1DJPA

Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor don covalently bound in the active site
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINASE-ASPARAGINASE
publication title Reactions of Pseudomonas 7A glutaminase-asparaginase with diazo analogues of glutamine and asparagine result in unexpected covalent inhibitions and suggests an unusual catalytic triad Thr-Tyr-Glu.
pubmed doi rcsb
molecule tags Hydrolase
total genus 113
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1djpA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1djpA01
1O7JA 2WT4A 2D6FA 4RA9A 4R8KA 5CBPA 5I48A 2WLTA 3ECAA 1NNSA 1IHDA 1WLSA 2GVNA 1WNFA 1ZQ1A 4R8LA 5HW0A 5K3OA 4NJEB 4PGAA 4ECAA 5K4HA 5I4BA 5K45A 1JJAA 2OCDA 4NJEA 2HIMA 1HG1A 2JK0A 1JSRA 1HFWA 2HLNA 1ZCFA 5DNEA 5F52A 1AGXA 1DJPA 1HG0A 2P2DA 4RA6B 5DNDA 1WSAA 3NXKA 5DNCA 1DJOA 4RA6A 1JSLA 3PGA1 2P2NA 4Q0MA 5K4GA 1HFKA 1HFJA 1JAZA 1HO3A 5CBPB 3NTXA 4RA9B 5I3ZA
chains in the Genus database with same CATH superfamily
1D4ZA 3GPIA 2ZYTX 3F5DA 5CLJA 1A5AB 4TM7A 3E9QA 3B3FA 3KUUA 1L5GB 1MRSA 2DGDA 2JW5A 1T34A 3IP6A 2JAPA 1N3IA 2VA9A 2LIPA 3HPQA 3T4UA 3R0XA 2ZUBA 4R5MA 1IOVA 3QKWA 3W5JA 3SFVA 3VXKA 3E23A 3PHLA 4BFSA 2FDXA 2SKEA 1ZITA 3LHDA 2B25A 1QHIA 2C84A 3GOQA 4PCVA 4Y2XA 1U8ZA 4Z8XA 3ZG6A 5JU6A 4OU4A 4TV8B 4OGKA 4A0SA 1MRZA 4H2DA 1GAXA 1AS0A 1VSQA 3Q1LA 2W42A 4LIPD 4Q9NA 2A9PA 1UM9A 5LU9A 5C3MA 3CMMA 3ZHYA 2IXFA 4K9KA 2AR9A 2M1XA 5MN5A 4AJ9A 2PKRA 1E4VA 1REQA 4JS0A 4RD6A 1S0UA 3WRXA 4UVHA 4NU6A 3BERA 1G21A 4RY2A 3CUUA 3VKUA 5F1OA 2HZ7A 1DJQA 1FMLA 3OPQA 3GLVA 4J8PA 4MI3A 1JEOA 3QYPA 5EHXA 4Y9RA 1RJWA 3UA3A 3CNQS 3FPSA 3IPXA 5MDHA 2P77A 1I7LA 1HA3A 3TW4A 5B7NA 4D96A 1WUTA 4ZCSA 1BD4A 3B2NA 4LVCA 2BFPA 4X63A 5TMBA 1BCRA 2ASEA 1FFDA 1J8YF 3JWPA 4DDVA 2WPNA 3JVIA 1CZOA 2QA5A 4FXPA 4PR3A 1L5NA 4NTZA 5C1IA 1Z0SA 4NABA 3SQOA 1P8JA 3B6MA 4M8SA 2OTCA 2YV4A 3DKIA 5TY0A 1UJ4A 1C81A 2YWXA 4PZZA 3GLIE 3LUCA 4QEZA 1KI4A 2C3UA 2NSHA 1LJLA 3PWTA 3QVXA 5TSDA 1BXZA 5LXTF 1M7HA 1PIWA 5BXYA 1HDYA 4AKGA 1ZBQA 3ND9A 5SZIA 1KRXA 4NYIR 4KFRA 5L95A 1I32A 3S1SA 4B2IA 2VQFB 1W35A 2A9RA 1EFRD 2OQVA 4AMYA 3AHHA 3ZWAA 3ZE6A 4C4OA 3ANLA 1D03A 1T9AA 4KHPB 4P4LA 1CR2A 1YHYA 1VE3A 5C53B 3V1UA 2QXYA 2AF3C 1TK9A 3REOA 2WJIA 3GZNB 2QN3A 3AFGA 4CM9A 4DADA 4UHEA 2NAPA 1IJBA 4BLWA 3AB7A 1D6NA 5AM5A 1A2QA 2GF2A 2B61A 5KYNA 3CM0A 1UMDB 3QI2A 1ZJ6A 2R87A 4D9JA 2DEUA 2QLNA 1YVEI 3B12A 3I30X 1U0FA 5TIIA 3RVRA 2GFHA 1EIWA 2VP2A 2WWWA 4DDUA 2PG3A 3MTQA 5LA6F 2FW1A 1MF7A 3L6CA 2RHWA 3OF2A 4O2AA 3UXYA 3ZDZB 5K09A 1NJFA 3EARA 5B3JA 3W7AA 3SKXA 4GBGA 1DQYA 4NCHA 2INGX 1KTVA 3TZQA 3AOEA 3DEYX 1FTGA 3OPMA 4GRDA 1KNQA 2GEJA 2XCLA 4NLLA 3OBIA 2JJ1A 3L9XA 3I0NA 3Q9SA 2VRWA 3CZ5A 3KRTA 4YPVA 1D2AA 1YTUA 1CZHA 1V16B 2II6A 1YKGA 3QMMA 5BV1A 2R8EA 3PEVA 1WA5A 2C0CA 2O7SA 2I3BA 4U1RA 2VXYA 5EXEA 3RV3A 3SBOA 1ACMA 3EG5A 4ZDWA 5TEWA 1Q74A 1VCHA 2NV6A 1J8QA 2RGWA 2W6OA 1POWA 4KE9A 3T7AA 4B4OA 2YHIA 3VVMA 5DF1A 1M33A 4RLFA 4QQRA 1M0WA 1P4JA 3RBVA 3EVDA 2UYCA 3LY5A 3ZE0B 5FL7A 4KB5A 4NE9A 5DBIA 2DHCA 1DKUA 4CU2A 3VR4D 1Z68A 2XNDD 1NA5A 1J5EB 3TQCA 4XKJA 3FDIA 1PL0A 3AIMA 2I6TA 4FR2A 3AJAA 3O21A 2IE0A 4WZBB 1AN9A 5CB6A 5BR1A 2IELA 4Q01A 3UICA 2QU7A 2FV8A 2HPAA 2NUPA 4OM7A 5I48A 3M6XA 4F21A 1QYRA 2IC5A 2OC9A 1L7QA 1G55A 4OFBA 4KE8A 3DG9A 2HQSA 1V26A 4L8FA 4UMDA 4DQLA 4ZRDA 2A9JA 4GKAA 5CYGA 3MM4A 2RKWA 2F3PA 2DWOA 4OHFA 3MCWA 3AW8A 4ETWA 4W9MC 1GXSA 2AMJA 1XHFA 1QG4A 2NVUA 5KKCA 4GS5A 3EC1A 4PLPA 4QOIA 4DXDA 3I2JA 4RJTA 5F3DA 5D1NA 1W0CA 3NHBA 2EOAA 3V48A 1SKBA 2O0JA 4DBLC 4PPYA 5ESXA 4JMLA 3B6KA 3FUTA 3GUCA 3VR5H 5ESWA 3HZHA 4PE5B 1I2MA 3FCEA 1CJKC 4LOAA 1TCUA 2OFPA 1J1IA 5IU6A 3N75A 2PFSA 4M87A 3TRJA 4YJ3F 1S7CA 3WKEA 1OX6A 2PQMA 1W75A 3AUTA 1LPNA 1WHTB 4XDGA 2VDMB 4NC9A 5AICA 2VXCA 5L45A 3VR3A 5C4IA 2I66A 4HGRA 2FEMA 4FFBA 5AM2A 5I7AA 4TZ0A 1KI8A 4B3XA 4KQXA 1BIFA 2CXQA 2FB9A 4OKIA 1ZCFA 2OD7A 2XMPA 1B23P 3UUGA 1QTQA 1OXTA 1EX1A 2C7QA 2AQKA 4IOJA 1E6WA 4HPXB 2QTNA 3GRRA 2ERCA 4DILA 4V1CA 3T3IA 2QOEA 5HJEA 1XA3A 1P61B 2X4GA 3BE8A 1L8OA 1ISIA 3DUFB 3ILVA 3QLEA 4CIVA 4CIYA 3ZHVA 2L0XA 1PWXA 4CCSA 3UJ3X 5ICEA 4IOKA 2G08A 1D2NA 4OJKA 2JFPA 5FPKA 1JDZA 1IWPB 2Q5JA 3HY3A 4CMBA 3TUZC 2KMLA 1QHHA 3TQIA 1RWXA 2GRAA 4YT8A 1D5CA 5FTMA 5FULA 1BD3A 1FMJA 5IJ0B 1SULA 1U9ZA 2BMFA 2LE0A 4ZCPA 2X8JA 1TU0A 2XODA 4N5HX 5JH7B 4FBLA 4EKEA 3B6ZA 3NO4A 3T9AA 1X86B 1A5ZA 4NYMQ 1YQDA 4OK3A 1HZJA 3AHFA 2X42A 3JSXA 1XTJA 1ZM4A 3QHAA 1PUIA 3QRWA 4TRRA 4WLUA 4UQLA 1SC9A 5ARDA 2XIQA 5BMVF 4AM8A 3AVUA 3MWDB 3RAEC 1QHGA 4ND1A 4QDKA 1Z6YA 4BNDA 1PQWA 3ABQB 3FSGA 5CT4A 5GJWC 4HDKA 4QPJC 5A7GA 3RS9A 3SX2A 2PJRA 1L9KA 3EIUA 3LPNA 3DDNA 8GPBA 4RFVA 5FUMA 2XWQA 3H4TA 3NEJA 5LYJF 4A26A 3QOXA 1XVAA 2C29D 4ZOLF 4UAJA 1KYVA 1GGHA 4FFOA 1KQNA 2VT7A 4FE3A 3R7SA 4KPUA 5AKJA 3TUJC 1M74A 4TXHA 3AIKA 5BOSB 5L3SB 1DKOA 4IWYA 1YDWA 2C3MA 1X0XA 3WMEA 2X3YA 1BA3A 1G0NA 1SVUA 2ZYSA 3AH8A 2DFDA 2Q28A 4URYR 3MW8A 3O0DA 4CN8A 1A8QA 1KZHA 2ZB3A 4DTCA 5A02A 5I7UA 2OP1A 4ZTZB 1HUQA 1R0CA 1B2LA 2ODNA 1W94A 1RAGA 2QV0A 2ZCUA 2A5GA 3F78A 3L40A 4NPHA 3H2SA 2HOQA 2WIGA 4PCAA 4BJ3A 3DQZA 4ZIRA 3M6FA 5ARBA 2PKYX 4QPDA 1H6BA 3WLEA 1QS0B 1ZI9A 3KCNA 2XAUA 4BU1A 4LF4B 2BDUA 4K87A 3LA8A 2DR2A 1FJXA 4HR7A 3AWDA 3H04A 1GQRA 3VU0A 1G3IA 3OQJA 2AKYA 5JEEA 2CW5A 2O59A 3MINB 1XVIA 3JQAD 3SX4A 2PZEA 1KMHA 1YB4A 4DA8A 2H06A 2W00A 3AG6A 1ND6A 1G2OA 3GNTA 3L6OO 4NCIA 4B8WA 2ZIEA 3GZJA 4C0WA 1I9CA 3HSKA 4YRQA 1T8YA 2IEGA 4HGZA 3SE7A 3AK4A 5JNUA 5F7XA 5JS7A 2GTPA 5DTQA 5FI0B 5C1BA 1QZXA 4NHEA 4OMUA 2ATXA 4PIVA 5EYPA 5FPHA 3UAWA 4F04A 1ST3A 1QIIA 5K0BA 3U44A 2Q99A 4L28A 1E0KA 1LPBB 2APJA 3EAQA 3LP6A 4GZLA 1KKUA 1JEEA 2HLPA 1IFXA 2QXUA 2WFAA 3BULA 4KO4S 1PR0A 4Q66C 1AMOA 4Q48A 5JAMA 3B36A 1WMBA 1M8PA 4B6RA 4EUSA 1NF9A 1T2VA 2FWJA 5KZMB 1W0KD 3OAAD 1GL9B 2VPQA 3PRYA 4JBIA 4XIJA 3TQFA 2B20A 3GCDA 2QF7A 4LBZA 2W6MA 1BHJA 2QQFA 1FZQA 1HYQA 2ORED 5FOSA 5HF5A 3VR4H 2A0UA 1A4XA 3AHCA 2BBTA 4LZJA 4RWEA 3VV2A 3G79A 1F3LA 4EMUA 1A4UA 5LQMA 2WA2A 3DZKA 1HNZB 4KGXA 4I81A 2NU8B 4XIFA 5DISB 1IRXA 4FIDA 4IDPA 4DCGA 5MFZA 1ODLA 2B6NA 4GOLD 5FA5A 4BNMA 4LHXA 2CDBA 3WDLA 3QEBZ 4ITRC 2FMUA 4JNKA 2XD4A 4HDMB 3ZIUA 3OU7A 1LA2A 4R69A 4PWZA 4BMXA 1C3EA 1H6AA 3KZNA 1TZMA 3FOBA 1PTJC 1T3HA 1TO6A 2L69A 2PQ6A 1KI2A 2X2FA 4PIPA 5FPSA 1CV2A 1KNXA 1UBMS 1IHOA 3O2NA 1GPMA 4GPIB 4OYYA 4Z9FA 3ZZTA 1SC3A 2ODWA 5KKAA 4EG8A 2J7PA 2NT4A 2WAOA 2WF6A 4U7DA 4BFLA 3G68A 5JRJA 3EVCA 4UUQA 2C03A 3I23A 1DWPA 4D79A 3W5AA 3TM4A 1V45E 3INRA 5DNCA 1ZI6A 2NZVG 5K0LA 4W5RA 1X9HA 3NC1C 1GR0A 2D7CA 5LZ5A 3C6XA 3N0VA 2BYTA 3N2NA 5F5LA 4UDYX 4MKIA 2GHQA 2BW0A 1MX1A 3E0XA 2WEKA 4FKZA 3ZC3A 2QORA 1QGYA 2XE8A 3NJ4A 4G3XA 4NDZA 3FPCA 2NU7B 4NCNA 4M86A 2IRWA 1PAUA 3C4JA 4RSMA 1RHRA 5G1NA 4O1HA 1OWLA 4ZKEA 3MLBA 1A9ZA 2EJCA 3QUSA 4Q3NA 1OV4A 5DGCA 5IVDA 3ZH9B 3HWX1 1NV9A 3W34A 3PZBA 1L7BA 3UYKA 2IF0A 3WKCA 2DFTA 1IXKA 3O84A 4HQ6A 4D82A 1ZZEA 2ZREA 5CT9A 3GF4A 1YXMA 3QUQA 2HCBA 5E6UA 3ADOA 3E8XA 2AL7A 1T13A 1NQAO 3RJ9A 4IGKA 3WLAA 3FRHA 4S12A 4F6RB 3A3PA 1BXRB 2GYYA 4D9FA 1W2GA 4F72A 1PX2A 2XZLA 4TYNA 1QIMA 4P7KA 3S68A 4B79A 1GR1A 3E7PA 2PU5A 4YX9A 4KO8A 4PG8A 4NATA 1VE5A 3MD9A 1JHYA 5ALZA 4Z51A 2I8LA 4L07A 4UASA 5DM2A 3U5ZB 1U7ZA 1NR7A 4ECAA 3SX0A 4CUKA 2XOKA 1E1KA 2WD9A 1WTAA 2WM9B 4Q1DA 4AAYA 2WF7A 2R2AA 1EE1A 3DMNA 3EZ9A 5F76A 4CMAA 4U0KA 2GFIA 2Z9DA 5CJJA 3AERB 3U81A 3UKJA 3V4OA 2HUNA 2J33A 5AUOB 3U1BA 5A6VA 1TDJA 5CNIA 4BZWA 1G4UR 3B1KA 3I09A 1R5OA 4HBGA 4CV0A 4ND3A 1TU4A 1UEJA 2H07A 2Q3EA 2ZVJA 1L7DA 4HXGA 2R86A 5AI0A 2DBZA 2ZIUB 1YU9A 5B1DA 4PRYA 4DIFA 1R88A 3T34A 3PLAE 1KIMA 4MKFA 3STXA 2OK8A 1B6TA 4DM3A 3PC7A 1WP4A 1KR5A 3D4BA 3OZGA 2FZEA 3PX3A 4KGDA 4IP0A 4FK8A 3MMXA 4NPCA 2QE7A 3GVXA 2HF7A 1SHTX 5C4MA 4JI4B 4QOHA 3N0RA 4MVJF 4LZPA 3ORYA 1ZESA 2WJGA 4M1WA 3TW6A 5BSHA 4EGCB 1T9ZA 2W8BA 3RVQA 4XIIA 2UYOA 5JBQA 5TJ9A 4TV9F 1TM4E 2Q7OE 5LZ9A 4DM4A 4P98A 3OOWA 3L07A 1MC8A 3IXLA 1IY9A 1SHKA 5CPBA 5LA6B 3RIHA 4D44A 4HNVA 4DIKA 2QP4A 4HVLA 1E1DA 3ITDA 1D0SA 1Z6PA 4LISA 1RAIA 4I19A 3U7HB 4CF7A 1F38A 2DHRA 3PI7A 3WLOA 2IL1A 3DWIA 1S3GA 4BRUA 4CM6A 2ODPA 4DLTA 1I7QB 5EHIA 1A88A 3DDSA 3GA5A 4QQNA 1CUAA 1II8A 2YV3A 3PQDA 4FQ5A 4LQCA 5F35A 1KAHA 2HWUA 3ND5A 3TNDA 5EN4A 1X94A 4JODA 5FWXA 3U7RA 1FDUA 4IVRA 4ETMA 1A9RA 4IY1A 1M8KA 5AXBA 2D3WA 1SCAA 4GM1A 4AN0A 4HN4B 1XXHE 3M4XA 1ORVA 5J2TF 4ARUA 1JI0A 4BAUA 5BPHA 3N8DA 4BGDA 5T8KC 1NYQA 1GZ6A 4KXMA 2JBHA 2CYBA 1M8FA 5F4ZA 1FDVA 1E3EA 1FOEB 2ZTLA 2R66A 3DLAA 1CEXA 2ECQA 1IJKA 2BEWB 3Q6NA 1S4MA 1A8UA 1M6HA 2H6EA 2PSSA 5I9BA 1TYZA 4YCMA 4GNRA 1FBNA 1SC4A 1SXJD 2E1RA 3EXG2 4O4JA 3ON5A 1DRJA 3FPHA 1VFNA 2B7LA 1LBIA 1SXPA 4JGGA 1T0UA 2B9EA 4V3BA 3BFXA 5HCUA 2ZI3A 1SKYB 4ND8B 1PF7E 5ALLA 2AUNA 1Z4OA 4Q02A 1U7UA 3PXAA 3TR0A 2XCIA 4MVXA 4TLDA 3H11B 3R7AA 3X43A 5AK4A 2JFHA 1DC7A 4X6XA 4YR9A 3GFTA 3ZJTA 3OM1A 3OEHD 3D7NA 1YZQA 1R4ZA 3OIDA 1Z25A 1ENZA 1HRDA 1ODJA 2YWBA 4CGZA 1YZNA 4WL0A 1U3UA 5ALHA 2A7QA 2ZRFA 3VZRA 3ZHBA 3W6NA 1GSHA 3DHYA 2AD1A 2V7XA 3RUHA 3UAGA 4AZWA 5JANA 1E3MA 2BT4A 3A0UA 3HCAA 3C14C 3TLGB 3KSZO 1Y5RA 3PGMA 4JGBA 1UT8A 2NU6A 3EW7A 1RZRA 1EG2A 2R6CA 1Z0DA 2WPDA 2XNHA 2OCKA 4AU1A 4Z1OA 2CL0X 2HXGA 1VHWA 3BMCA 1W88A 1X7XB 2L19A 4NP6A 2UUOA 4E5UA 3I8OA 2CYCA 3IUMA 4O2BF 1ESNA 3NR2A 4Z9YA 2F1OA 1RPAA 2JIPA 2R6AA 3AVOA 3PUVA 3UTCA 2AJTA 1M6VB 1GKLA 2F48A 2UXCB 1JAIA 1OBVA 1O0BA 1QAQA 2POQX 4CG2A 1OFHA 3OE4A 1W8IA 2C59A 4AECA 3ED1A 2FX5A 4Z3OA 3GFBA 4LF5B 5JZOA 3TVTA 2IY8A 3DR3A 3U4GA 4IS2A 3DS8A 2EGGA 2BCGY 4G1BA 5BO5A 1LC0A 2ZULA 1KEZA 1N5OX 2IPOA 2OO5A 1PJAA 3TAUA 4P54A 4A8TA 4YH1A 2WT9A 3MYRA 4DLLA 4NU0A 4UTNA 1NRIA 1E5QA 1NW3A 1UOOA 3P52A 1DFGA 3JZIA 2WC1A 1NY5A 4O33A 3WYNA 5IUNC 3P0HA 2HFKA 2ICAA 5LB2A 2EJUA 1X0VA 1I10A 3IVMA 4LPSA 4U0JA 2VP6A 2WSYB 3NJ8A 4IRUB 3RRMA 1TEHA 4ZEOA 2OV3A 5JCJA 2VF8A 3G5MA 3Q7IA 4L8YA 5FV4A 2AEFA 3LQRA 4MGIR 3UFBA 2J45A 4E88A 3BBLA 5FTLA 3Q9LA 3OFNA 1SA0B 3PXBA 2I3ZA 4OEHA 2R68A 3RW9A 3KOZA 3UAYA 5CFOA 1SN7A 2LIVA 2NTVA 4MUFA 5F78A 4BS9A 4Q4CA 1TQ6A 2JGNA 4D56A 3G0CA 3O8NA 1YVRA 1ZK3A 2C31A 4OQFA 1XJQA 2CLLB 2ZSHA 1IAVA 1Q0HA 3GNSA 3PF8A 2H4FA 1NXSA 3KOMA 4YC7A 5CNJA 3EAFA 2ZI6A 4COOA 3KYJB 4RYDA 1IXRC 2OL4A 2RBEA 2WYWA 3UK1A 1T9HA 4E1AA 3DD5A 1V4VA 1DV2A 3IRUA 1PFVA 3AUJB 5KTOA 4QUEA 4RKYA 3PLRA 5ALDA 2QMZA 4KVGA 1ADGA 3TZBA 3COPA 5D6NA 4MDHA 1PQ4A 4HGNA 5G3YA 1OLUB 4G8DA 1I51A 3CLUD 1M1NB 2PS9A 4TL7A 1YFLA 5JMPA 4Z4GA 5ITSA 1HX7A 1DT3A 3EHDA 2ZJBA 2J31A 3O8OB 4G89A 3FWPA 2CLIB 1EFAA 4Y1GA 4CM5A 5JD5A 1HLFA 3U16A 1N2OA 1HETA 2GO1A 3QVGA 3JSAA 3V4VB 5SICE 5EXDA 3A4IA 2IV3A 1E9BA 4M54A 2JG3A 4Z4EA 3CLRC 3P0FA 3L5OA 1QTNA 4BMYA 2VSOA 3OD5A 2E55A 1KJ8A 2NV2B 2HB6A 3AR9A 4HEJA 1MTZA 3ZV7A 3I2YX 5AI5A 3WLIA 1R6UA 2VBGA 1SFRA 1U2GC 4JOCA 5DULA 2HKIA 4EEXA 3W5CA 1KZ4A 1VLHA 2O1WA 1Y37A 1AN0A 4GMDA 5DDIP 3FNRA 3ELYA 5AW1A 1H1TA 4B3RB 1HQCA 3U7JA 1W87A 2BPOA 5FLYA 4DV5B 4GPBA 2YXEA 1LVUA 2CV0A 2ZIGA 3EMVA 4MDEA 4ATNA 2C9OA 3NP9A 3UMYA 3G49A 4CVNA 1SH7A 1MTOA 1N5DA 1OTYA 1TQ4A 2FWPA 3BSWA 3O8BA 1YKSA 1ZDMA 4G5OA 3JQCA 4IIUA 4AJ2A 1L4FA 1LWOA 3W4IA 3ZDAA 5IJ9A 2VKQA 3IBTA 1XJ5A 1JAYA 3H87A 2JI9A 3MUFA 4FMDF 4JUFA 4CFZA 3MG9A 3LRPA 1P1HA 2PA3A 4DDTA 2VQ6A 1JALA 3I04A 4J1TA 4DCJA 1CQIA 3EH1A 4OX9Y 1MX9A 1A9TA 2WWHA 4WKNA 3NVMB 2P6RA 3C3AA 2QTLA 3C3PA 3F74A 2OXIA 1GU1A 3UK0A 2ZE5A 4RY9A 4Z0TA 1WXEA 2I6QA 2BKUA 3QVLA 1NQUA 5COQA 5H80A 5CB4F 3ZKWB 4MYRA 2K87A 1DXYA 4GRAA 3V8MA 5LZ2A 4S05A 3K9HA 5ADUS 4IHJF 3IB3A 3KE9A 4MVJD 3L4BC 4R54A 5THXA 1T4CB 2VDLB 3OUUA 4X6YA 4A82A 2AJDA 2J46A 2WLTA 1ULAA 1T0HB 2E5FA 3B7PA 1VYHA 2GLUA 2Z2KA 3PYMA 2DFPA 3LV8A 4Z0HO 1BNCA 4W63A 2RCYA 4KSBA 3A10A 4REOA 4RMIA 1ORTA 1Z0JA 2IYYA 2FUG1 3L8CA 3ZDDA 4HDCA 2PZKA 1B93A 1KY5A 5BYAA 3D3KA 3HL4A 3IO3A 3V8QA 1XU7A 3BGDA 3CPHA 3TO5A 4BO3A 4LFBB 4ZMSA 2EFJA 4WK4B 3JVUA 1U5CA 2XYHA 1XQXA 2B1JA 4RTKA 3EGDB 1J8FA 2O23A 2B1QA 4DY4A 3FLMA 2XXJA 2C5GA 2X9QA 1P2BA 4QG3A 4U3JB 4H0NA 3DWEX 1PG2A 4URWR 4ZO8A 5GJBA 1HZZA 2HDWA 4MMYB 1E63A 1NYTA 4XM0A 1LDNA 3HTXA 1O08A 1R6VA 4BMSA 4RZ2A 5KYXA 3B7WA 1BQEA 3GGOA 3QBDA 4UEKA 3CUEF 5H3LA 3N76A 4RK5A 1AS3A 3V46A 1XIVA 1N92A 2VDUE 2QENA 1A8IA 2AXPA 3JQ7B 2AXEA 4WN9A 4B80A 1GUYA 3H4IA 1N9KA 4PVDA 1X1RA 3HSSA 3Q3EA 4DV0B 5DX1A 4HWPA 1GSIA 3EA0A 2J0UA 3IP5A 1LTHR 5FO0A 1QM5A 5JWOA 5BSTA 1U8EA 3E9MA 2VCHA 1DAHA 2WMNB 1DOAA 1U5AA 1US8A 3PDUA 3GLRA 4IH1A 1G9SA 1I3OA 1ZBDA 1ZRMA 3MPUA 4FGKA 1LTKA 2CXOA 2AE2A 3OE7D 4TT3A 4JR0A 4PGGA 1S89A 4PLCA 1Q83A 1FUYB 1XROA 5L3ZA 3WAKA 3VR2D 1P31A 1U63A 5DZSA 3K6SA 1XU4A 1NVVQ 1N2XA 4RU1A 2RMKA 5U4XA 1NJGA 4EMTA 3BTVA 3EDYA 4DMMA 5B3LA 4YRGA 3CKYA 4YJFA 1U99A 4MW4A 4RGQA 3FDXA 5LLTA 4IGEA 3A9SA 4NCKA 1RKBA 3KBBA 4A2QA 1KIAA 2O4CA 4EH1A 4GMHA 3WKDA 2YINC 2ZYRA 3CLTD 4FNOA 2AR7A 2PGDA 4R9UC 5JBIA 5ALTA 1YJQA 4OAPA 2DKFA 2F1KA 3SIRA 3SHTA 3KPVA 3R09A 3ZNNA 4B9AA 4L5AA 1WP9A 4DBLE 4GKBA 1A2KC 1TNDA 3NTLA 5C5DA 1QQ6A 2C58A 2OENG 3FOCA 3W9BA 1N1MA 1Z5GA 3VPXA 3C6MA 2GETA 3DXYA 3M33A 4LJ5A 3TE7A 5AESA 4PRLA 3HMQA 4JBGA 3B3JA 3NHZA 4A8JB 3M8KA 2NPFA 5E6SA 3SC6A 3UUFA 5KKNB 4RHTA 4F8EA 4ZICA 1WCIB 1CUCA 1USKA 4IEFB 1GZUA 2LNDA 2NLOA 5KCMA 1VL8A 2ZUVA 4IIEA 3Q5GA 4OJNA 1HYHA 4AKIA 2ZS8A 4OHRA 1LPPA 2F7SA 2LWIA 3ZWPA 3GVHA 1XRQA 1U28C 3L7KA 1XEXB 3SXJA 4AO7A 1NC3A 4TKVA 1OYWA 1I2ZA 3HXOA 5D7NA 4AMBA 3UVEA 2CF6A 4PHCA 2QGZA 5B1YA 4G8BA 4HUJA 4G25A 1M1ZA 2IYOA 1OY1A 2XB6A 2C4UA 3GX1A 3D3WA 3I4LA 3NONA 4G0OA 4CQMB 3EBOA 2BKEA 3ACCA 4HWOA 2IS2A 3NG1A 3NBXX 1OPXA 5HK8A 3V1KA 4CCYB 1OB5A 5JD6A 5BN1A 1CPYA 3SC2B 1WE2A 2FHSA 2PWAA 2R5NA 3HKDA 3I6ZA 3KBOA 3M6LA 4C7KA 4F4UA 5KDOA 1TF7A 1ZK1A 4QDOA 5EMLA 3M3DA 3ZCSA 1N6PA 3EGIA 4HFJA 5IAKA 1C7ZA 2XUJA 4RMHA 3ZHCA 5KNBA 1ZZGA 3A6ZA 3LF2A 4MVJM 5HPYB 3HZRA 2H5JA 5IKPA 2IS1A 5DHSA 5LZ7A 3CZMA 2X5OA 2HXYA 4EB6A 1Z38A 4INAA 3K6SB 1QDLB 1YK0A 2EP8A 3UAOA 1F7VA 3NASA 4RVUA 3ABZA 3U49A 5HYVA 1PJZA 2IHTA 1HYEA 2IXGA 4PGAA 1UC9A 1QV9A 1A7AA 1GHTA 4CR7A 1CDEA 5AUQA 3HR4A 1U8UA 4X90A 1ZHFA 3WKAA 2LPMA 4MUYA 2BLLA 1UJ5A 4PFKA 3K5HA 2DBYA 2BZ0A 3PR3A 4CTNA 1E59A 2Q6IA 1MVLA 1XCJA 3W7VA 1WUYA 1G8HA 5CUQA 3DOOA 5EUCA 2B78A 3WS7A 3NGXA 4Q1VA 1EGQA 5F7JA 1CVIA 3T1NA 2JLXA 1BWQA 4Z2AA 4MVJH 2BOVA 2L2QA 1H42A 4NOJA 1XLUA 1JG6A 4NENA 5J4YA 2YXBA 2PUFA 1NUPA 3IS3A 1PGNA 3V4RA 4TL9A 4JYBA 4WKCA 2OZVA 4UVEA 2EIHA 4JJ6A 1GZSA 1QHFA 2Q2NA 2X4LA 3F49S 3WNZA 4CF6A 3D6MA 5B7PA 2XGGA 1DIBA 3AONB 4QNNA 5DHTA 4F96A 3UK7A 3DV9A 3HI6A 4RTLA 4JJIA 5B1HA 1T6NA 4ANFA 1LH0A 3GMIA 1NT2A 4QFCA 1YGYA 4EK9A 1IVSA 4B09A 3DXXA 3FCXA 3L1IA 1M6NA 1QZTA 4QUHA 4XASA 1AQIA 1SUCA 2EBWA 1ID8A 1G20B 2AI3A 1JHPA 1SVLA 4HNQA 3QLTA 2WTXA 1ZUNA 1MJGA 1RCFA 1UCFA 1X9GA 4XDHA 1V7ZA 1WDKA 1XRJA 2P9HA 3FUUA 4RD4A 5K3BA 1RLMA 2PL5A 3FCSB 2E85A 4PQGA 1HR0B 3EPRA 1D2HA 3GLQA 2PIDA 3I0ZA 4R2HA 3AEQB 4DVJA 4GSYA 1Y1TA 3P4XA 4IICA 3TL2A 3UWSA 1LLFA 3OTGA 1N7JA 3MLAA 1I2DA 2HMAA 2FZ4A 3SAJA 2G1UA 3LXXA 1ZSNA 2PYIA 5BP7A 4YK7A 4PHGA 1XMIA 3F6EX 4XSGA 4JOBA 1WBBA 2H1CA 3X1MA 3FUVA 3AUSA 2JAHA 3H83A 3H75A 3WRXC 2D2IA 1N5RA 1OBCA 3LUBA 3ZN2A 2R1TA 1GPH1 4N6GA 2V6JA 3MJSA 1VRWA 4LXIA 3DYBA 3LDGA 1NF8A 2BHLA 4J94A 1BAPA 1B3BA 2HLDA 4JROA 4MV3A 5C8DA 1V8PA 4LI3X 5HZKA 1UFQA 1C5KA 2WSMA 3T9FA 1R0BA 1SVKA 4RTPA 1YGPA 4DUGD 2YXNA 3MRXA 5KC9A 4CTKA 3EXEB 2LDXA 3KT0A 4GQIA 4BX3A 1P3DA 1YDFA 3GBSA 1CDOA 3ROZA 1CULC 1QIEA 2RGEA 1ZM2A 2XNCA 3UA4A 1DBVO 5IZ4A 5JSZA 3C7DB 3LLCA 1YC5A 2V7QA 3WL4A 1JUDA 4CJXA 1PHPA 2YYYA 3Q0IA 5CRIA 2ZZNA 3BF8A 1NBMD 3RVMA 4CL8A 4GPD1 5T57A 2CEAA 4D0GA 3K09C 2Q5EA 4TUYA 2VWHA 2WE8A 4EJMA 1E1RD 1C3JA 1GTVA 1T2EA 3I9MA 5IVPA 3U7QA 5KPDA 1XCPA 4M9CA 1WXWA 3R5TA 3AQIA 1E64A 1EK2A 3LDAA 2F3SA 2PRJA 4BP9A 4E7PA 2E5WA 3N59A 5SZJA 1QYWA 3D6NB 2XECA 1WQ4A 3IXMA 3OMWA 1VIDA 4I1IA 3KXDA 4LGYA 2O7VA 1J2YA 4XSHA 3RQSA 4CMJA 5BRAA 5LPNA 2B34A 4BV3A 1Q91A 2IGTA 1MO4A 3EPJA 4A5SA 2VJMB 5JIBA 1AZWA 4TSRA 2NAFA 1Z29A 4M88A 3AM5A 2BV3A 2RAPA 1CNEA 1XCOA 2GLXA 3DFMA 5J2UA 2BFEB 3MAJA 4G0YA 2JC3A 1OBOA 1NJ1A 1U9CA 4JBXA 2NUAB 5B3JC 5CDTA 4DA6A 4PYNA 3H2ZA 2AFHE 2HH9A 1RVV1 1VXOA 3E1KA 4LGCA 3QXHA 4YV1A 3E1GA 4M9ZA 1JT9A 2H1VA 3GROA 4HNAA 2OXTA 3QYJA 3OD1A 1E1QD 4RVHA 1CNFA 1GV0A 5CW1A 3EY9A 4RIIA 3OEEA 1DIAA 1JAXA 2TMKA 4H3HB 2GASA 4NFLA 5DHPA 3SNHA 3W2IA 2J0QA 1XZIA 3HDQA 1K4KA 2W83A 4LJLA 2EW1A 2ZJOA 5H4GA 3TGPA 1N3LA 2DUUA 4IJKA 2GTIA 1IUNA 3LT0A 4YRFA 3FGZA 3L6UA 4Q7KA 1ZHOA 2JLAA 2X1MA 5EFOA 5HIKA 2YFHA 4DIOA 4ZMBA 1YFJA 2G5GX 2OD2A 2GRUA 1L4LA 2OKGA 5B4TA 4AKSA 3RS8A 2J67A 2D1RA 3OCCA 3QG1A 4HK4A 2Q0QA 2BSAA 2VBFA 4FPXA 3UGJA 3O7MA 3A6PC 4HQKA 5G41A 1L8XA 2JKYA 2VEOA 2M6KA 2BFWA 2Y1WA 2D2FA 2ISQA 4KYVA 1FDIA 4HG2A 2JH8A 3VBCA 2FSVC 4WJZA 1M2VA 3EPPA 3IUNA 4G0ZA 4ZZ2A 3R4CA 4MOWA 3ZWXA 1P2FA 2A58A 3L7DA 4TXLA 3WFIA 4ZHQA 1ZMTA 2PVPA 2WD8A 4GZMA 5CHYA 5GPBA 5CX1A 1JDUA 2C9ZA 1LBSA 4KDRA 2HT6A 2Q4EA 3ETEA 3GJ7A 2ZOSA 5JD3A 1EP1B 4DCOA 4YMTA 1TMYA 2F90A 4NAHA 3ZU2A 4EYQA 3PEWA 2XMSA 4C0AC 1DGQA 1DRUA 4X8OA 3ZGZA 3ESBA 3N39C 2EKLA 3JALA 4HAVA 4QTZA 1NT4A 3BX1A 2J08A 4YACA 1PZEA 2HK7A 2JKZA 3NBAA 3O82A 3KKNA 5BWOA 1FEZA 5CFLA 1CYDA 3H5LA 2AN5A 5J5CA 2QPTA 4MS3A 5T4EA 2QS9A 1I14A 4FHCA 4DEXA 3TGWA 1EVIA 2JBAA 1W59A 2XTJA 1RHKA 4ZV4A 4ZYXA 4F0JA 4LV6A 1SXHA 4ZI7B 4P4UA 3UWOA 1GU7A 3DL2A 1SUBA 4UVDA 5HKOA 3LW7A 1UBLS 2PYDA 2GEDA 3I37X 2CJWA 2DWQA 1LK5A 1PQYA 2P2CA 4Z3DA 2UYHA 1FTWA 1MABA 2E9SA 3BB4A 4FZRA 2HDNB 3JVEA 5EZYA 4YXFA 1IU9A 1OH8A 2C8VA 2WU0A 4Y6QA 4CMIB 4O2LA 3GVCA 4M83A 4UUAA 5LDDC 3IJPA 4OHPA 1PE0A 3PFBA 1KVRA 3E9CA 1KPHA 4PBTA 4KQ1A 4U2KA 2R4QA 3KD3A 3RWOA 4A1FA 2VTEA 3ECAA 4MNTA 3N2YA 2R1VA 4PPFA 1F48A 1DKNA 1NI4B 4MROA 2P9TA 5K01A 4O5OA 1R74A 4NNOA 4UTOA 2QX8A 4UEWA 5CTJA 3VX3A 2F1HA 1NYLA 5DW0A 3L0YA 4YAIA 5BNIA 5GVSA 4GOND 3TKAA 1H2BA 1TM3E 3LUGA 3HUTA 5KX5A 4J0GA 2NYVA 2GCIA 4US0R 2VJAA 5I47A 1FSPA 1DRWA 4NRDA 1G2IA 1RWKA 3IAAA 2I0FA 3GQBA 5KWIA 1P5FA 3QWIA 4KQKA 4RPHA 4H1WA 5ALKA 4D8WA 1L5VA 2EX4A 3KQUA 3PDHA 1NX9A 1R0YA 1B42A 5EOVA 4ZAXA 3PTLA 4GXTA 4WY5A 5TGDA 4FI3C 4LDZA 1KA9H 3TQRA 2E48A 1RKXA 2O8EA 5DLDA 2RHMA 4DSAA 1Y6GA 2YJZA 2BCEA 3D6AA 1AHIA 3N0TA 1UDXA 2V96A 3K1AB 1RI4A 4R0NA 4Z4CA 1RYMA 4KIFA 3FTDA 4X1YA 1GRVA 4OHVA 4KX5A 1AS2A 3B9PA 5BSRA 3MS7A 3KLOA 1DAOA 1K8ZB 2GN9A 2I1VB 1E1CB 4P3XA 4X5OA 3S1AA 4ZN6A 3NDBB 2PIAA 4U4AA 3G13A 3O8QA 4JT4A 1FUIA 1N1DA 3EVBA 2J30A 5AQEA 1XZCA 2AE1A 3FI0A 1V6SA 3M1YA 4F9GA 4EHIA 5I9NA 2PM8A 3D8HA 4KHZA 3WL8A 4FGLA 4NU5A 5HIJA 2OVBA 1HSOA 4IDDA 4H3VA 3RUIA 2QX9A 5A4FS 1QFYA 4PNHA 1GG2A 5ABPA 1FDTA 1E9SA 1AHPA 2IOYA 3DOHA 1MGPA 3H1EA 1IQRA 3U9TA 3G0HA 1JMYA 4U7GA 1O5TA 4W5JA 3K31A 4N3CA 4CR6A 3P7MA 4F46A 2HPVA 4OSEA 1WIWA 4TMTA 3PNSA 1RLJA 1XHEA 2V97A 4YJ2B 5G1OA 3UWPA 2GZHA 3WFJA 4QGSA 3OTQA 3O4HA 3BK2A 4X1IB 1PWZA 2ZETA 4TZTA 3C5VA 4Q15A 1V43A 2YRWA 2NU9B 5LP6C 4JT8A 1SRRA 5JQGA 3HMKA 4FR0A 3O9VA 1KL7A 3IX7A 5EJ5A 1T24A 1JLRA 3V8PA 2QTVB 1NATA 4FW8A 2BFOA 1EX6A 4RW0A 1POXA 5IN5A 4UARA 3RYIB 3I9JA 3U13A 1PZHA 3IALA 3K0KA 1VGQA 1XHLA 4LRSB 4EDFA 4BVBA 2NNLD 1VOTA 2P62A 3KB8A 2PXXA 4ROTA 3V8EA 2PGJA 3FSEA 1W36B 2H1LA 4AURA 6GPBA 5LZ4A 3EPKA 1QQBA 4FEYA 4WECA 5HF9A 2ZCJA 3K0EA 5HKKD 4JJ8A 1RXEA 1VPVA 2KWIA 4KGZA 3ND7A 4YAKA 3PQ8A 1JB9A 1KO1A 1EUDB 1YQEA 4NAUA 3MOSA 4AT1A 4DZRA 1GYRA 3CINA 2C3OA 2VJYA 2FH5B 2IS4A 1M1YE 4D80A 2OG1A 1E69A 4XQCA 3DDUA 4O6VA 5C8XA 3QE0A 2G36A 5IARA 1ZN9A 1KSJA 4N48A 3RS5A 3PEUA 1ONNA 3T4PA 4UCXA 5LSAA 1TB4A 2AZ4A 2PGOA 1XTTA 2OY0A 3C3JA 2W2PA 3QUBA 5IXSA 4OA8A 2A8YA 4MP6A 1Q17A 4KIJA 1U3GA 1ZU4A 3Q2KA 1EEHA 3K8YA 1ZP6A 2A9QA 2EBFX 4OGGA 5FYDA 4JELA 3KR2A 2UV8A 1GTRA 1A27A 4LJ9A 3RRFA 2DG2A 4IIJA 1DX4A 5HGXA 1H3EA 1KMQA 2OHGA 2H1WA 3THWA 2A78A 1BEZA 4CKEA 1DWOA 3N5KA 3ANMA 1S2LA 3EEQA 3NHAA 2X0RA 3OZEA 4PSDA 1OJLA 4NBRA 4O8ZA 5BNFA 5ALSA 3VR3D 2IH5A 3BDAA 1L7NA 4JLAA 1NUHA 1OZAA 1V8FA 5CLLA 3JD0A 2B2NA 2DKNA 2X7XA 2YQ5A 2ZIWB 1RM5A 1XCMA 3I9V1 3LPAA 4E70A 2CLHB 4TTTS 3RYCB 4X7MA 4EHKA 4AMZA 2O8FB 1N2CA 3H2BA 2Q5IA 5IDVA 1CR1A 3MHPA 721PA 5IUKC 2XUIA 4GDFA 2Y1DA 2V54A 3CO0S 3DPIA 2H17A 3A7EA 1UADA 5CVUA 1QJCA 1GU0A 5FOWA 3HYNA 3LKZA 1WR8A 3NCHA 1VZ3A 3ZZMA 1KEKA 1FYVA 3DE0X 2G9VA 3GJRA 3QKRB 1IYZA 4RL6A 3WL3A 2GS9A 3FPFA 4EELA 1U8CB 1JH9A 3D4NA 1KFJB 4PSAA 2PKCA 5GV8A 2B37A 2VJCA 2XZOA 1QVAA 4B3HA 3K0BA 4FYWA 4DQVA 3BB1A 2F9FA 4XQ0A 5KJCA 3EF1A 2PUGA 4E1BA 2QZJA 4ZEXA 2VBIA 2ZXFA 3KOUA 4E6EA 1QGDA 3R3XA 5KQSA 1IDOA 1YI1A 2VH2A 1Q0TA 2RI1A 4H7PA 1L1EA 5I7EA 1C1DB 5CGQB 4YGXB 4HQOA 1RC8A 3RKUA 4YJDA 2FNAA 1D7OA 4QZVA 2N0SA 4LDRA 4B8ZA 4LRUA 3HXPA 2LW7A 3LT4A 4HB3A 2F8SA 2I2CA 3ZK9A 1UC8A 3USES 1QCYA 2AN4A 1IZ0A 2HPZA 3FAKA 3EWAA 3O31A 3TTVA 1K98A 1W46A 1N7IA 3SVZA 1IXZA 1Y9JA 2QD2A 2QX4A 3K1TA 1NUQA 3UH1A 4U5QA 5K0JA 1AJEA 1PR2A 3FSGD 5LNK6 1MKYA 1OXMA 1ITZA 4G2NA 4BDSA 4RTSA 3RC1A 3TECE 1NVKA 1VFPA 4K9NA 4OV6B 1E7MA 1ADYA 3H16A 4KXFB 3S70A 1OB2A 2PKXA 1Z4JA 4ZO7A 4Z6KA 1ZONA 4N40A 3AVWA 1IE3A 2QW1A 4TWRA 2HIGA 3MCZA 3R9XA 3ZLUA 3TKLA 1J33A 2FF5A 4YDHB 3TJZA 1PR5A 3U7GA 4O4JF 4YT2A 1VPEA 1NRXA 3KPJA 3AF6A 2F43B 1R0ZA 1HDGO 5G40A 2V6BA 3L5KA 5K6AA 2WVAA 1NN5A 3PNQA 1UKCA 3WXMA 4BZXA 1RQXA 4FB4A 1JR3A 2JFNA 4BUCA 1SR8A 1U7OA 3OPNA 1CJTC 3K2QA 5REQA 2ZDHA 1UBSB 2VSXA 4WY8A 2HRQA 5DHRA 1C7EA 1J2UA 3PC4A 4Y1RB 4G0WA 1PDOA 1ZVJA 3ZZNA 1MOSA 3LRXA 4PC3A 5CNMA 3UK6A 1KEVA 3DM9B 1QQTA 1UAYA 2BR3A 2RKBA 1V7PC 1FPMA 1YR6A 3MQ2A 5GZ3A 2W8ZA 1OX4A 3PSHA 1ZOLA 4Q21A 3NQ41 5AHXA 4ZJUA 5C32A 4RNDB 1SY7A 2C4KA 3HA2A 1R16A 2G63A 3TB4A 1DC5A 4QHSA 5DYIA 4OXXA 3NHJA 2CNKA 4X64B 4HZUB 3VPAA 1ZUD1 2WSLA 1VCIA 2JIQA 2E89A 5D3KA 2WHRA 4MWZA 5CFRA 5C8VA 3KR0A 4ZVQA 3NHMA 5KDDA 2OV1A 2V4ZA 2WF8A 4B6EA 2AEMA 5AVQA 5AW0A 2WUGA 3BIJA 4F6LA 3DE6X 3PHGA 4RTJA 2I3DA 1WF3A 2HSJA 3FPKA 3HSYA 1Q1EA 4P35A 3HA7A 4Z3KA 4ZVVA 2P6MA 4QM6A 3WR5A 3TPZA 1RADA 4PLFA 2P2ZA 4PM4A 2OV8A 3D6TB 1ETHA 4R8LA 4Z9AA 4CEHB 2ZATA 1Z0UA 3D81A 3HXLA 1WCYA 5IKMA 2WAAA 1U8FO 2E6UX 3KQQA 1E58A 1FRQA 1B8PA 3IAHA 4L22A 2P5SA 1I30A 2YN0A 3BE5A 4FGZA 2A1TS 4IDQA 4OOFA 1ATZA 3V3KA 1I8TA 4Q6BA 1X38A 3H8WA 2WK1A 4LHSA 4BX2A 1E2KA 4QGAA 1EZ4A 4M1SA 3GL9A 2FRXA 4DG8A 5LQSA 4P84A 5DGIA 3RBXA 3BMQB 1DOZA 4LGMA 3RRXA 4YRNA 3FVTA 1L6RA 2J7PD 4PZDA 6REQB 3VI3B 5K3FB 1IBCA 4Y0VA 4INPA 1CEYA 3ZR4B 2XA9A 1AURA 4CYMA 1SUDA 1O9HA 1WXIA 4XCQA 1TAUA 3HKBA 5KJFA 1VSTA 1S2OA 3RWMB 1C1XA 2W2TA 2ZUTA 3TJMA 1I01A 4E2FA 5HXAA 4O4IA 1LNQA 1LLQA 3DL7A 4HUTA 2QLFA 2OBBA 5KYUA 4PW0A 3VV3A 3V9PA 1RJEA 3R5FA 3T3EA 4OJMX 2V7BA 4JY7A 2HO5A 2PZGA 5T67A 2ROQA 4TTSA 3VPCA 2HNBA 2WWRA 4HLUA 1SU8A 3IMGA 4UXJA 1K5DA 2ZRHA 1QAOA 2GEBA 3DE5X 3OZAA 1JEDA 2ATCA 3EGOA 3AINA 1P6XA 4QDXA 1PGQA 4KZPA 4UC0A 4ZOEA 4BE9A 1NNLA 2W6NA 2WYHA 3FKQA 5JVDB 4BKOA 3TG2A 4RD3A 3MGKA 2J09A 2C8LA 4AS2A 5BR4A 4RH0A 2WINI 1N78A 3AETA 3G3EA 4ZVSA 4KK4A 4JJ7A 3RFTA 4KSCA 1KI6A 4FCVA 4Q7EA 4EG3A 1NV8A 3LWNA 1TT5A 3QUTA 3V1LA 1QZUA 5KYVA 4GBED 4BLPA 1GZ4A 3V4FA 2NYUA 1SKAA 2ZBQA 1WMFA 1N9GA 2ZIXB 3ZLTA 3PX7A 4I1SA 2XGSA 3R20A 1R9GA 1J8DA 1QHSA 5GONB 3VR5A 1GQ2A 3W6ZA 2J5RA 2JIZA 3AHIA 4ZDKA 3UM9A 1E89A 2XE6A 1SUIA 1MVOA 3DAPA 3GLIB 3MCUA 1MIOB 1Z36A 3QEOA 1BEEA 3DMGA 5T3UA 2JHFA 1K7SN 2VRCA 1YA4A 4JLKA 3QX3A 2A4MA 2XBMA 5ADVA 3SVLA 4E07A 2FK7A 4ZAWA 2F8LA 5FUBA 4Y6OA 1XRNA 2R3SA 1SXQA 3INYA 3VX4A 1TVKA 3LTNC 3B38A 2PL3A 2Z8ZA 4PAWA 1YBHA 3PT5A 4R8SA 5E4FA 3U26A 3BL6A 4Z0NA 4C5AA 1CUVA 3ETGA 1CY7A 2ZBVA 1UL1X 2QE7D 3BWMA 4AMVA 3CURA 4UM5A 4X65B 1J56A 1T8UA 3GO4A 3G6WA 3G0IA 9LDBA 3C70A 3G2PA 2EZTA 2P5TB 2ZSKA 4HNSA 3QYAA 1TFUA 4J43A 2XNJA 5LOVF 1LJ8A 3H6KA 3ID6C 1G59A 1JSRA 3BRSA 2WM2A 3GNLA 5A9TA 3F8SA 3GFPA 2WNHA 2FPWA 3PNVA 2WG2A 3ESYA 3LNTA 2DT8A 2FEWB 2PX6A 1XTZA 5EIOA 2I2XB 4H0FA 1MG0A 2D5AA 4P2GA 3P9NA 1AA9A 3C1UA 4FKBA 1D1TA 3WGVA 2QSYA 3K94A 3P9PA 4HPJB 4BFTA 2I76A 3D2CA 5D6OA 3UHAA 3TLXA 1V41E 2J1LA 3KJIA 1B8NA 1DMRA 2ATIA 3DMHA 3JS5A 2IIBA 4G8JA 4D9BA 1FVXA 1MW9X 2MMCA 4JR2A 1OLOA 3AKCA 5J58A 2DPYA 1ZGHA 3MLEA 4LYYA 2A84A 3EFBA 4PTLA 4RS4A 4ALIA 2WE7A 3EULA 3LUHA 2OCPA 3EVAA 1YB7A 4M0EA 2WR8A 4RSGA 2Q4TA 1LS6A 2ZJAA 3P9ZA 1CY2A 1XZBA 1BC5A 5AI8A 5EZ6B 5IANA 3VDMA 1Y7TA 3LAWA 1JJFA 2NP6A 1HLDA 4BB5A 1E6LA 3PC8A 3VNSA 3H3FA 4E3ZA 1OZ0A 4D0LB 1I9GA 2PRSA 3ZQUA 3MJFA 3LH5A 4BOYA 1XKLA 2ZJ1A 1RI5A 1UH5A 2ZAOA 4WNYA 4TLLB 4CF5A 1JT2A 3GGJA 4JJKA 4LDNA 1X92A 1XX6A 3C3EA 1THTA 1XZQA 3RDPA 4EPYA 4PANA 1TEZA 2NQ2C 4BXOA 3VNQA 4IMIB 5FWDA 1HL3A 3KQKA 1VMAA 1WNTA 2UZ1A 4UHDA 2C3PA 2J3DA 2NQ8A 4MMXB 2ISSD 5ALFA 3I61A 2CK3A 3OKCA 4S1OA 2ZYDA 3SGLA 4DDKA 2BGKA 1ZN7A 4B35A 3AL2A 2QQ5A 1SVNA 1L5QA 1VL0A 2AFIA 3H5AA 1CQPA 2X0KA 3HJCA 3KVYA 4MMZB 5JCPA 3QU2A 2X6TA 1XVUA 1K7XB 4YJGB 3C24A 3LC0A 1JG2A 3REFA 3WC4A 4PY2A 1PEDA 1S8NA 5D8DA 2FZCA 3T0GA 1C4XA 1QAMA 2Q8QA 3E5NA 3KQSA 4O25A 3V1YA 3FE2A 5BVGB 4IIFA 2AMLA 2IYPA 1V5GA 1QRDA 4X85A 2X1VA 1JQBA 3KTFA 4MA5A 1G4HA 2XGJA 1X7ZA 3SR3A 4YXWD 4EKIA 4XE5A 3CVVA 1GKYA 3KALA 2OKCA 4JC4A 1XELA 3MHTA 2V3WA 4J1SA 1XQYA 2GB4A 1EUCA 3B9BA 1VHDA 3KSUA 3M4JA 1G38A 4ZA2A 3KE8A 3DPUA 5DGHA 1RE1A 3KK0A 3SF8B 2P2GA 4D9EA 2JGFA 1W5TA 3GT4A 4L0CA 1DAPA 4WH0A 1HG0A 1WQ1R 4YCBA 5DB4A 3SS7X 2FTKE 3X3HA 3JZFA 4LKOA 4WKOA 1JA1A 3ZGLA 1O9BA 2BFNA 3ZLBA 1KYWA 1SQGA 5K3CA 2PRZA 4CR8A 5LYYA 4EHJA 3DLTA 2GEKA 3RC2A 3HGQA 3BSYA 4JL8A 3BB3A 1ADJA 1JIXA 3R0VA 4KW7A 2C5AA 2QG4A 2VZ9A 3L02A 3ES9A 2FPIA 1YMUA 2H1IA 1TA9A 4F9FA 2FPMA 3GJ6A 2X2PA 2OA0A 1P0MA 3FKSA 3L1UA 2XCQA 3B3QA 3HB0A 1FFGA 3LBYA 3LBAA 3PFIA 4L6AA 5ANRB 5JCJD 3GI1A 4Z99A 2G3YA 4CKCB 2YWHA 4AXBA 2HLNA 3RREA 3EPLA 3OFND 4OF4A 3O9ZA 3GLGE 3N2GB 2XPCA 3DVAB 4PX9A 4V03A 1YRQA 3MT9A 2HRDA 4MIOA 5ALPA 1WS6A 1OCEA 3A6JA 1JZTA 3U0BA 4ISCA 1H69A 4BL5A 1LZKA 3Q88A 3CR3C 4WNAB 4Y67A 1GZ3A 5IF3A 1D5WA 4JB8A 1OVGA 2W7TA 2BLNA 4G4SP 4LC1A 2X6QA 3CGWA 1U3DA 1ZIDA 2OGTA 3LX5A 4Y7CA 4N41A 4IAOA 1X77A 2C9MA 1C7QA 3CUYA 3MJCA 3QMWA 2V6GA 1XD2B 5CM8B 5D3QA 5ALQA 4I1OA 4URVR 2FMXA 4D42A 3P20A 2DQKA 1W44A 1CZNA 3NTUA 1HMPA 4JKOA 4WD3A 4NV0A 3D6FA 2QRPA 2JL1A 1Q0RA 3D6HA 4NH4A 4EHAA 2D06A 3OIGA 5F9FA 4PEVA 3A3KA 1H1DA 1VDMA 3BWVA 2C5HA 3R3WA 1BFUA 1QB7A 2YX1A 3AO0B 4P3YA 4Z9BA 3U3XA 4B81A 5BWCA 5IHPA 1AH2A 3ECSA 3PCRB 1T2FA 1YCDA 4K3UA 4TZKA 3ZI7A 1J0BA 1JQEA 1Z34A 4UMVA 3HG7A 4BBPA 2KX7A 3K3PA 4PSCA 2C4MA 2O5VA 2H7YA 3FHOA 4PLYA 5T4BA 1B43A 4N5DA 3R5SA 2OQRA 4C7OB 4H6XA 3BGIA 4NYJR 2D2VA 2FEXA 3WGLA 1F3OA 1YHNA 2EWVA 3IKLA 5B1SA 5SZKB 4RFSA 4C1BA 2GZSA 2WF5A 4PLGA 1RP1A 3MUEA 4NULA 4FX5A 5AHWA 5JJIA 1ULBA 4PYRA 5DKFA 3WBJA 3BL5A 1I80A 2EKDA 4CL2A 3GHHA 5ES4B 2O2JA 4CKXA 3DV0A 3CUKA 3QQ5A 1U0GA 1FP7A 2DBVO 1DQPA 2WD7B 3PGVA 3DE4X 3M6MD 3N8KA 3QBJA 2XUHA 3KZOA 4G0VA 1UBNA 3A6LA 3GUUA 2J0VA 1MBZA 3L7AA 4QBHA 1CERA 2OHJA 2VJDA 4M9RA 4M60A 3SBDA 3V00A 3VPSA 1U4NA 4BO0A 2VTVA 2ZRCA 2WDZA 4C78A 4K9QA 4H7DA 4EDHA 1O8BA 3U4DA 1U98A 4GVXA 2JGKA 3GT7A 4FBGA 4RA9A 4ZZIA 4PZ9A 1ND5A 1BGWA 2XVAA 4EIWA 3BICA 1E2MA 1Q7GA 1KOLA 5K51A 1P45A 4LDPA 3ZX4A 1JVBA 1W5AA 1W0JA 4OUKX 3G5UA 3TEJA 4D25A 2GPAA 2PJDA 5KINB 2Z4RA 3PIDA 5SYNA 1LTQA 1M8GA 4NS1A 3RC8A 4J29A 3NKFA 3QYFA 3D1JA 1SVIA 5KTMA 4GQBA 4H3SA 2W2KA 1EM8A 2FW0A 4FE7A 3TFWA 4YY3B 4M7WA 5FFFA 3X2FA 2ZB4A 5IFLA 3NHYA 1BX3A 1MV8A 5EGNA 4YV0A 5CA0B 1K6IA 1BGXT 1SIOA 2CJPA 5B6JA 1NIJA 1NRWA 3EMKA 4N0DA 1ISSA 3RANA 5AM4A 2JI7A 2OSVA 3INGA 3KVOA 4MB2A 2OV4A 521PA 4AC9A 2FOLA 4YP0A 4E33A 3TNYA 1PS9A 4I50A 1GGNA 4MICA 1XZDA 1UQRA 4LC0A 1XB2A 3A58B 4AKHA 4UPDA 3CNLA 3IAFA 4REQB 4BLRA 5EUBA 3N2KB 3WGMA 1LS1A 5EE3A 3NIBA 4C0BA 4WINA 2JIDA 2BKXA 4HGYA 4CLRB 1ZD3A 5AO9A 4MQBA 4GPZA 4OXKA 4ZREA 4E5NA 1E8DA 4P33A 4F38A 4G4SO 2AIRA 2VN8A 4QJIA 2RHBA 1JDPA 1ZOOA 2EKBA 4TUYF 5EXTA 3RB8A 3IFSA 1NDUA 2QW0X 3H5NA 4OHCA 1A50B 1FFHA 1PJSA 3B6EA 5FPQA 4YMWA 2ZR0A 4XRGA 1ZXLA 5EJFA 3DKPA 1DUSA 1GITA 1TUEA 1Y8RB 2BFFB 3BIFA 3OI7A 1K5HA 3IT2A 2P9BA 3Q98A 4TLMB 4CKBA 4AQ7A 4ZT5A 2GJ4A 4TLEA 1U1FA 2OMKA 1H05A 2HBYA 3DJFA 1SKUA 5FBWB 1FJGB 1C0LA 1Z6ZA 1Z5VA 2WWFA 5JHHB 3RSQA 2Z2IA 4LNAA 4ZQGA 2DUMA 2WFMA 2WAYA 3DLPX 2LVBA 1DBSA 5K2OA 3I5UA 1UT6A 3QVJA 3BHMA 4TT3D 3VOBA 4DLBA 3ICCA 3LQ4A 1MNAA 1X2EA 3WB2A 1JLHA 5KBYA 2F55A 3PRKE 1MJHA 1YNOA 3OZSA 2GN2A 3A2KA 3H1AA 3ER8A 2AKAB 2PD3A 1WB6A 1D8TA 3DEIA 4Z7JA 3WAGA 4V2IA 1T10A 2BGNA 5E2BA 5EHQA 3SYRA 5KI6A 1ML4A 1LX6A 5T4HA 1XCGB 4RZIA 2GBGA 3VYWA 4JA0A 3R0JA 5LQRA 3OIYA 4DV3B 1WD5A 1QX3A 4UNPA 4GVLA 1T5TA 4BZZA 1P39A 2CL6X 4Y2RA 2UYYA 1JFSA 3N8NA 1ZN8A 2L82A 1KRWA 1CZRA 3KWJA 3FZGA 2QJTA 1M7BA 1A9QA 1OFUA 1KYQA 3QWAA 2VDJA 4Q82A 5TNXA 3PPIA 1XK6A 4FYXA 2IS6A 3SSAA 3MJEA 3EEFA 4ACAA 2R44A 4EI9A 4U7FA 3EDOA 4UMEA 4B47A 2H1RA 2QRHA 4KBGA 2WG1A 1T36A 5FJJA 3T38A 4B4VA 1NG1A 3GZNA 3F8WA 5DOVA 1LKZA 3IBFA 4L8LA 2BWJA 1V8ZA 2I54A 2WTNA 3KJNA 2NZ8A 1XNJA 4HEA1 4DMFA 3PD1A 2FMTA 3RIMA 3NH6A 2VHEA 3HQ4O 1R15A 3BH6A 1JTEA 2CKMA 4X1OA 4F97A 2VATA 3DCYA 1AKMA 2XYGA 3L0ZA 5GIPE 4C2TA 3KLPX 2G40A 5LBUA 3WQQA 4ZHQF 3HXQA 3EVFA 2J3HA 1EFDN 4TRMA 4D9CA 2ZRGA 3KPYA 4JXJA 3JZDA 2QMEA 3I04M 4P7GA 3CEJA 2AC4A 1XYVA 1S2NA 4UBOA 2F3QA 4LVNA 1QPZA 5FWYB 3RRJA 3KUXA 2Z8YA 3ZEIA 2AF4C 2QRVB 3GRYA 3L6RA 4BNTA 7ABPA 1NXXA 1H94A 1ZFNA 1KMIY 2WU1A 4CW7A 1W4RA 5BVHB 5KVCA 3E48A 3QBEA 4EPXA 2E18A 1A9XA 1J00A 4TT8A 3JQDA 4FN4A 4K0RA 4OOEA 1JXOA 4RXMA 3V42A 4YRCA 2PUBA 4YMSA 2XRFA 2MJLA 4JBLA 4CBVA 3TRFA 3LOPA 5CPFA 2VNAA 1XXHB 2HCFA 4R83A 4U7TB 5HK9A 1JFTA 4Q0MA 1A95A 1ZJYA 2E21A 2YFQA 4U9UA 1CHDA 3ZWVA 2C82A 3IOBA 3VNBA 4NZZA 4KOEC 1FE8A 5C81A 2QLLA 5FUQA 4E7OA 1NSFA 3I1IA 4BWYA 4DJFC 3S44A 2PUVA 2M6RA 3BCRA 1JECA 3BIWA 2MYTA 4I9NA 4YHBA 1K68A 1CQWA 4XSVA 3P9YA 1I2CA 2QLTA 3CC8A 2OT3B 1IEVA 1S2GA 2AOWA 4XEUA 5CXSA 4ER0A 1D3AA 3PHHA 1OZGA 4BFYA 2JA1A 3AJEA 2VS1A 4RV5A 4XVQA 3HXMA 1FXUA 1IY0A 1AKWA 1TI7A 5KX5F 3F6BX 4R8MA 1I6MA 3DO5A 3ZCTA 2IF2A 3EOZA 1JIIA 4AO6A 3K71B 3DXZA 4WOPA 4MVJI 4EHFA 4BC1A 2NV0A 4RCYA 1BTOA 4YRIA 1E3SA 1G8MA 1XN1A 1TZCA 2TYSB 1Z4MA 3PITA 1E6EA 1YF3A 1OXSC 3PS9A 4YEDA 1T2CA 3F9IA 3LHIA 4G24A 5F4BA 2XKJE 4FD3A 2N9UA 4MP3A 4XAQA 3AYXB 4A4DA 5C7IO 5H7XA 3K0FA 5DEIA 2ACVA 4FFRA 2QYHA 2QU8A 2V6FA 4D4IA 3O5AA 1BA2A 1QOZA 2IYNA 2OFOA 2IU0A 2Q29A 4X54A 3WWCA 4ZEMA 3T3GA 3A4VA 1DG1G 3M5WA 4L8GA 1UIMA 3T9DA 2GXQA 4L4RA 5IZCC 3W5BA 3KWFA 2PUCA 1ECGA 1OILA 4URXR 4W5WA 1TXGA 4GDMA 3ZK8A 5L4LA 5GIOE 4I5FA 1W96A 1HE2A 2DUNA 5E8JA 5ENZA 2Z0MA 3TIFA 3D43A 4BY9E 4P86A 3BSFA 1TMKA 4FCWA 4EY3A 2YXDA 4ZDJA 3PYLA 4LY9A 3RKRA 1OU0A 4DLNA 3NETA 4BO8A 1NMEA 4HWKA 1SRQA 4OBBA 1Q6ZA 3UT6A 3JQQA 3EXG1 1BVHA 1UK6A 2RG7A 1F4PA 3MJ4A 4Y0AA 4ZOAA 3H9UA 4NDNE 1I5EA 5AM3A 1E7RA 3C3XA 4DB4A 1SG0A 2HLDD 4BP3A 4DARA 4G4GA 4KCGA 3T5BA 4AZTA 2LGJA 1IHYA 5JNRA 1G98A 2KM1A 2R84A 1LJUA 1VTKA 2A5JA 1IG0A 3HJUA 3IBSA 5ED4A 1Z9BA 4JI5B 1N33B 4FC6A 1UANA 1C1HA 5I8PA 3T3OA 2ZBGA 3KU4A 2W6JA 3PEFA 2Y1KA 4QUIA 2ZT7A 1G3UA 1ULSA 5JQGF 3KHTA 3K92A 3CXUA 2FX3A 3WYGA 3CKLA 2HF2A 4ZDIA 4MJLA 1R6BX 4IDEA 3MWDA 2ONZA 3NKVA 3Q0EA 1V6CA 3BQMB 1KEPA 1C3OB 2JI4A 2VAMA 1UBFA 2IPNA 2V7QD 2HSEA 4Q03A 1UJ6A 1QLJA 3QX7A 3ED5A 1HMYA 5IKXA 4B7AA 1XRPA 2GEVA 1KAMA 1Q12A 1X80A 1J21A 5B3KA 8OHMA 4FS3A 1F4VA 3JAWA 2XIJA 4Z4HA 3ZIDA 1JQKA 1KC1A 3OZVA 5EE0A 4BVKA 2J9RA 3PPVA 2YNMA 3D7MA 4PU0A 5KMGB 1RRKA 3HKCB 3JWGA 3L1HA 3VGJA 4R2IA 5KO2A 3RSGA 1A7JA 1CRLA 1RPNA 2PNJA 3ZHQA 1QONA 3FB4A 3PGLA 4W9NC 3IHLA 5ELMA 1L2TA 1RMYA 5LB4A 3DEKA 1PU2A 2B8JA 2QYTA 1D2MA 2VHYA 4QXQA 4CTJA 3LLVA 1GUAA 3OQ6A 3QVOA 4JB0A 4RCVA 3FZQA 4JLWA 1YS7A 1G19A 3O1IC 3P9IA 3N8IA 2TS1A 2XXAB 1FFYA 2WHPB 1DFIA 3P27A 4LC9A 1DBRA 3UT5A 1M2JA 5LUAA 2FUG6 2HEIA 3TVDA 3TGLA 2JLWA 3MINA 1VYUA 2BEVA 2ZITA 4KXLA 4ZCLA 3OQIA 4OPMA 4EUNA 4IIJF 1OZHA 2DPMA 3D8UA 1UZUA 1NUUA 1J25A 2OV6A 1M76A 2JFQA 2JIRA 2ZSJA 4MR9B 2Q1WA 2Z4SA 2G17A 3CBQA 1VXRA 3GEMA 3UWKA 4BGUA 4N18A 2VH5R 4P4GA 1IXYA 1O3YA 4XWKA 4IHAA 1QBGA 2Q3FA 1T3LA 4FZ3A 1RYYA 3OCXA 4H7EA 1WZ2A 3O8DA 4KE6A 5C9ZA 3LYAA 3OZUA 5B7QA 4EEKA 2H2GA 2G8LA 2G67A 4B85A 1RTKA 1I1NA 3WLMA 4F85A 2KS6A 5KNBH 1CX9B 1LZLA 1UC4B 3CGGA 2OYCA 3ZNOA 5KUTA 1PV2A 3EVZA 2XZTA 3E82A 3RG2A 3KSRA 4XJSA 2YDYA 5FLKA 1EE2A 3SHOA 1GT91 1KXZA 1PI3A 1XWWA 3F73A 4X8LA 2ORWA 1I7NA 2OCAA 2PUWA 2ZPTX 4KIWA 5LWQA 3E3MA 2RIRA 1JLLB 1OROA 2IA5A 3WSTA 1Z13A 1EGHA 4D0SA 3L84A 2QAGA 4NOMA 3LZ6A 3DDWA 1DPFA 2C5SA 5CYFA 1GILA 1U6JA 4C29A 1ZQ1A 1Y33E 1H0KA 2R6ZA 3OZRA 3S4YA 3IV6A 4CV3A 1T8RA 4HDNB 2Z04A 5IWAB 3HM2A 1XLVA 1DU4A 2VPZA 2YICA 2YIJA 3HABA 4J03A 2OHOA 2A5FA 4WDQA 3CLVA 3HDHA 1CF4A 2P40A 3Q12A 5HQJA 1MJGM 2QE6A 4YRTA 3G2JA 2ZM6B 3O3NB 2BJWA 4RYLA 4JVMA 3WRYC 4WTOA 4DPMA 2O9JA 5H0IA 3QSGA 3E5HA 5CBPB 1N5JA 1KYTA 3UO8B 2VR1A 2JHGA 3WB9A 5B58T 1T0IA 4LY6A 3WLJA 1BCSB 1G5IA 1IQUA 1V5WA 1QRUA 4X20A 1P4SA 1XEFA 2AN9A 4J7CA 2RGBA 4KN6A 3VR6A 4BTEA 3FYUA 1X39A 2FFBA 3CRW1 3CVUA 5I7FA 1UIRA 1MR3F 2VK4A 4C22A 2G6BA 2X1LA 3RJ5A 5HZHA 1MEOA 1S1MA 3QHQA 4RK1A 2EAUA 2YJGA 3C2QA 1ISRA 3JQGB 2KBFA 3PQ3A 4U9HS 1KVQA 5C18A 3HRHA 3DGFC 3UTDA 1T0PA 2J3MA 1ZGGA 2B0JA 2GPNA 2BHRA 2M1ZA 1SQ0A 4L57A 1JVSA 1WXDA 4NBVA 4X9XA 1ECBA 1EVYA 4E46A 3THXB 1BMFD 4R1UA 3JQAB 3L43A 1BH6A 5D86A 1ESZA 1DBPA 4Q00A 1CR4A 2PJUA 5IAEA 3JY6A 5FQOA 2IBMA 1NKTA 2OAP1 4RPKA 4S24A 1C0EA 5DT9A 3OUTA 3WL6A 5LXTB 4ME6A 1G291 3FMVA 3GLHB 3KTOA 2D54A 2PWYA 2Q5LA 3G9TA 4URZR 1G4AE 4V0SA 5DVZA 3KYCB 5TPWB 4DLRA 1R6DA 2UVDA 3BDIA 3H0EA 1J0XO 3TCXB 2D5BA 1OF1A 4MR7A 1HG1A 1NPTO 4L51A 4Q18A 4CLXA 4EM6A 1L5HB 3O2SB 3HNOA 5F52A 2G4CA 4CWAA 4JP3A 5A06A 4F4JA 4F4HA 1QF6A 1FTNA 1A96A 1Q0ZA 4CUZA 2O19A 4RANA 4XGIA 2G25A 3UXHA 1F1JA 3ZWBA 2O50A 4WCFB 1VDZA 4WHMA 3W3AA 1O95C 1R0KA 4BV8A 3M1LA 3DBVO 4X7PA 3LT5A 4QWWA 2DP4E 4NMWA 1DE0A 4PINA 1AQJA 2FX2A 5EEHA 6CHYA 3G2OA 3E5RA 2IWRA 2PCLA 4EYEA 4HP8A 4I2VA 4ML3A 1S7GA 3LVRE 1WEHA 4DQDA 3E7XA 4NJEB 3SM3A 3AEKB 5G53C 4MWGA 1WPGA 3RBAA 4MI6A 5EQJB 1KVUA 3IVCA 3ZXIA 5CEFA 4LNHA 4LFAB 4FQ8A 4IRXA 5KU7A 1AGRA 1GUBA 3EISA 1GA4A 3RC3A 5H3HA 1S2DA 1ADBA 1SNYA 1YRHA 4LE0A 3F47A 5EKSA 5C5EA 2YHUA 4W6QA 3BJEA 4PZPA 4TTVA 5K6AC 3WWPA 1UZMA 4G8CA 4WFIA 1ULHA 1RJ9A 1AHHA 1U9YA 3AUFA 1EWYA 4Q4AA 5IVKA 1G6Q1 3FFAA 1EBBA 9GPBA 3F9RA 4YP1A 4C5CA 1DSSG 2Z83A 1H2ZA 1XCLA 2H57A 4GECA 1Z17A 1F2UA 4BNJA 4OL9A 1Z6AA 1UDAA 4AG6A 1ZMBA 2WUFA 3HJNA 3ETNA 3BTUA 3Q3GE 4RLSA 5CLQA 1R12A 3GAMA 4D43A 2B1IA 5I9LA 1Z8HA 1ZYUA 2RH5A 4RF5A 4O4IF 3U6BA 2I2AA 3F98A 2DSTA 2BFCB 3EFHA 2OVFA 3QPCA 4PZLA 3FGOA 8LDHA 5K7SA 1XDUA 1ANKA 5DE3A 2YZ7A 2UXDB 3ADBA 1JDNA 1Z08A 3GLUA 4XB1A 5AK3A 3AOGA 1D1PA 1GGFA 2NUTB 2ZP1A 2HMVA 3FW1A 1N57A 5FNVA 2BEWA 4R8RA 1KAEA 5BORA 5IYZA 2IZ0A 3QHPA 3RUAA 4N4AA 4L3OA 5BYJA 5BN5B 5KHLB 1EINA 2CWWA 3H84A 3VPFA 5F2EA 2EF0A 3UWMA 1ETUA 1WXHA 4GD3Q 3OLZA 4OYLA 1E6KA 1EXWA 1VG9B 4C0JA 4M53A 1Z07A 3D6UA 3QK7A 4Q05A 1SHZA 4QFDA 2FWNA 2KPOA 1L4NA 4LSZA 4JYMA 1KWKA 2FRDA 3HUDA 1K6MA 2BI8A 1QO7A 1QGAA 1U94A 2F4NA 2JA2A 2X76A 3OO1A 3INNA 1XEAA 2Y8EA 4V0MA 4WEOA 3T3DA 1E18A 5HRUA 1SM4A 4E5VA 3L7LA 3D1LA 1HL7A 2QLJA 4NNPA 3PUJA 3SIPA 2A9KA 2O6LA 4GOJA 4UOEA 4EGJA 2OBFA 4PIMA 3ZD8A 1CLUA 1PSWA 4GX1A 2C7OA 4PR0A 4I1YA 1W1IA 4ER3A 1UK9A 5KQLA 2B6HA 3A1CA 3LXMA 1NVMB 3RLFA 3SU8A 1QRAA 3FCYA 1T2NA 1N8KA 3KKZA 3WI7A 4CT0A 2NO4A 2P2DA 1MQ8B 2VUUA 3JYOA 5IEJA 4KPFC 3LY9A 2XLBA 1E5DA 1HTBA 2HA6A 2OGZA 5DX0A 2RHOA 2VI5A 4ZAYA 3CEPB 4K8OA 4UU1A 3H1TA 3MUOA 3T7TA 4MGKR 2P91A 3L8YA 4CMCA 3J81A 1VA5A 1DQNA 1LBEA 2FPSA 2OZEA 3CG0A 4LJ6A 4KYUA 2AOTB 3OF5A 2XA1A 5EJAA 5FNZA 4JB2A 1I6LA 2DHQA 2FGKA 3WL5A 3WNQA 2XTAA 1WY7A 2G76A 4WXPA 5LDGA 3E61A 3HBMA 1A5BB 4ESHA 1QIDA 4JI7B 5E95A 1AQNA 1ZM9A 2WJAA 3EXIB 4LAFA 3WGIA 4EYGA 5BMVB 2XUDA 4IDOA 1XPRA 2QTAA 2XUAA 3NT5A 4B0PA 1KK1A 3CBGA 4FLFA 4LYFA 4D57A 4XEHA 4YRMA 4GOMD 4KWTA 4BTLA 5C7LO 5A03A 2JFZA 1JAZA 4LF6B 3WY9A 2Z2JA 2V9PA 3RWBA 1JHXA 1TPYA 3O1LA 3CMCO 3IAS1 4MLDA 1MJ5A 1DCMA 1VKHA 4PICA 4HPWA 5L4SA 5H8WA 5J3JA 2ZU6A 1F2TA 5LYJB 4ER7A 2OP0A 3KC2A 2A94A 3PDIB 5SYMA 5JRZA 3GPCA 5ER6A 3V4SA 5HZGA 5I7OA 4ENVA 5ILOA 1NQOA 3ZZ1A 4RX1A 1L7VC 3ZBPA 4DNXA 3WKBA 2VF7A 2IYEA 2PR7A 1ZGZA 4JQZA 4OXRA 2JGDB 5EVCA 3L4JA 5EMJA 3UXEA 4EFLA 4A15A 2LTAA 3P9XA 2CLDX 1LSJA 1KH1A 3TNLA 1AKNA 2ZEJA 2X22A 1FSSA 5DBEX 1YBMA 3KZVA 4AO8A 2J0EA 4IJ5A 3DBRA 3IODA 3GGCA 3CPJB 4RIEA 1FP6A 1RXIA 2A9FA 3VBEA 3CWCA 4RDXA 1N9ZA 1SUAA 3LP8A 2VSYA 3M81A 4MXDA 1JR3D 3VTZA 5EPOA 4F3KA 4XQ9A 4Q3CA 5LN1A 2IKSA 1ODKA 2ZXEA 3ENKA 3V6LA 5G0SA 1JQLB 2DTEA 3UMSA 3PENA 1H3FA 3LQ1A 4HSGA 4UTZA 4H4DA 3NWPA 1MORA 2XY4A 1U2EA 4FW9A 3QV2A 3C15C 2GF9A 2CT8A 1U04A 2XOEA 3ZOZA 4KFCA 2DHDA 2GM5A 3HR7A 3HZOA 1KU0A 1XALA 2QTRA 3LNCA 3QELA 4U6SA 5DNEA 3UW3A 1PD0A 5GM1A 5ITVA 4C4XA 2WJVA 5EWLB 4BQSA 1CRZA 3GZTB 3GB9A 4BB6A 3L1VA 1F9EA 4LJ7A 3GLFB 1BWRA 2OILA 4GYWA 4PQYA 1OX5A 2RGCA 3BCSA 4EOGA 2CBXA 3HYSA 4XTRA 1KE2A 1KVSA 5ALIA 5CCEA 4EL0A 1XE3A 4GT1A 4QUJA 1WKBA 1Y1LA 3D02A 1H0HA 1GNPA 3C5WP 3F5SA 2P35A 4G4JA 1J49A 4NYMR 3WLNA 3ZYZA 5KYTA 2AFHB 4NY1A 2PDAA 5CCDA 5JZ9A 4MS1A 1AKTA 4Q39A 2AOUB 1K6EA 1VHQA 4XWTA 1EXVA 3JWIA 3UHOA 2PMBA 2O5CA 4KL8S 1GEGA 2JCBA 4YWHA 2IUYA 4HWGA 4TWZA 1YA6A 3AHJA 3DAGA 4RHUA 4A23A 5ICGA 1S3SA 4YA6A 2XF8A 4UPEA 4DQUA 1J7JA 2ZUEA 2MYNA 4Q3AA 1Y1RA 4EY6A 2WKPA 3BD8A 2CBGA 2DPGA 2B1GA 2FSIA 2GYUA 1B0ZA 3AFOA 1J1UA 3TSZA 1VP9A 1Z33A 1HNWB 1OXXK 1HY3A 1RQRA 3FLBA 1SGWA 2E4ZA 2XNDA 4JWKA 2MYPA 3Q7PA 2YJ3A 1K7FB 1PSZA 5DCLA 5HOQA 4MEJA 4V0RA 3U61B 2VUHB 3O38A 4LOJA 4J1NA 1CUBA 4MQMA 4NOLA 3SJZA 1SKYE 2GERA 2HX1A 2JZOA 1JPUA 1KZ7B 1PS8A 3RFCA 1NZDA 1GT6A 1Y3AA 3KEGA 1LY1A 1U0TA 4GX5A 1XFAA 1XVVA 2UVPB 1A7KA 2PV0A 4RK7A 4F7WA 1AQ6A 2JD2A 1RWPA 5EE9A 1RWMA 3HHPA 4XM1A 2QQGA 3KKKA 2I7XA 4Q9JA 4DR6B 3UG7A 1L5YA 1NE2A 1J2RA 1LI4A 4IYRA 1IH8A 2CFRA 3VTKA 2YV2A 1P5ZB 2V58A 3L7CA 3KAPA 4HAXA 4PSUA 4QOFA 4E09A 2CYAA 5C5CA 3W05A 4U3JA 1EFTA 2Q5OA 3FMFA 3LKBA 4QWMA 5I9TA 3WMRA 1J06A 1R8YA 2PWPA 1LSSA 2H0RA 1BU8A 2ZAMA 5CT5A 4HV4A 1E4EA 1KBZA 4DYVA 5B55A 3I01A 3V8NA 3FZYA 1GQSA 3G9UA 4HQFA 4OIFA 5G02A 3RS4A 4HC4A 4C06A 4JHXA 4WRRA 1R4NB 3GELA 3UJBA 2Q3LA 1DRVA 1W4LA 3AHEA 4RSRA 3DP9A 4QGBA 4UUMA 5C46F 1SJ9A 2C5FA 4IX9A 1Y5NA 1DADA 4YMUA 5H9WA 1GTSA 4JX9A 2QB5A 4WK6A 1LQ2A 4UHCA 1PV1A 1N4DA 2OHIA 3DDZX 1Y63A 5AK5A 2OOSA 1LF5A 3C6QA 2FPKA 2YQ4A 3MA0A 1PBTA 2OORA 3ISTA 1PR1A 4KXUA 3ZE8A 3CCCA 4FMCF 1O97D 1W85B 1KDVA 4LHEA 3N5CA 3O2QB 2DE0X 2HU2A 3K2BA 3LY8A 2A1IA 4OBEA 4RXUA 1CY6A 5IVIA 3SQLA 3SZOA 4ENPA 3H9BA 1FCJA 2N75A 4QDUA 4Y30A 2E4WA 3S28A 1P7WA 1AXEA 5IAAA 1EVKA 1ZK2A 3FR7A 1L8AA 3L46A 4QC2A 5EAIA 3WYAA 4V1CI 1XDGA 1I4DD 1OH6A 1Q22A 1QV6A 2C4VA 1ZIXA 1V1RA 1C0PA 4Q4HB 1MB4A 1WDWB 3I05A 3IBCA 1ORWA 3QMVA 2VJNA 3P32A 1R7RA 4XA8A 4HAUA 5A6SB 2BMDA 1N5IA 4GEKA 3HDGA 3TRDA 1KZYC 2I6GA 1RKUA 3LF1A 4YONB 5IT4A 5IVHA 3MTJA 1IONA 5I5GA 3UB4A 1KI1A 3OETA 1TW2A 2OBYA 2JIZD 4EUFA 4R0MA 3IIEA 5EIBC 1WF6A 4JP2A 2I4MA 4F3YA 2DJIA 5JC8A 5JMTA 5JTUA 1RAFA 3C7TA 1MB3A 1WZUA 1XVLA 3KJQA 1L7PA 4DLWA 3EK2A 4FYIA 2EQ5A 1JEYA 3AZPA 2Q1YA 4P83A 3R7WB 4AFNA 3TBFA 2VRCD 4RHYA 2VA8A 1XZJA 4B6QA 4AYWA 2NMVA 2O3SA 3RTBA 2JFFA 4FOOA 3U1VA 1DAIA 3EIFA 2V7TA 2FP4A 4J0HA 1JWLA 3PQCA 3MTIA 3PK0A 4MUKA 4DJ5X 1MLDA 1TEVA 1YD7A 4DIBA 1U31A 5IX8A 3R9IA 5FBKA 1I6WA 2X19A 3AVPA 3LHFA 4TOIA 4TV9B 3MS4A 3DOIA 1JR2A 2NZUG 2BRUC 2QVGA 4PAMA 5INTA 2HC9A 3AZOA 2ZT6A 2F59A 2LCFA 4PSVA 4X60A 4KR3A 5BUCA 2I7CA 3AI1A 1PDWA 3EXFB 4G1FA 2OFFA 1GAEO 2B0CA 3OLXA 3X2SA 2COKA 3HLTA 3FX2A 1Z37A 3WIUA 2WSIA 3WO0A 4PYQA 4UJ3A 4JSYA 1WX1A 4OKNA 1W93A 4M6WB 3GCZA 3H9JA 1VE7A 1L7XA 4C6TA 2YH2A 5A0VA 4X3OA 1O4VA 3LC2O 1T4BA 3NZEA 3HCNA 1Z7WA 1QP0A 2W43A 4GE3A 3IDFA 5J2TB 1CE8B 4JH0A 5TXGA 5H3CA 1YC2A 3M34A 3SPXA 3NTOA 5DBOA 3VTAA 4C6SA 5IKOA 1GFIA 4CM8B 2J8ZA 1XDSA 1VP3A 2OAGA 5FRDA 4I50F 1QP7A 3ONEA 3E81A 5A71A 4GGMX 2HDOA 5HIIA 2A35A 3NTRA 4KQ6A 2BZ1A 2CB9A 2IE8A 4E21A 1Q77A 3TQOA 1TKBA 1MX5A 1QFSA 4R9RA 3I4FA 4FJ0A 1M5UA 1VE1A 4G67A 4OLHA 2ONJA 3ZD9A 1OLXA 4AYXA 4DCVA 2R8BA 4M1OA 3U40A 1M54A 1XDBA 2GVNA 4G5SA 4YP5A 3NYWA 3I9V6 1E2PA 4FE4A 1TQDA 3BHIA 3FBGA 3Q7EA 2JJ2A 4PYKA 5DM1A 3GJTA 2IHBA 2VVTA 3LPMA 1ZH6A 1Z15A 3UKDA 1NMZA 1WUKS 3AUAA 3FRJA 2AD5A 2HJGA 3VH4A 4RD2A 1ICEA 3MAAC 2F8TA 4KFTA 1HT1E 1A1VA 3OAAA 1OGJA 1MAVA 2Y2VA 4K9LA 2IYSA 3A1UA 4ZK2A 3TH5A 3SG0A 2H7CA 5L6LB 1M2OB 1NUAA 2EXXA 2G71A 2G8NA 2ILTA 1DCFA 2VT6A 1M1YB 3DVSX 4WZZA 1JEQB 2REOA 4H15A 4B8YA 4NJMB 3K0AB 4KQWA 3WWDA 1RW4A 3LLSA 4JFAA 1XPUA 3BMNB 5I8WA 2AYZA 2ECOA 2ZRDA 4J6EA 2PN1A 2PX5A 4W6ZA 4XR9A 5HBGA 2OGWA 3E9YA 3WZLA 3NBKA 1PS0A 3GUZA 1DBQA 4O2BB 5DP1A 4QFMA 1VI2A 5AJZA 1C9EA 3C43A 2QKYA 3M49A 3AR7A 221PA 3CS3A 5CNKA 4W5TA 3E2PA 3WDKA 3B5JA 4C05A 3AEZA 4AI6A 1DOHA 3H7IA 4CODB 2V0GA 3EF3A 3HP1A 4HYQA 4RV9A 2ZZMA 1Z0ZA 2WVGA 5KQGA 2PPLA 4JX8A 1DQZA 2JJMA 3K70D 3D8NA 5EHZA 5KYYB 5JT1A 3WDSA 3L8GA 4IIHA 5DN6A 1TUBA 2BIFA 1VCNA 1P1KA 3T6KA