F A;  3BYD A;  4IVI A;  4KZ6 A;  4E3N A;  1QME A;  1Y54 A;  4EBP A;  4OP5 A;  3I7J A;  4KZA A;  3G30 A;  4IVK A;  2XDM A;  1E3U A;  3UPN A;  3IXH A;  4OOY A;  2WKH A;  3GV9 A;  1E25 A;  3HUN A;  4OH0 A;  2PU4 A;  3VP2 A;  3VP4 A;  3PBQ A;  3EQV A;  4S2J A;  3IWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...