1DJCA

Structure of beta-lactamase precursor, s70a mutant, at 120k
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 91
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djcA00
3OPPA 4KQQA 3UE0A 3WS0A 1JVJA 2HDRA 5TFQA 2ZM2A 3C5AA 4WZ5A 2EFUA 3MZDA 2Y91A 4QY6A 5A91A 4K91A 1BT5A 4DF6A 2XFTA 4WM9A 3WWXA 1YLPA 5KZHA 4FH2A 4ZJ1A 1MY8A 1E4DA 3DW0A 3VOYA 1RP5A 1LLBA 3IH9A 5E43A 2P9VA 4BD0A 4WMCA 5FQJA 2R9WA 5FASA 1ES3A 2QMIA 3C4OA 1YLWA 4OONA 1GA0A 3OPLA 4QD4A 1BUEA 3BLMA 3LY4A 5CXWA 5CHUA 1E3UA 1H8YA 2JC7A 5DTSA 5AQAA 1AXBA 3P09A 5IHVA 2ZQ7A 3UDXA 2J7VA 3QHYA 1FCNA 4KQRA 2OV5A 2Y2JA 1PWDA 4ZBEA 4GZBA 3PAGA 1MXOA 4QB8A 4OQ0A 4BENA 5CEBA 1MKIA 3N7WA 3IT9A 2QPNA 4E6WA 2OLVA 5F1FA 1NZUA 2HDSA 2BG1A 4JPMA 5EVIC 4OVDA 5HAIA 2Y2LA 3IH8A 1ES5A 3WRZA 3VSKA 4Y0OA 1PWCA 2ZC4B 4X55A 3GR2A 5JYOA 5EE8A 2XH9A 1K56D 1ESUA 2VGKA 4C75A 4UA7A 3MKFA 4OKPA 4BQMA 4YINA 1CK3A 5TR7A 5CERA 3HLEA 1KE3A 1CEFA 1H8ZA 3CG5A 5FAOA 5GLDA 4U0XA 3HBRA 1PI5A 3G32A 3ZNTA 1IYOA 1IKGA 4GDBA 1KVMA 4K0XA 4A5RA 3RXWA 1BLHA 2XDMA 1ES2A 3D4FA 4BD1A 1L0DA 3HUOA 5M19A 1W8YA 2H10A 1N9BA 3W8KA 5EVID 1XXMA 1K54A 3CZDA 4P85A 4R4SA 1Z6FA 4U0TA 3SH7A 2E8IA 4R3BA 4H8RA 5KSHA 2ZJ9A 3IWOA 3FWLA 1DJAA 3E2KA 1SDNA 3BFCA 4S2KA 5A92A 5FSRA 1O07A 1W8QA 1XGIA 4B4ZA 3O88A 1K55A 3BFDA 5CGXA 1K6RA 4XXRA 2ZLYA 3HLWA 4E6XA 3IXGA 4S2MA 3WS2A 1WE4A 5EVIB 4UA6A 2IWCA 4S2OA 3G30A 1ONHA 4BL3A 4WEJA 2WKEA 1Q2QA 3LCEA 3GV9A 2WADA 5F1GA 1CI8A 4HESA 2Y2IA 1GA9A 1RGYA 3WRTA 4FH4A 3UDFA 1LL5A 4E3JA 1MWUA 3QNCA 1XA7A 4OPZA 5E2GA 2Y59A 3HL9A 3TOIA 1JTDA 4WMCD 4DKIA 2XEPA 1TDLA 3IWQA 3SOIA 1JWVA 2X02A 4KZ3A 3G35A 4KZBA 3ITAA 2ZQAA 4GDNA 4E3KA 1FSYA 5E2EA 3ZVWA 3BRMA 1IYPA 1FCMA 5JYPA 1YMSA 3N6IA 5CTNA 2WGWB 5J8XA 4GNUA 4L0LA 2C5WB 3UNWA 5CGSA 4ZAMA 4KZ6A 3P98A 4PM9A 3ZNYA 4S2NC 2HP9A 3VSLA 1GHMA 1LHYA 1Q2PA 2H0TA 4JKTA 3DTMA 3FKVA 3NDEA 3G4PA 1KGGA 3NC8A 2JE5A 4HBTA 2EX8A 2HP6A 1K4EA 3GVBA 3IF6C 4N1HA 5FQQA 1HTZA 1ERQA 1IKIA 5EVLA 5L2FA 3GSGA 1WYBA 4RYEA 3OC2A 1XP4A 4K0WA 4R3JA 5DTTA 2PU2A 1L0FA 4E3IA 3VOZA 3IQAA 5KMWA 3HUMA 3A3EA 3A3DA 4JXGA 5HARA 3GRJA 3M6BA 4HEFA 4DDYA 4QU3A 2WZZA 1K4FA 1FSWA 1SKFA 2ZQDA 2Z2LB 2ZM0A 4DRTA 1NJ4A 2V1ZA 5GL9A 3BM6A 2Y4AA 4GD6A 3N8SA 4JLFA 4CPKA 4WEKA 3UN7A 4LCLA 5EOEA 1JWZA 4R1GA 1YLZA 5FAPA 1U60A 5CGWA 3RJUA 4R23A 2XFSA 2RCXA 4ID4A 1NYMA 4LV0A 5A93A 3G2YA 2V20A 4OP5A 1SDEA 5BOHA 1L0EA 1LL9A 1YT4A 2Y2MA 1FCOA 3ZFZA 5CTMA 1GHPA 4EV4A 5HAPA 2QZ6A 3N4IA 5GLBA 2Y2HA 3VMAA 2X01A 2XQZA 3IXBA 5EPHA 1LI0A 2PBYA 3ZG0A 1ALQA 2H0YA 2HP5A 3IF6B 3NI9A 3Q7VB 3BFGA 2EX6A 3N8LA 4ZJ3A 5F83A 5U47A 4RVAA 4DE2A 1BLSA 1H5XA 3VP0A 1NRFA 1E25A 5M18A 2ZC6B 5HFOA 4P87A 3V39A 4BJPA 1LI9A 3HLCA 3AGFA 4E3MA 3LY3A 4FSFA 5EECA 2Y2OA 3Q82A 3PAEA 3UO9A 1ZKJA 1YLTA 2Y2PA 4S2PA 4N9LA 4UAAA 5FQIA 4EBPA 3VP2A 1C3BA 1TEMA 4B4XA 1QMEA 3GQZA 1VQQA 2Y2NA 3HLDA 5FAQA 3W4OA 1FOFA 1PIOA 2Y2QA 1S6RA 3FYZA 1DJCA 5FI6A 2DCFA 4Y7PA 3UDIA 4EBLA 5FQMA 3BFFA 5G18A 3V3SA 4WZ5C 4KZAA 3PBNA 5EOOA 3MZFA 2XLNA 3ZG9B 3E2LA 3MFDA 3BLSA 4MNRA 3UPPA 1GCEA 3O86A 3GTCA 4OPQA 5I94A 1K57A 4JF6A 1K6SA 3PBQA 5DF7A 4PPRA 1OMEA 2J9OA 2IWBA 2WKIA 4MBHA 3FV7A 4S2NA 4UHUA 1MWTA 3HUNA 4Y0UA 5E2HA 3IHAA 2J8YA 2WZXA 4OLDA 3NIAA 1EROA 2X71A 1XGJA 2FFFB 3Q7VA 3ITBA 2ZQ9A 4DDSA 3BYDA 1S0WA 4Y0TA 3Q07A 1DY6A 1KE4A 4B88A 2A49A 1YMXA 3TG9A 3CJMA 4Q8IA 1L0GA 4LV1A 2R9XA 3S4XA 3ZG5A 4IVIA 4JXSA 1HVBA 4P6BA 3OZHA 2B5RA 4NETA 4XUZA 4X6TA 1ESIA 3A3JA 3PTEA 1BZAA 1I2SA 4RX3A 4XUXA 1E3UD 2WAEA 1I5QA 1NYYA 4X56A 4C3QA 1ZC2A 1Y54A 4X69A 3RXXA 3AGDA 3PBOA 1K56A 1PWGA 1PYYA 2JCHA 4OLGA 3EQUA 4S2LA 3I7JA 3Q81A 1L2SA 3DWKA 3MZEA 3SS4A 3W4PA 4DXCA 4LV3A 2P9VB 3M2JA 1SHVA 1ONGA 2C6WB 1TDGA 3PBTA 2HDUA 4N92A 4QHCA 4FD8A 5GLAA 3ZCZA 5DTKA 2Q9NA 3PBRA 1K54C 4CJNA 2RL3A 2G2WA 1NZOA 4F94A 2WUQA 2PU4A 5EVIA 3OPHA 5FDHA 4HBUA 3IWIA 3C7UA 3EQVA 4PM8A 2ZQ8A 2XD1A 1ES4A 3PBSA 5FQKA 1K25A 5F82A 1NXYA 3BEBA 3UE1A 4JXVA 3WS4A 4EWFA 5HW3A 4WELA 1K55C 2H5SA 5GHZA 1GHIA 5CHJA 1BSGA 3OPRA 3VP4A 1DJBA 1ZG6A 2HPBA 3ISGA 3V5MA 1EI5A 3SH8A 4P0MA 4S2IA 4MEZA 4IVKA 3IHBA 3NY4A 1XKZA 3SH9A 4KZ5A 2UWXA 4N9KA 4NK3A 1W79A 1PZPA 5DF9A 1YQSA 3GMWA 3IXHA 4FCFA 5FQ9A 4X53A 1IEMA 2ZC5B 2XF3A 3NCKA 4N1XA 3JYIA 5DVAA 2WKHA 2FFYA 4GB7A 2XD5A 2OLUA 4JF5A 4DE3A 2WGWA 4KENB 4OH0A 4EBNA 1ZG4A 4JXWA 1MPLA 3Q7ZA 3NDGA 3B3XA 1I2WA 2WYXA 4DE1A 3FKWA 4D2OA 1G68A 2ZC7A 4U3TA 1W5DA 1YLYA 3C4PA 1W7FA 4PM6A 4OP8A 3UPNA 3C7VA 4EUZA 1SCWA 4ZDXA 2DNSA 4R0QA 2XK1A 3HLGA 1WYCA 3DWZA 1M40A 2HDQA 3O3VA 4WBGA 3W4QA 3MKEA 4OPYA 3V50A 4KQOA 1BLCA 4IBRA 1O7EA 3M2KA 3UPOA 4OQGA 3VP3A 2WGVA 3OCLA 3FZCA 1KE0A 3NBLA 2BLSA 5GLCA 1CI9A 4YFMA 4BL2A 2IWDA 2ZM8A 2EXBA 4E3LA 4UA9A 4RX2A 4OOYA 2WAFA 5CRFA 3ZG8B 3SS5A 3IXDA 5AQ7A 4GOGA 3A3FA 5M1AA 2XGNA 1YLJA 1KVLA 3Q1FA 4DE0A 1FR1A 1IELA 3HVFA 1PW1A 2WK0A 5KSCA 4WYYA 5E2FA 4Z9QA 2EFXA 4GN2A 2EX9A 4JBFA 5HAQA 4LCMA 3G34A 1HZOA 4R4RA 4MBFA 4S2JA 1NY0A 1ERMA 3TSGA 1KGFA 4X68A 4OPRA 3IF6A 5AQ9A 4DXBA 4O7DA 3HLBA 4M3KA 1EWZA 3UY6A 3CMZA 1KGEA 1HD8A 2A3UA 2WGIA 3BFEA 2ZC3B 5FATA 2I72A 4RA7A 3V3RA 3VFFA 4KG2A 1PI4A 1VM1A 3M6HA 5GHXA 2OSUA 3ZG7B 4PM7A 3VP1A 4QJGA 1N4OA 2JBFA 2CC1A 2Y2GA 1BLPA 4MBKA 3ZDJA 2ZMAA 1RGZA 2Y2KA 4IBXA 4WZ4A 4E3NA 1YM1A 4PMAA 2Z2MB 5CECA 1MWSA 5HX9A 1KDSA 3A3IA 4EQIA 1G6AA 4KG5A 2G2UA 4LENA 1K38A 1QMFA 2EXAA 1CEGA 2XR0A 3HLFA 3ZVTA 5A90A 2Q9MA 3MXSA 4ZTKA 2DRWA 5FI2A 1KDWA 3UE3A 1FQGA 5TGFA 4KG6A 4C6YA 3MXRA 2VGJA 5EUAA 2ZD8A 5DF8A 1XA1A 4OQHA 5FA7A 5FI7A 3VFHA 1PW8A 4MLLA 3S22A 1MBLA 3SS3A 1JTGA 1BTLA 2P74A 2ZQCA 5HL1A 1MWRA 1IYQA 4KZ7A 3LO7A 1JWPA 1XX2A 3LEZA 4KZ9A 1BULA 2Y55A 2EX2A 1M6KA 4ZJ2A 4PM5A 2GDNA 1IYSA 4IEDA 4BLMA 4JF4A 4OQIA 1RCJA 5AQBA 5GHYA 1K57C 3G31A 3G2ZA 5CHMA 3MBZA 1TVFA 5CEDA 4E3OA 4OOLA 3AGEA 4QY5A 4LV2A 3ZHHA 3N8RA 3IF5A 2V2FF 4GKUA 3BECA 1FR6A 3S1YA 4GD8A 3OCNA 2J9PA 1PZOA 3WS5A 3HREA 5D3OA 3ZGAB 4KZ8A 3O87A 1XPBA 3QNBA 1J9MA 4OOMA 4KZ4A 3WS1A
chains in the Genus database with same CATH superfamily
1T1AA 3C5AA 4I39A 5A91A 2GNXA 5K5BA 1BT5A 3WWXA 1YLPA 4MMNA 3KSGA 3VOYA 2Y8HA 3LIEA 3IH9A 4P6ZS 4ETZA 1F5MA 4MDZA 4QD4A 2GZAA 1E3UA 3P09A 3QHYA 1PWDA 4ZBEA 4OQ0A 3CWFA 1N9NA 3N7WA 2QPNA 1NZUA 4JPMA 3U2AA 4OVDA 5JYOA 2XH9A 3L7HA 1K56D 1GSXA 4UA7A 4OKPA 4YINA 3CLOA 1KE3A 1CEFA 1G5UA 5GLDA 3ZYTA 3G32A 4GDBA 1KVMA 2XDMA 3QP5A 1W8YA 3E98A 4Q0HA 4I38A 2VV6A 1K54A 3CZDA 4FOFA 2OWJA 4HJ4A 4U0TA 3IWOA 2V0UA 1XGIA 1K6RA 3CITA 4I3JA 4XXRA 2R78A 4Y15A 4NXBA 4EERA 1ONHA 2PYPA 2WADA 4G3VA 4HESA 2Y2IA 1GA9A 4ARZB 4F3LB 3UDFA 3HL9A 3TOIA 1N9LA 3SOIA 3LR0A 3MSHA 3BRMA 1FCMA 1IFQA 5JYPA 5CTNA 2WGWB 5EM1A 5CGSA 4ZAMA 5HPIA 1Z09A 4L9GA 3DTKA 1GHMA 1LHYA 3DTMA 5EV0A 3G4PA 2JE5A 2EX8A 3IF6C 3GVBA 5EVLA 5L2FA 3T1XA 3GSGA 1FIKA 3OC2A 2M7UA 3IQAA 5KMWA 3A3EA 4JXGA 5HARA 4ARZA 4F3LA 3GRJA 3M6BA 4HEFA 4DDYA 4QU3A 3P7NA 3PYPA 1SKFA 1S66L 2AVXA 4DRTA 4EU0A 2V1ZA 5GL9A 3BM6A 3N8SA 2OAQ1 5EVEA 3OOVA 4BBVA 1YLZA 4R23A 4HHDA 2V20A 5BOHA 1SDEA 3MXQA 1X0OA 1XJ3A 1GHPA 1F2KA 3CUEC 2Y2HA 3RTYA 2X01A 3IXBA 3CPTB 3IF6B 3BFGA 5U47A 4DE2A 1H0MA 1E25A 5M18A 2ZC6B 3AGFA 2Y2OA 3Q82A 3UO9A 5FQIA 4EBPA 4B4XA 3KSFA 1PIOA 4Y17A 2Y2QA 1S6RA 1DJCA 3QP6A 3UDIA 4KZAA 2I9VA 3LR3A 3MZFA 2OOLA 2XLNA 3E2LA 2Y79A 4MNRA 4GHIA 4OPQA 5L09A 1GSWA 4JF6A 5HDCA 4PPRA 1OMEA 3FV7A 3T4OA 3HUNA 4Y0UA 5TBMA 1EROA 2FFFB 4HQAA 3EOIA 1LL8A 2QYBA 4R38A 3TG9A 1CJFA 4WL9A 1DP9A 4LGWA 5IU1A 2ZBBA 4P6BA 5TJJA 2W0NA 1BZAA 4XUXA 2WKQA 2WAEA 1I5QA 4C3QA 4GW9A 1Y54A 4X69A 3JVUA 3PBOA 1K56A 1PWGA 3QP4A 1W63Q 3EQUA 4R3AA 4S2LA 3Q81A 1L2SA 3LICA 3PBTA 5J4EA 4FD8A 5F69A 2VV8A 2Q9NA 4NXGA 3T12B 4IJGA 2PU4A 3OPHA 5HDDA 1FILA 3UE1A 4JXVA 3IX3A 5CHJA 1BSGA 3OPRA 2V0WA 2HPBA 3ISGA 3V5MA 1EI5A 2D02A 3C8CA 4S2IA 1ZHHB 2XRNA 2UWXA 5DF9A 4N9KA 4YOFA 4FCFA 3IXHA 1IEMA 2W27A 4Q0IA 5DVAA 4QPRA 4OH0A 4KENB 1I2WA 1G68A 2ZC7A 5IS1A 4JGPA 2M7VA 4EUZA 4ZDXA 1OTEA 4GLQA 1WYCA 1A0KA 1M40A 4ESPA 4NG2A 4IBRA 4NEED 3IX8A 1CI9A 1P9RA 4BL2A 4EETB 2EXBA 2LB5A 2WAFA 2XGNA 3NOTC 2PYRA 3T50A 1FR1A 1XFQA 1PW1A 4II7A 2EWVA 4Z9QA 2EX9A 5HAQA 4PKYA 5AQ9A 1YSPA 3HLBA 3ZCZA 4ZRRA 3R4KA 5FATA 3ZG7B 2OSUA 3VP1A 2Y2GA 4CLCE 4MBKA 1D06A 1S4RA 1GSVA 3A3IA 2J3TC 4KG5A 4LENA 3ZVTA 2EXAA 2XR0A 3S7NA 3MXSA 1FQGA 5TGFA 2ZD8A 4DN0A 4JGOA 1V9ZA 4OQHA 4R70A 2O9BA 4HJ3A 1MWRA 2YKFA 1JWPA 2VX8A 2PHYA 1BULA 2HGVA 5J3WA 4LFUA 1VETA 4OQIA 5HSQA 5AQBA 3G2ZA 3G31A 3IS2B 2JKTI 4HP9A 3AGEA 4DMZA 4QWOA 2V2FF 3PR6A 3OCNA 1LSXA 3VOLA 2QHKA 2VK3A 5TFQA 2ZM2A 3MZDA 2Y91A 2XFTA 1BYWA 3UB8A 4ZJ1A 1RP5A 5E43A 1WA9A 3VE4A 4BD0A 4WMCA 2R9WA 2V1AA 1YLWA 1GA0A 1IOUA 1AXBA 3MMHA 3UDXA 2J7VA 1P0ZA 1FCNA 2OV5A 4QB8A 4BENA 2OLVA 3LIFA 3IH8A 1ES5A 3WRZA 3BJNA 4RQ9A 4Y0OA 3DAVA 1T19A 1CK3A 5TR7A 4EXOA 1H8ZA 1OTAA 3CG5A 5FAOA 4U0XA 4GS9B 1D1JA 2B95A 4BD1A 3HUOA 5M19A 3KO6A 2H10A 1OTDA 3TJZC 1OTBA 2W3DA 3SH7A 1L3LA 4H8RA 3KX0X 5KSHA 3QP1A 3E2KA 2P08A 5A92A 4B4ZA 1K55A 5CGXA 3HLWA 1DP8A 3IXGA 2VGLS 4UA6A 2IWCA 2NUPC 2WKEA 1CI8A 4EUVA 3LEQA 2XSSA 2P04A 4E3JA 5E2GA 1XJ4A 3JVVA 4P6ZM 4DKIA 1JWVA 2X02A 2ZMVA 2W1TB 4KZ3A 1TD5A 3EWKA 4KZBA 2PAVP 1FSYA 1YPRA 5E2EA 3ZVWA 2Z6CA 1DRMA 3F1OA 1IYPA 1YMSA 3N6IA 2C5WB 4LLOB 3UNWA 3VSLA 1Q2PA 5LBRA 1KGGA 3NC8A 1IKIA 2V1BA 1HLUP 4K0WA 3DTIA 1L0FA 4E3IA 3K3DA 5I5LA 3A3DA 3B47A 2WZZA 1K4FA 2ZQDA 4H6JA 3LI9A 3H82A 1OJGA 2ZM0A 5DKLA 2Y4AA 4JLFA 4LCLA 2W1TA 3C38A 1XFNA 5CGWA 5A93A 4KUOA 2GX5A 3G2YA 1YT4A 2QJ5A 4HH2A 4K08A 3ZFZA 5MC7A 2QZ6A 3N4IA 3VMAA 4O0PA 5EPHA 2PBYA 3ZG0A 1ALQA 3NI9A 2B18A 2EX6A 3VP0A 1NRFA 4ME4A 3HLCA 2DMWA 3LY3A 5EECA 3BW6A 5IT5A 1YLTA 4S2PA 3VP2A 5FAQA 3W4OA 2A24B 3FYZA 5FI6A 4Y7PA 4WZ5C 3PBNA 5EOOA 2OWHA 3KYQA 3MFDA 3UPPA 1S1ZA 1GCEA 3CI6A 3GTCA 2PD7A 5I94A 5DF7A 3S7QA 2W3EA 4BBUA 2WKIA 1MWTA 3E4OA 2J8YA 2WZXA 3NIAA 1XGJA 3ITBA 2HF6A 2EWWA 3BYDA 3SW1A 3Q07A 1YMXA 4GCZA 2QWSA 3CJMA 3E4PA 5G4YA 3E0YA 4JXSA 4FTXA 2B5RA 4NETA 4LRYC 2BTFP 4RX3A 1UWPX 1NYYA 2ZMFA 3RXXA 1EW0A 3DWKA 3MZEA 3SS4A 3W4PA 2K31A 2P9VB 2W3HA 1SHVA 1P9WA 2C6WB 2D01A 5GLAA 5DTKA 4CJNA 2G2WA 3MQOA 4HBUA 2ZQ8A 4NXFA 3T1SA 1K25A 5F82A 4EWFA 2H5SA 5GHZA 4I3AA 1ZG6A 3SH8A 4P0MA 3IHBA 3NY4A 2M1CA 4KZ5A 4NK3A 5FDSA 1W79A 1PZPA 3GMWA 2XF3A 1XJ6A 3FPWA 3JYIA 2FFYA 3MF0A 2WGWA 1MZUA 3BQAA 4JXWA 2VA0A 3B3XA 3H9WA 4DE1A 4D2OA 4U3TA 3C4PA 3FC7A 4OP8A 5HPFA 3C7VA 1SKOB 1SCWA 3CAXA 3HLGA 4KUKA 3IBJA 3UPOA 4OQGA 4YFMA 2ZM8A 5DJTA 3MQQA 2WK0A 5E2FA 2EFXA 4LCMA 1VB6A 4S2JA 1NY0A 3CPTA 2K2NA 3IF6A 1EWZA 3UB6A 1HD8A 2WGIA 1SKOA 3BFEA 4KG2A 1PI4A 1VM1A 4PM7A 2JKTM 3GECA 1STZA 4PMAA 1TS6A 5CECA 1G6AA 1Y4OA 2G2UA 1K38A 1CEGA 5A90A 1MC0A 1YKDA 3UB7A 3UE3A 1ODVA 1PRQA 5DF8A 3LR5A 1XA1A 4X1LA 1PW8A 5HZHA 3SS3A 3CUEA 2ZQCA 3B42A 4B9OA 2J3TD 2Y55A 2GDNA 1IYSA 2JHEA 4IEDA 3IBRA 1RCJA 1K57C 5CEDA 4OOLA 4LV2A 3IF5A 2J9PA 4KZ8A 1XPBA 1P97A 3MJQA 4OOMA 4KZ4A 3OPPA 4KQQA 3UE0A 3WS0A 3D9YA 2HDRA 4K91A 4X25A 4DF6A 4WM9A 4L9FA 3MQ0A 1E4DA 1ES3A 2ZL1B 1PFLA 2QMIA 4OONA 3OPLA 1BUEA 3LY4A 5CXWA 5DTSA 5AQAA 5HDSA 5IHVA 2ZQ7A 4NKPA 5G4ZA 3NECA 4GZBA 1MXOA 5CEBA 5AVEA 3IT9A 4E6WA 5F1FA 1KOUA 2PRFA 2BG1A 5EVIC 1TS8A 4WN5A 4MN5A 2ZC4B 3GR2A 1T1BA 1ESUA 2J3WA 2VGKA 3ZQ5A 3MKFA 4KQDA 3NJAA 4BQMA 5CERA 3HLEA 2PDRA 2H28A 3HBRA 3KYZA 1IYOA 4K0XA 2KOIA 2ZOHA 4A5RA 3NOPC 3RXWA 3D4FA 3QP2A 1L0DA 2VV7A 1LSWA 3C30A 1XXMA 2QJ7A 4P85A 4R4SA 4UQIS 4R3BA 1SDNA 4BWIA 1VEUB 1W8QA 3O88A 2KDKA 3BFDA 2ZLYA 4S2MA 3WS2A 1WE4A 5EVIB 4BL3A 1TS7A 3T1RA 1Q2QA 3LCEA 3GV9A 5F1GA 4YWZA 1RGYA 1LL5A 1N9OA 1MWUA 1XA7A 4OPZA 2Y59A 3EGXC 1T18A 1ACFA 1JTDA 3S7PA 1V9YA 1NLZA 2ZQAA 3ULFA 3UMEA 1YAXA 3LIAA 5HD3A 2NUTC 4KZ6A 4PM9A 2H0TA 4JKTA 4HJ6A 3NDEA 4LRXC 3TRCA 4HBTA 1VEUA 5FQQA 4N1HA 1HTZA 4RYEA 4R3JA 2PU2A 5HL6A 3HUMA 3BWLA 2Z2LB 1NJ4A 4GD6A 4CPKA 1LSVA 1JWZA 4R6LA 3T4SA 2RCXA 4LV0A 1F98A 1L0EA 1LL9A 1FCOA 5L8MA 3IS2A 5CTMA 5HAPA 5GLBA 2IA2A 4Y3IA 2H0YA 2HP5A 2VGLM 1BLSA 5HFOA 4P87A 2Q0OA 4E3MA 3T4QA 5HWVA 3PAEA 1ZKJA 4N9LA 4UAAA 3GQZA 1VQQA 3HLDA 2XA7S 3EGDC 4Y2FA 3BFFA 5CX7A 3V3SA 3BLSA 3O86A 1J3WA 4MBHA 2BASA 5E2HA 4OLDA 4XT2B 4DDSA 4Z1WA 5L07A 1S0WA 1KE4A 4I3IA 4Q8IA 1OPXA 1G6OA 3OZHA 4GS9A 4X6TA 1ESIA 1I2SA 4X56A 5FEGA 3AGDA 4NXEA 2VZWA 2JCHA 3CHWP 4OLGA 4LV3A 1NWZA 3F1PB 3T1QB 2HDUA 3QP8A 4L9EA 4QHCA 1K54C 3JPUA 4D60A 1NZOA 4F94A 2WUQA 3EEHA 4PM8A 3IWIA 2XD1A 1ES4A 5FQKA 2P7JA 3KSIA 1NXYA 3WS4A 4WELA 1DJBA 3BY8A 4PHTA 5FEFA 1YQSA 3HJKA 5FQ9A 4X53A 4G3WA 3K3CA 2XD5A 2OLUA 4EBNA 1ZG4A 1MPLA 3NDGA 3RH8B 3S7OA 3FKWA 4MCWA 4Y13A 1W5DA 1YLYA 3F1PA 5HWWA 2FH5A 2Z6DA 4PM6A 3UPNA 2PR6A 2DNSA 4R0QA 2OAP1 4WF0A 3DWZA 2HDQA 3LYXA 4OPYA 3V50A 3M2KA 1Y28A 3G6OA 2WGVA 3OCLA 3NBLA 2BLSA 5AJGA 5GLCA 2IWDA 1CQAA 4OOYA 3ZG8B 3SS5A 3NHQA 1YLJA 2L4RA 3Q1FA 1OT6A 3EEAA 1IELA 3HVFA 2B02A 3HJIA 4GN2A 3G34A 4DJ2A 4R4RA 4BBTA 4O7DA 4M3KA 4HI4A 3CMZA 1KGEA 1TF1A 2A3UA 3VFFA 2ZC3B 1SZVA 2I72A 2KLIA 5L10A 2WKPA 4QJGA 2JBFA 1BLPA 2ZMAA 4M4XA 1YM1A 1MWSA 2A24A 5AVFA 3H7WB 2PBDP 4HY8A 4JGRA 2Q9MA 5FI2A 2DRWA 2PD8A 3MFXA 4KG6A 2WKRA 3MXRA 2ACGA 4IHQA 5EUAA 4B93A 5FA7A 2FZ0A 3VE3A 1BTLA 2P74A 3E4QA 5HL1A 3LO7A 1XX2A 1MKMA 4G3KA 2EX2A 1UGUA 1OJ5A 3MS6A 3RFBA 4X1MA 4BLMA 3K2NA 4JF4A 3MBZA 4E3OA 3N8RA 3BECA 3S1YA 4GD8A 4O01A 3WS5A 3HREA 5D3OA 3O87A 2PT7A 1ZTUA 3OLOA 4PKYG 1J9MA 2A2LA 4HOIA 3H7WA 4IUHA 1JVJA 3VV4A 4WZ5A 2EFUA 4QY6A 3UB5P 4BMWA 5KZHA 4FH2A 1MY8A 3BQ8A 2O9AA 3DW0A 1LLBA 4EEPA 2P9VA 5FQJA 5FASA 2JKRM 2VJWA 3C4OA 3TE8A 2VEAA 1H3QA 3BLMA 5CHUA 1H8YA 2JC7A 1NRJA 4GHIB 1LT0A 3NULA 4KQRA 4MN7A 2Y2JA 2W3FA 3FPVA 3PAGA 4EW7A 1MKIA 5FL3A 5TBMB 2HJ9C 3T4LA 5HWTA 2HDSA 3P01A 5HAIA 2Y2LA 5F6AA 3VSKA 4PAUA 1PWCA 4UEYA 3T4KA 4X55A 5EE8A 4C75A 1PNEA 1S1YA 1PI5A 3ZNTA 1IKGA 1BLHA 1ES2A 3O5YA 2CMNA 3OBFA 1N9BA 5HD5A 3W8KA 5EVID 2K7SA 1Z6FA 3D72A 2E8IA 2ZJ9A 3FWLA 1DJAA 3BFCA 4S2KA 5FSRA 1O07A 1OTIA 4E6XA 4AFIA 2INWA 2V8CA 1G28A 2XROA 4S2OA 3G30A 4WEJA 2L1MA 1UWNX 3WRTA 4FH4A 4FUWA 3QNCA 5KIZA 4WMCD 2XEPA 1TDLA 3IWQA 3G35A 2O9CA 2JKGA 3ITAA 4GDNA 4E3KA 2HZ5A 5J8XA 4GNUA 4L0LA 4MN6A 3P98A 3ZNYA 4S2NC 2HP9A 4CLCD 3FKVA 2QKPA 5F5YA 2HP6A 1K4EA 3B33A 3LUQA 1K0KA 1ERQA 2GJ3A 1WYBA 1XP4A 5DTTA 5EM0A 3VOZA 3ICYA 2EA9A 1FSWA 4CQHA 3LIBA 2LB9A 4WEKA 3UN7A 5EOEA 3R7WB 4R1GA 5FAPA 3RJUA 1U60A 2XFSA 4ID4A 3LFVA 1NYMA 4UQIM 3A0RA 4OP5A 2Y2MA 4EV4A 1JNUA 2W1RA 2XQZA 1LI0A 1T1CA 3V67A 3A0SA 3Q7VB 3N8LA 4ZJ3A 5F83A 4RVAA 1H5XA 3DTEA 3V39A 4BJPA 1LI9A 5DKKA 3NOUC 4FSFA 2Y2PA 1C3BA 1TEMA 1QMEA 2Y2NA 4EESA 2O99A 1FOFA 2JKRI 2DCFA 4EBLA 4JGQA 2ZL1A 5FQMA 5G18A 3KSHA 2V8FA 3R7WA 5DFYA 3ZG9B 5EFWA 2JKFA 1CF0A 1K57A 1K6SA 3PBQA 2E8JA 3GDIA 2J9OA 2IWBA 4S2NA 4UHUA 3IHAA 2X71A 3Q7VA 3T4JA 2ZQ9A 1VETB 5C5KA 2YKHA 2J80A 4Y0TA 1D7EA 1DY6A 4B88A 2A49A 2MJ6A 1L0GA 4LV1A 2R9XA 4CLCC 2G7UA 3TW8A 3S4XA 3ZG5A 4IVIA 1HVBA 3L9KA 4XUZA 3A3JA 3PTEA 3IX4A 1E3UD 3D3OA 1ZC2A 1W63M 1AWIA 1PYYA 3I7JA 4DXCA 3M2JA 4EEUA 1ONGA 1TDGA 4GJ4A 2HV1A 4N92A 5F68A 3BY9A 3PBRA 2RL3A 5EVIA 4E04A 2W3GA 5FDHA 3C7UA 3EQVA 3MR0A 3FG8A 3PBSA 3BEBA 4CLCB 5HW3A 1K55C 2XA7M 1GHIA 2VLGA 3VP4A 4DJ3A 4MEZA 4IVKA 1H8MA 1XKZA 3SH9A 2ZC5B 3NCKA 4N1XA 1TS0A 2WKHA 4GB7A 3C2WA 3LGOA 4JF5A 4DE3A 2HJEA 4ETXA 4HNBA 4HP4A 3HCYA 2V9AA 3Q7ZA 2WYXA 4YNRA 3UE6A 3LR4A 1W7FA 2ZOIA 5J7EA 2XK1A 3T4TA 3LI8A 3O3VA 4WBGA 3W4QA 3MKEA 4KQOA 1BLCA 1O7EA 3VP3A 4CLCA 3FZCA 1KE0A 5DFXA 4E3LA 4UA9A 4RX2A 4Y5FA 5CRFA 4I5SA 3IXDA 5AQ7A 4GOGA 3A3FA 5M1AA 1KVLA 4DE0A 3PXPA 3KYEA 5KSCA 4WYYA 2KX6A 3F1NB 1VHMA 4JBFA 3LIDA 3UMDA 3DBAA 1HZOA 4MBFA 3TSGA 1ERMA 1KGFA 4X68A 4OPRA 3F1OB 4DXBA 2UV0E 4EQ1A 3UY6A 5A8BA 4RA7A 3V3RA 2L0WA 5GHXA 3M6HA 4WUJA 1N4OA 2CC1A 2O0YA 3ZDJA 4WLAA 4E3NA 1RGZA 2Y2KA 4IBXA 4WZ4A 4LRZE 2Z2MB 5HX9A 3A0VA 4LPZA 1KDSA 4EQIA 1QMFA 1XJ2A 3HLFA 4O8GA 4IUKA 4ZTKA 1KDWA 4C6YA 5DJUA 2VGJA 4H6JB 5FI7A 3H82B 3VFHA 1S67L 4MLLA 3S22A 1MBLA 1F9IA 1JTGA 2PR5A 3UB9A 1IYQA 3F1NA 4KZ7A 1DP6A 3LEZA 4KZ9A 4XT2A 1M6KA 1NLYA 4ZJ2A 4HIAA 4PM5A 4Q0JA 1OT9A 5GHYA 5CHMA 3PHYA 1TVFA 4QY5A 3ZHHA 4HH3A 4GKUA 1YSQA 1FR6A 3SZTA 1S4SA 1PZOA 3U4LP 3ZGAB 2JN7A 3QNBA 3W2ZA 3WS1A 2VKSA
chains in the Genus database with same CATH topology
3OPPA 4KQQA 3UE0A 3WS0A 1JVJA 2HDRA 5TFQA 2ZM2A 3C5AA 4WZ5A 2EFUA 3MZDA 2Y91A 4QY6A 5A91A 4K91A 1BT5A 4DF6A 2XFTA 4WM9A 3WWXA 1YLPA 5KZHA 4FH2A 4ZJ1A 1MY8A 1E4DA 3DW0A 3VOYA 1RP5A 1LLBA 3IH9A 5E43A 2P9VA 4BD0A 4WMCA 5FQJA 2R9WA 5FASA 1ES3A 2QMIA 3C4OA 1YLWA 4OONA 1GA0A 3OPLA 4QD4A 1BUEA 3BLMA 3LY4A 5CXWA 5CHUA 1E3UA 1H8YA 2JC7A 5DTSA 5AQAA 1AXBA 3P09A 5IHVA 2ZQ7A 3UDXA 2J7VA 3QHYA 1FCNA 4KQRA 2OV5A 2Y2JA 1PWDA 4ZBEA 4GZBA 3PAGA 1MXOA 4QB8A 4OQ0A 4BENA 5CEBA 1MKIA 3N7WA 3IT9A 2QPNA 4E6WA 2OLVA 5F1FA 1NZUA 2HDSA 2BG1A 4JPMA 5EVIC 4OVDA 5HAIA 2Y2LA 3IH8A 1ES5A 3WRZA 3VSKA 4Y0OA 1PWCA 2ZC4B 4X55A 3GR2A 5JYOA 5EE8A 2XH9A 1K56D 1ESUA 2VGKA 4C75A 4UA7A 3MKFA 4OKPA 4BQMA 4YINA 1CK3A 5TR7A 5CERA 3HLEA 1KE3A 1CEFA 1H8ZA 3CG5A 5FAOA 5GLDA 4U0XA 3HBRA 1PI5A 3G32A 3ZNTA 1IYOA 1IKGA 4GDBA 1KVMA 4K0XA 4A5RA 3RXWA 1BLHA 2XDMA 1ES2A 3D4FA 4BD1A 1L0DA 3HUOA 5M19A 1W8YA 2H10A 1N9BA 3W8KA 5EVID 1XXMA 1K54A 3CZDA 4P85A 4R4SA 1Z6FA 4U0TA 3SH7A 2E8IA 4R3BA 4H8RA 5KSHA 2ZJ9A 3IWOA 3FWLA 1DJAA 3E2KA 1SDNA 3BFCA 4S2KA 5A92A 5FSRA 1O07A 1W8QA 1XGIA 4B4ZA 3O88A 1K55A 3BFDA 5CGXA 1K6RA 4XXRA 2ZLYA 3HLWA 4E6XA 3IXGA 4S2MA 3WS2A 1WE4A 5EVIB 4UA6A 2IWCA 4S2OA 3G30A 1ONHA 4BL3A 4WEJA 2WKEA 1Q2QA 3LCEA 3GV9A 2WADA 5F1GA 1CI8A 4HESA 2Y2IA 1GA9A 1RGYA 3WRTA 4FH4A 3UDFA 1LL5A 4E3JA 1MWUA 3QNCA 1XA7A 4OPZA 5E2GA 2Y59A 3HL9A 3TOIA 1JTDA 4WMCD 4DKIA 2XEPA 1TDLA 3IWQA 3SOIA 1JWVA 2X02A 4KZ3A 3G35A 4KZBA 3ITAA 2ZQAA 4GDNA 4E3KA 1FSYA 5E2EA 3ZVWA 3BRMA 1IYPA 1FCMA 5JYPA 1YMSA 3N6IA 5CTNA 2WGWB 5J8XA 4GNUA 4L0LA 2C5WB 3UNWA 5CGSA 4ZAMA 4KZ6A 3P98A 4PM9A 3ZNYA 4S2NC 2HP9A 3VSLA 1GHMA 1LHYA 1Q2PA 2H0TA 4JKTA 3DTMA 3FKVA 3NDEA 3G4PA 1KGGA 3NC8A 2JE5A 4HBTA 2EX8A 2HP6A 1K4EA 3GVBA 3IF6C 4N1HA 5FQQA 1HTZA 1ERQA 1IKIA 5EVLA 5L2FA 3GSGA 1WYBA 4RYEA 3OC2A 1XP4A 4K0WA 4R3JA 5DTTA 2PU2A 1L0FA 4E3IA 3VOZA 3IQAA 5KMWA 3HUMA 3A3EA 3A3DA 4JXGA 5HARA 3GRJA 3M6BA 4HEFA 4DDYA 4QU3A 2WZZA 1K4FA 1FSWA 1SKFA 2ZQDA 2Z2LB 2ZM0A 4DRTA 1NJ4A 2V1ZA 5GL9A 3BM6A 2Y4AA 4GD6A 3N8SA 4JLFA 4CPKA 4WEKA 3UN7A 4LCLA 5EOEA 1JWZA 4R1GA 1YLZA 5FAPA 1U60A 5CGWA 3RJUA 4R23A 2XFSA 2RCXA 4ID4A 1NYMA 4LV0A 5A93A 3G2YA 2V20A 4OP5A 1SDEA 5BOHA 1L0EA 1LL9A 1YT4A 2Y2MA 1FCOA 3ZFZA 5CTMA 1GHPA 4EV4A 5HAPA 2QZ6A 3N4IA 5GLBA 2Y2HA 3VMAA 2X01A 2XQZA 3IXBA 5EPHA 1LI0A 2PBYA 3ZG0A 1ALQA 2H0YA 2HP5A 3IF6B 3NI9A 3Q7VB 3BFGA 2EX6A 3N8LA 4ZJ3A 5F83A 5U47A 4RVAA 4DE2A 1BLSA 1H5XA 3VP0A 1NRFA 1E25A 5M18A 2ZC6B 5HFOA 4P87A 3V39A 4BJPA 1LI9A 3HLCA 3AGFA 4E3MA 3LY3A 4FSFA 5EECA 2Y2OA 3Q82A 3PAEA 3UO9A 1ZKJA 1YLTA 2Y2PA 4S2PA 4N9LA 4UAAA 5FQIA 4EBPA 3VP2A 1C3BA 1TEMA 4B4XA 1QMEA 3GQZA 1VQQA 2Y2NA 3HLDA 5FAQA 3W4OA 1FOFA 1PIOA 2Y2QA 1S6RA 3FYZA 1DJCA 5FI6A 2DCFA 4Y7PA 3UDIA 4EBLA 5FQMA 3BFFA 5G18A 3V3SA 4WZ5C 4KZAA 3PBNA 5EOOA 3MZFA 2XLNA 3ZG9B 3E2LA 3MFDA 3BLSA 4MNRA 3UPPA 1GCEA 3O86A 3GTCA 4OPQA 5I94A 1K57A 4JF6A 1K6SA 3PBQA 5DF7A 4PPRA 1OMEA 2J9OA 2IWBA 2WKIA 4MBHA 3FV7A 4S2NA 4UHUA 1MWTA 3HUNA 4Y0UA 5E2HA 3IHAA 2J8YA 2WZXA 4OLDA 3NIAA 1EROA 2X71A 1XGJA 2FFFB 3Q7VA 3ITBA 2ZQ9A 4DDSA 3BYDA 1S0WA 4Y0TA 3Q07A 1DY6A 1KE4A 4B88A 2A49A 1YMXA 3TG9A 3CJMA 4Q8IA 1L0GA 4LV1A 2R9XA 3S4XA 3ZG5A 4IVIA 4JXSA 1HVBA 4P6BA 3OZHA 2B5RA 4NETA 4XUZA 4X6TA 1ESIA 3A3JA 3PTEA 1BZAA 1I2SA 4RX3A 4XUXA 1E3UD 2WAEA 1I5QA 1NYYA 4X56A 4C3QA 1ZC2A 1Y54A 4X69A 3RXXA 3AGDA 3PBOA 1K56A 1PWGA 1PYYA 2JCHA 4OLGA 3EQUA 4S2LA 3I7JA 3Q81A 1L2SA 3DWKA 3MZEA 3SS4A 3W4PA 4DXCA 4LV3A 2P9VB 3M2JA 1SHVA 1ONGA 2C6WB 1TDGA 3PBTA 2HDUA 4N92A 4QHCA 4FD8A 5GLAA 3ZCZA 5DTKA 2Q9NA 3PBRA 1K54C 4CJNA 2RL3A 2G2WA 1NZOA 4F94A 2WUQA 2PU4A 5EVIA 3OPHA 5FDHA 4HBUA 3IWIA 3C7UA 3EQVA 4PM8A 2ZQ8A 2XD1A 1ES4A 3PBSA 5FQKA 1K25A 5F82A 1NXYA 3BEBA 3UE1A 4JXVA 3WS4A 4EWFA 5HW3A 4WELA 1K55C 2H5SA 5GHZA 1GHIA 5CHJA 1BSGA 3OPRA 3VP4A 1DJBA 1ZG6A 2HPBA 3ISGA 3V5MA 1EI5A 3SH8A 4P0MA 4S2IA 4MEZA 4IVKA 3IHBA 3NY4A 1XKZA 3SH9A 4KZ5A 2UWXA 4N9KA 4NK3A 1W79A 1PZPA 5DF9A 1YQSA 3GMWA 3IXHA 4FCFA 5FQ9A 4X53A 1IEMA 2ZC5B 2XF3A 3NCKA 4N1XA 3JYIA 5DVAA 2WKHA 2FFYA 4GB7A 2XD5A 2OLUA 4JF5A 4DE3A 2WGWA 4KENB 4OH0A 4EBNA 1ZG4A 4JXWA 1MPLA 3Q7ZA 3NDGA 3B3XA 1I2WA 2WYXA 4DE1A 3FKWA 4D2OA 1G68A 2ZC7A 4U3TA 1W5DA 1YLYA 3C4PA 1W7FA 4PM6A 4OP8A 3UPNA 3C7VA 4EUZA 1SCWA 4ZDXA 2DNSA 4R0QA 2XK1A 3HLGA 1WYCA 3DWZA 1M40A 2HDQA 3O3VA 4WBGA 3W4QA 3MKEA 4OPYA 3V50A 4KQOA 1BLCA 4IBRA 1O7EA 3M2KA 3UPOA 4OQGA 3VP3A 2WGVA 3OCLA 3FZCA 1KE0A 3NBLA 2BLSA 5GLCA 1CI9A 4YFMA 4BL2A 2IWDA 2ZM8A 2EXBA 4E3LA 4UA9A 4RX2A 4OOYA 2WAFA 5CRFA 3ZG8B 3SS5A 3IXDA 5AQ7A 4GOGA 3A3FA 5M1AA 2XGNA 1YLJA 1KVLA 3Q1FA 4DE0A 1FR1A 1IELA 3HVFA 1PW1A 2WK0A 5KSCA 4WYYA 5E2FA 4Z9QA 2EFXA 4GN2A 2EX9A 4JBFA 5HAQA 4LCMA 3G34A 1HZOA 4R4RA 4MBFA 4S2JA 1NY0A 1ERMA 3TSGA 1KGFA 4X68A 4OPRA 3IF6A 5AQ9A 4DXBA 4O7DA 3HLBA 4M3KA 1EWZA 3UY6A 3CMZA 1KGEA 1HD8A 2A3UA 2WGIA 3BFEA 2ZC3B 5FATA 2I72A 4RA7A 3V3RA 3VFFA 4KG2A 1PI4A 1VM1A 3M6HA 5GHXA 2OSUA 3ZG7B 4PM7A 3VP1A 4QJGA 1N4OA 2JBFA 2CC1A 2Y2GA 1BLPA 4MBKA 3ZDJA 2ZMAA 1RGZA 2Y2KA 4IBXA 4WZ4A 4E3NA 1YM1A 4PMAA 2Z2MB 5CECA 1MWSA 5HX9A 1KDSA 3A3IA 4EQIA 1G6AA 4KG5A 2G2UA 4LENA 1K38A 1QMFA 2EXAA 1CEGA 2XR0A 3HLFA 3ZVTA 5A90A 2Q9MA 3MXSA 4ZTKA 2DRWA 5FI2A 1KDWA 3UE3A 1FQGA 5TGFA 4KG6A 4C6YA 3MXRA 2VGJA 5EUAA 2ZD8A 5DF8A 1XA1A 4OQHA 5FA7A 5FI7A 3VFHA 1PW8A 4MLLA 3S22A 1MBLA 3SS3A 1JTGA 1BTLA 2P74A 2ZQCA 5HL1A 1MWRA 1IYQA 4KZ7A 3LO7A 1JWPA 1XX2A 3LEZA 4KZ9A 1BULA 2Y55A 2EX2A 1M6KA 4ZJ2A 4PM5A 2GDNA 1IYSA 4IEDA 4BLMA 4JF4A 4OQIA 1RCJA 5AQBA 5GHYA 1K57C 3G31A 3G2ZA 5CHMA 3MBZA 1TVFA 5CEDA 4E3OA 4OOLA 3AGEA 4QY5A 4LV2A 3ZHHA 3N8RA 3IF5A 2V2FF 4GKUA 3BECA 1FR6A 3S1YA 4GD8A 3OCNA 2J9PA 1PZOA 3WS5A 3HREA 5D3OA 3ZGAB 4KZ8A 3O87A 1XPBA 3QNBA 1J9MA 4OOMA 4KZ4A 3WS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPP A;  4KQQ A;  3UE0 A;  3WS0 A;  1JVJ A;  2HDR A;  5TFQ A;  2ZM2 A;  3C5A A;  4WZ5 A;  2EFU A;  3MZD A;  2Y91 A;  4QY6 A;  5A91 A;  4K91 A;  1BT5 A;  4DF6 A;  2XFT A;  4WM9 A;  3WWX A;  1YLP A;  5KZH A;  4FH2 A;  4ZJ1 A;  1MY8 A;  1E4D A;  3DW0 A;  3VOY A;  1RP5 A;  1LLB A;  3IH9 A;  5E43 A;  2P9V A;  4BD0 A;  4WMC A;  5FQJ A;  2R9W A;  5FAS A;  1ES3 A;  2QMI A;  3C4O A;  1YLW A;  4OON A;  1GA0 A;  3OPL A;  4QD4 A;  1BUE A;  3BLM A;  3LY4 A;  5CXW A;  5CHU A;  1E3U A;  1H8Y A;  2JC7 A;  5DTS A;  5AQA A;  1AXB A;  3P09 A;  5IHV A;  2ZQ7 A;  3UDX A;  2J7V A;  3QHY A;  1FCN A;  4KQR A;  2OV5 A;  2Y2J A;  1PWD A;  4ZBE A;  4GZB A;  3PAG A;  1MXO A;  4QB8 A;  4OQ0 A;  4BEN A;  5CEB A;  1MKI A;  3N7W A;  3IT9 A;  2QPN A;  4E6W A;  2OLV A;  5F1F A;  1NZU A;  2HDS A;  2BG1 A;  4JPM A;  5EVI C;  4OVD A;  5HAI A;  2Y2L A;  3IH8 A;  1ES5 A;  3WRZ A;  3VSK A;  4Y0O A;  1PWC A;  2ZC4 B;  4X55 A;  3GR2 A;  5JYO A;  5EE8 A;  2XH9 A;  1K56 D;  1ESU A;  2VGK A;  4C75 A;  4UA7 A;  3MKF A;  4OKP A;  4BQM A;  4YIN A;  1CK3 A;  5TR7 A;  5CER A;  3HLE A;  1KE3 A;  1CEF A;  1H8Z A;  3CG5 A;  5FAO A;  5GLD A;  4U0X A;  3HBR A;  1PI5 A;  3G32 A;  3ZNT A;  1IYO A;  1IKG A;  4GDB A;  1KVM A;  4K0X A;  4A5R A;  3RXW A;  1BLH A;  2XDM A;  1ES2 A;  3D4F A;  4BD1 A;  1L0D A;  3HUO A;  5M19 A;  1W8Y A;  2H10 A;  1N9B A;  3W8K A;  5EVI D;  1XXM A;  1K54 A;  3CZD A;  4P85 A;  4R4S A;  1Z6F A;  4U0T A;  3SH7 A;  2E8I A;  4R3B A;  4H8R A;  5KSH A;  2ZJ9 A;  3IWO A;  3FWL A;  1DJA A;  3E2K A;  1SDN A;  3BFC A;  4S2K A;  5A92 A;  5FSR A;  1O07 A;  1W8Q A;  1XGI A;  4B4Z A;  3O88 A;  1K55 A;  3BFD A;  5CGX A;  1K6R A;  4XXR A;  2ZLY A;  3HLW A;  4E6X A;  3IXG A;  4S2M A;  3WS2 A;  1WE4 A;  5EVI B;  4UA6 A;  2IWC A;  4S2O A;  3G30 A;  1ONH A;  4BL3 A;  4WEJ A;  2WKE A;  1Q2Q A;  3LCE A;  3GV9 A;  2WAD A;  5F1G A;  1CI8 A;  4HES A;  2Y2I A;  1GA9 A;  1RGY A;  3WRT A;  4FH4 A;  3UDF A;  1LL5 A;  4E3J A;  1MWU A;  3QNC A;  1XA7 A;  4OPZ A;  5E2G A;  2Y59 A;  3HL9 A;  3TOI A;  1JTD A;  4WMC D;  4DKI A;  2XEP A;  1TDL A;  3IWQ A;  3SOI A;  1JWV A;  2X02 A;  4KZ3 A;  3G35 A;  4KZB A;  3ITA A;  2ZQA A;  4GDN A;  4E3K A;  1FSY A;  5E2E A;  3ZVW A;  3BRM A;  1IYP A;  1FCM A;  5JYP A;  1YMS A;  3N6I A;  5CTN A;  2WGW B;  5J8X A;  4GNU A;  4L0L A;  2C5W B;  3UNW A;  5CGS A;  4ZAM A;  4KZ6 A;  3P98 A;  4PM9 A;  3ZNY A;  4S2N C;  2HP9 A;  3VSL A;  1GHM A;  1LHY A;  1Q2P A;  2H0T A;  4JKT A;  3DTM A;  3FKV A;  3NDE A;  3G4P A;  1KGG A;  3NC8 A;  2JE5 A;  4HBT A;  2EX8 A;  2HP6 A;  1K4E A;  3GVB A;  3IF6 C;  4N1H A;  5FQQ A;  1HTZ A;  1ERQ A;  1IKI A;  5EVL A;  5L2F A;  3GSG A;  1WYB A;  4RYE A;  3OC2 A;  1XP4 A;  4K0W A;  4R3J A;  5DTT A;  2PU2 A;  1L0F A;  4E3I A;  3VOZ A;  3IQA A;  5KMW A;  3HUM A;  3A3E A;  3A3D A;  4JXG A;  5HAR A;  3GRJ A;  3M6B A;  4HEF A;  4DDY A;  4QU3 A;  2WZZ A;  1K4F A;  1FSW A;  1SKF A;  2ZQD A;  2Z2L B;  2ZM0 A;  4DRT A;  1NJ4 A;  2V1Z A;  5GL9 A;  3BM6 A;  2Y4A A;  4GD6 A;  3N8S A;  4JLF A;  4CPK A;  4WEK A;  3UN7 A;  4LCL A;  5EOE A;  1JWZ A;  4R1G A;  1YLZ A;  5FAP A;  1U60 A;  5CGW A;  3RJU A;  4R23 A;  2XFS A;  2RCX A;  4ID4 A;  1NYM A;  4LV0 A;  5A93 A;  3G2Y A;  2V20 A;  4OP5 A;  1SDE A;  5BOH A;  1L0E A;  1LL9 A;  1YT4 A;  2Y2M A;  1FCO A;  3ZFZ A;  5CTM A;  1GHP A;  4EV4 A;  5HAP A;  2QZ6 A;  3N4I A;  5GLB A;  2Y2H A;  3VMA A;  2X01 A;  2XQZ A;  3IXB A;  5EPH A;  1LI0 A;  2PBY A;  3ZG0 A;  1ALQ A;  2H0Y A;  2HP5 A;  3IF6 B;  3NI9 A;  3Q7V B;  3BFG A;  2EX6 A;  3N8L A;  4ZJ3 A;  5F83 A;  5U47 A;  4RVA A;  4DE2 A;  1BLS A;  1H5X A;  3VP0 A;  1NRF A;  1E25 A;  5M18 A;  2ZC6 B;  5HFO A;  4P87 A;  3V39 A;  4BJP A;  1LI9 A;  3HLC A;  3AGF A;  4E3M A;  3LY3 A;  4FSF A;  5EEC A;  2Y2O A;  3Q82 A;  3PAE A;  3UO9 A;  1ZKJ A;  1YLT A;  2Y2P A;  4S2P A;  4N9L A;  4UAA A;  5FQI A;  4EBP A;  3VP2 A;  1C3B A;  1TEM A;  4B4X A;  1QME A;  3GQZ A;  1VQQ A;  2Y2N A;  3HLD A;  5FAQ A;  3W4O A;  1FOF A;  1PIO A;  2Y2Q A;  1S6R A;  3FYZ A;  1DJC A;  5FI6 A;  2DCF A;  4Y7P A;  3UDI A;  4EBL A;  5FQM A;  3BFF A;  5G18 A;  3V3S A;  4WZ5 C;  4KZA A;  3PBN A;  5EOO A;  3MZF A;  2XLN A;  3ZG9 B;  3E2L A;  3MFD A;  3BLS A;  4MNR A;  3UPP A;  1GCE A;  3O86 A;  3GTC A;  4OPQ A;  5I94 A;  1K57 A;  4JF6 A;  1K6S A;  3PBQ A;  5DF7 A;  4PPR A;  1OME A;  2J9O A;  2IWB A;  2WKI A;  4MBH A;  3FV7 A;  4S2N A;  4UHU A;  1MWT A;  3HUN A;  4Y0U A;  5E2H A;  3IHA A;  2J8Y A;  2WZX A;  4OLD A;  3NIA A;  1ERO A;  2X71 A;  1XGJ A;  2FFF B;  3Q7V A;  3ITB A;  2ZQ9 A;  4DDS A;  3BYD A;  1S0W A;  4Y0T A;  3Q07 A;  1DY6 A;  1KE4 A;  4B88 A;  2A49 A;  1YMX A;  3TG9 A;  3CJM A;  4Q8I A;  1L0G A;  4LV1 A;  2R9X A;  3S4X A;  3ZG5 A;  4IVI A;  4JXS A;  1HVB A;  4P6B A;  3OZH A;  2B5R A;  4NET A;  4XUZ A;  4X6T A;  1ESI A;  3A3J A;  3PTE A;  1BZA A;  1I2S A;  4RX3 A;  4XUX A;  1E3U D;  2WAE A;  1I5Q A;  1NYY A;  4X56 A;  4C3Q A;  1ZC2 A;  1Y54 A;  4X69 A;  3RXX A;  3AGD A;  3PBO A;  1K56 A;  1PWG A;  1PYY A;  2JCH A;  4OLG A;  3EQU A;  4S2L A;  3I7J A;  3Q81 A;  1L2S A;  3DWK A;  3MZE A;  3SS4 A;  3W4P A;  4DXC A;  4LV3 A;  2P9V B;  3M2J A;  1SHV A;  1ONG A;  2C6W B;  1TDG A;  3PBT A;  2HDU A;  4N92 A;  4QHC A;  4FD8 A;  5GLA A;  3ZCZ A;  5DTK A;  2Q9N A;  3PBR A;  1K54 C;  4CJN A;  2RL3 A;  2G2W A;  1NZO A;  4F94 A;  2WUQ A;  2PU4 A;  5EVI A;  3OPH A;  5FDH A;  4HBU A;  3IWI A;  3C7U A;  3EQV A;  4PM8 A;  2ZQ8 A;  2XD1 A;  1ES4 A;  3PBS A;  5FQK A;  1K25 A;  5F82 A;  1NXY A;  3BEB A;  3UE1 A;  4JXV A;  3WS4 A;  4EWF A;  5HW3 A;  4WEL A;  1K55 C;  2H5S A;  5GHZ A;  1GHI A;  5CHJ A;  1BSG A;  3OPR A;  3VP4 A;  1DJB A;  1ZG6 A;  2HPB A;  3ISG A;  3V5M A;  1EI5 A;  3SH8 A;  4P0M A;  4S2I A;  4MEZ A;  4IVK A;  3IHB A;  3NY4 A;  1XKZ A;  3SH9 A;  4KZ5 A;  2UWX A;  4N9K A;  4NK3 A;  1W79 A;  1PZP A;  5DF9 A;  1YQS A;  3GMW A;  3IXH A;  4FCF A;  5FQ9 A;  4X53 A;  1IEM A;  2ZC5 B;  2XF3 A;  3NCK A;  4N1X A;  3JYI A;  5DVA A;  2WKH A;  2FFY A;  4GB7 A;  2XD5 A;  2OLU A;  4JF5 A;  4DE3 A;  2WGW A;  4KEN B;  4OH0 A;  4EBN A;  1ZG4 A;  4JXW A;  1MPL A;  3Q7Z A;  3NDG A;  3B3X A;  1I2W A;  2WYX A;  4DE1 A;  3FKW A;  4D2O A;  1G68 A;  2ZC7 A;  4U3T A;  1W5D A;  1YLY A;  3C4P A;  1W7F A;  4PM6 A;  4OP8 A;  3UPN A;  3C7V A;  4EUZ A;  1SCW A;  4ZDX A;  2DNS A;  4R0Q A;  2XK1 A;  3HLG A;  1WYC A;  3DWZ A;  1M40 A;  2HDQ A;  3O3V A;  4WBG A;  3W4Q A;  3MKE A;  4OPY A;  3V50 A;  4KQO A;  1BLC A;  4IBR A;  1O7E A;  3M2K A;  3UPO A;  4OQG A;  3VP3 A;  2WGV A;  3OCL A;  3FZC A;  1KE0 A;  3NBL A;  2BLS A;  5GLC A;  1CI9 A;  4YFM A;  4BL2 A;  2IWD A;  2ZM8 A;  2EXB A;  4E3L A;  4UA9 A;  4RX2 A;  4OOY A;  2WAF A;  5CRF A;  3ZG8 B;  3SS5 A;  3IXD A;  5AQ7 A;  4GOG A;  3A3F A;  5M1A A;  2XGN A;  1YLJ A;  1KVL A;  3Q1F A;  4DE0 A;  1FR1 A;  1IEL A;  3HVF A;  1PW1 A;  2WK0 A;  5KSC A;  4WYY A;  5E2F A;  4Z9Q A;  2EFX A;  4GN2 A;  2EX9 A;  4JBF A;  5HAQ A;  4LCM A;  3G34 A;  1HZO A;  4R4R A;  4MBF A;  4S2J A;  1NY0 A;  1ERM A;  3TSG A;  1KGF A;  4X68 A;  4OPR A;  3IF6 A;  5AQ9 A;  4DXB A;  4O7D A;  3HLB A;  4M3K A;  1EWZ A;  3UY6 A;  3CMZ A;  1KGE A;  1HD8 A;  2A3U A;  2WGI A;  3BFE A;  2ZC3 B;  5FAT A;  2I72 A;  4RA7 A;  3V3R A;  3VFF A;  4KG2 A;  1PI4 A;  1VM1 A;  3M6H A;  5GHX A;  2OSU A;  3ZG7 B;  4PM7 A;  3VP1 A;  4QJG A;  1N4O A;  2JBF A;  2CC1 A;  2Y2G A;  1BLP A;  4MBK A;  3ZDJ A;  2ZMA A;  1RGZ A;  2Y2K A;  4IBX A;  4WZ4 A;  4E3N A;  1YM1 A;  4PMA A;  2Z2M B;  5CEC A;  1MWS A;  5HX9 A;  1KDS A;  3A3I A;  4EQI A;  1G6A A;  4KG5 A;  2G2U A;  4LEN A;  1K38 A;  1QMF A;  2EXA A;  1CEG A;  2XR0 A;  3HLF A;  3ZVT A;  5A90 A;  2Q9M A;  3MXS A;  4ZTK A;  2DRW A;  5FI2 A;  1KDW A;  3UE3 A;  1FQG A;  5TGF A;  4KG6 A;  4C6Y A;  3MXR A;  2VGJ A;  5EUA A;  2ZD8 A;  5DF8 A;  1XA1 A;  4OQH A;  5FA7 A;  5FI7 A;  3VFH A;  1PW8 A;  4MLL A;  3S22 A;  1MBL A;  3SS3 A;  1JTG A;  1BTL A;  2P74 A;  2ZQC A;  5HL1 A;  1MWR A;  1IYQ A;  4KZ7 A;  3LO7 A;  1JWP A;  1XX2 A;  3LEZ A;  4KZ9 A;  1BUL A;  2Y55 A;  2EX2 A;  1M6K A;  4ZJ2 A;  4PM5 A;  2GDN A;  1IYS A;  4IED A;  4BLM A;  4JF4 A;  4OQI A;  1RCJ A;  5AQB A;  5GHY A;  1K57 C;  3G31 A;  3G2Z A;  5CHM A;  3MBZ A;  1TVF A;  5CED A;  4E3O A;  4OOL A;  3AGE A;  4QY5 A;  4LV2 A;  3ZHH A;  3N8R A;  3IF5 A;  2V2F F;  4GKU A;  3BEC A;  1FR6 A;  3S1Y A;  4GD8 A;  3OCN A;  2J9P A;  1PZO A;  3WS5 A;  3HRE A;  5D3O A;  3ZGA B;  4KZ8 A;  3O87 A;  1XPB A;  3QNB A;  1J9M A;  4OOM A;  4KZ4 A;  3WS1 A; 
#chains in the Genus database with same CATH topology
 1T1A A;  3C5A A;  4I39 A;  5A91 A;  2GNX A;  5K5B A;  1BT5 A;  3WWX A;  1YLP A;  4MMN A;  3KSG A;  3VOY A;  2Y8H A;  3LIE A;  3IH9 A;  4P6Z S;  4ETZ A;  1F5M A;  4MDZ A;  4QD4 A;  2GZA A;  1E3U A;  3P09 A;  3QHY A;  1PWD A;  4ZBE A;  4OQ0 A;  3CWF A;  1N9N A;  3N7W A;  2QPN A;  1NZU A;  4JPM A;  3U2A A;  4OVD A;  5JYO A;  2XH9 A;  3L7H A;  1K56 D;  1GSX A;  4UA7 A;  4OKP A;  4YIN A;  3CLO A;  1KE3 A;  1CEF A;  1G5U A;  5GLD A;  3ZYT A;  3G32 A;  4GDB A;  1KVM A;  2XDM A;  3QP5 A;  1W8Y A;  3E98 A;  4Q0H A;  4I38 A;  2VV6 A;  1K54 A;  3CZD A;  4FOF A;  2OWJ A;  4HJ4 A;  4U0T A;  3IWO A;  2V0U A;  1XGI A;  1K6R A;  3CIT A;  4I3J A;  4XXR A;  2R78 A;  4Y15 A;  4NXB A;  4EER A;  1ONH A;  2PYP A;  2WAD A;  4G3V A;  4HES A;  2Y2I A;  1GA9 A;  4ARZ B;  4F3L B;  3UDF A;  3HL9 A;  3TOI A;  1N9L A;  3SOI A;  3LR0 A;  3MSH A;  3BRM A;  1FCM A;  1IFQ A;  5JYP A;  5CTN A;  2WGW B;  5EM1 A;  5CGS A;  4ZAM A;  5HPI A;  1Z09 A;  4L9G A;  3DTK A;  1GHM A;  1LHY A;  3DTM A;  5EV0 A;  3G4P A;  2JE5 A;  2EX8 A;  3IF6 C;  3GVB A;  5EVL A;  5L2F A;  3T1X A;  3GSG A;  1FIK A;  3OC2 A;  2M7U A;  3IQA A;  5KMW A;  3A3E A;  4JXG A;  5HAR A;  4ARZ A;  4F3L A;  3GRJ A;  3M6B A;  4HEF A;  4DDY A;  4QU3 A;  3P7N A;  3PYP A;  1SKF A;  1S66 L;  2AVX A;  4DRT A;  4EU0 A;  2V1Z A;  5GL9 A;  3BM6 A;  3N8S A;  2OAQ 1;  5EVE A;  3OOV A;  4BBV A;  1YLZ A;  4R23 A;  4HHD A;  2V20 A;  5BOH A;  1SDE A;  3MXQ A;  1X0O A;  1XJ3 A;  1GHP A;  1F2K A;  3CUE C;  2Y2H A;  3RTY A;  2X01 A;  3IXB A;  3CPT B;  3IF6 B;  3BFG A;  5U47 A;  4DE2 A;  1H0M A;  1E25 A;  5M18 A;  2ZC6 B;  3AGF A;  2Y2O A;  3Q82 A;  3UO9 A;  5FQI A;  4EBP A;  4B4X A;  3KSF A;  1PIO A;  4Y17 A;  2Y2Q A;  1S6R A;  1DJC A;  3QP6 A;  3UDI A;  4KZA A;  2I9V A;  3LR3 A;  3MZF A;  2OOL A;  2XLN A;  3E2L A;  2Y79 A;  4MNR A;  4GHI A;  4OPQ A;  5L09 A;  1GSW A;  4JF6 A;  5HDC A;  4PPR A;  1OME A;  3FV7 A;  3T4O A;  3HUN A;  4Y0U A;  5TBM A;  1ERO A;  2FFF B;  4HQA A;  3EOI A;  1LL8 A;  2QYB A;  4R38 A;  3TG9 A;  1CJF A;  4WL9 A;  1DP9 A;  4LGW A;  5IU1 A;  2ZBB A;  4P6B A;  5TJJ A;  2W0N A;  1BZA A;  4XUX A;  2WKQ A;  2WAE A;  1I5Q A;  4C3Q A;  4GW9 A;  1Y54 A;  4X69 A;  3JVU A;  3PBO A;  1K56 A;  1PWG A;  3QP4 A;  1W63 Q;  3EQU A;  4R3A A;  4S2L A;  3Q81 A;  1L2S A;  3LIC A;  3PBT A;  5J4E A;  4FD8 A;  5F69 A;  2VV8 A;  2Q9N A;  4NXG A;  3T12 B;  4IJG A;  2PU4 A;  3OPH A;  5HDD A;  1FIL A;  3UE1 A;  4JXV A;  3IX3 A;  5CHJ A;  1BSG A;  3OPR A;  2V0W A;  2HPB A;  3ISG A;  3V5M A;  1EI5 A;  2D02 A;  3C8C A;  4S2I A;  1ZHH B;  2XRN A;  2UWX A;  5DF9 A;  4N9K A;  4YOF A;  4FCF A;  3IXH A;  1IEM A;  2W27 A;  4Q0I A;  5DVA A;  4QPR A;  4OH0 A;  4KEN B;  1I2W A;  1G68 A;  2ZC7 A;  5IS1 A;  4JGP A;  2M7V A;  4EUZ A;  4ZDX A;  1OTE A;  4GLQ A;  1WYC A;  1A0K A;  1M40 A;  4ESP A;  4NG2 A;  4IBR A;  4NEE D;  3IX8 A;  1CI9 A;  1P9R A;  4BL2 A;  4EET B;  2EXB A;  2LB5 A;  2WAF A;  2XGN A;  3NOT C;  2PYR A;  3T50 A;  1FR1 A;  1XFQ A;  1PW1 A;  4II7 A;  2EWV A;  4Z9Q A;  2EX9 A;  5HAQ A;  4PKY A;  5AQ9 A;  1YSP A;  3HLB A;  3ZCZ A;  4ZRR A;  3R4K A;  5FAT A;  3ZG7 B;  2OSU A;  3VP1 A;  2Y2G A;  4CLC E;  4MBK A;  1D06 A;  1S4R A;  1GSV A;  3A3I A;  2J3T C;  4KG5 A;  4LEN A;  3ZVT A;  2EXA A;  2XR0 A;  3S7N A;  3MXS A;  1FQG A;  5TGF A;  2ZD8 A;  4DN0 A;  4JGO A;  1V9Z A;  4OQH A;  4R70 A;  2O9B A;  4HJ3 A;  1MWR A;  2YKF A;  1JWP A;  2VX8 A;  2PHY A;  1BUL A;  2HGV A;  5J3W A;  4LFU A;  1VET A;  4OQI A;  5HSQ A;  5AQB A;  3G2Z A;  3G31 A;  3IS2 B;  2JKT I;  4HP9 A;  3AGE A;  4DMZ A;  4QWO A;  2V2F F;  3PR6 A;  3OCN A;  1LSX A;  3VOL A;  2QHK A;  2VK3 A;  5TFQ A;  2ZM2 A;  3MZD A;  2Y91 A;  2XFT A;  1BYW A;  3UB8 A;  4ZJ1 A;  1RP5 A;  5E43 A;  1WA9 A;  3VE4 A;  4BD0 A;  4WMC A;  2R9W A;  2V1A A;  1YLW A;  1GA0 A;  1IOU A;  1AXB A;  3MMH A;  3UDX A;  2J7V A;  1P0Z A;  1FCN A;  2OV5 A;  4QB8 A;  4BEN A;  2OLV A;  3LIF A;  3IH8 A;  1ES5 A;  3WRZ A;  3BJN A;  4RQ9 A;  4Y0O A;  3DAV A;  1T19 A;  1CK3 A;  5TR7 A;  4EXO A;  1H8Z A;  1OTA A;  3CG5 A;  5FAO A;  4U0X A;  4GS9 B;  1D1J A;  2B95 A;  4BD1 A;  3HUO A;  5M19 A;  3KO6 A;  2H10 A;  1OTD A;  3TJZ C;  1OTB A;  2W3D A;  3SH7 A;  1L3L A;  4H8R A;  3KX0 X;  5KSH A;  3QP1 A;  3E2K A;  2P08 A;  5A92 A;  4B4Z A;  1K55 A;  5CGX A;  3HLW A;  1DP8 A;  3IXG A;  2VGL S;  4UA6 A;  2IWC A;  2NUP C;  2WKE A;  1CI8 A;  4EUV A;  3LEQ A;  2XSS A;  2P04 A;  4E3J A;  5E2G A;  1XJ4 A;  3JVV A;  4P6Z M;  4DKI A;  1JWV A;  2X02 A;  2ZMV A;  2W1T B;  4KZ3 A;  1TD5 A;  3EWK A;  4KZB A;  2PAV P;  1FSY A;  1YPR A;  5E2E A;  3ZVW A;  2Z6C A;  1DRM A;  3F1O A;  1IYP A;  1YMS A;  3N6I A;  2C5W B;  4LLO B;  3UNW A;  3VSL A;  1Q2P A;  5LBR A;  1KGG A;  3NC8 A;  1IKI A;  2V1B A;  1HLU P;  4K0W A;  3DTI A;  1L0F A;  4E3I A;  3K3D A;  5I5L A;  3A3D A;  3B47 A;  2WZZ A;  1K4F A;  2ZQD A;  4H6J A;  3LI9 A;  3H82 A;  1OJG A;  2ZM0 A;  5DKL A;  2Y4A A;  4JLF A;  4LCL A;  2W1T A;  3C38 A;  1XFN A;  5CGW A;  5A93 A;  4KUO A;  2GX5 A;  3G2Y A;  1YT4 A;  2QJ5 A;  4HH2 A;  4K08 A;  3ZFZ A;  5MC7 A;  2QZ6 A;  3N4I A;  3VMA A;  4O0P A;  5EPH A;  2PBY A;  3ZG0 A;  1ALQ A;  3NI9 A;  2B18 A;  2EX6 A;  3VP0 A;  1NRF A;  4ME4 A;  3HLC A;  2DMW A;  3LY3 A;  5EEC A;  3BW6 A;  5IT5 A;  1YLT A;  4S2P A;  3VP2 A;  5FAQ A;  3W4O A;  2A24 B;  3FYZ A;  5FI6 A;  4Y7P A;  4WZ5 C;  3PBN A;  5EOO A;  2OWH A;  3KYQ A;  3MFD A;  3UPP A;  1S1Z A;  1GCE A;  3CI6 A;  3GTC A;  2PD7 A;  5I94 A;  5DF7 A;  3S7Q A;  2W3E A;  4BBU A;  2WKI A;  1MWT A;  3E4O A;  2J8Y A;  2WZX A;  3NIA A;  1XGJ A;  3ITB A;  2HF6 A;  2EWW A;  3BYD A;  3SW1 A;  3Q07 A;  1YMX A;  4GCZ A;  2QWS A;  3CJM A;  3E4P A;  5G4Y A;  3E0Y A;  4JXS A;  4FTX A;  2B5R A;  4NET A;  4LRY C;  2BTF P;  4RX3 A;  1UWP X;  1NYY A;  2ZMF A;  3RXX A;  1EW0 A;  3DWK A;  3MZE A;  3SS4 A;  3W4P A;  2K31 A;  2P9V B;  2W3H A;  1SHV A;  1P9W A;  2C6W B;  2D01 A;  5GLA A;  5DTK A;  4CJN A;  2G2W A;  3MQO A;  4HBU A;  2ZQ8 A;  4NXF A;  3T1S A;  1K25 A;  5F82 A;  4EWF A;  2H5S A;  5GHZ A;  4I3A A;  1ZG6 A;  3SH8 A;  4P0M A;  3IHB A;  3NY4 A;  2M1C A;  4KZ5 A;  4NK3 A;  5FDS A;  1W79 A;  1PZP A;  3GMW A;  2XF3 A;  1XJ6 A;  3FPW A;  3JYI A;  2FFY A;  3MF0 A;  2WGW A;  1MZU A;  3BQA A;  4JXW A;  2VA0 A;  3B3X A;  3H9W A;  4DE1 A;  4D2O A;  4U3T A;  3C4P A;  3FC7 A;  4OP8 A;  5HPF A;  3C7V A;  1SKO B;  1SCW A;  3CAX A;  3HLG A;  4KUK A;  3IBJ A;  3UPO A;  4OQG A;  4YFM A;  2ZM8 A;  5DJT A;  3MQQ A;  2WK0 A;  5E2F A;  2EFX A;  4LCM A;  1VB6 A;  4S2J A;  1NY0 A;  3CPT A;  2K2N A;  3IF6 A;  1EWZ A;  3UB6 A;  1HD8 A;  2WGI A;  1SKO A;  3BFE A;  4KG2 A;  1PI4 A;  1VM1 A;  4PM7 A;  2JKT M;  3GEC A;  1STZ A;  4PMA A;  1TS6 A;  5CEC A;  1G6A A;  1Y4O A;  2G2U A;  1K38 A;  1CEG A;  5A90 A;  1MC0 A;  1YKD A;  3UB7 A;  3UE3 A;  1ODV A;  1PRQ A;  5DF8 A;  3LR5 A;  1XA1 A;  4X1L A;  1PW8 A;  5HZH A;  3SS3 A;  3CUE A;  2ZQC A;  3B42 A;  4B9O A;  2J3T D;  2Y55 A;  2GDN A;  1IYS A;  2JHE A;  4IED A;  3IBR A;  1RCJ A;  1K57 C;  5CED A;  4OOL A;  4LV2 A;  3IF5 A;  2J9P A;  4KZ8 A;  1XPB A;  1P97 A;  3MJQ A;  4OOM A;  4KZ4 A;  3OPP A;  4KQQ A;  3UE0 A;  3WS0 A;  3D9Y A;  2HDR A;  4K91 A;  4X25 A;  4DF6 A;  4WM9 A;  4L9F A;  3MQ0 A;  1E4D A;  1ES3 A;  2ZL1 B;  1PFL A;  2QMI A;  4OON A;  3OPL A;  1BUE A;  3LY4 A;  5CXW A;  5DTS A;  5AQA A;  5HDS A;  5IHV A;  2ZQ7 A;  4NKP A;  5G4Z A;  3NEC A;  4GZB A;  1MXO A;  5CEB A;  5AVE A;  3IT9 A;  4E6W A;  5F1F A;  1KOU A;  2PRF A;  2BG1 A;  5EVI C;  1TS8 A;  4WN5 A;  4MN5 A;  2ZC4 B;  3GR2 A;  1T1B A;  1ESU A;  2J3W A;  2VGK A;  3ZQ5 A;  3MKF A;  4KQD A;  3NJA A;  4BQM A;  5CER A;  3HLE A;  2PDR A;  2H28 A;  3HBR A;  3KYZ A;  1IYO A;  4K0X A;  2KOI A;  2ZOH A;  4A5R A;  3NOP C;  3RXW A;  3D4F A;  3QP2 A;  1L0D A;  2VV7 A;  1LSW A;  3C30 A;  1XXM A;  2QJ7 A;  4P85 A;  4R4S A;  4UQI S;  4R3B A;  1SDN A;  4BWI A;  1VEU B;  1W8Q A;  3O88 A;  2KDK A;  3BFD A;  2ZLY A;  4S2M A;  3WS2 A;  1WE4 A;  5EVI B;  4BL3 A;  1TS7 A;  3T1R A;  1Q2Q A;  3LCE A;  3GV9 A;  5F1G A;  4YWZ A;  1RGY A;  1LL5 A;  1N9O A;  1MWU A;  1XA7 A;  4OPZ A;  2Y59 A;  3EGX C;  1T18 A;  1ACF A;  1JTD A;  3S7P A;  1V9Y A;  1NLZ A;  2ZQA A;  3ULF A;  3UME A;  1YAX A;  3LIA A;  5HD3 A;  2NUT C;  4KZ6 A;  4PM9 A;  2H0T A;  4JKT A;  4HJ6 A;  3NDE A;  4LRX C;  3TRC A;  4HBT A;  1VEU A;  5FQQ A;  4N1H A;  1HTZ A;  4RYE A;  4R3J A;  2PU2 A;  5HL6 A;  3HUM A;  3BWL A;  2Z2L B;  1NJ4 A;  4GD6 A;  4CPK A;  1LSV A;  1JWZ A;  4R6L A;  3T4S A;  2RCX A;  4LV0 A;  1F98 A;  1L0E A;  1LL9 A;  1FCO A;  5L8M A;  3IS2 A;  5CTM A;  5HAP A;  5GLB A;  2IA2 A;  4Y3I A;  2H0Y A;  2HP5 A;  2VGL M;  1BLS A;  5HFO A;  4P87 A;  2Q0O A;  4E3M A;  3T4Q A;  5HWV A;  3PAE A;  1ZKJ A;  4N9L A;  4UAA A;  3GQZ A;  1VQQ A;  3HLD A;  2XA7 S;  3EGD C;  4Y2F A;  3BFF A;  5CX7 A;  3V3S A;  3BLS A;  3O86 A;  1J3W A;  4MBH A;  2BAS A;  5E2H A;  4OLD A;  4XT2 B;  4DDS A;  4Z1W A;  5L07 A;  1S0W A;  1KE4 A;  4I3I A;  4Q8I A;  1OPX A;  1G6O A;  3OZH A;  4GS9 A;  4X6T A;  1ESI A;  1I2S A;  4X56 A;  5FEG A;  3AGD A;  4NXE A;  2VZW A;  2JCH A;  3CHW P;  4OLG A;  4LV3 A;  1NWZ A;  3F1P B;  3T1Q B;  2HDU A;  3QP8 A;  4L9E A;  4QHC A;  1K54 C;  3JPU A;  4D60 A;  1NZO A;  4F94 A;  2WUQ A;  3EEH A;  4PM8 A;  3IWI A;  2XD1 A;  1ES4 A;  5FQK A;  2P7J A;  3KSI A;  1NXY A;  3WS4 A;  4WEL A;  1DJB A;  3BY8 A;  4PHT A;  5FEF A;  1YQS A;  3HJK A;  5FQ9 A;  4X53 A;  4G3W A;  3K3C A;  2XD5 A;  2OLU A;  4EBN A;  1ZG4 A;  1MPL A;  3NDG A;  3RH8 B;  3S7O A;  3FKW A;  4MCW A;  4Y13 A;  1W5D A;  1YLY A;  3F1P A;  5HWW A;  2FH5 A;  2Z6D A;  4PM6 A;  3UPN A;  2PR6 A;  2DNS A;  4R0Q A;  2OAP 1;  4WF0 A;  3DWZ A;  2HDQ A;  3LYX A;  4OPY A;  3V50 A;  3M2K A;  1Y28 A;  3G6O A;  2WGV A;  3OCL A;  3NBL A;  2BLS A;  5AJG A;  5GLC A;  2IWD A;  1CQA A;  4OOY A;  3ZG8 B;  3SS5 A;  3NHQ A;  1YLJ A;  2L4R A;  3Q1F A;  1OT6 A;  3EEA A;  1IEL A;  3HVF A;  2B02 A;  3HJI A;  4GN2 A;  3G34 A;  4DJ2 A;  4R4R A;  4BBT A;  4O7D A;  4M3K A;  4HI4 A;  3CMZ A;  1KGE A;  1TF1 A;  2A3U A;  3VFF A;  2ZC3 B;  1SZV A;  2I72 A;  2KLI A;  5L10 A;  2WKP A;  4QJG A;  2JBF A;  1BLP A;  2ZMA A;  4M4X A;  1YM1 A;  1MWS A;  2A24 A;  5AVF A;  3H7W B;  2PBD P;  4HY8 A;  4JGR A;  2Q9M A;  5FI2 A;  2DRW A;  2PD8 A;  3MFX A;  4KG6 A;  2WKR A;  3MXR A;  2ACG A;  4IHQ A;  5EUA A;  4B93 A;  5FA7 A;  2FZ0 A;  3VE3 A;  1BTL A;  2P74 A;  3E4Q A;  5HL1 A;  3LO7 A;  1XX2 A;  1MKM A;  4G3K A;  2EX2 A;  1UGU A;  1OJ5 A;  3MS6 A;  3RFB A;  4X1M A;  4BLM A;  3K2N A;  4JF4 A;  3MBZ A;  4E3O A;  3N8R A;  3BEC A;  3S1Y A;  4GD8 A;  4O01 A;  3WS5 A;  3HRE A;  5D3O A;  3O87 A;  2PT7 A;  1ZTU A;  3OLO A;  4PKY G;  1J9M A;  2A2L A;  4HOI A;  3H7W A;  4IUH A;  1JVJ A;  3VV4 A;  4WZ5 A;  2EFU A;  4QY6 A;  3UB5 P;  4BMW A;  5KZH A;  4FH2 A;  1MY8 A;  3BQ8 A;  2O9A A;  3DW0 A;  1LLB A;  4EEP A;  2P9V A;  5FQJ A;  5FAS A;  2JKR M;  2VJW A;  3C4O A;  3TE8 A;  2VEA A;  1H3Q A;  3BLM A;  5CHU A;  1H8Y A;  2JC7 A;  1NRJ A;  4GHI B;  1LT0 A;  3NUL A;  4KQR A;  4MN7 A;  2Y2J A;  2W3F A;  3FPV A;  3PAG A;  4EW7 A;  1MKI A;  5FL3 A;  5TBM B;  2HJ9 C;  3T4L A;  5HWT A;  2HDS A;  3P01 A;  5HAI A;  2Y2L A;  5F6A A;  3VSK A;  4PAU A;  1PWC A;  4UEY A;  3T4K A;  4X55 A;  5EE8 A;  4C75 A;  1PNE A;  1S1Y A;  1PI5 A;  3ZNT A;  1IKG A;  1BLH A;  1ES2 A;  3O5Y A;  2CMN A;  3OBF A;  1N9B A;  5HD5 A;  3W8K A;  5EVI D;  2K7S A;  1Z6F A;  3D72 A;  2E8I A;  2ZJ9 A;  3FWL A;  1DJA A;  3BFC A;  4S2K A;  5FSR A;  1O07 A;  1OTI A;  4E6X A;  4AFI A;  2INW A;  2V8C A;  1G28 A;  2XRO A;  4S2O A;  3G30 A;  4WEJ A;  2L1M A;  1UWN X;  3WRT A;  4FH4 A;  4FUW A;  3QNC A;  5KIZ A;  4WMC D;  2XEP A;  1TDL A;  3IWQ A;  3G35 A;  2O9C A;  2JKG A;  3ITA A;  4GDN A;  4E3K A;  2HZ5 A;  5J8X A;  4GNU A;  4L0L A;  4MN6 A;  3P98 A;  3ZNY A;  4S2N C;  2HP9 A;  4CLC D;  3FKV A;  2QKP A;  5F5Y A;  2HP6 A;  1K4E A;  3B33 A;  3LUQ A;  1K0K A;  1ERQ A;  2GJ3 A;  1WYB A;  1XP4 A;  5DTT A;  5EM0 A;  3VOZ A;  3ICY A;  2EA9 A;  1FSW A;  4CQH A;  3LIB A;  2LB9 A;  4WEK A;  3UN7 A;  5EOE A;  3R7W B;  4R1G A;  5FAP A;  3RJU A;  1U60 A;  2XFS A;  4ID4 A;  3LFV A;  1NYM A;  4UQI M;  3A0R A;  4OP5 A;  2Y2M A;  4EV4 A;  1JNU A;  2W1R A;  2XQZ A;  1LI0 A;  1T1C A;  3V67 A;  3A0S A;  3Q7V B;  3N8L A;  4ZJ3 A;  5F83 A;  4RVA A;  1H5X A;  3DTE A;  3V39 A;  4BJP A;  1LI9 A;  5DKK A;  3NOU C;  4FSF A;  2Y2P A;  1C3B A;  1TEM A;  1QME A;  2Y2N A;  4EES A;  2O99 A;  1FOF A;  2JKR I;  2DCF A;  4EBL A;  4JGQ A;  2ZL1 A;  5FQM A;  5G18 A;  3KSH A;  2V8F A;  3R7W A;  5DFY A;  3ZG9 B;  5EFW A;  2JKF A;  1CF0 A;  1K57 A;  1K6S A;  3PBQ A;  2E8J A;  3GDI A;  2J9O A;  2IWB A;  4S2N A;  4UHU A;  3IHA A;  2X71 A;  3Q7V A;  3T4J A;  2ZQ9 A;  1VET B;  5C5K A;  2YKH A;  2J80 A;  4Y0T A;  1D7E A;  1DY6 A;  4B88 A;  2A49 A;  2MJ6 A;  1L0G A;  4LV1 A;  2R9X A;  4CLC C;  2G7U A;  3TW8 A;  3S4X A;  3ZG5 A;  4IVI A;  1HVB A;  3L9K A;  4XUZ A;  3A3J A;  3PTE A;  3IX4 A;  1E3U D;  3D3O A;  1ZC2 A;  1W63 M;  1AWI A;  1PYY A;  3I7J A;  4DXC A;  3M2J A;  4EEU A;  1ONG A;  1TDG A;  4GJ4 A;  2HV1 A;  4N92 A;  5F68 A;  3BY9 A;  3PBR A;  2RL3 A;  5EVI A;  4E04 A;  2W3G A;  5FDH A;  3C7U A;  3EQV A;  3MR0 A;  3FG8 A;  3PBS A;  3BEB A;  4CLC B;  5HW3 A;  1K55 C;  2XA7 M;  1GHI A;  2VLG A;  3VP4 A;  4DJ3 A;  4MEZ A;  4IVK A;  1H8M A;  1XKZ A;  3SH9 A;  2ZC5 B;  3NCK A;  4N1X A;  1TS0 A;  2WKH A;  4GB7 A;  3C2W A;  3LGO A;  4JF5 A;  4DE3 A;  2HJE A;  4ETX A;  4HNB A;  4HP4 A;  3HCY A;  2V9A A;  3Q7Z A;  2WYX A;  4YNR A;  3UE6 A;  3LR4 A;  1W7F A;  2ZOI A;  5J7E A;  2XK1 A;  3T4T A;  3LI8 A;  3O3V A;  4WBG A;  3W4Q A;  3MKE A;  4KQO A;  1BLC A;  1O7E A;  3VP3 A;  4CLC A;  3FZC A;  1KE0 A;  5DFX A;  4E3L A;  4UA9 A;  4RX2 A;  4Y5F A;  5CRF A;  4I5S A;  3IXD A;  5AQ7 A;  4GOG A;  3A3F A;  5M1A A;  1KVL A;  4DE0 A;  3PXP A;  3KYE A;  5KSC A;  4WYY A;  2KX6 A;  3F1N B;  1VHM A;  4JBF A;  3LID A;  3UMD A;  3DBA A;  1HZO A;  4MBF A;  3TSG A;  1ERM A;  1KGF A;  4X68 A;  4OPR A;  3F1O B;  4DXB A;  2UV0 E;  4EQ1 A;  3UY6 A;  5A8B A;  4RA7 A;  3V3R A;  2L0W A;  5GHX A;  3M6H A;  4WUJ A;  1N4O A;  2CC1 A;  2O0Y A;  3ZDJ A;  4WLA A;  4E3N A;  1RGZ A;  2Y2K A;  4IBX A;  4WZ4 A;  4LRZ E;  2Z2M B;  5HX9 A;  3A0V A;  4LPZ A;  1KDS A;  4EQI A;  1QMF A;  1XJ2 A;  3HLF A;  4O8G A;  4IUK A;  4ZTK A;  1KDW A;  4C6Y A;  5DJU A;  2VGJ A;  4H6J B;  5FI7 A;  3H82 B;  3VFH A;  1S67 L;  4MLL A;  3S22 A;  1MBL A;  1F9I A;  1JTG A;  2PR5 A;  3UB9 A;  1IYQ A;  3F1N A;  4KZ7 A;  1DP6 A;  3LEZ A;  4KZ9 A;  4XT2 A;  1M6K A;  1NLY A;  4ZJ2 A;  4HIA A;  4PM5 A;  4Q0J A;  1OT9 A;  5GHY A;  5CHM A;  3PHY A;  1TVF A;  4QY5 A;  3ZHH A;  4HH3 A;  4GKU A;  1YSQ A;  1FR6 A;  3SZT A;  1S4S A;  1PZO A;  3U4L P;  3ZGA B;  2JN7 A;  3QNB A;  3W2Z A;  3WS1 A;  2VKS A; 
#chains in the Genus database with same CATH homology
 3OPP A;  4KQQ A;  3UE0 A;  3WS0 A;  1JVJ A;  2HDR A;  5TFQ A;  2ZM2 A;  3C5A A;  4WZ5 A;  2EFU A;  3MZD A;  2Y91 A;  4QY6 A;  5A91 A;  4K91 A;  1BT5 A;  4DF6 A;  2XFT A;  4WM9 A;  3WWX A;  1YLP A;  5KZH A;  4FH2 A;  4ZJ1 A;  1MY8 A;  1E4D A;  3DW0 A;  3VOY A;  1RP5 A;  1LLB A;  3IH9 A;  5E43 A;  2P9V A;  4BD0 A;  4WMC A;  5FQJ A;  2R9W A;  5FAS A;  1ES3 A;  2QMI A;  3C4O A;  1YLW A;  4OON A;  1GA0 A;  3OPL A;  4QD4 A;  1BUE A;  3BLM A;  3LY4 A;  5CXW A;  5CHU A;  1E3U A;  1H8Y A;  2JC7 A;  5DTS A;  5AQA A;  1AXB A;  3P09 A;  5IHV A;  2ZQ7 A;  3UDX A;  2J7V A;  3QHY A;  1FCN A;  4KQR A;  2OV5 A;  2Y2J A;  1PWD A;  4ZBE A;  4GZB A;  3PAG A;  1MXO A;  4QB8 A;  4OQ0 A;  4BEN A;  5CEB A;  1MKI A;  3N7W A;  3IT9 A;  2QPN A;  4E6W A;  2OLV A;  5F1F A;  1NZU A;  2HDS A;  2BG1 A;  4JPM A;  5EVI C;  4OVD A;  5HAI A;  2Y2L A;  3IH8 A;  1ES5 A;  3WRZ A;  3VSK A;  4Y0O A;  1PWC A;  2ZC4 B;  4X55 A;  3GR2 A;  5JYO A;  5EE8 A;  2XH9 A;  1K56 D;  1ESU A;  2VGK A;  4C75 A;  4UA7 A;  3MKF A;  4OKP A;  4BQM A;  4YIN A;  1CK3 A;  5TR7 A;  5CER A;  3HLE A;  1KE3 A;  1CEF A;  1H8Z A;  3CG5 A;  5FAO A;  5GLD A;  4U0X A;  3HBR A;  1PI5 A;  3G32 A;  3ZNT A;  1IYO A;  1IKG A;  4GDB A;  1KVM A;  4K0X A;  4A5R A;  3RXW A;  1BLH A;  2XDM A;  1ES2 A;  3D4F A;  4BD1 A;  1L0D A;  3HUO A;  5M19 A;  1W8Y A;  2H10 A;  1N9B A;  3W8K A;  5EVI D;  1XXM A;  1K54 A;  3CZD A;  4P85 A;  4R4S A;  1Z6F A;  4U0T A;  3SH7 A;  2E8I A;  4R3B A;  4H8R A;  5KSH A;  2ZJ9 A;  3IWO A;  3FWL A;  1DJA A;  3E2K A;  1SDN A;  3BFC A;  4S2K A;  5A92 A;  5FSR A;  1O07 A;  1W8Q A;  1XGI A;  4B4Z A;  3O88 A;  1K55 A;  3BFD A;  5CGX A;  1K6R A;  4XXR A;  2ZLY A;  3HLW A;  4E6X A;  3IXG A;  4S2M A;  3WS2 A;  1WE4 A;  5EVI B;  4UA6 A;  2IWC A;  4S2O A;  3G30 A;  1ONH A;  4BL3 A;  4WEJ A;  2WKE A;  1Q2Q A;  3LCE A;  3GV9 A;  2WAD A;  5F1G A;  1CI8 A;  4HES A;  2Y2I A;  1GA9 A;  1RGY A;  3WRT A;  4FH4 A;  3UDF A;  1LL5 A;  4E3J A;  1MWU A;  3QNC A;  1XA7 A;  4OPZ A;  5E2G A;  2Y59 A;  3HL9 A;  3TOI A;  1JTD A;  4WMC D;  4DKI A;  2XEP A;  1TDL A;  3IWQ A;  3SOI A;  1JWV A;  2X02 A;  4KZ3 A;  3G35 A;  4KZB A;  3ITA A;  2ZQA A;  4GDN A;  4E3K A;  1FSY A;  5E2E A;  3ZVW A;  3BRM A;  1IYP A;  1FCM A;  5JYP A;  1YMS A;  3N6I A;  5CTN A;  2WGW B;  5J8X A;  4GNU A;  4L0L A;  2C5W B;  3UNW A;  5CGS A;  4ZAM A;  4KZ6 A;  3P98 A;  4PM9 A;  3ZNY A;  4S2N C;  2HP9 A;  3VSL A;  1GHM A;  1LHY A;  1Q2P A;  2H0T A;  4JKT A;  3DTM A;  3FKV A;  3NDE A;  3G4P A;  1KGG A;  3NC8 A;  2JE5 A;  4HBT A;  2EX8 A;  2HP6 A;  1K4E A;  3GVB A;  3IF6 C;  4N1H A;  5FQQ A;  1HTZ A;  1ERQ A;  1IKI A;  5EVL A;  5L2F A;  3GSG A;  1WYB A;  4RYE A;  3OC2 A;  1XP4 A;  4K0W A;  4R3J A;  5DTT A;  2PU2 A;  1L0F A;  4E3I A;  3VOZ A;  3IQA A;  5KMW A;  3HUM A;  3A3E A;  3A3D A;  4JXG A;  5HAR A;  3GRJ A;  3M6B A;  4HEF A;  4DDY A;  4QU3 A;  2WZZ A;  1K4F A;  1FSW A;  1SKF A;  2ZQD A;  2Z2L B;  2ZM0 A;  4DRT A;  1NJ4 A;  2V1Z A;  5GL9 A;  3BM6 A;  2Y4A A;  4GD6 A;  3N8S A;  4JLF A;  4CPK A;  4WEK A;  3UN7 A;  4LCL A;  5EOE A;  1JWZ A;  4R1G A;  1YLZ A;  5FAP A;  1U60 A;  5CGW A;  3RJU A;  4R23 A;  2XFS A;  2RCX A;  4ID4 A;  1NYM A;  4LV0 A;  5A93 A;  3G2Y A;  2V20 A;  4OP5 A;  1SDE A;  5BOH A;  1L0E A;  1LL9 A;  1YT4 A;  2Y2M A;  1FCO A;  3ZFZ A;  5CTM A;  1GHP A;  4EV4 A;  5HAP A;  2QZ6 A;  3N4I A;  5GLB A;  2Y2H A;  3VMA A;  2X01 A;  2XQZ A;  3IXB A;  5EPH A;  1LI0 A;  2PBY A;  3ZG0 A;  1ALQ A;  2H0Y A;  2HP5 A;  3IF6 B;  3NI9 A;  3Q7V B;  3BFG A;  2EX6 A;  3N8L A;  4ZJ3 A;  5F83 A;  5U47 A;  4RVA A;  4DE2 A;  1BLS A;  1H5X A;  3VP0 A;  1NRF A;  1E25 A;  5M18 A;  2ZC6 B;  5HFO A;  4P87 A;  3V39 A;  4BJP A;  1LI9 A;  3HLC A;  3AGF A;  4E3M A;  3LY3 A;  4FSF A;  5EEC A;  2Y2O A;  3Q82 A;  3PAE A;  3UO9 A;  1ZKJ A;  1YLT A;  2Y2P A;  4S2P A;  4N9L A;  4UAA A;  5FQI A;  4EBP A;  3VP2 A;  1C3B A;  1TEM A;  4B4X A;  1QME A;  3GQZ A;  1VQQ A;  2Y2N A;  3HLD A;  5FAQ A;  3W4O A;  1FOF A;  1PIO A;  2Y2Q A;  1S6R A;  3FYZ A;  1DJC A;  5FI6 A;  2DCF A;  4Y7P A;  3UDI A;  4EBL A;  5FQM A;  3BFF A;  5G18 A;  3V3S A;  4WZ5 C;  4KZA A;  3PBN A;  5EOO A;  3MZF A;  2XLN A;  3ZG9 B;  3E2L A;  3MFD A;  3BLS A;  4MNR A;  3UPP A;  1GCE A;  3O86 A;  3GTC A;  4OPQ A;  5I94 A;  1K57 A;  4JF6 A;  1K6S A;  3PBQ A;  5DF7 A;  4PPR A;  1OME A;  2J9O A;  2IWB A;  2WKI A;  4MBH A;  3FV7 A;  4S2N A;  4UHU A;  1MWT A;  3HUN A;  4Y0U A;  5E2H A;  3IHA A;  2J8Y A;  2WZX A;  4OLD A;  3NIA A;  1ERO A;  2X71 A;  1XGJ A;  2FFF B;  3Q7V A;  3ITB A;  2ZQ9 A;  4DDS A;  3BYD A;  1S0W A;  4Y0T A;  3Q07 A;  1DY6 A;  1KE4 A;  4B88 A;  2A49 A;  1YMX A;  3TG9 A;  3CJM A;  4Q8I A;  1L0G A;  4LV1 A;  2R9X A;  3S4X A;  3ZG5 A;  4IVI A;  4JXS A;  1HVB A;  4P6B A;  3OZH A;  2B5R A;  4NET A;  4XUZ A;  4X6T A;  1ESI A;  3A3J A;  3PTE A;  1BZA A;  1I2S A;  4RX3 A;  4XUX A;  1E3U D;  2WAE A;  1I5Q A;  1NYY A;  4X56 A;  4C3Q A;  1ZC2 A;  1Y54 A;  4X69 A;  3RXX A;  3AGD A;  3PBO A;  1K56 A;  1PWG A;  1PYY A;  2JCH A;  4OLG A;  3EQU A;  4S2L A;  3I7J A;  3Q81 A;  1L2S A;  3DWK A;  3MZE A;  3SS4 A;  3W4P A;  4DXC A;  4LV3 A;  2P9V B;  3M2J A;  1SHV A;  1ONG A;  2C6W B;  1TDG A;  3PBT A;  2HDU A;  4N92 A;  4QHC A;  4FD8 A;  5GLA A;  3ZCZ A;  5DTK A;  2Q9N A;  3PBR A;  1K54 C;  4CJN A;  2RL3 A;  2G2W A;  1NZO A;  4F94 A;  2WUQ A;  2PU4 A;  5EVI A;  3OPH A;  5FDH A;  4HBU A;  3IWI A;  3C7U A;  3EQV A;  4PM8 A;  2ZQ8 A;  2XD1 A;  1ES4 A;  3PBS A;  5FQK A;  1K25 A;  5F82 A;  1NXY A;  3BEB A;  3UE1 A;  4JXV A;  3WS4 A;  4EWF A;  5HW3 A;  4WEL A;  1K55 C;  2H5S A;  5GHZ A;  1GHI A;  5CHJ A;  1BSG A;  3OPR A;  3VP4 A;  1DJB A;  1ZG6 A;  2HPB A;  3ISG A;  3V5M A;  1EI5 A;  3SH8 A;  4P0M A;  4S2I A;  4MEZ A;  4IVK A;  3IHB A;  3NY4 A;  1XKZ A;  3SH9 A;  4KZ5 A;  2UWX A;  4N9K A;  4NK3 A;  1W79 A;  1PZP A;  5DF9 A;  1YQS A;  3GMW A;  3IXH A;  4FCF A;  5FQ9 A;  4X53 A;  1IEM A;  2ZC5 B;  2XF3 A;  3NCK A;  4N1X A;  3JYI A;  5DVA A;  2WKH A;  2FFY A;  4GB7 A;  2XD5 A;  2OLU A;  4JF5 A;  4DE3 A;  2WGW A;  4KEN B;  4OH0 A;  4EBN A;  1ZG4 A;  4JXW A;  1MPL A;  3Q7Z A;  3NDG A;  3B3X A;  1I2W A;  2WYX A;  4DE1 A;  3FKW A;  4D2O A;  1G68 A;  2ZC7 A;  4U3T A;  1W5D A;  1YLY A;  3C4P A;  1W7F A;  4PM6 A;  4OP8 A;  3UPN A;  3C7V A;  4EUZ A;  1SCW A;  4ZDX A;  2DNS A;  4R0Q A;  2XK1 A;  3HLG A;  1WYC A;  3DWZ A;  1M40 A;  2HDQ A;  3O3V A;  4WBG A;  3W4Q A;  3MKE A;  4OPY A;  3V50 A;  4KQO A;  1BLC A;  4IBR A;  1O7E A;  3M2K A;  3UPO A;  4OQG A;  3VP3 A;  2WGV A;  3OCL A;  3FZC A;  1KE0 A;  3NBL A;  2BLS A;  5GLC A;  1CI9 A;  4YFM A;  4BL2 A;  2IWD A;  2ZM8 A;  2EXB A;  4E3L A;  4UA9 A;  4RX2 A;  4OOY A;  2WAF A;  5CRF A;  3ZG8 B;  3SS5 A;  3IXD A;  5AQ7 A;  4GOG A;  3A3F A;  5M1A A;  2XGN A;  1YLJ A;  1KVL A;  3Q1F A;  4DE0 A;  1FR1 A;  1IEL A;  3HVF A;  1PW1 A;  2WK0 A;  5KSC A;  4WYY A;  5E2F A;  4Z9Q A;  2EFX A;  4GN2 A;  2EX9 A;  4JBF A;  5HAQ A;  4LCM A;  3G34 A;  1HZO A;  4R4R A;  4MBF A;  4S2J A;  1NY0 A;  1ERM A;  3TSG A;  1KGF A;  4X68 A;  4OPR A;  3IF6 A;  5AQ9 A;  4DXB A;  4O7D A;  3HLB A;  4M3K A;  1EWZ A;  3UY6 A;  3CMZ A;  1KGE A;  1HD8 A;  2A3U A;  2WGI A;  3BFE A;  2ZC3 B;  5FAT A;  2I72 A;  4RA7 A;  3V3R A;  3VFF A;  4KG2 A;  1PI4 A;  1VM1 A;  3M6H A;  5GHX A;  2OSU A;  3ZG7 B;  4PM7 A;  3VP1 A;  4QJG A;  1N4O A;  2JBF A;  2CC1 A;  2Y2G A;  1BLP A;  4MBK A;  3ZDJ A;  2ZMA A;  1RGZ A;  2Y2K A;  4IBX A;  4WZ4 A;  4E3N A;  1YM1 A;  4PMA A;  2Z2M B;  5CEC A;  1MWS A;  5HX9 A;  1KDS A;  3A3I A;  4EQI A;  1G6A A;  4KG5 A;  2G2U A;  4LEN A;  1K38 A;  1QMF A;  2EXA A;  1CEG A;  2XR0 A;  3HLF A;  3ZVT A;  5A90 A;  2Q9M A;  3MXS A;  4ZTK A;  2DRW A;  5FI2 A;  1KDW A;  3UE3 A;  1FQG A;  5TGF A;  4KG6 A;  4C6Y A;  3MXR A;  2VGJ A;  5EUA A;  2ZD8 A;  5DF8 A;  1XA1 A;  4OQH A;  5FA7 A;  5FI7 A;  3VFH A;  1PW8 A;  4MLL A;  3S22 A;  1MBL A;  3SS3 A;  1JTG A;  1BTL A;  2P74 A;  2ZQC A;  5HL1 A;  1MWR A;  1IYQ A;  4KZ7 A;  3LO7 A;  1JWP A;  1XX2 A;  3LEZ A;  4KZ9 A;  1BUL A;  2Y55 A;  2EX2 A;  1M6K A;  4ZJ2 A;  4PM5 A;  2GDN A;  1IYS A;  4IED A;  4BLM A;  4JF4 A;  4OQI A;  1RCJ A;  5AQB A;  5GHY A;  1K57 C;  3G31 A;  3G2Z A;  5CHM A;  3MBZ A;  1TVF A;  5CED A;  4E3O A;  4OOL A;  3AGE A;  4QY5 A;  4LV2 A;  3ZHH A;  3N8R A;  3IF5 A;  2V2F F;  4GKU A;  3BEC A;  1FR6 A;  3S1Y A;  4GD8 A;  3OCN A;  2J9P A;  1PZO A;  3WS5 A;  3HRE A;  5D3O A;  3ZGA B;  4KZ8 A;  3O87 A;  1XPB A;  3QNB A;  1J9M A;  4OOM A;  4KZ4 A;  3WS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...