1DK2A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords DNA POLYMERASE BETA
total genus 19
structure length 86
sequence length 86
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk2A00
4KLHA 7ICNA 7ICOA 2FMPA 3JPRA 9ICVA 4XA5A 4NLKA 4TUSA 4RPZA 4FO6A 4DOCA 3B0YA 2BCVA 4M9GA 1ZQHA 4KLTA 5J2HA 1BNPA 3JPPA 8ICXA 3RJJA 4RQ7A 4KLMA 7ICMA 9ICEA 8ICKA 4PHDA 4M9LA 2BCRA 7ICVA 4PGQA 1KDHA 3JPOA 4NY8A 4RQ4A 1KEJA 4F5PA 4QZCA 1ZQKA 2KP7A 8ICYA 4MF8A 3LK9A 5J2FA 4I29A 4KLSA 5IIOA 5HHIA 5J0XA 1XSPA 4PHPA 9ICBA 4F5RA 4MFCA 3UXNA 8ICUA 4DOAA 4UBCA 4PGYA 3ISBA 4O9MA 4GXKA 4KLUA 4GXJA 4RPYA 4X5VA 4NM1A 1RZTA 8ICEA 8ICGA 9ICNA 4QZIA 1MQ2A 4I2IA 7ICIA 9ICQA 3HX0A 4R65A 3PMNA 4KLQA 1ZQCA 3MDAA 3RJFA 8ICBA 5D4BA 9ICFA 5J2GA 3PNCA 2BPFA 8ICNA 4RQ8A 1ZQRA 3C2KA 7ICTA 4I2CA 3B0XA 8ICIA 5DBAA 3V7KA 2PFNA 2BCSA 4Z6FA 9ICGA 4M2YA 4KLEA 4KLLA 9ICAA 9ICKA 4PGXA 4R64A 3HW8A 1ZQIA 4R63A 5D46A 4JWNA 4KLJA 3JPTA 7ICSA 1BPYA 3RJIA 9ICLA 4QZGA 4M9HA 4O5CA 4UB4A 3UQ2A 5IIKA 3AUOA 9ICPA 8ICSA 8ICRA 3RJEA 4TUPA 2PFQA 1HUOA 7ICLA 2BCUA 4MFAA 5J0UA 7ICRA 2GWSA 5DKWA 3V7LA 7ICGA 1ZQQA 2BPGA 5J2CA 9ICOA 4YMNA 4NXZA 4R66A 5J0SA 4KLFA 4MF2A 3RJHA 9ICXA 5J29A 5BOMA 3UPQA 2ISOA 4RPXA 8ICTA 1ZQPA 5EOZA 4M9JA 8ICWA 4IQVA 5J0RA 5IIIA 3TFSA 1ZQNA 1XSNA 4KLOA 8ICCA 4Z6EA 8ICJA 3GDXA 8ICLA 4UB3A 8ICPA 4UB1A 3C2LA 1ZJNA 4TURA 5BPCA 5IILA 1BPEA 4YD2A 5TZVA 3MDCA 3RH4A 1ZQSA 4RQ3A 5J0YA 1BPXA 4F5OA 2ISPA 4PHEA 4YMOA 4YD1A 3HWTA 4MFFA 5CB1A 4LZGA 1ZQTA 1BNOA 3MGIA 1ZQAA 2IHMA 7ICPA 9ICSA 4RQ1A 4F5QA 8ICOA 2PXIA 3ISCA 1MQ3A 4M04A 3RJKA 5CWRA 3RH6A 7ICHA 9ICWA 9ICCA 2FMQA 1TVAA 4K4IA 9ICRA 4I27A 4RT3A 4I2EA 4QZFA 4UB5A 7ICUA 2P66A 5J2KA 2W9MA 3JPQA 3C5FA 4DO9A 7ICQA 5DBBA 4LZDA 1DK2A 4M0AA 5DB9A 3V72A 4Z6DA 4QZHA 3TFRA 4PH5A 9ICTA 1TV9A 1ZQDA 3C5GA 5HHHA 4RQ5A 2PFOA 3PMLA 4UBBA 4I2GA 5J0QA 3AU6A 7ICFA 2BCQA 1XSLA 3ISDA 1ZQGA 4I2FA 4NLNA 1DK3A 4RQ2A 2I9GA 4I2HA 8ICZA 3JPSA 4M47A 4NM2A 4UAZA 4PPXA 5J0OA 4K4HA 4UAWA 4K4GA 5J0WA 7ICJA 5DDYA 4QZ9A 4O5KA 4RQ0A 5IIJA 9ICHA 9ICMA 5J2IA 4TUQA 4UB2A 4NLZA 3AU2A 5J2AA 5D49A 1ZQFA 2FMSA 1BPDA 4QZEA 9ICJA 4IQWA 1ZQBA 8ICHA 4RT2A 3UQ0A 4P2HA 3JPNA 9ICUA 1ZQOA 4I2AA 5J2BA 1ZJMA 8ICQA 4I2DA 3OGUA 4XUSA 4YCXA 3RJGA 5J2EA 8ICMA 4F5NA 4M9NA 1ZQEA 4GXIA 5J2DA 1ZQJA 5IINA 7ICEA 8ICFA 4JWMA 3MGHA 5BOLA 4PHAA 1NZPA 5DB8A 3V7JA 4O5EA 1HUZA 5DB7A 4IQUA 4QZAA 4LVSA 3UXOA 4I2BA 5J2JA 4KLDA 1ZQMA 5DB6A 3UXPA 4QZDA 1JMSA 4KLGA 3RH5A 8ICAA 8ICVA 4RQ6A 3MBYA 4YMMA 4DOBA 4IQTA 5IIMA 3C2MA 5J0TA 4KLIA 4I28A 5J0PA 7ICKA 4QZ8A 4Z6CA 4UAYA 5DBCA 1BPZA 4YN4A 1ZQLA 4QZBA 4I2JA 9ICIA 2PFPA
chains in the Genus database with same CATH superfamily
2DPIA 3O0FA 7ICNA 4P0QB 3HP6A 2J6UA 2ZTEA 3DEEA 9ICVA 4Y2SA 3H40A 3QE9Y 4C8OA 4M9GA 2YB1A 3WU2U 2FLPA 3GFKB 4YR2A 2ZIWB 2EZXA 1NK4A 4ECUA 4ECYA 2AH5A 4PHDA 2W9BA 4M9LA 5AKKA 2XGQA 1KDHA 3I28A 4NL9A 1KEJA 4Q8FA 4QZCA 2WF9A 1ZQKA 1FEZA 3MGVA 4AP9A 4J9KA 1Q3UA 4F72A 5KFSA 1N62A 5KFCA 1V97A 1RG6A 5J0XA 1XSPA 5AI0A 4ICAA 4PHPA 5F9LA 4FS1A 2XCPA 4F5RA 4MFCA 3UXNA 9ICBA 3MR6A 3WKCA 2BZFA 2E1FA 5ALYA 4OJLA 4GXKA 2XC9A 3GIMA 2K8BB 4ECXA 4KLUA 1DGJA 3QZ7A 4RQMA 3HRDD 2Z7JA 4C7ZA 2HI0A 1K1QA 2YMMA 4NM1A 3KBBA 5KT7A 1MSWD 5ALGA 3T5JA 4OJOA 4F4YA 4I2IA 1SB3C 2ZJ8A 4DFDA 4KLQA 5DDMA 1ZQXA 3MFHA 1ZRMA 4DS4A 9ICFA 2XCAA 2DKZA 3QYPA 4IRCA 3LDAA 3PNCA 2ALZA 3EYZA 3QEAZ 2XICA 1ZQRA 4Y2RA 7ICTA 4I2CA 4R8UA 4ED0A 5DBAA 3V7KA 4ED3A 2PFNA 4U6PA 1NJZA 4USAA 2QB0A 1LV5A 5ALMA 5KFUA 3IRUA 2HW3A 5KG0A 2W03A 5AKEA 3H8MA 4YVZA 1ZQIA 1IG6A 3QX7A 4LJXA 3BZCA 1Z1BA 3SAHA 1LB2B 1FFVA 3M9NB 5L1JA 1L5UA 5F9NA 4O5CA 1XS9D 2CPRA 4BGDA 2OYYA 1ZQ1C 4PZNA 5KFKA 4TQRA 4DL2A 2HVIA 1ZOLA 2VA8A 4ECZA 2QKQA 5AI5A 2FLNA 4FE3A 2EH9A 1S0VA 2HOIA 7ICLA 5KT5A 3PW4A 3R9KA 3PY8A 1N61A 4B9NA 3KTQA 5ALIA 4CDGA 3RRGA 3RBDA 4KX5A 7ICGA 1WUDA 4O3QA 1ZQQA 5KAFU 4DS5A 5KFQA 5DG7A 2YMQA 3TKAA 1SGGA 1QQ7A 3RJHA 9ICXA 5J29A 5BOMA 1S0MA 8ICTA 3QU4A 1SKSA 1ZQPA 4TQSA 4M9JA 2VJ5A 5IIIA 3TFSA 5KFEA 1ZQNA 1HJPA 4KLOA 4Q43A 5HMLA 1Z00A 1YZ6A 4TURA 5IILA 4YD2A 5TZVA 2YX8A 1B4FA 1ZRNA 2JEIA 3QU5A 4F5OA 4F4KA 4YMOA 2ZUCA 4MFFA 1ZETA 1BNOA 2KMDA 2PI5A 2IHNA 5KFGA 1TAUA 5KFIA 1KLNA 2FPKA 3BQ7A 2DF4B 2B6GA 2IHMA 4RQ1A 4DFPA 8ICOA 2G07A 4EELA 2F44A 3BQ1A 3ISCA 3NRWA 9ICWA 1T94A 2LYAA 1TVAA 3NS1A 2IOFK 1C7YA 4EX6A 1YZ7A 4F4ZA 4P0PB 3PSFA 4Y2PA 2JR5A 1O08A 3ETRA 4I27A 4UB5A 2K4IA 2HHWA 2K4EA 1JRPA 4OCZA 5J2KA 2W9MA 2MUTA 7ICQA 2HOFA 1L7OA 4OJ5A 2KG5A 5DB9A 5ALVA 2RRDA 2H5XA 4PH5A 3PX0A 1ZQDA 4RQ5A 1UCVA 2PFOA 3SQIA 3Q8KA 3FDSA 3T79A 3U26A 5J0QA 3AU6A 4YXMA 2QARA 4G9BA 5KNIA 2JZBA 4Y2JA 2ZJ5A 5CRXA 2GOLA 2KK0A 3NVVA 2RLTA 3JPSA 3GIKA 4UAZA 4PPXA 4Q44A 4FZNA 5KFHA 4B9LA 1L6NA 3KFUF 3RF9A 5AHXA 4RNNA 5IIJA 2HHTA 9ICMA 4ACOA 1LVHA 1PK3A 3RB0A 3F5EA 4DL5A 4ELUA 4QZEA 5AKLA 2VJ4A 4CE6A 1Z1VA 1SV4A 3FC4A 5HR7A 2F2AB 2V9WA 4EENA 8ICHA 4UAVA 4RT2A 2ODGA 5KFJA 3JPNA 3OSNA 3K1RB 2KOBA 2G06A 4I2AA 1Z4NA 2G09A 2WB1F 1MA7A 1CEZA 4C8KA 4YCXA 2ZIVA 3Q8SB 4C8NA 8ICMA 2JEJA 1ECWA 2K8AA 3N7SC 3C23A 5ALLA 3TADA 4DSFA 3ZDDA 2MU2A 1IXRA 3H0LB 1KRPA 2HHUA 2E8PA 2JZBB 7ICEA 2KHVA 4OJ6A 5EWFA 4JWMA 4DL3A 4UATA 2JEFA 2F76X 3V7JA 2RHFA 1HUZA 3V6JA 2CN1A 4F3OA 3NVZA 3OJUA 3EPGA 4LVSA 4UAUA 4KLDA 4ED2A 2HHSA 1KTQA 2BPCA 2IA6A 1ZD4A 4IR1A 5AM1A 3T5HA 1X2IA 5EWEA 1UPHA 3NRZA 4DOBA 1RYRA 1COKA 2XVTA 1URJA 4ED7A 4DSEA 1QSYA 4A8EA 1QLNA 2JH1A 4C4SA 1SZPA 3BJYA 2W54A 5DQHA 4UAYA 2Y1IA 4Q45A 2UVWA 3MC1A 4QZBA 1TE2A 3QU2A 3KZXA 4DF8A 1N5XA 5G5GA 2E8OA 1T4GA 2PFPA 1M6YA 4KLHA 7ICOA 5KT3A 2H3VA 2P6UA 4US9A 5KFTA 2FI1A 1SWWA 2OM6A 2XIDA 4NLCA 5AK6A 1SV0C 4NLKA 3HKZC 3SAGA 4FO6A 1O03A 2PI4A 4DOCA 2R8IA 1X9XA 2EDUA 1D8LA 2BHNA 2YQEA 1NK0A 2BDPA 4MEXA 3PSPA 1JUDA 2HBJA 1BNPA 8ICXA 5AM5A 3RJJA 1VDVA 3PR4A 3TAPA 2BCRA 2AQ0A 7ICVA 4PGQA 3LWLA 2O6KA 4RQ4A 1S8OA 3TACB 1OXJA 3ORYA 2DKXA 2A1AA 2NO4A 4F93B 2HDOA 2DGZA 3AL0B 1NOMA 4NLBA 2XY5A 1BPBA 4J03A 5HMMA 2MSNA 5HHIA 2YB4A 1OUQA 2ES6A 2WTFA 1L3UA 8ICUA 3OJSA 1KQQA 3QXGA 2ESEA 5KFPA 3M6ZA 2BKEA 1T3NA 2ASLA 3OTQA 4O9MA 1ZXIA 3KKAC 4RPYA 3H4DA 3T3FA 1RQNA 2KV2A 1JXEA 1X6JA 4DWIA 2V4RA 8ICEA 2DUYA 3WK8A 1X66A 2VKQA 3GZFA 7ICIA 2KN7A 3HX0A 5CHGA 1UA0A 1ZQCA 4B9TA 3HILA 3KHGA 2BGWA 2ZIUB 3H8SA 4RQ8A 2E3TA 5EE3A 4Z6FA 3WK7A 9ICAA 2W11A 9ICKA 2FLLA 1JROA 5EE0A 3LVWA 4PGXA 3HW8A 1S9FA 3SYZA 4ECRA 2JH7A 1X6IA 2NO5A 4UQGA 3DDHA 1WCNA 3CYMA 3BZKA 5ALXA 4DL4A 1RM6C 4JWNA 3PSTA 3M9MB 4P4MA 2KJ5A 1PVRA 3JPTA 4P4OA 2W55A 5KG7A 3RJIA 3IG8A 2KZZA 3B9JA 2ZIXA 1JALA 4YG2A 4UB4A 1S76D 2EANA 2F1IA 8ICSA 3ICXA 3Q8PB 4TUPA 5L1KA 3IG5A 2KE7A 5J8YA 2GWSA 1WCLA 3RAQA 2OEHA 3L4PA 4NV0A 4XRHA 2OWOA 3V7LA 5J2CA 1MN8A 9ICOA 4YMNA 1S97A 3C28A 2WF6A 2EAOA 2A3VA 3K75D 2NV3A 4MF2A 1DOQA 3N7RC 1RXWA 3C1ZA 2CRXA 1HEKA 4YFKA 8ICWA 2ATLA 5EE9A 4YR0A 1GO3F 3NASA 1NJWA 5AKJA 4J9OA 1X9SA 5T14A 3H0MB 4QWEA 8ICCA 4IRKA 2KKVA 5KG1A 4E0DA 1ZJNA 3MDCA 3KHRA 2P35A 3UM9A 1PK1A 4RQ3A 2ISPA 4P0PA 3BQ0A 1XC9A 3HWTA 2OH2A 5KT4A 4LZGA 2KZMA 2E5SA 3PSIA 2Y0SF 2K4HA 2LKYA 3GV8B 3MGIA 1ZQAA 2MRLA 3SR6A 1F0MA 4IL6U 2BR0A 5AKYA 1Z00B 5AKIA 1X9MA 1NK9A 1MQ3A 2I6XA 3RJKA 1ZQYA 3ALRA 5CWRA 3MR3A 2MA1A 3RH6A 3RB4A 1Z4OA 7ICHA 2AGOA 5DLFA 4WJ3B 2OCEA 2Y1JA 4ELTA 2JEGA 2KJ9A 1ZD3A 9ICRA 3F2CA 1K5OA 2L5YA 3ZI4A 1S10A 7ICUA 3RB6A 1QSSA 3WKDA 4FBUA 4DO9A 4DSLA 5DBBA 4DFMA 4LZDA 4Z6DA 3D2QA 4QZHA 2FPMA 3PV8A 1TV9A 3C5GA 1Q46A 4UBBA 5KFMA 7ICFA 3G6XA 2ZG6A 4YR3A 2W9BB 4JK1A 1D9FA 3KKAA 4Y2UA 2G08A 3H0RB 5ALSA 2ZTCA 1N63A 5ALEA 1SZHA 4OO1J 4BUGA 3BS7A 1LKYB 2ZUDA 5CEHA 4K4GA 1OW5A 4PJ0U 5ALOA 4QZ9A 4B6JA 4RQ0A 4PL1A 3PVXA 3PX6A 2OXOA 2LBOA 3E58A 1U49A 1XNSA 4RZRA 3AU2A 5D49A 4EX7A 2R8GA 3IV6A 1T7PA 1KKXA 2JGAA 3PW0A 3F5AA 2FMSA 3QZ8A 9ICJA 4US8A 1SL2A 1ZD5A 3AMZA 2LM4A 3QUCA 3PO5A 4QWBA 1ZQOA 1ZJMA 3L3FX 3OGUA 1X9WA 4EEYA 3RJGA 1D9DA 3QUBA 1U4BA 1WWUA 4ECTA 2F1HA 5G5HA 3VC8A 3AN1A 1D8YA 2WF7A 4J9SA 2W3RA 3MGHA 5BOLA 4PHAA 5F3XB 1NZPA 2Y9TA 4FS2A 3LVVA 5DB7A 3RR8A 1L7MA 5KL8B 4JV0A 3UXOA 3V6HA 3N7PD 3NUQA 5DB6A 3UXPA 1RPLA 4P4PA 1JMSA 3AM9A 3G6YA 2K8CB 1VJ5A 1QSLA 4C7YA 1NZBA 1UA1A 2ZJAA 3SZ2A 4O3RA 1WWVA 3WK6A 4Z6CA 1YT3A 1ZYQA 2PKEA 5DBCA 2D8CA 2KFZA 4RNOA 3C1YA 2DBYA 2KSOB 2B21A 4EEKA 3MABA 2XY7A 2FDRA 2F3NA 2JRZA 5AKGA 3OHAA 2R8JA 4KN4A 4JB3A 1VLBA 3JPRA 4KMOB 4XA5A 4TUSA 4F71A 4RPZA 2R8KA 4OJPA 1FFUA 4O3SA 4KLTA 3BQTA 3N28A 4EZ6A 3RFAA 5ALZA 4IS7A 5AKHA 1J97A 4F91B 5AIBA 1B43A 3QUQA 4RQ7A 5KFRA 2EQYA 3M1YA 7ICMA 4BXOB 2KTQA 9ICEA 2W04A 3M7DA 2NRVA 1BGXT 2AHOB 2AJQA 2OHFA 4CF3A 2KVSA 2JMGA 1Q3VA 5AM4A 5L1IA 4F5PA 1Z3EB 3PZPA 5ALNA 3QUTA 2C2EA 2D3DA 3AEVA 3LK9A 4GFJA 1PVQA 1SIJA 5J2FA 2YTUA 5KFFA 4BWJA 4KLSA 5IIOA 2LYBA 2HBKA 2E8MA 1NK7A 2BQ3A 4UBCA 4PGYA 4MEYA 3ISBA 3KOOA 2EAPA 1TK8A 1N48A 1T3QA 1L8LA 1U45A 4DFKA 1COOA 2R18A 1RZTA 3D2SA 1XO0A 5AKXA 1N5WA 9ICNA 4QZIA 5AK4A 2AXTU 4R65A 5KFAA 3MDAA 3TI0A 3WK5A 8ICBA 1UT8A 2Q0ZX 4J9LA 5D4BA 3OHBA 3EUB2 5K4LA 4O3OA 1NJXA 2P6RA 8ICNA 3T5LA 3C2KA 4CNQA 1AQ6A 3B0XA 5AI4A 8ICIA 3IDWA 3H8WA 2C22A 3KHLA 2ZTDA 3H8JA 2Q4TA 2NYVA 3SV3A 2HBLA 2MAXA 2YN4A 1SL0A 4M2YA 1SV0A 4KLEA 2C28A 4ELVA 4R64A 5DG8A 4Q8EA 1U47A 1A76A 2RQ5A 5JUMA 2W8KA 5CJ7A 4FBTA 3NVYA 2F8LA 4NJ8A 4RUCA 3RB3A 5GTHU 2HCFA 7ICSA 1BPYA 2WAQC 3ZDEA 4ED8A 5AIAA 4RUAA 4RQNA 5DGAA 1CRXA 4M9HA 2K60A 3A0HU 1NKCA 3UQ2A 9ICPA 2F77X 4R8UB 3RJEA 4DCCA 2PFQA 2B0CA 1NKEA 2FPLA 1HUOA 2HOQA 3N97B 2M9NA 5L1MA 2A19A 4MFAA 3KZIU 4B9SA 7ICRA 1MC8A 3FM9A 5DKWA 3FYHA 1NK8A 5FP0A 1XU4A 5HP4A 2BQRA 2BPGA 1A0PA 3SEIA 4R66A 5KG6A 5AI9A 1FO4A 4KLFA 3Q8LA 1S5LU 2W8LA 1JXLA 2E1EA 4C4TA 4NLGA 3TADC 3M9OB 2GO7A 5J0RA 4GC6A 1WG8A 4C8MA 2RDJA 1RYUA 1XSNA 1JN3A 1C20A 4CF5A 4UASA 3C29A 4ECQA 3BS5B 4ED1A 1TKDA 1F44A 3GDXA 8ICLA 4KN7A 1PZNA 2HVHA 1QCKA 4UB1A 2CXYA 3ZD9A 2R8HA 4Y2XA 5DG9A 4J9QA 4F4WA 2D6FC 4EBCA 1RDFA 1PK1B 3MR2A 1KW4A 4ED6A 2J6SA 2GH1A 4DSKA 2AU0A 3AQFA 1V9PA 1SWVA 3QNMA 9ICSA 4CF4A 1S77D 3QU9A 4F5QA 3M8SA 4YQWA 2LHTA 4EYHB 4M04A 2WHEA 4F4XA 2ZXHA 2FMQA 4PL2A 1AROP 1UQVA 1HIWA 5DQIA 3GU3A 2IOFA 3S6JA 1S0OA 2EZZA 4ZH4A 3BQ2A 4NWIA 3MFIA 4RT3A 4QZFA 4KTQA 2VA2A 3JPQA 1B0XA 3C5FA 3ZDAA 1DK2A 3HPOA 4ZOHC 3V72A 1K1SA 2I1QA 1SXDA 1H38A 2HHXA 5HHHA 4JV2A 4J9NA 1KL9A 1L7PA 4QW8A 1T8EA 2BCQA 4QJFB 1XSLA 1TFRA 2HSZA 4NLNA 4KITB 5AICA 1RYSA 4J9RA 4M47A 2KIVA 2KKPA 5ALRA 4Y2YA 5KFZA 2A1JA 5J0OA 5KFXA 3A0BU 1SKWA 1U48A 7ICJA 4DLGA 5ALPA 4O5KA 4C0ZA 2XI9A 3F53A 3M6KA 2FE9A 9ICHA 1Y88A 4FZMA 4TUQA 4UB2A 1Z19A 4B9MA 1ZQUA 1L3SA 3CW2C 2E8NA 1ZQFA 1BPDA 4PZOA 4EBEA 3WK9A 5KTQA 1NI3A 5KG2A 1KFSA 2M0NA 5DGBA 4M6WB 4ECSA 1L7NA 3AQEA 3H4BA 1SKRA 3PO4A 1J2MA 3UQ0A 5L9XA 5HR6A 9ICUA 3EW9A 5J2BA 3M8RA 3V6KA 8ICQA 4I2DA 3I1YA 4XUSA 3SD7A 5J2EA 1IM4A 5KL1B 5JTIA 3UMGA 4DSJA 3NGDA 1ZQJA 5J2DA 4YXJA 5L1LA 4DQRA 2IBKA 5B66U 2HHVA 4O5EA 1EXNA 1CUKA 3CRXA 5KG4A 5A0LA 5B5EU 2C2RA 3GV7B 2KNJA 4I2BA 4M6WA 1ZQMA 1JIHA 1DRGA 4QZDA 2W7OA 1ZD2P 1B22A 8ICVA 3ETLA 1X42A 4B9VA 2W9CB 3MBYA 2KIWA 5KFBA 5H2FU 5IIMA 2QLTA 3WKBA 4BXOA 3K1ZA 3ZD8A 5ALDA 3THVA 3ZDCA 4I28A 5J0PA 4G3IA 5ALTA 2G0AA 2HMXA 3VCBA 4QWDA 4AYBF 4YN4A 1NJYA 1N56A 1BPZA 1ZQLA 3Q8RB 5ALFA 5KT2A 2W3SA 4I2JA 5C5JA 3CNHA 5AI8A 4J9MA 2JHDA 2XGPA 3OSPA 2FMPA 2ZXIA 4CGZA 2LPEA 2N1RA 3EPIA 1IV8A 2ZIUA 3ED5A 3D2NA 3GQCA 3DV9A 1KSPA 3B0YA 2BCVA 1ZQHA 5ALUA 2Y9UA 5J2HA 5ALQA 4BWMA 3JPPA 4HAIA 1ED1A 4KLMA 4DQQA 8ICKA 2ASJA 3TAQA 3TQ1A 1N2XA 1KBUA 4BJQA 2W9CA 3JPOA 2KZ3A 3ZDBA 4NY8A 2H3ZA 1TK0A 2KFNA 2KP7A 5KFYA 3NVWA 2YY6A 8ICYA 4O3MA 4UB8U 4MF8A 3FAHA 1UHUA 5EWGA 5ALHA 3WK4A 2Y0SC 2UVVA 2IMWP 4I29A 5CR0A 1KN5A 5EE1A 2HBMA 2WF5A 2DPJA 3BDPA 1V85A 2W43A 5DLGA 1A77A 4P0QA 1BVSA 2VANA 3OPXA 2RDIA 4DOAA 1WYGA 2XO7A 1N60A 5ALKA 2GLEA 3TANA 4GXJA 4X5VA 5KFLA 4KMUA 2LYHA 3C21A 4QW9A 4DQSA 2WAQF 4UARA 5KT6A 4NL9C 8ICGA 3IP4B 5C0YA 2ZIVB 2YMLA 4F92B 1SL1A 1MQ2A 9ICQA 2DQNB 3PMNA 4F8RA 3RJFA 4B9UA 2W7PA 4JUZA 5J2GA 3HJEA 2BPFA 5JRTA 3RR7A 5JU5A 3L5KA 2DFLA 3PR5B 4RNMA 2BCSA 1XWLA 9ICGA 2QB0B 4CCHA 4KX3A 4J9PA 4KLLA 4O3NA 1NK6A 2EZYA 5ALJA 4MHVA 3LYSA 3EZ5A 4R63A 2ZIWA 5D46A 2W9AA 2NRWA 1X40A 4KLJA 2V4QA 5CA7A 4BX9C 1NKBA 3RRHA 9ICLA 4QZGA 1PUZA 1QH9A 2AQ4A 2A1JB 4EYIB 1XO1A 5IIKA 3AUOA 2HHQA 8ICRA 2KVCA 1J2NA 3PX4A 3J81j 2BCUA 4GC7A 2UVRA 2KEYA 5J0UA 5AK3A 4JMUA 3H7IA 1KFTA 3IN5A 2VA3A 4FZLA 2UVUA 4QIWF 4NXZA 3SENA 5J0SA 4O0IA 3UMBA 2DWQA 2LM1A 3SMVA 2LI6A 3UPQA 5KAIU 2ISOA 4F2SA 4RPXA 4UB6U 5EOZA 5AI6A 4IQVA 3SAFA 4DLEA 2WF8A 3RAXA 4IRDA 1ZQVA 4Z6EA 8ICJA 4UB3A 4GIBA 8ICPA 3IM1A 4Y2VA 5KG3A 3C2LA 2PMZC 1CI4A 2NRZA 1D8BA 5BPCA 4C8LA 1BPEA 3RH4A 3PW7A 4OD0A 1ZQSA 3UMCA 2ASDA 5J0YA 1L3VA 3CP8A 1BPXA 1PVPA 4PHEA 4YD1A 2AGQA 1JI7A 1NNLA 4QIWC 4AYBC 1IIPA 1P7DA 4CRXA 2VIXA 5CB1A 2YMPA 1ZQTA 5AM3A 3GIJA 3PW2A 3GIIA 1S0NA 3GV5B 2K89A 5KFOA 5KFDA 7ICPA 3RBEA 1ZQWA 3E2EA 3ONNA 4HYKA 4GLXA 5DQGA 2ZIXB 4BDPA 3BS5A 2PXIA 3HKZF 4UW9A 2J6TA 9ICCA 2G5HB 5AKZA 3EWAA 1TAMA 5AM2A 4K4IA 1V38A 1LKYA 4EBDA 4O3PA 5J8YC 2NRXA 5KFWA 1L3TA 4I2EA 2AGPA 1ZQZA 2P66A 4ECWA 2H3QA 4QWCA 2BQUA 3KD3A 2C2DA 4M0AA 1F5SA 3TFRA 1DXSA 4QWAA 9ICTA 3PMLA 3Q8QB 2DL0A 4I2GA 2H3FA 4DSIA 1JX4A 3T5KA 3MR5A 4IC9A 3QEBZ 4ECVA 4YP3A 5KG5A 4Y2TA 3GILA 5AM0A 3ISDA 3I76A 2WB1C 1ZQGA 4I2FA 1A6SA 3F2DA 1DK3A 5GTIU 3F2BA 3Q8MA 4RU9A 4F2RA 1FIQA 1L8OA 4RQ2A 2I9GA 4DL6A 4I2HA 8ICZA 3WKAA 4NM2A 2RP5A 4F50A 2KD1A 3SV4A 4K4HA 4UAWA 2WFAA 1QQ6A 2KHQA 5J0WA 5DDYA 2MUTB 3K4GA 4DQPA 2QB1A 1TAQA 1RQLA 3NTUA 5J2IA 4NLZA 5J2AA 2KJ8A 4IR9A 4EZ9A 4C4RA 3G6VA 3KHHA 3SI8A 1NK5A 4DFJA 2I5HA 4IQWA 1ZQBA 2ZUBA 4P2HA 2LMRA 3QU7A 2XY6A 1SXEA 1DGSA 2KSOA 1RXVA 1KFDA 4F5NA 2JXJA 4JV1A 1ZQEA 4M9NA 4DEZA 4GXIA 5IINA 5HNKA 8ICFA 3TARA 2H3IA 2NRTA 3RTVA 3PW5A 4U7CA 1Q8KA 5DB8A 2KICA 5TISU 2K4PA 3E0FA 4IQUA 3D6JA 4C80A 4QZAA 5KFVA 3HT3A 2F1JA 3IHQB 4DF4A 5J2JA 4DL7A 5KFNA 5AK5A 1TK5A 5CP2A 2IOHA 3RH5A 4KLGA 2QARB 8ICAA 4RQ6A 1U9LA 1UT5A 3N4MB 4FFDA 2PMZF 2BDUA 4YMMA 4IQTA 3C2MA 5J0TA 2F8KA 4KLIA 1QQ5A 7ICKA 4QZ8A 3LWMA 2FJ6A 5E79U 2G5IB 4XQ8A 4Y2QA 9ICIA 1QTMA 3WKEA 2JV3A 4QNLA 2EAMA 5ALWA 4DQIA
chains in the Genus database with same CATH topology
4KLHA 7ICNA 7ICOA 2FMPA 3JPRA 9ICVA 4XA5A 4NLKA 4TUSA 4RPZA 4FO6A 4DOCA 3B0YA 2BCVA 4M9GA 1ZQHA 4KLTA 5J2HA 1BNPA 3JPPA 8ICXA 3RJJA 4RQ7A 4KLMA 7ICMA 9ICEA 8ICKA 4PHDA 4M9LA 2BCRA 7ICVA 4PGQA 1KDHA 3JPOA 4NY8A 4RQ4A 1KEJA 4F5PA 4QZCA 1ZQKA 2KP7A 8ICYA 4MF8A 3LK9A 5J2FA 4I29A 4KLSA 5IIOA 5HHIA 5J0XA 1XSPA 4PHPA 9ICBA 4F5RA 4MFCA 3UXNA 8ICUA 4DOAA 4UBCA 4PGYA 3ISBA 4O9MA 4GXKA 4KLUA 4GXJA 4RPYA 4X5VA 4NM1A 1RZTA 8ICEA 8ICGA 9ICNA 4QZIA 1MQ2A 4I2IA 7ICIA 9ICQA 3HX0A 4R65A 3PMNA 4KLQA 1ZQCA 3MDAA 3RJFA 8ICBA 5D4BA 9ICFA 5J2GA 3PNCA 2BPFA 8ICNA 4RQ8A 1ZQRA 3C2KA 7ICTA 4I2CA 3B0XA 8ICIA 5DBAA 3V7KA 2PFNA 2BCSA 4Z6FA 9ICGA 4M2YA 4KLEA 4KLLA 9ICAA 9ICKA 4PGXA 4R64A 3HW8A 1ZQIA 4R63A 5D46A 4JWNA 4KLJA 3JPTA 7ICSA 1BPYA 3RJIA 9ICLA 4QZGA 4M9HA 4O5CA 4UB4A 3UQ2A 5IIKA 3AUOA 9ICPA 8ICSA 8ICRA 3RJEA 4TUPA 2PFQA 1HUOA 7ICLA 2BCUA 4MFAA 5J0UA 7ICRA 2GWSA 5DKWA 3V7LA 7ICGA 1ZQQA 2BPGA 5J2CA 9ICOA 4YMNA 4NXZA 4R66A 5J0SA 4KLFA 4MF2A 3RJHA 9ICXA 5J29A 5BOMA 3UPQA 2ISOA 4RPXA 8ICTA 1ZQPA 5EOZA 4M9JA 8ICWA 4IQVA 5J0RA 5IIIA 3TFSA 1ZQNA 1XSNA 4KLOA 8ICCA 4Z6EA 8ICJA 3GDXA 8ICLA 4UB3A 8ICPA 4UB1A 3C2LA 1ZJNA 4TURA 5BPCA 5IILA 1BPEA 4YD2A 5TZVA 3MDCA 3RH4A 1ZQSA 4RQ3A 5J0YA 1BPXA 4F5OA 2ISPA 4PHEA 4YMOA 4YD1A 3HWTA 4MFFA 5CB1A 4LZGA 1ZQTA 1BNOA 3MGIA 1ZQAA 2IHMA 7ICPA 9ICSA 4RQ1A 4F5QA 8ICOA 2PXIA 3ISCA 1MQ3A 4M04A 3RJKA 5CWRA 3RH6A 7ICHA 9ICWA 9ICCA 2FMQA 1TVAA 4K4IA 9ICRA 4I27A 4RT3A 4I2EA 4QZFA 4UB5A 7ICUA 2P66A 5J2KA 2W9MA 3JPQA 3C5FA 4DO9A 7ICQA 5DBBA 4LZDA 1DK2A 4M0AA 5DB9A 3V72A 4Z6DA 4QZHA 3TFRA 4PH5A 9ICTA 1TV9A 1ZQDA 3C5GA 5HHHA 4RQ5A 2PFOA 3PMLA 4UBBA 4I2GA 5J0QA 3AU6A 7ICFA 2BCQA 1XSLA 3ISDA 1ZQGA 4I2FA 4NLNA 1DK3A 4RQ2A 2I9GA 4I2HA 8ICZA 3JPSA 4M47A 4NM2A 4UAZA 4PPXA 5J0OA 4K4HA 4UAWA 4K4GA 5J0WA 7ICJA 5DDYA 4QZ9A 4O5KA 4RQ0A 5IIJA 9ICHA 9ICMA 5J2IA 4TUQA 4UB2A 4NLZA 3AU2A 5J2AA 5D49A 1ZQFA 2FMSA 1BPDA 4QZEA 9ICJA 4IQWA 1ZQBA 8ICHA 4RT2A 3UQ0A 4P2HA 3JPNA 9ICUA 1ZQOA 4I2AA 5J2BA 1ZJMA 8ICQA 4I2DA 3OGUA 4XUSA 4YCXA 3RJGA 5J2EA 8ICMA 4F5NA 4M9NA 1ZQEA 4GXIA 5J2DA 1ZQJA 5IINA 7ICEA 8ICFA 4JWMA 3MGHA 5BOLA 4PHAA 1NZPA 5DB8A 3V7JA 4O5EA 1HUZA 5DB7A 4IQUA 4QZAA 4LVSA 3UXOA 4I2BA 5J2JA 4KLDA 1ZQMA 5DB6A 3UXPA 4QZDA 1JMSA 4KLGA 3RH5A 8ICAA 8ICVA 4RQ6A 3MBYA 4YMMA 4DOBA 4IQTA 5IIMA 3C2MA 5J0TA 4KLIA 4I28A 5J0PA 7ICKA 4QZ8A 4Z6CA 4UAYA 5DBCA 1BPZA 4YN4A 1ZQLA 4QZBA 4I2JA 9ICIA 2PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLH A;  7ICN A;  7ICO A;  2FMP A;  3JPR A;  9ICV A;  4XA5 A;  4NLK A;  4TUS A;  4RPZ A;  4FO6 A;  4DOC A;  3B0Y A;  2BCV A;  4M9G A;  1ZQH A;  4KLT A;  5J2H A;  1BNP A;  3JPP A;  8ICX A;  3RJJ A;  4RQ7 A;  4KLM A;  7ICM A;  9ICE A;  8ICK A;  4PHD A;  4M9L A;  2BCR A;  7ICV A;  4PGQ A;  1KDH A;  3JPO A;  4NY8 A;  4RQ4 A;  1KEJ A;  4F5P A;  4QZC A;  1ZQK A;  2KP7 A;  8ICY A;  4MF8 A;  3LK9 A;  5J2F A;  4I29 A;  4KLS A;  5IIO A;  5HHI A;  5J0X A;  1XSP A;  4PHP A;  9ICB A;  4F5R A;  4MFC A;  3UXN A;  8ICU A;  4DOA A;  4UBC A;  4PGY A;  3ISB A;  4O9M A;  4GXK A;  4KLU A;  4GXJ A;  4RPY A;  4X5V A;  4NM1 A;  1RZT A;  8ICE A;  8ICG A;  9ICN A;  4QZI A;  1MQ2 A;  4I2I A;  7ICI A;  9ICQ A;  3HX0 A;  4R65 A;  3PMN A;  4KLQ A;  1ZQC A;  3MDA A;  3RJF A;  8ICB A;  5D4B A;  9ICF A;  5J2G A;  3PNC A;  2BPF A;  8ICN A;  4RQ8 A;  1ZQR A;  3C2K A;  7ICT A;  4I2C A;  3B0X A;  8ICI A;  5DBA A;  3V7K A;  2PFN A;  2BCS A;  4Z6F A;  9ICG A;  4M2Y A;  4KLE A;  4KLL A;  9ICA A;  9ICK A;  4PGX A;  4R64 A;  3HW8 A;  1ZQI A;  4R63 A;  5D46 A;  4JWN A;  4KLJ A;  3JPT A;  7ICS A;  1BPY A;  3RJI A;  9ICL A;  4QZG A;  4M9H A;  4O5C A;  4UB4 A;  3UQ2 A;  5IIK A;  3AUO A;  9ICP A;  8ICS A;  8ICR A;  3RJE A;  4TUP A;  2PFQ A;  1HUO A;  7ICL A;  2BCU A;  4MFA A;  5J0U A;  7ICR A;  2GWS A;  5DKW A;  3V7L A;  7ICG A;  1ZQQ A;  2BPG A;  5J2C A;  9ICO A;  4YMN A;  4NXZ A;  4R66 A;  5J0S A;  4KLF A;  4MF2 A;  3RJH A;  9ICX A;  5J29 A;  5BOM A;  3UPQ A;  2ISO A;  4RPX A;  8ICT A;  1ZQP A;  5EOZ A;  4M9J A;  8ICW A;  4IQV A;  5J0R A;  5III A;  3TFS A;  1ZQN A;  1XSN A;  4KLO A;  8ICC A;  4Z6E A;  8ICJ A;  3GDX A;  8ICL A;  4UB3 A;  8ICP A;  4UB1 A;  3C2L A;  1ZJN A;  4TUR A;  5BPC A;  5IIL A;  1BPE A;  4YD2 A;  5TZV A;  3MDC A;  3RH4 A;  1ZQS A;  4RQ3 A;  5J0Y A;  1BPX A;  4F5O A;  2ISP A;  4PHE A;  4YMO A;  4YD1 A;  3HWT A;  4MFF A;  5CB1 A;  4LZG A;  1ZQT A;  1BNO A;  3MGI A;  1ZQA A;  2IHM A;  7ICP A;  9ICS A;  4RQ1 A;  4F5Q A;  8ICO A;  2PXI A;  3ISC A;  1MQ3 A;  4M04 A;  3RJK A;  5CWR A;  3RH6 A;  7ICH A;  9ICW A;  9ICC A;  2FMQ A;  1TVA A;  4K4I A;  9ICR A;  4I27 A;  4RT3 A;  4I2E A;  4QZF A;  4UB5 A;  7ICU A;  2P66 A;  5J2K A;  2W9M A;  3JPQ A;  3C5F A;  4DO9 A;  7ICQ A;  5DBB A;  4LZD A;  1DK2 A;  4M0A A;  5DB9 A;  3V72 A;  4Z6D A;  4QZH A;  3TFR A;  4PH5 A;  9ICT A;  1TV9 A;  1ZQD A;  3C5G A;  5HHH A;  4RQ5 A;  2PFO A;  3PML A;  4UBB A;  4I2G A;  5J0Q A;  3AU6 A;  7ICF A;  2BCQ A;  1XSL A;  3ISD A;  1ZQG A;  4I2F A;  4NLN A;  1DK3 A;  4RQ2 A;  2I9G A;  4I2H A;  8ICZ A;  3JPS A;  4M47 A;  4NM2 A;  4UAZ A;  4PPX A;  5J0O A;  4K4H A;  4UAW A;  4K4G A;  5J0W A;  7ICJ A;  5DDY A;  4QZ9 A;  4O5K A;  4RQ0 A;  5IIJ A;  9ICH A;  9ICM A;  5J2I A;  4TUQ A;  4UB2 A;  4NLZ A;  3AU2 A;  5J2A A;  5D49 A;  1ZQF A;  2FMS A;  1BPD A;  4QZE A;  9ICJ A;  4IQW A;  1ZQB A;  8ICH A;  4RT2 A;  3UQ0 A;  4P2H A;  3JPN A;  9ICU A;  1ZQO A;  4I2A A;  5J2B A;  1ZJM A;  8ICQ A;  4I2D A;  3OGU A;  4XUS A;  4YCX A;  3RJG A;  5J2E A;  8ICM A;  4F5N A;  4M9N A;  1ZQE A;  4GXI A;  5J2D A;  1ZQJ A;  5IIN A;  7ICE A;  8ICF A;  4JWM A;  3MGH A;  5BOL A;  4PHA A;  1NZP A;  5DB8 A;  3V7J A;  4O5E A;  1HUZ A;  5DB7 A;  4IQU A;  4QZA A;  4LVS A;  3UXO A;  4I2B A;  5J2J A;  4KLD A;  1ZQM A;  5DB6 A;  3UXP A;  4QZD A;  1JMS A;  4KLG A;  3RH5 A;  8ICA A;  8ICV A;  4RQ6 A;  3MBY A;  4YMM A;  4DOB A;  4IQT A;  5IIM A;  3C2M A;  5J0T A;  4KLI A;  4I28 A;  5J0P A;  7ICK A;  4QZ8 A;  4Z6C A;  4UAY A;  5DBC A;  1BPZ A;  4YN4 A;  1ZQL A;  4QZB A;  4I2J A;  9ICI A;  2PFP A; 
#chains in the Genus database with same CATH topology
 2DPI A;  3O0F A;  7ICN A;  4P0Q B;  3HP6 A;  2J6U A;  2ZTE A;  3DEE A;  9ICV A;  4Y2S A;  3H40 A;  3QE9 Y;  4C8O A;  4M9G A;  2YB1 A;  3WU2 U;  2FLP A;  3GFK B;  4YR2 A;  2ZIW B;  2EZX A;  1NK4 A;  4ECU A;  4ECY A;  2AH5 A;  4PHD A;  2W9B A;  4M9L A;  5AKK A;  2XGQ A;  1KDH A;  3I28 A;  4NL9 A;  1KEJ A;  4Q8F A;  4QZC A;  2WF9 A;  1ZQK A;  1FEZ A;  3MGV A;  4AP9 A;  4J9K A;  1Q3U A;  4F72 A;  5KFS A;  1N62 A;  5KFC A;  1V97 A;  1RG6 A;  5J0X A;  1XSP A;  5AI0 A;  4ICA A;  4PHP A;  5F9L A;  4FS1 A;  2XCP A;  4F5R A;  4MFC A;  3UXN A;  9ICB A;  3MR6 A;  3WKC A;  2BZF A;  2E1F A;  5ALY A;  4OJL A;  4GXK A;  2XC9 A;  3GIM A;  2K8B B;  4ECX A;  4KLU A;  1DGJ A;  3QZ7 A;  4RQM A;  3HRD D;  2Z7J A;  4C7Z A;  2HI0 A;  1K1Q A;  2YMM A;  4NM1 A;  3KBB A;  5KT7 A;  1MSW D;  5ALG A;  3T5J A;  4OJO A;  4F4Y A;  4I2I A;  1SB3 C;  2ZJ8 A;  4DFD A;  4KLQ A;  5DDM A;  1ZQX A;  3MFH A;  1ZRM A;  4DS4 A;  9ICF A;  2XCA A;  2DKZ A;  3QYP A;  4IRC A;  3LDA A;  3PNC A;  2ALZ A;  3EYZ A;  3QEA Z;  2XIC A;  1ZQR A;  4Y2R A;  7ICT A;  4I2C A;  4R8U A;  4ED0 A;  5DBA A;  3V7K A;  4ED3 A;  2PFN A;  4U6P A;  1NJZ A;  4USA A;  2QB0 A;  1LV5 A;  5ALM A;  5KFU A;  3IRU A;  2HW3 A;  5KG0 A;  2W03 A;  5AKE A;  3H8M A;  4YVZ A;  1ZQI A;  1IG6 A;  3QX7 A;  4LJX A;  3BZC A;  1Z1B A;  3SAH A;  1LB2 B;  1FFV A;  3M9N B;  5L1J A;  1L5U A;  5F9N A;  4O5C A;  1XS9 D;  2CPR A;  4BGD A;  2OYY A;  1ZQ1 C;  4PZN A;  5KFK A;  4TQR A;  4DL2 A;  2HVI A;  1ZOL A;  2VA8 A;  4ECZ A;  2QKQ A;  5AI5 A;  2FLN A;  4FE3 A;  2EH9 A;  1S0V A;  2HOI A;  7ICL A;  5KT5 A;  3PW4 A;  3R9K A;  3PY8 A;  1N61 A;  4B9N A;  3KTQ A;  5ALI A;  4CDG A;  3RRG A;  3RBD A;  4KX5 A;  7ICG A;  1WUD A;  4O3Q A;  1ZQQ A;  5KAF U;  4DS5 A;  5KFQ A;  5DG7 A;  2YMQ A;  3TKA A;  1SGG A;  1QQ7 A;  3RJH A;  9ICX A;  5J29 A;  5BOM A;  1S0M A;  8ICT A;  3QU4 A;  1SKS A;  1ZQP A;  4TQS A;  4M9J A;  2VJ5 A;  5III A;  3TFS A;  5KFE A;  1ZQN A;  1HJP A;  4KLO A;  4Q43 A;  5HML A;  1Z00 A;  1YZ6 A;  4TUR A;  5IIL A;  4YD2 A;  5TZV A;  2YX8 A;  1B4F A;  1ZRN A;  2JEI A;  3QU5 A;  4F5O A;  4F4K A;  4YMO A;  2ZUC A;  4MFF A;  1ZET A;  1BNO A;  2KMD A;  2PI5 A;  2IHN A;  5KFG A;  1TAU A;  5KFI A;  1KLN A;  2FPK A;  3BQ7 A;  2DF4 B;  2B6G A;  2IHM A;  4RQ1 A;  4DFP A;  8ICO A;  2G07 A;  4EEL A;  2F44 A;  3BQ1 A;  3ISC A;  3NRW A;  9ICW A;  1T94 A;  2LYA A;  1TVA A;  3NS1 A;  2IOF K;  1C7Y A;  4EX6 A;  1YZ7 A;  4F4Z A;  4P0P B;  3PSF A;  4Y2P A;  2JR5 A;  1O08 A;  3ETR A;  4I27 A;  4UB5 A;  2K4I A;  2HHW A;  2K4E A;  1JRP A;  4OCZ A;  5J2K A;  2W9M A;  2MUT A;  7ICQ A;  2HOF A;  1L7O A;  4OJ5 A;  2KG5 A;  5DB9 A;  5ALV A;  2RRD A;  2H5X A;  4PH5 A;  3PX0 A;  1ZQD A;  4RQ5 A;  1UCV A;  2PFO A;  3SQI A;  3Q8K A;  3FDS A;  3T79 A;  3U26 A;  5J0Q A;  3AU6 A;  4YXM A;  2QAR A;  4G9B A;  5KNI A;  2JZB A;  4Y2J A;  2ZJ5 A;  5CRX A;  2GOL A;  2KK0 A;  3NVV A;  2RLT A;  3JPS A;  3GIK A;  4UAZ A;  4PPX A;  4Q44 A;  4FZN A;  5KFH A;  4B9L A;  1L6N A;  3KFU F;  3RF9 A;  5AHX A;  4RNN A;  5IIJ A;  2HHT A;  9ICM A;  4ACO A;  1LVH A;  1PK3 A;  3RB0 A;  3F5E A;  4DL5 A;  4ELU A;  4QZE A;  5AKL A;  2VJ4 A;  4CE6 A;  1Z1V A;  1SV4 A;  3FC4 A;  5HR7 A;  2F2A B;  2V9W A;  4EEN A;  8ICH A;  4UAV A;  4RT2 A;  2ODG A;  5KFJ A;  3JPN A;  3OSN A;  3K1R B;  2KOB A;  2G06 A;  4I2A A;  1Z4N A;  2G09 A;  2WB1 F;  1MA7 A;  1CEZ A;  4C8K A;  4YCX A;  2ZIV A;  3Q8S B;  4C8N A;  8ICM A;  2JEJ A;  1ECW A;  2K8A A;  3N7S C;  3C23 A;  5ALL A;  3TAD A;  4DSF A;  3ZDD A;  2MU2 A;  1IXR A;  3H0L B;  1KRP A;  2HHU A;  2E8P A;  2JZB B;  7ICE A;  2KHV A;  4OJ6 A;  5EWF A;  4JWM A;  4DL3 A;  4UAT A;  2JEF A;  2F76 X;  3V7J A;  2RHF A;  1HUZ A;  3V6J A;  2CN1 A;  4F3O A;  3NVZ A;  3OJU A;  3EPG A;  4LVS A;  4UAU A;  4KLD A;  4ED2 A;  2HHS A;  1KTQ A;  2BPC A;  2IA6 A;  1ZD4 A;  4IR1 A;  5AM1 A;  3T5H A;  1X2I A;  5EWE A;  1UPH A;  3NRZ A;  4DOB A;  1RYR A;  1COK A;  2XVT A;  1URJ A;  4ED7 A;  4DSE A;  1QSY A;  4A8E A;  1QLN A;  2JH1 A;  4C4S A;  1SZP A;  3BJY A;  2W54 A;  5DQH A;  4UAY A;  2Y1I A;  4Q45 A;  2UVW A;  3MC1 A;  4QZB A;  1TE2 A;  3QU2 A;  3KZX A;  4DF8 A;  1N5X A;  5G5G A;  2E8O A;  1T4G A;  2PFP A;  1M6Y A;  4KLH A;  7ICO A;  5KT3 A;  2H3V A;  2P6U A;  4US9 A;  5KFT A;  2FI1 A;  1SWW A;  2OM6 A;  2XID A;  4NLC A;  5AK6 A;  1SV0 C;  4NLK A;  3HKZ C;  3SAG A;  4FO6 A;  1O03 A;  2PI4 A;  4DOC A;  2R8I A;  1X9X A;  2EDU A;  1D8L A;  2BHN A;  2YQE A;  1NK0 A;  2BDP A;  4MEX A;  3PSP A;  1JUD A;  2HBJ A;  1BNP A;  8ICX A;  5AM5 A;  3RJJ A;  1VDV A;  3PR4 A;  3TAP A;  2BCR A;  2AQ0 A;  7ICV A;  4PGQ A;  3LWL A;  2O6K A;  4RQ4 A;  1S8O A;  3TAC B;  1OXJ A;  3ORY A;  2DKX A;  2A1A A;  2NO4 A;  4F93 B;  2HDO A;  2DGZ A;  3AL0 B;  1NOM A;  4NLB A;  2XY5 A;  1BPB A;  4J03 A;  5HMM A;  2MSN A;  5HHI A;  2YB4 A;  1OUQ A;  2ES6 A;  2WTF A;  1L3U A;  8ICU A;  3OJS A;  1KQQ A;  3QXG A;  2ESE A;  5KFP A;  3M6Z A;  2BKE A;  1T3N A;  2ASL A;  3OTQ A;  4O9M A;  1ZXI A;  3KKA C;  4RPY A;  3H4D A;  3T3F A;  1RQN A;  2KV2 A;  1JXE A;  1X6J A;  4DWI A;  2V4R A;  8ICE A;  2DUY A;  3WK8 A;  1X66 A;  2VKQ A;  3GZF A;  7ICI A;  2KN7 A;  3HX0 A;  5CHG A;  1UA0 A;  1ZQC A;  4B9T A;  3HIL A;  3KHG A;  2BGW A;  2ZIU B;  3H8S A;  4RQ8 A;  2E3T A;  5EE3 A;  4Z6F A;  3WK7 A;  9ICA A;  2W11 A;  9ICK A;  2FLL A;  1JRO A;  5EE0 A;  3LVW A;  4PGX A;  3HW8 A;  1S9F A;  3SYZ A;  4ECR A;  2JH7 A;  1X6I A;  2NO5 A;  4UQG A;  3DDH A;  1WCN A;  3CYM A;  3BZK A;  5ALX A;  4DL4 A;  1RM6 C;  4JWN A;  3PST A;  3M9M B;  4P4M A;  2KJ5 A;  1PVR A;  3JPT A;  4P4O A;  2W55 A;  5KG7 A;  3RJI A;  3IG8 A;  2KZZ A;  3B9J A;  2ZIX A;  1JAL A;  4YG2 A;  4UB4 A;  1S76 D;  2EAN A;  2F1I A;  8ICS A;  3ICX A;  3Q8P B;  4TUP A;  5L1K A;  3IG5 A;  2KE7 A;  5J8Y A;  2GWS A;  1WCL A;  3RAQ A;  2OEH A;  3L4P A;  4NV0 A;  4XRH A;  2OWO A;  3V7L A;  5J2C A;  1MN8 A;  9ICO A;  4YMN A;  1S97 A;  3C28 A;  2WF6 A;  2EAO A;  2A3V A;  3K75 D;  2NV3 A;  4MF2 A;  1DOQ A;  3N7R C;  1RXW A;  3C1Z A;  2CRX A;  1HEK A;  4YFK A;  8ICW A;  2ATL A;  5EE9 A;  4YR0 A;  1GO3 F;  3NAS A;  1NJW A;  5AKJ A;  4J9O A;  1X9S A;  5T14 A;  3H0M B;  4QWE A;  8ICC A;  4IRK A;  2KKV A;  5KG1 A;  4E0D A;  1ZJN A;  3MDC A;  3KHR A;  2P35 A;  3UM9 A;  1PK1 A;  4RQ3 A;  2ISP A;  4P0P A;  3BQ0 A;  1XC9 A;  3HWT A;  2OH2 A;  5KT4 A;  4LZG A;  2KZM A;  2E5S A;  3PSI A;  2Y0S F;  2K4H A;  2LKY A;  3GV8 B;  3MGI A;  1ZQA A;  2MRL A;  3SR6 A;  1F0M A;  4IL6 U;  2BR0 A;  5AKY A;  1Z00 B;  5AKI A;  1X9M A;  1NK9 A;  1MQ3 A;  2I6X A;  3RJK A;  1ZQY A;  3ALR A;  5CWR A;  3MR3 A;  2MA1 A;  3RH6 A;  3RB4 A;  1Z4O A;  7ICH A;  2AGO A;  5DLF A;  4WJ3 B;  2OCE A;  2Y1J A;  4ELT A;  2JEG A;  2KJ9 A;  1ZD3 A;  9ICR A;  3F2C A;  1K5O A;  2L5Y A;  3ZI4 A;  1S10 A;  7ICU A;  3RB6 A;  1QSS A;  3WKD A;  4FBU A;  4DO9 A;  4DSL A;  5DBB A;  4DFM A;  4LZD A;  4Z6D A;  3D2Q A;  4QZH A;  2FPM A;  3PV8 A;  1TV9 A;  3C5G A;  1Q46 A;  4UBB A;  5KFM A;  7ICF A;  3G6X A;  2ZG6 A;  4YR3 A;  2W9B B;  4JK1 A;  1D9F A;  3KKA A;  4Y2U A;  2G08 A;  3H0R B;  5ALS A;  2ZTC A;  1N63 A;  5ALE A;  1SZH A;  4OO1 J;  4BUG A;  3BS7 A;  1LKY B;  2ZUD A;  5CEH A;  4K4G A;  1OW5 A;  4PJ0 U;  5ALO A;  4QZ9 A;  4B6J A;  4RQ0 A;  4PL1 A;  3PVX A;  3PX6 A;  2OXO A;  2LBO A;  3E58 A;  1U49 A;  1XNS A;  4RZR A;  3AU2 A;  5D49 A;  4EX7 A;  2R8G A;  3IV6 A;  1T7P A;  1KKX A;  2JGA A;  3PW0 A;  3F5A A;  2FMS A;  3QZ8 A;  9ICJ A;  4US8 A;  1SL2 A;  1ZD5 A;  3AMZ A;  2LM4 A;  3QUC A;  3PO5 A;  4QWB A;  1ZQO A;  1ZJM A;  3L3F X;  3OGU A;  1X9W A;  4EEY A;  3RJG A;  1D9D A;  3QUB A;  1U4B A;  1WWU A;  4ECT A;  2F1H A;  5G5H A;  3VC8 A;  3AN1 A;  1D8Y A;  2WF7 A;  4J9S A;  2W3R A;  3MGH A;  5BOL A;  4PHA A;  5F3X B;  1NZP A;  2Y9T A;  4FS2 A;  3LVV A;  5DB7 A;  3RR8 A;  1L7M A;  5KL8 B;  4JV0 A;  3UXO A;  3V6H A;  3N7P D;  3NUQ A;  5DB6 A;  3UXP A;  1RPL A;  4P4P A;  1JMS A;  3AM9 A;  3G6Y A;  2K8C B;  1VJ5 A;  1QSL A;  4C7Y A;  1NZB A;  1UA1 A;  2ZJA A;  3SZ2 A;  4O3R A;  1WWV A;  3WK6 A;  4Z6C A;  1YT3 A;  1ZYQ A;  2PKE A;  5DBC A;  2D8C A;  2KFZ A;  4RNO A;  3C1Y A;  2DBY A;  2KSO B;  2B21 A;  4EEK A;  3MAB A;  2XY7 A;  2FDR A;  2F3N A;  2JRZ A;  5AKG A;  3OHA A;  2R8J A;  4KN4 A;  4JB3 A;  1VLB A;  3JPR A;  4KMO B;  4XA5 A;  4TUS A;  4F71 A;  4RPZ A;  2R8K A;  4OJP A;  1FFU A;  4O3S A;  4KLT A;  3BQT A;  3N28 A;  4EZ6 A;  3RFA A;  5ALZ A;  4IS7 A;  5AKH A;  1J97 A;  4F91 B;  5AIB A;  1B43 A;  3QUQ A;  4RQ7 A;  5KFR A;  2EQY A;  3M1Y A;  7ICM A;  4BXO B;  2KTQ A;  9ICE A;  2W04 A;  3M7D A;  2NRV A;  1BGX T;  2AHO B;  2AJQ A;  2OHF A;  4CF3 A;  2KVS A;  2JMG A;  1Q3V A;  5AM4 A;  5L1I A;  4F5P A;  1Z3E B;  3PZP A;  5ALN A;  3QUT A;  2C2E A;  2D3D A;  3AEV A;  3LK9 A;  4GFJ A;  1PVQ A;  1SIJ A;  5J2F A;  2YTU A;  5KFF A;  4BWJ A;  4KLS A;  5IIO A;  2LYB A;  2HBK A;  2E8M A;  1NK7 A;  2BQ3 A;  4UBC A;  4PGY A;  4MEY A;  3ISB A;  3KOO A;  2EAP A;  1TK8 A;  1N48 A;  1T3Q A;  1L8L A;  1U45 A;  4DFK A;  1COO A;  2R18 A;  1RZT A;  3D2S A;  1XO0 A;  5AKX A;  1N5W A;  9ICN A;  4QZI A;  5AK4 A;  2AXT U;  4R65 A;  5KFA A;  3MDA A;  3TI0 A;  3WK5 A;  8ICB A;  1UT8 A;  2Q0Z X;  4J9L A;  5D4B A;  3OHB A;  3EUB 2;  5K4L A;  4O3O A;  1NJX A;  2P6R A;  8ICN A;  3T5L A;  3C2K A;  4CNQ A;  1AQ6 A;  3B0X A;  5AI4 A;  8ICI A;  3IDW A;  3H8W A;  2C22 A;  3KHL A;  2ZTD A;  3H8J A;  2Q4T A;  2NYV A;  3SV3 A;  2HBL A;  2MAX A;  2YN4 A;  1SL0 A;  4M2Y A;  1SV0 A;  4KLE A;  2C28 A;  4ELV A;  4R64 A;  5DG8 A;  4Q8E A;  1U47 A;  1A76 A;  2RQ5 A;  5JUM A;  2W8K A;  5CJ7 A;  4FBT A;  3NVY A;  2F8L A;  4NJ8 A;  4RUC A;  3RB3 A;  5GTH U;  2HCF A;  7ICS A;  1BPY A;  2WAQ C;  3ZDE A;  4ED8 A;  5AIA A;  4RUA A;  4RQN A;  5DGA A;  1CRX A;  4M9H A;  2K60 A;  3A0H U;  1NKC A;  3UQ2 A;  9ICP A;  2F77 X;  4R8U B;  3RJE A;  4DCC A;  2PFQ A;  2B0C A;  1NKE A;  2FPL A;  1HUO A;  2HOQ A;  3N97 B;  2M9N A;  5L1M A;  2A19 A;  4MFA A;  3KZI U;  4B9S A;  7ICR A;  1MC8 A;  3FM9 A;  5DKW A;  3FYH A;  1NK8 A;  5FP0 A;  1XU4 A;  5HP4 A;  2BQR A;  2BPG A;  1A0P A;  3SEI A;  4R66 A;  5KG6 A;  5AI9 A;  1FO4 A;  4KLF A;  3Q8L A;  1S5L U;  2W8L A;  1JXL A;  2E1E A;  4C4T A;  4NLG A;  3TAD C;  3M9O B;  2GO7 A;  5J0R A;  4GC6 A;  1WG8 A;  4C8M A;  2RDJ A;  1RYU A;  1XSN A;  1JN3 A;  1C20 A;  4CF5 A;  4UAS A;  3C29 A;  4ECQ A;  3BS5 B;  4ED1 A;  1TKD A;  1F44 A;  3GDX A;  8ICL A;  4KN7 A;  1PZN A;  2HVH A;  1QCK A;  4UB1 A;  2CXY A;  3ZD9 A;  2R8H A;  4Y2X A;  5DG9 A;  4J9Q A;  4F4W A;  2D6F C;  4EBC A;  1RDF A;  1PK1 B;  3MR2 A;  1KW4 A;  4ED6 A;  2J6S A;  2GH1 A;  4DSK A;  2AU0 A;  3AQF A;  1V9P A;  1SWV A;  3QNM A;  9ICS A;  4CF4 A;  1S77 D;  3QU9 A;  4F5Q A;  3M8S A;  4YQW A;  2LHT A;  4EYH B;  4M04 A;  2WHE A;  4F4X A;  2ZXH A;  2FMQ A;  4PL2 A;  1ARO P;  1UQV A;  1HIW A;  5DQI A;  3GU3 A;  2IOF A;  3S6J A;  1S0O A;  2EZZ A;  4ZH4 A;  3BQ2 A;  4NWI A;  3MFI A;  4RT3 A;  4QZF A;  4KTQ A;  2VA2 A;  3JPQ A;  1B0X A;  3C5F A;  3ZDA A;  1DK2 A;  3HPO A;  4ZOH C;  3V72 A;  1K1S A;  2I1Q A;  1SXD A;  1H38 A;  2HHX A;  5HHH A;  4JV2 A;  4J9N A;  1KL9 A;  1L7P A;  4QW8 A;  1T8E A;  2BCQ A;  4QJF B;  1XSL A;  1TFR A;  2HSZ A;  4NLN A;  4KIT B;  5AIC A;  1RYS A;  4J9R A;  4M47 A;  2KIV A;  2KKP A;  5ALR A;  4Y2Y A;  5KFZ A;  2A1J A;  5J0O A;  5KFX A;  3A0B U;  1SKW A;  1U48 A;  7ICJ A;  4DLG A;  5ALP A;  4O5K A;  4C0Z A;  2XI9 A;  3F53 A;  3M6K A;  2FE9 A;  9ICH A;  1Y88 A;  4FZM A;  4TUQ A;  4UB2 A;  1Z19 A;  4B9M A;  1ZQU A;  1L3S A;  3CW2 C;  2E8N A;  1ZQF A;  1BPD A;  4PZO A;  4EBE A;  3WK9 A;  5KTQ A;  1NI3 A;  5KG2 A;  1KFS A;  2M0N A;  5DGB A;  4M6W B;  4ECS A;  1L7N A;  3AQE A;  3H4B A;  1SKR A;  3PO4 A;  1J2M A;  3UQ0 A;  5L9X A;  5HR6 A;  9ICU A;  3EW9 A;  5J2B A;  3M8R A;  3V6K A;  8ICQ A;  4I2D A;  3I1Y A;  4XUS A;  3SD7 A;  5J2E A;  1IM4 A;  5KL1 B;  5JTI A;  3UMG A;  4DSJ A;  3NGD A;  1ZQJ A;  5J2D A;  4YXJ A;  5L1L A;  4DQR A;  2IBK A;  5B66 U;  2HHV A;  4O5E A;  1EXN A;  1CUK A;  3CRX A;  5KG4 A;  5A0L A;  5B5E U;  2C2R A;  3GV7 B;  2KNJ A;  4I2B A;  4M6W A;  1ZQM A;  1JIH A;  1DRG A;  4QZD A;  2W7O A;  1ZD2 P;  1B22 A;  8ICV A;  3ETL A;  1X42 A;  4B9V A;  2W9C B;  3MBY A;  2KIW A;  5KFB A;  5H2F U;  5IIM A;  2QLT A;  3WKB A;  4BXO A;  3K1Z A;  3ZD8 A;  5ALD A;  3THV A;  3ZDC A;  4I28 A;  5J0P A;  4G3I A;  5ALT A;  2G0A A;  2HMX A;  3VCB A;  4QWD A;  4AYB F;  4YN4 A;  1NJY A;  1N56 A;  1BPZ A;  1ZQL A;  3Q8R B;  5ALF A;  5KT2 A;  2W3S A;  4I2J A;  5C5J A;  3CNH A;  5AI8 A;  4J9M A;  2JHD A;  2XGP A;  3OSP A;  2FMP A;  2ZXI A;  4CGZ A;  2LPE A;  2N1R A;  3EPI A;  1IV8 A;  2ZIU A;  3ED5 A;  3D2N A;  3GQC A;  3DV9 A;  1KSP A;  3B0Y A;  2BCV A;  1ZQH A;  5ALU A;  2Y9U A;  5J2H A;  5ALQ A;  4BWM A;  3JPP A;  4HAI A;  1ED1 A;  4KLM A;  4DQQ A;  8ICK A;  2ASJ A;  3TAQ A;  3TQ1 A;  1N2X A;  1KBU A;  4BJQ A;  2W9C A;  3JPO A;  2KZ3 A;  3ZDB A;  4NY8 A;  2H3Z A;  1TK0 A;  2KFN A;  2KP7 A;  5KFY A;  3NVW A;  2YY6 A;  8ICY A;  4O3M A;  4UB8 U;  4MF8 A;  3FAH A;  1UHU A;  5EWG A;  5ALH A;  3WK4 A;  2Y0S C;  2UVV A;  2IMW P;  4I29 A;  5CR0 A;  1KN5 A;  5EE1 A;  2HBM A;  2WF5 A;  2DPJ A;  3BDP A;  1V85 A;  2W43 A;  5DLG A;  1A77 A;  4P0Q A;  1BVS A;  2VAN A;  3OPX A;  2RDI A;  4DOA A;  1WYG A;  2XO7 A;  1N60 A;  5ALK A;  2GLE A;  3TAN A;  4GXJ A;  4X5V A;  5KFL A;  4KMU A;  2LYH A;  3C21 A;  4QW9 A;  4DQS A;  2WAQ F;  4UAR A;  5KT6 A;  4NL9 C;  8ICG A;  3IP4 B;  5C0Y A;  2ZIV B;  2YML A;  4F92 B;  1SL1 A;  1MQ2 A;  9ICQ A;  2DQN B;  3PMN A;  4F8R A;  3RJF A;  4B9U A;  2W7P A;  4JUZ A;  5J2G A;  3HJE A;  2BPF A;  5JRT A;  3RR7 A;  5JU5 A;  3L5K A;  2DFL A;  3PR5 B;  4RNM A;  2BCS A;  1XWL A;  9ICG A;  2QB0 B;  4CCH A;  4KX3 A;  4J9P A;  4KLL A;  4O3N A;  1NK6 A;  2EZY A;  5ALJ A;  4MHV A;  3LYS A;  3EZ5 A;  4R63 A;  2ZIW A;  5D46 A;  2W9A A;  2NRW A;  1X40 A;  4KLJ A;  2V4Q A;  5CA7 A;  4BX9 C;  1NKB A;  3RRH A;  9ICL A;  4QZG A;  1PUZ A;  1QH9 A;  2AQ4 A;  2A1J B;  4EYI B;  1XO1 A;  5IIK A;  3AUO A;  2HHQ A;  8ICR A;  2KVC A;  1J2N A;  3PX4 A;  3J81 j;  2BCU A;  4GC7 A;  2UVR A;  2KEY A;  5J0U A;  5AK3 A;  4JMU A;  3H7I A;  1KFT A;  3IN5 A;  2VA3 A;  4FZL A;  2UVU A;  4QIW F;  4NXZ A;  3SEN A;  5J0S A;  4O0I A;  3UMB A;  2DWQ A;  2LM1 A;  3SMV A;  2LI6 A;  3UPQ A;  5KAI U;  2ISO A;  4F2S A;  4RPX A;  4UB6 U;  5EOZ A;  5AI6 A;  4IQV A;  3SAF A;  4DLE A;  2WF8 A;  3RAX A;  4IRD A;  1ZQV A;  4Z6E A;  8ICJ A;  4UB3 A;  4GIB A;  8ICP A;  3IM1 A;  4Y2V A;  5KG3 A;  3C2L A;  2PMZ C;  1CI4 A;  2NRZ A;  1D8B A;  5BPC A;  4C8L A;  1BPE A;  3RH4 A;  3PW7 A;  4OD0 A;  1ZQS A;  3UMC A;  2ASD A;  5J0Y A;  1L3V A;  3CP8 A;  1BPX A;  1PVP A;  4PHE A;  4YD1 A;  2AGQ A;  1JI7 A;  1NNL A;  4QIW C;  4AYB C;  1IIP A;  1P7D A;  4CRX A;  2VIX A;  5CB1 A;  2YMP A;  1ZQT A;  5AM3 A;  3GIJ A;  3PW2 A;  3GII A;  1S0N A;  3GV5 B;  2K89 A;  5KFO A;  5KFD A;  7ICP A;  3RBE A;  1ZQW A;  3E2E A;  3ONN A;  4HYK A;  4GLX A;  5DQG A;  2ZIX B;  4BDP A;  3BS5 A;  2PXI A;  3HKZ F;  4UW9 A;  2J6T A;  9ICC A;  2G5H B;  5AKZ A;  3EWA A;  1TAM A;  5AM2 A;  4K4I A;  1V38 A;  1LKY A;  4EBD A;  4O3P A;  5J8Y C;  2NRX A;  5KFW A;  1L3T A;  4I2E A;  2AGP A;  1ZQZ A;  2P66 A;  4ECW A;  2H3Q A;  4QWC A;  2BQU A;  3KD3 A;  2C2D A;  4M0A A;  1F5S A;  3TFR A;  1DXS A;  4QWA A;  9ICT A;  3PML A;  3Q8Q B;  2DL0 A;  4I2G A;  2H3F A;  4DSI A;  1JX4 A;  3T5K A;  3MR5 A;  4IC9 A;  3QEB Z;  4ECV A;  4YP3 A;  5KG5 A;  4Y2T A;  3GIL A;  5AM0 A;  3ISD A;  3I76 A;  2WB1 C;  1ZQG A;  4I2F A;  1A6S A;  3F2D A;  1DK3 A;  5GTI U;  3F2B A;  3Q8M A;  4RU9 A;  4F2R A;  1FIQ A;  1L8O A;  4RQ2 A;  2I9G A;  4DL6 A;  4I2H A;  8ICZ A;  3WKA A;  4NM2 A;  2RP5 A;  4F50 A;  2KD1 A;  3SV4 A;  4K4H A;  4UAW A;  2WFA A;  1QQ6 A;  2KHQ A;  5J0W A;  5DDY A;  2MUT B;  3K4G A;  4DQP A;  2QB1 A;  1TAQ A;  1RQL A;  3NTU A;  5J2I A;  4NLZ A;  5J2A A;  2KJ8 A;  4IR9 A;  4EZ9 A;  4C4R A;  3G6V A;  3KHH A;  3SI8 A;  1NK5 A;  4DFJ A;  2I5H A;  4IQW A;  1ZQB A;  2ZUB A;  4P2H A;  2LMR A;  3QU7 A;  2XY6 A;  1SXE A;  1DGS A;  2KSO A;  1RXV A;  1KFD A;  4F5N A;  2JXJ A;  4JV1 A;  1ZQE A;  4M9N A;  4DEZ A;  4GXI A;  5IIN A;  5HNK A;  8ICF A;  3TAR A;  2H3I A;  2NRT A;  3RTV A;  3PW5 A;  4U7C A;  1Q8K A;  5DB8 A;  2KIC A;  5TIS U;  2K4P A;  3E0F A;  4IQU A;  3D6J A;  4C80 A;  4QZA A;  5KFV A;  3HT3 A;  2F1J A;  3IHQ B;  4DF4 A;  5J2J A;  4DL7 A;  5KFN A;  5AK5 A;  1TK5 A;  5CP2 A;  2IOH A;  3RH5 A;  4KLG A;  2QAR B;  8ICA A;  4RQ6 A;  1U9L A;  1UT5 A;  3N4M B;  4FFD A;  2PMZ F;  2BDU A;  4YMM A;  4IQT A;  3C2M A;  5J0T A;  2F8K A;  4KLI A;  1QQ5 A;  7ICK A;  4QZ8 A;  3LWM A;  2FJ6 A;  5E79 U;  2G5I B;  4XQ8 A;  4Y2Q A;  9ICI A;  1QTM A;  3WKE A;  2JV3 A;  4QNL A;  2EAM A;  5ALW A;  4DQI A; 
#chains in the Genus database with same CATH homology
 4KLH A;  7ICN A;  7ICO A;  2FMP A;  3JPR A;  9ICV A;  4XA5 A;  4NLK A;  4TUS A;  4RPZ A;  4FO6 A;  4DOC A;  3B0Y A;  2BCV A;  4M9G A;  1ZQH A;  4KLT A;  5J2H A;  1BNP A;  3JPP A;  8ICX A;  3RJJ A;  4RQ7 A;  4KLM A;  7ICM A;  9ICE A;  8ICK A;  4PHD A;  4M9L A;  2BCR A;  7ICV A;  4PGQ A;  1KDH A;  3JPO A;  4NY8 A;  4RQ4 A;  1KEJ A;  4F5P A;  4QZC A;  1ZQK A;  2KP7 A;  8ICY A;  4MF8 A;  3LK9 A;  5J2F A;  4I29 A;  4KLS A;  5IIO A;  5HHI A;  5J0X A;  1XSP A;  4PHP A;  9ICB A;  4F5R A;  4MFC A;  3UXN A;  8ICU A;  4DOA A;  4UBC A;  4PGY A;  3ISB A;  4O9M A;  4GXK A;  4KLU A;  4GXJ A;  4RPY A;  4X5V A;  4NM1 A;  1RZT A;  8ICE A;  8ICG A;  9ICN A;  4QZI A;  1MQ2 A;  4I2I A;  7ICI A;  9ICQ A;  3HX0 A;  4R65 A;  3PMN A;  4KLQ A;  1ZQC A;  3MDA A;  3RJF A;  8ICB A;  5D4B A;  9ICF A;  5J2G A;  3PNC A;  2BPF A;  8ICN A;  4RQ8 A;  1ZQR A;  3C2K A;  7ICT A;  4I2C A;  3B0X A;  8ICI A;  5DBA A;  3V7K A;  2PFN A;  2BCS A;  4Z6F A;  9ICG A;  4M2Y A;  4KLE A;  4KLL A;  9ICA A;  9ICK A;  4PGX A;  4R64 A;  3HW8 A;  1ZQI A;  4R63 A;  5D46 A;  4JWN A;  4KLJ A;  3JPT A;  7ICS A;  1BPY A;  3RJI A;  9ICL A;  4QZG A;  4M9H A;  4O5C A;  4UB4 A;  3UQ2 A;  5IIK A;  3AUO A;  9ICP A;  8ICS A;  8ICR A;  3RJE A;  4TUP A;  2PFQ A;  1HUO A;  7ICL A;  2BCU A;  4MFA A;  5J0U A;  7ICR A;  2GWS A;  5DKW A;  3V7L A;  7ICG A;  1ZQQ A;  2BPG A;  5J2C A;  9ICO A;  4YMN A;  4NXZ A;  4R66 A;  5J0S A;  4KLF A;  4MF2 A;  3RJH A;  9ICX A;  5J29 A;  5BOM A;  3UPQ A;  2ISO A;  4RPX A;  8ICT A;  1ZQP A;  5EOZ A;  4M9J A;  8ICW A;  4IQV A;  5J0R A;  5III A;  3TFS A;  1ZQN A;  1XSN A;  4KLO A;  8ICC A;  4Z6E A;  8ICJ A;  3GDX A;  8ICL A;  4UB3 A;  8ICP A;  4UB1 A;  3C2L A;  1ZJN A;  4TUR A;  5BPC A;  5IIL A;  1BPE A;  4YD2 A;  5TZV A;  3MDC A;  3RH4 A;  1ZQS A;  4RQ3 A;  5J0Y A;  1BPX A;  4F5O A;  2ISP A;  4PHE A;  4YMO A;  4YD1 A;  3HWT A;  4MFF A;  5CB1 A;  4LZG A;  1ZQT A;  1BNO A;  3MGI A;  1ZQA A;  2IHM A;  7ICP A;  9ICS A;  4RQ1 A;  4F5Q A;  8ICO A;  2PXI A;  3ISC A;  1MQ3 A;  4M04 A;  3RJK A;  5CWR A;  3RH6 A;  7ICH A;  9ICW A;  9ICC A;  2FMQ A;  1TVA A;  4K4I A;  9ICR A;  4I27 A;  4RT3 A;  4I2E A;  4QZF A;  4UB5 A;  7ICU A;  2P66 A;  5J2K A;  2W9M A;  3JPQ A;  3C5F A;  4DO9 A;  7ICQ A;  5DBB A;  4LZD A;  1DK2 A;  4M0A A;  5DB9 A;  3V72 A;  4Z6D A;  4QZH A;  3TFR A;  4PH5 A;  9ICT A;  1TV9 A;  1ZQD A;  3C5G A;  5HHH A;  4RQ5 A;  2PFO A;  3PML A;  4UBB A;  4I2G A;  5J0Q A;  3AU6 A;  7ICF A;  2BCQ A;  1XSL A;  3ISD A;  1ZQG A;  4I2F A;  4NLN A;  1DK3 A;  4RQ2 A;  2I9G A;  4I2H A;  8ICZ A;  3JPS A;  4M47 A;  4NM2 A;  4UAZ A;  4PPX A;  5J0O A;  4K4H A;  4UAW A;  4K4G A;  5J0W A;  7ICJ A;  5DDY A;  4QZ9 A;  4O5K A;  4RQ0 A;  5IIJ A;  9ICH A;  9ICM A;  5J2I A;  4TUQ A;  4UB2 A;  4NLZ A;  3AU2 A;  5J2A A;  5D49 A;  1ZQF A;  2FMS A;  1BPD A;  4QZE A;  9ICJ A;  4IQW A;  1ZQB A;  8ICH A;  4RT2 A;  3UQ0 A;  4P2H A;  3JPN A;  9ICU A;  1ZQO A;  4I2A A;  5J2B A;  1ZJM A;  8ICQ A;  4I2D A;  3OGU A;  4XUS A;  4YCX A;  3RJG A;  5J2E A;  8ICM A;  4F5N A;  4M9N A;  1ZQE A;  4GXI A;  5J2D A;  1ZQJ A;  5IIN A;  7ICE A;  8ICF A;  4JWM A;  3MGH A;  5BOL A;  4PHA A;  1NZP A;  5DB8 A;  3V7J A;  4O5E A;  1HUZ A;  5DB7 A;  4IQU A;  4QZA A;  4LVS A;  3UXO A;  4I2B A;  5J2J A;  4KLD A;  1ZQM A;  5DB6 A;  3UXP A;  4QZD A;  1JMS A;  4KLG A;  3RH5 A;  8ICA A;  8ICV A;  4RQ6 A;  3MBY A;  4YMM A;  4DOB A;  4IQT A;  5IIM A;  3C2M A;  5J0T A;  4KLI A;  4I28 A;  5J0P A;  7ICK A;  4QZ8 A;  4Z6C A;  4UAY A;  5DBC A;  1BPZ A;  4YN4 A;  1ZQL A;  4QZB A;  4I2J A;  9ICI A;  2PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...