1DK2A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 19
structure length 86
sequence length 86
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk2A00
8ICIA 4RQ1A 3AU6A 2I9GA 5J0XA 4FO6A 1ZQEA 2FMPA 4M9HA 2BCVA 3JPQA 4M9JA 2PFOA 5J0RA 4RT3A 9ICGA 4K4HA 3TFSA 1BPEA 1ZQSA 9ICHA 4UAYA 4O9MA 1MQ3A 4KLDA 1KDHA 4I28A 9ICUA 1DK2A 9ICSA 3RJHA 4KLGA 4MFAA 3UQ0A 5IIOA 5J29A 4M9GA 4I2IA 1KEJA 1ZQDA 7ICGA 4I2EA 4TUQA 4O5KA 5EOZA 7ICSA 3RH4A 2ISOA 1ZJMA 5IILA 3RJJA 1ZQHA 4UAWA 3AU2A 7ICEA 4PHPA 3HWTA 8ICMA 4I2GA 9ICRA 4F5NA 3ISCA 8ICCA 7ICJA 5BOLA 8ICOA 4UB4A 4O5EA 4PHDA 8ICXA 4QZBA 5J0UA 2KP7A 4YD1A 4O5CA 3V7LA 5J2GA 4F5PA 4PHAA 4RQ2A 1ZQQA 4PGXA 4YN4A 4F5QA 9ICPA 1ZQKA 5D4BA 1ZQMA 9ICOA 8ICSA 4GXIA 5J2CA 3MDCA 2PFQA 3JPNA 3V72A 4F5RA 4I2FA 4KLTA 7ICPA 2BCUA 3RH6A 5J0OA 5J2DA 4I2JA 5DDYA 4RPYA 4KLJA 5J0TA 3MBYA 4KLEA 3UPQA 4KLQA 4Z6FA 1TV9A 4M0AA 3JPSA 4NLKA 2PXIA 4Z6EA 7ICVA 4MF8A 5DB9A 4KLSA 5J0PA 5CB1A 1BPZA 4JWMA 5IIKA 2IHMA 5DKWA 1MQ2A 5DB8A 3MGHA 7ICOA 4IQVA 7ICUA 9ICJA 1ZQAA 4LZDA 4KLLA 3HX0A 3MGIA 8ICZA 1XSNA 2BPFA 4I2AA 4NY8A 4RQ0A 8ICAA 5J0WA 8ICJA 3JPTA 5DBBA 4YD2A 5J0YA 1ZQTA 4NXZA 4IQWA 5TZVA 3TFRA 9ICLA 5CWRA 4Z6CA 4QZGA 4XA5A 1BNPA 2PFPA 9ICTA 8ICKA 1XSPA 7ICKA 8ICFA 4I27A 4QZ8A 3OGUA 3C5FA 9ICQA 5D49A 8ICPA 3JPRA 1TVAA 7ICRA 3B0YA 4NLNA 4RPZA 4QZEA 4RQ7A 9ICAA 3PNCA 2FMSA 1ZQGA 2BCQA 5HHIA 3GDXA 5J2BA 4R66A 1DK3A 9ICNA 4PHEA 1XSLA 1ZQFA 4RQ5A 5DBCA 5J2KA 3HW8A 2ISPA 3PMNA 1NZPA 4YMMA 3UXPA 2BPGA 4KLHA 4UBCA 1JMSA 4RQ6A 4LZGA 4TURA 4NLZA 5IIIA 4UB5A 4UB2A 3PMLA 9ICIA 5J2AA 4NM2A 4I2CA 8ICWA 3JPPA 4RT2A 1HUOA 5HHHA 4YMNA 4XUSA 2BCSA 3RJGA 4F5OA 4R63A 4KLFA 4M04A 1BPYA 4LVSA 3C2LA 2PFNA 4QZ9A 4Z6DA 1ZQPA 4DOBA 4M2YA 4M47A 8ICLA 5J2HA 4TUPA 4IQTA 9ICMA 4UB1A 4KLIA 9ICBA 9ICWA 4PH5A 4GXKA 3LK9A 4KLUA 5DB6A 9ICKA 1ZQNA 8ICQA 4K4IA 9ICFA 2GWSA 4QZFA 1ZQJA 8ICRA 4QZAA 3B0XA 5J0SA 8ICTA 5IINA 4RQ4A 8ICGA 3MDAA 2FMQA 1ZQRA 4QZIA 3ISDA 4UB3A 5BPCA 4PGQA 8ICBA 5J2IA 3UXOA 5J2FA 4JWNA 8ICHA 4I2HA 3UQ2A 3RJFA 7ICFA 5J0QA 5IIMA 4KLOA 2P66A 4YMOA 4RPXA 8ICYA 5IIJA 9ICEA 4I2DA 3C5GA 4UAZA 4X5VA 5DBAA 4QZDA 1ZQCA 3JPOA 3RJKA 4KLMA 4DO9A 5D46A 5J2JA 4GXJA 4M9NA 4DOAA 7ICMA 7ICIA 7ICQA 4I29A 7ICHA 1ZQOA 4K4GA 4M9LA 7ICNA 1RZTA 3V7JA 4RQ8A 5J2EA 1BPDA 4QZHA 5DB7A 4R64A 8ICEA 1ZQIA 9ICCA 9ICXA 4QZCA 7ICTA 3RH5A 2W9MA 9ICVA 3UXNA 4NM1A 3V7KA 4YCXA 3RJEA 1BNOA 1ZJNA 4MFCA 4MF2A 4IQUA 3AUOA 3RJIA 4PPXA 1ZQLA 4MFFA 8ICNA 1HUZA 8ICUA 4R65A 4UBBA 8ICVA 1ZQBA 3ISBA 3C2MA 2BCRA 7ICLA 4P2HA 4I2BA 4RQ3A 1BPXA 3C2KA 5BOMA 4PGYA 4DOCA 4TUSA
chains in the Genus database with same CATH superfamily
3NTUA 3MFIA 2KFZA 3OJUA 2JZBA 1T3QA 5KAIU 5J0XA 2BCVA 2ASDA 4M9JA 5ALQA 3PW0A 3PSIA 5EE3A 5KL8B 1JX4A 4K4HA 3J81j 2BGWA 2EAOA 3Q8RB 1BPEA 4QW9A 5KFCA 2OM6A 4KX3A 1KDHA 3FM9A 9ICUA 3H7IA 1DK2A 1VLBA 4QWDA 3M9MB 3PO5A 1KN5A 4F72A 4M9GA 1SV0C 3C1ZA 2KHQA 2KE7A 1HJPA 4I2IA 5L1LA 1QCKA 2A3VA 3T79A 1KFSA 2WF5A 4QWAA 2JV3A 1X42A 5ALLA 2NV3A 3WK7A 7ICSA 3RH4A 4RNNA 4DL2A 1N5XA 1ZQHA 7ICEA 3BDPA 4FE3A 9ICRA 5AM2A 8ICOA 2WF6A 3KD3A 4QZBA 2KP7A 4O5CA 1T3NA 3V7LA 4RQ2A 3Q8QB 1LKYB 2NO4A 4F5QA 4OD0A 1ZRNA 1X6IA 4DS5A 4P0PB 2VIXA 2LMRA 2W03A 4R8UB 3BJYA 1ZQYA 2G08A 5AI5A 1ZQ1C 2C2EA 3NVZA 5CA7A 2I5HA 3MDCA 2EAPA 2KTQA 1J97A 4KLTA 1FEZA 1NK8A 1V85A 5J0OA 5J2DA 5DDYA 5KG5A 4RQNA 4RPYA 3RRGA 2H3IA 4UB8U 2W54A 3PR4A 4KLEA 2NYVA 4P4OA 1U47A 3LVVA 5ALMA 1K5OA 1WG8A 2PI4A 5DB9A 1FFVA 5AICA 3CW2C 3TANA 5DB8A 3V6KA 3MC1A 5EWEA 4HAIA 4KLLA 1L3TA 4E0DA 3MGIA 1XNSA 1BVSA 1FFUA 5ALSA 8ICAA 5J0WA 2ZIUA 3EYZA 1SL1A 2GO7A 2KG5A 5DGAA 4G9BA 2KK0A 3SAGA 3EWAA 3K1ZA 2UVUA 3QU5A 1F5SA 4NXZA 1IXRA 4ACOA 2ZXIA 2ZJ8A 5KFYA 5TZVA 4P4PA 4XA5A 2PFPA 3Q8MA 2D3DA 3C21A 4I27A 3PVXA 5L9XA 1A77A 2KVCA 2HMXA 4O3PA 9ICQA 2LPEA 1QTMA 7ICRA 2R8KA 4NLNA 4RPZA 3LVWA 4OCZA 1T4GA 2IHNA 3PNCA 4FZNA 2FMSA 5AI6A 3H8WA 1VJ5A 1Q8KA 3NASA 5AKEA 3T5JA 3M7DA 5KG1A 4J9OA 1K1SA 5AKHA 2F8KA 4ZH4A 2K89A 2IMWP 2AQ4A 4B9LA 5DBCA 3CP8A 3HILA 1ZQZA 2CRXA 2BPGA 4KLHA 1TE2A 4PZNA 3AMZA 4O0IA 2BDUA 1QQ5A 3KHHA 1CEZA 3THVA 2HBJA 3H4DA 4UB5A 3GFKB 1PVQA 1GO3F 1TK5A 4O3SA 1SV0A 3G6VA 3IDWA 5KFOA 1URJA 9ICIA 4B9NA 2G5HB 1S0VA 2H3FA 1JROA 2MA1A 5J2AA 3GU3A 3IP4B 3JPPA 4RT2A 2HSZA 1HUOA 1XU4A 3KHRA 2B6GA 1Q3UA 4DL7A 2B0CA 1ZD5A 4F4ZA 2YX8A 4LVSA 3EW9A 2W7PA 2PFNA 3PSPA 3M1YA 4EELA 4FZMA 2E3TA 3IN5A 5KAFU 1ZQUA 5GTHU 4QNLA 2ZIWB 1D8LA 4Y2XA 4KLIA 4O3MA 2K8AA 2GH1A 9ICWA 2K4IA 3BS5B 2F76X 4PH5A 1J2NA 4GXKA 3LK9A 3H0RB 5AKKA 3N28A 2BQ3A 2ZJAA 5DB6A 3HP6A 2XY6A 2YB4A 2VANA 9ICKA 8ICQA 9ICFA 2K4EA 2KD1A 4HYKA 1WWVA 2AXTU 4BGDA 1SKRA 3WKBA 5J0SA 8ICTA 1B4FA 2KKPA 1NZBA 3UMBA 3MGVA 2EH9A 3MDAA 3H0LB 1XC9A 2KNJA 4NJ8A 4UAUA 5KFSA 4ED6A 1QQ7A 8ICBA 2F3NA 1D8YA 4JWNA 3Q8SB 2LM4A 2ZTEA 2DWQA 2CXYA 4YQWA 2PKEA 1KFDA 1ZQXA 4KN7A 2F44A 3HKZF 2GOLA 5E79U 3AM9A 3HT3A 1KRPA 4QIWF 4ELUA 2FPLA 3ZDBA 1UCVA 4UAZA 4X5VA 5DBAA 3KFUF 4QZDA 3HKZC 2B21A 3LWLA 1S9FA 2FI1A 1COOA 1X9MA 4B6JA 2EDUA 4QIWC 3RR8A 1UPHA 3RJKA 3NRWA 4F4XA 1Z1VA 5D46A 2W9CA 2XICA 3OHAA 4GXJA 2PMZF 1D9FA 4M9NA 3GIKA 2XY7A 7ICMA 3UMGA 2DF4B 3SR6A 5HP4A 2A1JB 3WKCA 1NK4A 2PMZC 1ZD2P 4UQGA 4XRHA 1DGJA 4J9PA 1ZQOA 4EEKA 4K4GA 4M9LA 1RZTA 4YFKA 3V7JA 4BXOB 4C8KA 8ICEA 2BPCA 5EWFA 2Z7JA 5ALJA 1ZQIA 9ICCA 1WUDA 3L5KA 2W9MA 9ICVA 5J8YC 2OEHA 3MFHA 3QX7A 3SQIA 2W11A 1ZJNA 3D6JA 3OJSA 5CP2A 4QWCA 4MF2A 3QEAZ 4IQUA 1PK1A 2P6UA 1HUZA 1NJZA 4UBBA 3C2MA 3NVYA 5KFGA 3IM1A 4DQRA 1QSLA 2R8GA 2XCAA 7ICLA 4YP3A 4P4MA 1AQ6A 3RBDA 3GZFA 2IA6A 5G5GA 4IC9A 2LBOA 4UARA 3QU4A 5J0RA 8ICIA 2W3SA 3H8SA 3AU6A 2JEIA 2I9GA 2NRTA 4OO1J 1ZQEA 3BQ7A 2LM1A 4Y2PA 4CF4A 1BPBA 3NGDA 5AIAA 4DFPA 2KHVA 1MC8A 2NRWA 5ALRA 4IRCA 5G5HA 2XC9A 3TAPA 3WU2U 4NLCA 1UHUA 3TFSA 3SZ2A 4DL6A 1RQLA 2MUTA 2FDRA 4KLDA 4NL9C 2BQUA 4DF4A 4I28A 4J9LA 1L3UA 4FS2A 2NRZA 3RJHA 4KLGA 2FLPA 4MFAA 4PL1A 3PX0A 4DSFA 3IG8A 2OHFA 4B9MA 1ZXIA 5C0YA 1SKSA 5KFTA 3LDAA 3K1RB 3KHLA 5ALEA 3BQTA 2ISOA 5H2FU 2D6FC 2KZZA 8ICMA 1Z3EB 3ISCA 8ICCA 3NVWA 4KN4A 2JXJA 5KFKA 2G0AA 3QZ8A 2VA8A 8ICXA 3ICXA 4U7CA 2F77X 4F5PA 4DS4A 2E8OA 1QSSA 4EBCA 2BR0A 1ZQQA 5KG7A 9ICPA 4DFJA 4Y2UA 2ZJ5A 2RDIA 5AM3A 5AKYA 2EZZA 3KHGA 4DL3A 1HEKA 1YZ7A 4GXIA 3LWMA 5J2CA 2F2AB 2PFQA 5EE0A 3JPNA 3V72A 4RNOA 1X40A 2F8LA 2D8CA 3SV4A 5J0TA 2FPKA 1PUZA 3UPQA 3H8JA 4Z6FA 2G06A 3SYZA 3JPSA 1N2XA 4Q43A 1C7YA 4Z6EA 3AEVA 7ICVA 1BPZA 2VJ5A 3BS7A 2IHMA 5DKWA 4FBTA 1N56A 1RYSA 2DFLA 3NRZA 4I2AA 2EZYA 2H3QA 8ICJA 4BWMA 5J0YA 4NLBA 3SV3A 1JUDA 3WK8A 5ALOA 5J8YA 2WF8A 1S0OA 9ICLA 5CWRA 3FDSA 4RUCA 4UASA 4Z6CA 4QZGA 1BNPA 3DEEA 1OUQA 7ICKA 4WJ3B 4B9VA 3OGUA 4PJ0U 2XCPA 3WKDA 1RDFA 1Z19A 1NK5A 3JPRA 2VA3A 3CYMA 2K8BB 3T5KA 4ECVA 1DRGA 5F9LA 5DQGA 9ICAA 1TK0A 3QNMA 4F8RA 3QZ7A 2JH7A 1PVRA 1JN3A 2DGZA 4DQPA 2V9WA 3OTQA 4ECXA 3GDXA 1DK3A 4PZOA 5B5EU 2G5IB 4PHEA 1FO4A 1XSLA 5DLFA 1U9LA 2ASJA 1ZQFA 2QARB 2LHTA 2DBYA 2DPIA 1NZPA 2E8MA 2KSOA 3L3FX 4DLEA 3HJEA 2LYBA 4NL9A 2QKQA 5AK6A 4YXMA 2OCEA 3C29A 3TQ1A 4P0QA 4NLZA 4JUZA 5IIIA 2K4HA 4ELVA 1ZETA 4DWIA 2F1JA 3PMLA 5KFIA 5KFWA 1PVPA 2EANA 4I2CA 1B0XA 4QWBA 4B9UA 3R9KA 4OJPA 1SL0A 2M9NA 1N5WA 1JXEA 3GV8B 2HCFA 4XUSA 2BQRA 1NK6A 2R8IA 4YXJA 4KLFA 2Q0ZX 1BPYA 4RQMA 2QB0A 4M2YA 3SMVA 1S0NA 4M47A 1L8OA 3F2BA 4DFKA 4Y2TA 4IRDA 5ALNA 5KG3A 1KL9A 1X2IA 5KFVA 1JIHA 3S6JA 3GIMA 1SXEA 2KJ8A 5KG0A 1L7MA 1ZQNA 4Q8FA 2GWSA 4QZFA 4YR3A 1ZQJA 3BQ0A 8ICRA 4QZAA 2J6TA 2EQYA 8ICGA 2W9AA 3VC8A 5KL1B 3WKAA 3ISDA 3G6YA 4UB3A 4IRKA 4MEXA 5A0LA 5J2IA 5J2FA 1SB3C 8ICHA 5ALKA 2KIVA 1YT3A 5IIMA 4O3NA 4YMOA 2AGQA 2ZTDA 2DL0A 3WK4A 3F2CA 5B66U 9ICEA 1X66A 4I2DA 3BQ2A 3I76A 1QQ6A 1FIQA 2RQ5A 2MRLA 3JPOA 4CE6A 4JMUA 2W9CB 5J2JA 1WCLA 1L8LA 4DOAA 3RB4A 3KOOA 2KKVA 4ED0A 5ALFA 3ALRA 2YTUA 4RZRA 2NRXA 3M6KA 1H38A 1Z00B 2F1HA 5AKJA 4BJQA 1RM6C 2E5SA 1LKYA 5DB7A 4R64A 2Y1JA 2DKXA 9ICXA 1V38A 2ZUBA 3RH5A 3B9JA 3V6HA 3EZ5A 1U48A 1MA7A 3L4PA 4P0PA 3EPGA 5T14A 3CNHA 3LYSA 4R8UA 3C28A 5ALUA 1JI7A 3RJIA 3RB6A 4MFFA 5DDMA 1TKDA 2ZIVB 3KBBA 3QUTA 1CI4A 8ICVA 3RR7A 1U49A 2W9BA 5KFQA 2BCRA 1A76A 4OJ6A 1M6YA 1L3SA 4J9KA 2YQEA 5DQIA 1UA0A 1ZQVA 5TISU 1NK0A 3OHBA 2GLEA 2ESEA 2R8JA 2R18A 3M8RA 5KFUA 5ALWA 5L1JA 4TUSA 4FFDA 4RQ1A 3F5AA 1SZPA 4DFMA 3AN1A 4M9HA 3PSFA 3PR5B 3JPQA 1D8BA 5AK5A 2PFOA 2CPRA 5FP0A 1WCNA 4RT3A 3VCBA 3FAHA 4AYBF 5KNIA 1ZQSA 2P6RA 1WYGA 5KFFA 2W04A 4AYBC 2NO5A 2KEYA 3QEBZ 1NJWA 2P35A 1J2MA 5AKZA 3UQ0A 5J29A 4JV0A 2C22A 1UA1A 1KEJA 2KVSA 4I2EA 1DXSA 5ALHA 1TAQA 4TUQA 4M6WB 3U26A 2YMLA 4O5KA 5EOZA 4RUAA 2UVWA 1ZQWA 4ICAA 1CUKA 5K4LA 3QYPA 4B9TA 3AU2A 2HVIA 3HWTA 2K60A 4F5NA 4ECQA 2XY5A 1MSWD 4QWEA 4UB4A 4O5EA 2ZTCA 4PHDA 5EWGA 3SI8A 2DPJA 3ZD8A 5JTIA 4PHAA 5KT5A 1XO0A 1C20A 1V9PA 5CJ7A 2JR5A 1U4BA 3HRDD 2HHTA 2F1IA 3KZIU 1B22A 5AIBA 2ZIXB 1NJYA 1ZQKA 2H3ZA 4ED3A 2W55A 1Y88A 4A8EA 1A0PA 5D4BA 1ZQMA 2K8CB 5GTIU 2QB1A 1NKCA 9ICOA 5AI8A 4EENA 1WWUA 3WKEA 1KQQA 7ICPA 1RPLA 3RH6A 2HOIA 1KFTA 4I2JA 2O6KA 3ETLA 3A0BU 4EYIB 4KLJA 1X9WA 3MBYA 4KLQA 1TV9A 4M0AA 5ALVA 3PX6A 2PXIA 2L5YA 4MF8A 3DDHA 1JALA 4Q44A 1LB2B 4KLSA 2KZ3A 2JZBB 2IOFA 3UM9A 3TI0A 3RFAA 4JWMA 5IIKA 4F92B 4DL5A 3RAQA 2DUYA 3MGHA 7ICOA 4C7YA 1OXJA 9ICJA 1ZQAA 4LZDA 5F9NA 4KITB 4EYHB 3QXGA 4CRXA 2KV2A 4NLGA 2WTFA 8ICZA 2AH5A 4BWJA 2BPFA 1VDVA 1Q46A 4KMOB 5KG6A 3JPTA 2R8HA 5DBBA 3BS5A 4YD2A 4JB3A 5KFEA 3M8SA 2XGPA 4EBEA 1IIPA 2JH1A 3TARA 2AJQA 1ZQTA 3MR5A 3PY8A 2HHWA 2XIDA 3TFRA 2LI6A 9ICTA 3QU2A 8ICKA 2KJ9A 3AQFA 4C4RA 1XSPA 2Y9UA 3BQ1A 8ICFA 2KOBA 4QZ8A 1ZD3A 3C5FA 1P7DA 5D49A 4QJFB 1TVAA 5EE1A 4UATA 5ALIA 3PW4A 3B0YA 5KT6A 5AM4A 2KZMA 2WHEA 3QU7A 4RQ7A 4DSKA 5EE9A 3T3FA 3C1YA 4F4KA 2HBKA 1ZQGA 1NOMA 2DQNB 4EZ9A 3ETRA 4DSJA 1SGGA 3TAQA 3E0FA 3PV8A 5J2BA 4F2RA 1CRXA 1V97A 9ICNA 3GV7B 4C4SA 3QUQA 5AKXA 3F53A 2C2DA 1S0MA 4CNQA 5ALZA 4RQ5A 2OXOA 3HW8A 3MR3A 5AK4A 3PMNA 4PL2A 4YMMA 4RNMA 1Z4OA 5KFPA 4DL4A 4UBCA 1RQNA 3M9NB 1ECWA 1JMSA 4RQ6A 1N48A 4LZGA 3WK6A 4DSIA 4BXOA 4IR1A 4EX7A 4BUGA 3TADC 3E58A 4UB2A 3ZDCA 4OJ5A 3PZPA 2Y1IA 4DCCA 2KJ5A 3ZI4A 1JRPA 5KT2A 1NK7A 4NM2A 5DGBA 3SENA 2HBLA 3G6XA 1T94A 3C23A 4YMNA 5KFBA 3D2NA 3DV9A 1TK8A 3WK5A 2AQ0A 2QB0B 3BZKA 1Z4NA 4Z6DA 1ZQPA 3D2QA 3K4GA 3TKAA 2E1FA 1L7PA 5AHXA 5J2HA 2HHXA 2H5XA 4IQTA 3I1YA 1S97A 4CF3A 2ZIUB 1IV8A 5AKIA 3EPIA 1XWLA 3EUB2 4J9RA 2G09A 2YMPA 2BZFA 1N63A 4RQ4A 3RTVA 5KFDA 3PW5A 1ZQRA 5KFAA 2VA2A 4QZIA 3Q8PB 2IOFK 1S76D 2XO7A 4ZOHC 4DQSA 1TAUA 2W7OA 1NI3A 4F2SA 1B43A 4IL6U 2JEFA 4I2HA 7ICFA 4KLOA 2P66A 2XI9A 5KFJA 3N4MB 5CEHA 3FC4A 4KMUA 4LJXA 2Y9TA 4ED2A 8ICYA 4TQRA 4J9MA 3C5GA 5KFLA 3ZDEA 4CF5A 4ED1A 4YR2A 2MSNA 3RB0A 4GIBA 4C4TA 4KLMA 4FZLA 3N7SC 2OWOA 1S77D 1QH9A 4G3IA 2HHVA 2LYHA 1NKEA 3MR2A 7ICQA 4I29A 1XS9D 3E2EA 1MN8A 4RQ8A 3T5LA 2G07A 4QZHA 5AKGA 4QZCA 1ZOLA 7ICTA 3V7KA 3GV5B 4YCXA 1QSYA 1U45A 1BNOA 2CN1A 5AI4A 3ZD9A 4MFCA 3Q8KA 3AUOA 1ZQLA 5L1KA 8ICUA 5ALPA 4R65A 4F71A 3N7RC 2W9BB 3PX4A 1KKXA 2ASLA 1N62A 4YR0A 3HPOA 2MU2A 4XQ8A 4I2BA 4JV1A 1NK9A 2JMGA 4AP9A 5BOMA 4PGYA 4UW9A 2HDOA 2WFAA 2ALZA 3KZXA 3V6JA 5KFMA 1RXVA 4O3OA 3RF9A 2ES6A 4FO6A 2FMPA 5ALXA 2PI5A 2JRZA 5KFXA 1UQVA 4C80A 9ICGA 5DQHA 1NJXA 3PW2A 3SAFA 9ICHA 2ODGA 2YMMA 3QU9A 4UAYA 4EEYA 1MQ3A 4O9MA 5AKLA 2OYYA 3ED5A 2IBKA 1L5UA 2JEJA 3TADA 1PZNA 3ONNA 1A6SA 4ECWA 5HMLA 4JV2A 5C5JA 9ICSA 5JU5A 2HW3A 3IHQB 5IIOA 2WB1F 2E8NA 2UVRA 2VJ4A 4JK1A 1XO1A 4IS7A 1ZQDA 5ALDA 7ICGA 2WB1C 4US8A 2BHNA 1ZJMA 5IILA 3PO4A 2AGPA 3RJJA 4UAWA 1BGXT 1SV4A 1YZ6A 5KFZA 4PHPA 3QE9Y 3ZDAA 1ZD4A 2FLNA 4I2GA 2HHSA 2KIWA 7ICJA 5BOLA 4DQIA 1ZYQA 4C7ZA 4DF8A 1LV5A 3H40A 1NNLA 1TFRA 2AU0A 5J0UA 5KTQA 4YD1A 5J2GA 2DKZA 4PGXA 3CRXA 4YN4A 1KSPA 4IR9A 3GQCA 1RYUA 3SEIA 4NV0A 4QW8A 4MEYA 2QARA 4GC7A 2JHDA 1S8OA 4F93B 8ICSA 2E8PA 1PK1B 4YG2A 5KT4A 3D2SA 1F0MA 3T5HA 1KBUA 2AHOB 1RYRA 4OJOA 4F5RA 4BDPA 1JXLA 4ECZA 4I2FA 2AGOA 2KMDA 3RAXA 2BCUA 4U6PA 2ZG6A 2W8KA 3NUQA 4O3QA 5DG9A 1Z1BA 3H0MB 2RHFA 4NWIA 2I6XA 4NLKA 4BX9C 2YY6A 1T7PA 2E1EA 2HVHA 1IM4A 5J0PA 4Y2QA 4DQQA 5CB1A 4CDGA 3KTQA 5HR6A 1MQ2A 3KKAC 1L7NA 2W43A 4IQVA 7ICUA 1X9XA 3HX0A 5ALYA 4Y2JA 3PW7A 1XSNA 2MUTB 3UMCA 5DG7A 4NY8A 4RQ0A 5AM5A 1LVHA 3ORYA 2J6UA 5DG8A 4C8LA 4UAVA 5KFNA 3IRUA 4FBUA 4FS1A 4IQWA 1SKWA 3NVVA 2BDPA 3GIIA 3OSPA 1PK3A 2I1QA 4ELTA 2HBMA 1DGSA 4J9NA 3K75D 3RBEA 2HOQA 5HMMA 1EXNA 4US9A 1OW5A 2ZXHA 4F91B 8ICPA 5AM1A 3IV6A 2FLLA 1O08A 2JEGA 4ECYA 2C28A 2BKEA 4QZEA 5KT7A 2W3RA 3A0HU 3AL0B 1KLNA 1K1QA 3RB3A 2QLTA 3BZCA 2BCQA 3SAHA 5HHIA 2LYAA 4DEZA 5CR0A 1F44A 5F3XB 4R66A 2WF7A 4J03A 4DLGA 3OPXA 2Y0SF 1NKBA 2KN7A 5AK3A 4Y2YA 2EAMA 4UB6U 5J2KA 4C8MA 2ISPA 2Y0SC 3UXPA 2N1RA 5L1MA 5AM0A 1SWVA 2KICA 3QUCA 1KW4A 2M0NA 5HNKA 4TURA 2FJ6A 4EBDA 1Z00A 1S10A 5CRXA 1X9SA 3RRHA 2LKYA 2A19A 2EZXA 2XVTA 4C8NA 2XGQA 5AI0A 3N97B 1ED1A 2VKQA 8ICWA 1O03A 5HHHA 3I28A 3M6ZA 2IOHA 2NRVA 2BCSA 4GC6A 3RJGA 4F5OA 2UVVA 4DSEA 4R63A 2ZIVA 2C2RA 4M04A 5L1IA 3C2LA 4QZ9A 3MR6A 5KG4A 4DOBA 4ECUA 8ICLA 1DOQA 4TUPA 4ECSA 9ICMA 1L3VA 4UB1A 1Q3VA 2RDJA 2W8LA 3H8MA 2WF9A 2ZIWA 9ICBA 1KTQA 4OJLA 4ED8A 4KLUA 4DFDA 2RP5A 4J9QA 4ECTA 4ED7A 4K4IA 4O3RA 5KFRA 2RLTA 2HHQA 2MAXA 3FYHA 3B0XA 2JGAA 1AROP 4F4YA 4TQSA 5JRTA 5IINA 3PSTA 2FMQA 3IG5A 1HIWA 5DLGA 5BPCA 1IG6A 5KFHA 3GILA 3AQEA 4C8OA 4PGQA 5KT3A 3UXOA 4Y2RA 3UQ2A 3RJFA 5J0QA 2RRDA 3M9OB 4GLXA 4KX5A 2V4RA 4YVZA 3Q8LA 4RPXA 3TACB 1SL2A 5IIJA 2FPMA 3NS1A 4B9SA 2V4QA 4USAA 3F5EA 3SD7A 2ATLA 3F2DA 2H3VA 1ZQCA 3WK9A 4M6WA 1SXDA 4ECRA 1RG6A 4DO9A 1COKA 4Q45A 1T8EA 4RU9A 3KKAA 1UT8A 2J6SA 2YN4A 4Y2SA 3OSNA 5ALGA 1TAMA 4Y2VA 2YMQA 1D9DA 7ICIA 2KSOB 2K4PA 5CHGA 3N7PD 4F50A 2A1JA 7ICHA 5AI9A 2FE9A 2Q4TA 7ICNA 4P0QB 5KG2A 2OH2A 5J2EA 4J9SA 1BPDA 4EX6A 1N60A 2KFNA 3H4BA 3MABA 1RXWA 3UXNA 4NM1A 4CCHA 1UT5A 2WAQF 4MHVA 4F4WA 2ZIXA 4C0ZA 3RJEA 1S5LU 5JUMA 4DSLA 4CGZA 2WAQC 1SWWA 4PPXA 1L7OA 8ICNA 2ZUCA 1QLNA 1L6NA 2HOFA 3O0FA 1N61A 3ISBA 5ALTA 1ZQBA 3ZDDA 2HI0A 4F3OA 2YB1A 4P2HA 4RQ3A 1ZRMA 1X6JA 1BPXA 3C2KA 2ZUDA 1SZHA 2HHUA 4KTQA 4GFJA 1SIJA 2A1AA 4EZ6A 4DOCA 5HR7A 3QUBA 3GIJA 4Q8EA
chains in the Genus database with same CATH topology
8ICIA 4RQ1A 3AU6A 2I9GA 5J0XA 4FO6A 1ZQEA 2FMPA 4M9HA 2BCVA 3JPQA 4M9JA 2PFOA 5J0RA 4RT3A 9ICGA 4K4HA 3TFSA 1BPEA 1ZQSA 9ICHA 4UAYA 4O9MA 1MQ3A 4KLDA 1KDHA 4I28A 9ICUA 1DK2A 9ICSA 3RJHA 4KLGA 4MFAA 3UQ0A 5IIOA 5J29A 4M9GA 4I2IA 1KEJA 1ZQDA 7ICGA 4I2EA 4TUQA 4O5KA 5EOZA 7ICSA 3RH4A 2ISOA 1ZJMA 5IILA 3RJJA 1ZQHA 4UAWA 3AU2A 7ICEA 4PHPA 3HWTA 8ICMA 4I2GA 9ICRA 4F5NA 3ISCA 8ICCA 7ICJA 5BOLA 8ICOA 4UB4A 4O5EA 4PHDA 8ICXA 4QZBA 5J0UA 2KP7A 4YD1A 4O5CA 3V7LA 5J2GA 4F5PA 4PHAA 4RQ2A 1ZQQA 4PGXA 4YN4A 4F5QA 9ICPA 1ZQKA 5D4BA 1ZQMA 9ICOA 8ICSA 4GXIA 5J2CA 3MDCA 2PFQA 3JPNA 3V72A 4F5RA 4I2FA 4KLTA 7ICPA 2BCUA 3RH6A 5J0OA 5J2DA 4I2JA 5DDYA 4RPYA 4KLJA 5J0TA 3MBYA 4KLEA 3UPQA 4KLQA 4Z6FA 1TV9A 4M0AA 3JPSA 4NLKA 2PXIA 4Z6EA 7ICVA 4MF8A 5DB9A 4KLSA 5J0PA 5CB1A 1BPZA 4JWMA 5IIKA 2IHMA 5DKWA 1MQ2A 5DB8A 3MGHA 7ICOA 4IQVA 7ICUA 9ICJA 1ZQAA 4LZDA 4KLLA 3HX0A 3MGIA 8ICZA 1XSNA 2BPFA 4I2AA 4NY8A 4RQ0A 8ICAA 5J0WA 8ICJA 3JPTA 5DBBA 4YD2A 5J0YA 1ZQTA 4NXZA 4IQWA 5TZVA 3TFRA 9ICLA 5CWRA 4Z6CA 4QZGA 4XA5A 1BNPA 2PFPA 9ICTA 8ICKA 1XSPA 7ICKA 8ICFA 4I27A 4QZ8A 3OGUA 3C5FA 9ICQA 5D49A 8ICPA 3JPRA 1TVAA 7ICRA 3B0YA 4NLNA 4RPZA 4QZEA 4RQ7A 9ICAA 3PNCA 2FMSA 1ZQGA 2BCQA 5HHIA 3GDXA 5J2BA 4R66A 1DK3A 9ICNA 4PHEA 1XSLA 1ZQFA 4RQ5A 5DBCA 5J2KA 3HW8A 2ISPA 3PMNA 1NZPA 4YMMA 3UXPA 2BPGA 4KLHA 4UBCA 1JMSA 4RQ6A 4LZGA 4TURA 4NLZA 5IIIA 4UB5A 4UB2A 3PMLA 9ICIA 5J2AA 4NM2A 4I2CA 8ICWA 3JPPA 4RT2A 1HUOA 5HHHA 4YMNA 4XUSA 2BCSA 3RJGA 4F5OA 4R63A 4KLFA 4M04A 1BPYA 4LVSA 3C2LA 2PFNA 4QZ9A 4Z6DA 1ZQPA 4DOBA 4M2YA 4M47A 8ICLA 5J2HA 4TUPA 4IQTA 9ICMA 4UB1A 4KLIA 9ICBA 9ICWA 4PH5A 4GXKA 3LK9A 4KLUA 5DB6A 9ICKA 1ZQNA 8ICQA 4K4IA 9ICFA 2GWSA 4QZFA 1ZQJA 8ICRA 4QZAA 3B0XA 5J0SA 8ICTA 5IINA 4RQ4A 8ICGA 3MDAA 2FMQA 1ZQRA 4QZIA 3ISDA 4UB3A 5BPCA 4PGQA 8ICBA 5J2IA 3UXOA 5J2FA 4JWNA 8ICHA 4I2HA 3UQ2A 3RJFA 7ICFA 5J0QA 5IIMA 4KLOA 2P66A 4YMOA 4RPXA 8ICYA 5IIJA 9ICEA 4I2DA 3C5GA 4UAZA 4X5VA 5DBAA 4QZDA 1ZQCA 3JPOA 3RJKA 4KLMA 4DO9A 5D46A 5J2JA 4GXJA 4M9NA 4DOAA 7ICMA 7ICIA 7ICQA 4I29A 7ICHA 1ZQOA 4K4GA 4M9LA 7ICNA 1RZTA 3V7JA 4RQ8A 5J2EA 1BPDA 4QZHA 5DB7A 4R64A 8ICEA 1ZQIA 9ICCA 9ICXA 4QZCA 7ICTA 3RH5A 2W9MA 9ICVA 3UXNA 4NM1A 3V7KA 4YCXA 3RJEA 1BNOA 1ZJNA 4MFCA 4MF2A 4IQUA 3AUOA 3RJIA 4PPXA 1ZQLA 4MFFA 8ICNA 1HUZA 8ICUA 4R65A 4UBBA 8ICVA 1ZQBA 3ISBA 3C2MA 2BCRA 7ICLA 4P2HA 4I2BA 4RQ3A 1BPXA 3C2KA 5BOMA 4PGYA 4DOCA 4TUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8ICI A;  4RQ1 A;  3AU6 A;  2I9G A;  5J0X A;  4FO6 A;  1ZQE A;  2FMP A;  4M9H A;  2BCV A;  3JPQ A;  4M9J A;  2PFO A;  5J0R A;  4RT3 A;  9ICG A;  4K4H A;  3TFS A;  1BPE A;  1ZQS A;  9ICH A;  4UAY A;  4O9M A;  1MQ3 A;  4KLD A;  1KDH A;  4I28 A;  9ICU A;  1DK2 A;  9ICS A;  3RJH A;  4KLG A;  4MFA A;  3UQ0 A;  5IIO A;  5J29 A;  4M9G A;  4I2I A;  1KEJ A;  1ZQD A;  7ICG A;  4I2E A;  4TUQ A;  4O5K A;  5EOZ A;  7ICS A;  3RH4 A;  2ISO A;  1ZJM A;  5IIL A;  3RJJ A;  1ZQH A;  4UAW A;  3AU2 A;  7ICE A;  4PHP A;  3HWT A;  8ICM A;  4I2G A;  9ICR A;  4F5N A;  3ISC A;  8ICC A;  7ICJ A;  5BOL A;  8ICO A;  4UB4 A;  4O5E A;  4PHD A;  8ICX A;  4QZB A;  5J0U A;  2KP7 A;  4YD1 A;  4O5C A;  3V7L A;  5J2G A;  4F5P A;  4PHA A;  4RQ2 A;  1ZQQ A;  4PGX A;  4YN4 A;  4F5Q A;  9ICP A;  1ZQK A;  5D4B A;  1ZQM A;  9ICO A;  8ICS A;  4GXI A;  5J2C A;  3MDC A;  2PFQ A;  3JPN A;  3V72 A;  4F5R A;  4I2F A;  4KLT A;  7ICP A;  2BCU A;  3RH6 A;  5J0O A;  5J2D A;  4I2J A;  5DDY A;  4RPY A;  4KLJ A;  5J0T A;  3MBY A;  4KLE A;  3UPQ A;  4KLQ A;  4Z6F A;  1TV9 A;  4M0A A;  3JPS A;  4NLK A;  2PXI A;  4Z6E A;  7ICV A;  4MF8 A;  5DB9 A;  4KLS A;  5J0P A;  5CB1 A;  1BPZ A;  4JWM A;  5IIK A;  2IHM A;  5DKW A;  1MQ2 A;  5DB8 A;  3MGH A;  7ICO A;  4IQV A;  7ICU A;  9ICJ A;  1ZQA A;  4LZD A;  4KLL A;  3HX0 A;  3MGI A;  8ICZ A;  1XSN A;  2BPF A;  4I2A A;  4NY8 A;  4RQ0 A;  8ICA A;  5J0W A;  8ICJ A;  3JPT A;  5DBB A;  4YD2 A;  5J0Y A;  1ZQT A;  4NXZ A;  4IQW A;  5TZV A;  3TFR A;  9ICL A;  5CWR A;  4Z6C A;  4QZG A;  4XA5 A;  1BNP A;  2PFP A;  9ICT A;  8ICK A;  1XSP A;  7ICK A;  8ICF A;  4I27 A;  4QZ8 A;  3OGU A;  3C5F A;  9ICQ A;  5D49 A;  8ICP A;  3JPR A;  1TVA A;  7ICR A;  3B0Y A;  4NLN A;  4RPZ A;  4QZE A;  4RQ7 A;  9ICA A;  3PNC A;  2FMS A;  1ZQG A;  2BCQ A;  5HHI A;  3GDX A;  5J2B A;  4R66 A;  1DK3 A;  9ICN A;  4PHE A;  1XSL A;  1ZQF A;  4RQ5 A;  5DBC A;  5J2K A;  3HW8 A;  2ISP A;  3PMN A;  1NZP A;  4YMM A;  3UXP A;  2BPG A;  4KLH A;  4UBC A;  1JMS A;  4RQ6 A;  4LZG A;  4TUR A;  4NLZ A;  5III A;  4UB5 A;  4UB2 A;  3PML A;  9ICI A;  5J2A A;  4NM2 A;  4I2C A;  8ICW A;  3JPP A;  4RT2 A;  1HUO A;  5HHH A;  4YMN A;  4XUS A;  2BCS A;  3RJG A;  4F5O A;  4R63 A;  4KLF A;  4M04 A;  1BPY A;  4LVS A;  3C2L A;  2PFN A;  4QZ9 A;  4Z6D A;  1ZQP A;  4DOB A;  4M2Y A;  4M47 A;  8ICL A;  5J2H A;  4TUP A;  4IQT A;  9ICM A;  4UB1 A;  4KLI A;  9ICB A;  9ICW A;  4PH5 A;  4GXK A;  3LK9 A;  4KLU A;  5DB6 A;  9ICK A;  1ZQN A;  8ICQ A;  4K4I A;  9ICF A;  2GWS A;  4QZF A;  1ZQJ A;  8ICR A;  4QZA A;  3B0X A;  5J0S A;  8ICT A;  5IIN A;  4RQ4 A;  8ICG A;  3MDA A;  2FMQ A;  1ZQR A;  4QZI A;  3ISD A;  4UB3 A;  5BPC A;  4PGQ A;  8ICB A;  5J2I A;  3UXO A;  5J2F A;  4JWN A;  8ICH A;  4I2H A;  3UQ2 A;  3RJF A;  7ICF A;  5J0Q A;  5IIM A;  4KLO A;  2P66 A;  4YMO A;  4RPX A;  8ICY A;  5IIJ A;  9ICE A;  4I2D A;  3C5G A;  4UAZ A;  4X5V A;  5DBA A;  4QZD A;  1ZQC A;  3JPO A;  3RJK A;  4KLM A;  4DO9 A;  5D46 A;  5J2J A;  4GXJ A;  4M9N A;  4DOA A;  7ICM A;  7ICI A;  7ICQ A;  4I29 A;  7ICH A;  1ZQO A;  4K4G A;  4M9L A;  7ICN A;  1RZT A;  3V7J A;  4RQ8 A;  5J2E A;  1BPD A;  4QZH A;  5DB7 A;  4R64 A;  8ICE A;  1ZQI A;  9ICC A;  9ICX A;  4QZC A;  7ICT A;  3RH5 A;  2W9M A;  9ICV A;  3UXN A;  4NM1 A;  3V7K A;  4YCX A;  3RJE A;  1BNO A;  1ZJN A;  4MFC A;  4MF2 A;  4IQU A;  3AUO A;  3RJI A;  4PPX A;  1ZQL A;  4MFF A;  8ICN A;  1HUZ A;  8ICU A;  4R65 A;  4UBB A;  8ICV A;  1ZQB A;  3ISB A;  3C2M A;  2BCR A;  7ICL A;  4P2H A;  4I2B A;  4RQ3 A;  1BPX A;  3C2K A;  5BOM A;  4PGY A;  4DOC A;  4TUS A; 
#chains in the Genus database with same CATH topology
 3NTU A;  3MFI A;  2KFZ A;  3OJU A;  2JZB A;  1T3Q A;  5KAI U;  5J0X A;  2BCV A;  2ASD A;  4M9J A;  5ALQ A;  3PW0 A;  3PSI A;  5EE3 A;  5KL8 B;  1JX4 A;  4K4H A;  3J81 j;  2BGW A;  2EAO A;  3Q8R B;  1BPE A;  4QW9 A;  5KFC A;  2OM6 A;  4KX3 A;  1KDH A;  3FM9 A;  9ICU A;  3H7I A;  1DK2 A;  1VLB A;  4QWD A;  3M9M B;  3PO5 A;  1KN5 A;  4F72 A;  4M9G A;  1SV0 C;  3C1Z A;  2KHQ A;  2KE7 A;  1HJP A;  4I2I A;  5L1L A;  1QCK A;  2A3V A;  3T79 A;  1KFS A;  2WF5 A;  4QWA A;  2JV3 A;  1X42 A;  5ALL A;  2NV3 A;  3WK7 A;  7ICS A;  3RH4 A;  4RNN A;  4DL2 A;  1N5X A;  1ZQH A;  7ICE A;  3BDP A;  4FE3 A;  9ICR A;  5AM2 A;  8ICO A;  2WF6 A;  3KD3 A;  4QZB A;  2KP7 A;  4O5C A;  1T3N A;  3V7L A;  4RQ2 A;  3Q8Q B;  1LKY B;  2NO4 A;  4F5Q A;  4OD0 A;  1ZRN A;  1X6I A;  4DS5 A;  4P0P B;  2VIX A;  2LMR A;  2W03 A;  4R8U B;  3BJY A;  1ZQY A;  2G08 A;  5AI5 A;  1ZQ1 C;  2C2E A;  3NVZ A;  5CA7 A;  2I5H A;  3MDC A;  2EAP A;  2KTQ A;  1J97 A;  4KLT A;  1FEZ A;  1NK8 A;  1V85 A;  5J0O A;  5J2D A;  5DDY A;  5KG5 A;  4RQN A;  4RPY A;  3RRG A;  2H3I A;  4UB8 U;  2W54 A;  3PR4 A;  4KLE A;  2NYV A;  4P4O A;  1U47 A;  3LVV A;  5ALM A;  1K5O A;  1WG8 A;  2PI4 A;  5DB9 A;  1FFV A;  5AIC A;  3CW2 C;  3TAN A;  5DB8 A;  3V6K A;  3MC1 A;  5EWE A;  4HAI A;  4KLL A;  1L3T A;  4E0D A;  3MGI A;  1XNS A;  1BVS A;  1FFU A;  5ALS A;  8ICA A;  5J0W A;  2ZIU A;  3EYZ A;  1SL1 A;  2GO7 A;  2KG5 A;  5DGA A;  4G9B A;  2KK0 A;  3SAG A;  3EWA A;  3K1Z A;  2UVU A;  3QU5 A;  1F5S A;  4NXZ A;  1IXR A;  4ACO A;  2ZXI A;  2ZJ8 A;  5KFY A;  5TZV A;  4P4P A;  4XA5 A;  2PFP A;  3Q8M A;  2D3D A;  3C21 A;  4I27 A;  3PVX A;  5L9X A;  1A77 A;  2KVC A;  2HMX A;  4O3P A;  9ICQ A;  2LPE A;  1QTM A;  7ICR A;  2R8K A;  4NLN A;  4RPZ A;  3LVW A;  4OCZ A;  1T4G A;  2IHN A;  3PNC A;  4FZN A;  2FMS A;  5AI6 A;  3H8W A;  1VJ5 A;  1Q8K A;  3NAS A;  5AKE A;  3T5J A;  3M7D A;  5KG1 A;  4J9O A;  1K1S A;  5AKH A;  2F8K A;  4ZH4 A;  2K89 A;  2IMW P;  2AQ4 A;  4B9L A;  5DBC A;  3CP8 A;  3HIL A;  1ZQZ A;  2CRX A;  2BPG A;  4KLH A;  1TE2 A;  4PZN A;  3AMZ A;  4O0I A;  2BDU A;  1QQ5 A;  3KHH A;  1CEZ A;  3THV A;  2HBJ A;  3H4D A;  4UB5 A;  3GFK B;  1PVQ A;  1GO3 F;  1TK5 A;  4O3S A;  1SV0 A;  3G6V A;  3IDW A;  5KFO A;  1URJ A;  9ICI A;  4B9N A;  2G5H B;  1S0V A;  2H3F A;  1JRO A;  2MA1 A;  5J2A A;  3GU3 A;  3IP4 B;  3JPP A;  4RT2 A;  2HSZ A;  1HUO A;  1XU4 A;  3KHR A;  2B6G A;  1Q3U A;  4DL7 A;  2B0C A;  1ZD5 A;  4F4Z A;  2YX8 A;  4LVS A;  3EW9 A;  2W7P A;  2PFN A;  3PSP A;  3M1Y A;  4EEL A;  4FZM A;  2E3T A;  3IN5 A;  5KAF U;  1ZQU A;  5GTH U;  4QNL A;  2ZIW B;  1D8L A;  4Y2X A;  4KLI A;  4O3M A;  2K8A A;  2GH1 A;  9ICW A;  2K4I A;  3BS5 B;  2F76 X;  4PH5 A;  1J2N A;  4GXK A;  3LK9 A;  3H0R B;  5AKK A;  3N28 A;  2BQ3 A;  2ZJA A;  5DB6 A;  3HP6 A;  2XY6 A;  2YB4 A;  2VAN A;  9ICK A;  8ICQ A;  9ICF A;  2K4E A;  2KD1 A;  4HYK A;  1WWV A;  2AXT U;  4BGD A;  1SKR A;  3WKB A;  5J0S A;  8ICT A;  1B4F A;  2KKP A;  1NZB A;  3UMB A;  3MGV A;  2EH9 A;  3MDA A;  3H0L B;  1XC9 A;  2KNJ A;  4NJ8 A;  4UAU A;  5KFS A;  4ED6 A;  1QQ7 A;  8ICB A;  2F3N A;  1D8Y A;  4JWN A;  3Q8S B;  2LM4 A;  2ZTE A;  2DWQ A;  2CXY A;  4YQW A;  2PKE A;  1KFD A;  1ZQX A;  4KN7 A;  2F44 A;  3HKZ F;  2GOL A;  5E79 U;  3AM9 A;  3HT3 A;  1KRP A;  4QIW F;  4ELU A;  2FPL A;  3ZDB A;  1UCV A;  4UAZ A;  4X5V A;  5DBA A;  3KFU F;  4QZD A;  3HKZ C;  2B21 A;  3LWL A;  1S9F A;  2FI1 A;  1COO A;  1X9M A;  4B6J A;  2EDU A;  4QIW C;  3RR8 A;  1UPH A;  3RJK A;  3NRW A;  4F4X A;  1Z1V A;  5D46 A;  2W9C A;  2XIC A;  3OHA A;  4GXJ A;  2PMZ F;  1D9F A;  4M9N A;  3GIK A;  2XY7 A;  7ICM A;  3UMG A;  2DF4 B;  3SR6 A;  5HP4 A;  2A1J B;  3WKC A;  1NK4 A;  2PMZ C;  1ZD2 P;  4UQG A;  4XRH A;  1DGJ A;  4J9P A;  1ZQO A;  4EEK A;  4K4G A;  4M9L A;  1RZT A;  4YFK A;  3V7J A;  4BXO B;  4C8K A;  8ICE A;  2BPC A;  5EWF A;  2Z7J A;  5ALJ A;  1ZQI A;  9ICC A;  1WUD A;  3L5K A;  2W9M A;  9ICV A;  5J8Y C;  2OEH A;  3MFH A;  3QX7 A;  3SQI A;  2W11 A;  1ZJN A;  3D6J A;  3OJS A;  5CP2 A;  4QWC A;  4MF2 A;  3QEA Z;  4IQU A;  1PK1 A;  2P6U A;  1HUZ A;  1NJZ A;  4UBB A;  3C2M A;  3NVY A;  5KFG A;  3IM1 A;  4DQR A;  1QSL A;  2R8G A;  2XCA A;  7ICL A;  4YP3 A;  4P4M A;  1AQ6 A;  3RBD A;  3GZF A;  2IA6 A;  5G5G A;  4IC9 A;  2LBO A;  4UAR A;  3QU4 A;  5J0R A;  8ICI A;  2W3S A;  3H8S A;  3AU6 A;  2JEI A;  2I9G A;  2NRT A;  4OO1 J;  1ZQE A;  3BQ7 A;  2LM1 A;  4Y2P A;  4CF4 A;  1BPB A;  3NGD A;  5AIA A;  4DFP A;  2KHV A;  1MC8 A;  2NRW A;  5ALR A;  4IRC A;  5G5H A;  2XC9 A;  3TAP A;  3WU2 U;  4NLC A;  1UHU A;  3TFS A;  3SZ2 A;  4DL6 A;  1RQL A;  2MUT A;  2FDR A;  4KLD A;  4NL9 C;  2BQU A;  4DF4 A;  4I28 A;  4J9L A;  1L3U A;  4FS2 A;  2NRZ A;  3RJH A;  4KLG A;  2FLP A;  4MFA A;  4PL1 A;  3PX0 A;  4DSF A;  3IG8 A;  2OHF A;  4B9M A;  1ZXI A;  5C0Y A;  1SKS A;  5KFT A;  3LDA A;  3K1R B;  3KHL A;  5ALE A;  3BQT A;  2ISO A;  5H2F U;  2D6F C;  2KZZ A;  8ICM A;  1Z3E B;  3ISC A;  8ICC A;  3NVW A;  4KN4 A;  2JXJ A;  5KFK A;  2G0A A;  3QZ8 A;  2VA8 A;  8ICX A;  3ICX A;  4U7C A;  2F77 X;  4F5P A;  4DS4 A;  2E8O A;  1QSS A;  4EBC A;  2BR0 A;  1ZQQ A;  5KG7 A;  9ICP A;  4DFJ A;  4Y2U A;  2ZJ5 A;  2RDI A;  5AM3 A;  5AKY A;  2EZZ A;  3KHG A;  4DL3 A;  1HEK A;  1YZ7 A;  4GXI A;  3LWM A;  5J2C A;  2F2A B;  2PFQ A;  5EE0 A;  3JPN A;  3V72 A;  4RNO A;  1X40 A;  2F8L A;  2D8C A;  3SV4 A;  5J0T A;  2FPK A;  1PUZ A;  3UPQ A;  3H8J A;  4Z6F A;  2G06 A;  3SYZ A;  3JPS A;  1N2X A;  4Q43 A;  1C7Y A;  4Z6E A;  3AEV A;  7ICV A;  1BPZ A;  2VJ5 A;  3BS7 A;  2IHM A;  5DKW A;  4FBT A;  1N56 A;  1RYS A;  2DFL A;  3NRZ A;  4I2A A;  2EZY A;  2H3Q A;  8ICJ A;  4BWM A;  5J0Y A;  4NLB A;  3SV3 A;  1JUD A;  3WK8 A;  5ALO A;  5J8Y A;  2WF8 A;  1S0O A;  9ICL A;  5CWR A;  3FDS A;  4RUC A;  4UAS A;  4Z6C A;  4QZG A;  1BNP A;  3DEE A;  1OUQ A;  7ICK A;  4WJ3 B;  4B9V A;  3OGU A;  4PJ0 U;  2XCP A;  3WKD A;  1RDF A;  1Z19 A;  1NK5 A;  3JPR A;  2VA3 A;  3CYM A;  2K8B B;  3T5K A;  4ECV A;  1DRG A;  5F9L A;  5DQG A;  9ICA A;  1TK0 A;  3QNM A;  4F8R A;  3QZ7 A;  2JH7 A;  1PVR A;  1JN3 A;  2DGZ A;  4DQP A;  2V9W A;  3OTQ A;  4ECX A;  3GDX A;  1DK3 A;  4PZO A;  5B5E U;  2G5I B;  4PHE A;  1FO4 A;  1XSL A;  5DLF A;  1U9L A;  2ASJ A;  1ZQF A;  2QAR B;  2LHT A;  2DBY A;  2DPI A;  1NZP A;  2E8M A;  2KSO A;  3L3F X;  4DLE A;  3HJE A;  2LYB A;  4NL9 A;  2QKQ A;  5AK6 A;  4YXM A;  2OCE A;  3C29 A;  3TQ1 A;  4P0Q A;  4NLZ A;  4JUZ A;  5III A;  2K4H A;  4ELV A;  1ZET A;  4DWI A;  2F1J A;  3PML A;  5KFI A;  5KFW A;  1PVP A;  2EAN A;  4I2C A;  1B0X A;  4QWB A;  4B9U A;  3R9K A;  4OJP A;  1SL0 A;  2M9N A;  1N5W A;  1JXE A;  3GV8 B;  2HCF A;  4XUS A;  2BQR A;  1NK6 A;  2R8I A;  4YXJ A;  4KLF A;  2Q0Z X;  1BPY A;  4RQM A;  2QB0 A;  4M2Y A;  3SMV A;  1S0N A;  4M47 A;  1L8O A;  3F2B A;  4DFK A;  4Y2T A;  4IRD A;  5ALN A;  5KG3 A;  1KL9 A;  1X2I A;  5KFV A;  1JIH A;  3S6J A;  3GIM A;  1SXE A;  2KJ8 A;  5KG0 A;  1L7M A;  1ZQN A;  4Q8F A;  2GWS A;  4QZF A;  4YR3 A;  1ZQJ A;  3BQ0 A;  8ICR A;  4QZA A;  2J6T A;  2EQY A;  8ICG A;  2W9A A;  3VC8 A;  5KL1 B;  3WKA A;  3ISD A;  3G6Y A;  4UB3 A;  4IRK A;  4MEX A;  5A0L A;  5J2I A;  5J2F A;  1SB3 C;  8ICH A;  5ALK A;  2KIV A;  1YT3 A;  5IIM A;  4O3N A;  4YMO A;  2AGQ A;  2ZTD A;  2DL0 A;  3WK4 A;  3F2C A;  5B66 U;  9ICE A;  1X66 A;  4I2D A;  3BQ2 A;  3I76 A;  1QQ6 A;  1FIQ A;  2RQ5 A;  2MRL A;  3JPO A;  4CE6 A;  4JMU A;  2W9C B;  5J2J A;  1WCL A;  1L8L A;  4DOA A;  3RB4 A;  3KOO A;  2KKV A;  4ED0 A;  5ALF A;  3ALR A;  2YTU A;  4RZR A;  2NRX A;  3M6K A;  1H38 A;  1Z00 B;  2F1H A;  5AKJ A;  4BJQ A;  1RM6 C;  2E5S A;  1LKY A;  5DB7 A;  4R64 A;  2Y1J A;  2DKX A;  9ICX A;  1V38 A;  2ZUB A;  3RH5 A;  3B9J A;  3V6H A;  3EZ5 A;  1U48 A;  1MA7 A;  3L4P A;  4P0P A;  3EPG A;  5T14 A;  3CNH A;  3LYS A;  4R8U A;  3C28 A;  5ALU A;  1JI7 A;  3RJI A;  3RB6 A;  4MFF A;  5DDM A;  1TKD A;  2ZIV B;  3KBB A;  3QUT A;  1CI4 A;  8ICV A;  3RR7 A;  1U49 A;  2W9B A;  5KFQ A;  2BCR A;  1A76 A;  4OJ6 A;  1M6Y A;  1L3S A;  4J9K A;  2YQE A;  5DQI A;  1UA0 A;  1ZQV A;  5TIS U;  1NK0 A;  3OHB A;  2GLE A;  2ESE A;  2R8J A;  2R18 A;  3M8R A;  5KFU A;  5ALW A;  5L1J A;  4TUS A;  4FFD A;  4RQ1 A;  3F5A A;  1SZP A;  4DFM A;  3AN1 A;  4M9H A;  3PSF A;  3PR5 B;  3JPQ A;  1D8B A;  5AK5 A;  2PFO A;  2CPR A;  5FP0 A;  1WCN A;  4RT3 A;  3VCB A;  3FAH A;  4AYB F;  5KNI A;  1ZQS A;  2P6R A;  1WYG A;  5KFF A;  2W04 A;  4AYB C;  2NO5 A;  2KEY A;  3QEB Z;  1NJW A;  2P35 A;  1J2M A;  5AKZ A;  3UQ0 A;  5J29 A;  4JV0 A;  2C22 A;  1UA1 A;  1KEJ A;  2KVS A;  4I2E A;  1DXS A;  5ALH A;  1TAQ A;  4TUQ A;  4M6W B;  3U26 A;  2YML A;  4O5K A;  5EOZ A;  4RUA A;  2UVW A;  1ZQW A;  4ICA A;  1CUK A;  5K4L A;  3QYP A;  4B9T A;  3AU2 A;  2HVI A;  3HWT A;  2K60 A;  4F5N A;  4ECQ A;  2XY5 A;  1MSW D;  4QWE A;  4UB4 A;  4O5E A;  2ZTC A;  4PHD A;  5EWG A;  3SI8 A;  2DPJ A;  3ZD8 A;  5JTI A;  4PHA A;  5KT5 A;  1XO0 A;  1C20 A;  1V9P A;  5CJ7 A;  2JR5 A;  1U4B A;  3HRD D;  2HHT A;  2F1I A;  3KZI U;  1B22 A;  5AIB A;  2ZIX B;  1NJY A;  1ZQK A;  2H3Z A;  4ED3 A;  2W55 A;  1Y88 A;  4A8E A;  1A0P A;  5D4B A;  1ZQM A;  2K8C B;  5GTI U;  2QB1 A;  1NKC A;  9ICO A;  5AI8 A;  4EEN A;  1WWU A;  3WKE A;  1KQQ A;  7ICP A;  1RPL A;  3RH6 A;  2HOI A;  1KFT A;  4I2J A;  2O6K A;  3ETL A;  3A0B U;  4EYI B;  4KLJ A;  1X9W A;  3MBY A;  4KLQ A;  1TV9 A;  4M0A A;  5ALV A;  3PX6 A;  2PXI A;  2L5Y A;  4MF8 A;  3DDH A;  1JAL A;  4Q44 A;  1LB2 B;  4KLS A;  2KZ3 A;  2JZB B;  2IOF A;  3UM9 A;  3TI0 A;  3RFA A;  4JWM A;  5IIK A;  4F92 B;  4DL5 A;  3RAQ A;  2DUY A;  3MGH A;  7ICO A;  4C7Y A;  1OXJ A;  9ICJ A;  1ZQA A;  4LZD A;  5F9N A;  4KIT B;  4EYH B;  3QXG A;  4CRX A;  2KV2 A;  4NLG A;  2WTF A;  8ICZ A;  2AH5 A;  4BWJ A;  2BPF A;  1VDV A;  1Q46 A;  4KMO B;  5KG6 A;  3JPT A;  2R8H A;  5DBB A;  3BS5 A;  4YD2 A;  4JB3 A;  5KFE A;  3M8S A;  2XGP A;  4EBE A;  1IIP A;  2JH1 A;  3TAR A;  2AJQ A;  1ZQT A;  3MR5 A;  3PY8 A;  2HHW A;  2XID A;  3TFR A;  2LI6 A;  9ICT A;  3QU2 A;  8ICK A;  2KJ9 A;  3AQF A;  4C4R A;  1XSP A;  2Y9U A;  3BQ1 A;  8ICF A;  2KOB A;  4QZ8 A;  1ZD3 A;  3C5F A;  1P7D A;  5D49 A;  4QJF B;  1TVA A;  5EE1 A;  4UAT A;  5ALI A;  3PW4 A;  3B0Y A;  5KT6 A;  5AM4 A;  2KZM A;  2WHE A;  3QU7 A;  4RQ7 A;  4DSK A;  5EE9 A;  3T3F A;  3C1Y A;  4F4K A;  2HBK A;  1ZQG A;  1NOM A;  2DQN B;  4EZ9 A;  3ETR A;  4DSJ A;  1SGG A;  3TAQ A;  3E0F A;  3PV8 A;  5J2B A;  4F2R A;  1CRX A;  1V97 A;  9ICN A;  3GV7 B;  4C4S A;  3QUQ A;  5AKX A;  3F53 A;  2C2D A;  1S0M A;  4CNQ A;  5ALZ A;  4RQ5 A;  2OXO A;  3HW8 A;  3MR3 A;  5AK4 A;  3PMN A;  4PL2 A;  4YMM A;  4RNM A;  1Z4O A;  5KFP A;  4DL4 A;  4UBC A;  1RQN A;  3M9N B;  1ECW A;  1JMS A;  4RQ6 A;  1N48 A;  4LZG A;  3WK6 A;  4DSI A;  4BXO A;  4IR1 A;  4EX7 A;  4BUG A;  3TAD C;  3E58 A;  4UB2 A;  3ZDC A;  4OJ5 A;  3PZP A;  2Y1I A;  4DCC A;  2KJ5 A;  3ZI4 A;  1JRP A;  5KT2 A;  1NK7 A;  4NM2 A;  5DGB A;  3SEN A;  2HBL A;  3G6X A;  1T94 A;  3C23 A;  4YMN A;  5KFB A;  3D2N A;  3DV9 A;  1TK8 A;  3WK5 A;  2AQ0 A;  2QB0 B;  3BZK A;  1Z4N A;  4Z6D A;  1ZQP A;  3D2Q A;  3K4G A;  3TKA A;  2E1F A;  1L7P A;  5AHX A;  5J2H A;  2HHX A;  2H5X A;  4IQT A;  3I1Y A;  1S97 A;  4CF3 A;  2ZIU B;  1IV8 A;  5AKI A;  3EPI A;  1XWL A;  3EUB 2;  4J9R A;  2G09 A;  2YMP A;  2BZF A;  1N63 A;  4RQ4 A;  3RTV A;  5KFD A;  3PW5 A;  1ZQR A;  5KFA A;  2VA2 A;  4QZI A;  3Q8P B;  2IOF K;  1S76 D;  2XO7 A;  4ZOH C;  4DQS A;  1TAU A;  2W7O A;  1NI3 A;  4F2S A;  1B43 A;  4IL6 U;  2JEF A;  4I2H A;  7ICF A;  4KLO A;  2P66 A;  2XI9 A;  5KFJ A;  3N4M B;  5CEH A;  3FC4 A;  4KMU A;  4LJX A;  2Y9T A;  4ED2 A;  8ICY A;  4TQR A;  4J9M A;  3C5G A;  5KFL A;  3ZDE A;  4CF5 A;  4ED1 A;  4YR2 A;  2MSN A;  3RB0 A;  4GIB A;  4C4T A;  4KLM A;  4FZL A;  3N7S C;  2OWO A;  1S77 D;  1QH9 A;  4G3I A;  2HHV A;  2LYH A;  1NKE A;  3MR2 A;  7ICQ A;  4I29 A;  1XS9 D;  3E2E A;  1MN8 A;  4RQ8 A;  3T5L A;  2G07 A;  4QZH A;  5AKG A;  4QZC A;  1ZOL A;  7ICT A;  3V7K A;  3GV5 B;  4YCX A;  1QSY A;  1U45 A;  1BNO A;  2CN1 A;  5AI4 A;  3ZD9 A;  4MFC A;  3Q8K A;  3AUO A;  1ZQL A;  5L1K A;  8ICU A;  5ALP A;  4R65 A;  4F71 A;  3N7R C;  2W9B B;  3PX4 A;  1KKX A;  2ASL A;  1N62 A;  4YR0 A;  3HPO A;  2MU2 A;  4XQ8 A;  4I2B A;  4JV1 A;  1NK9 A;  2JMG A;  4AP9 A;  5BOM A;  4PGY A;  4UW9 A;  2HDO A;  2WFA A;  2ALZ A;  3KZX A;  3V6J A;  5KFM A;  1RXV A;  4O3O A;  3RF9 A;  2ES6 A;  4FO6 A;  2FMP A;  5ALX A;  2PI5 A;  2JRZ A;  5KFX A;  1UQV A;  4C80 A;  9ICG A;  5DQH A;  1NJX A;  3PW2 A;  3SAF A;  9ICH A;  2ODG A;  2YMM A;  3QU9 A;  4UAY A;  4EEY A;  1MQ3 A;  4O9M A;  5AKL A;  2OYY A;  3ED5 A;  2IBK A;  1L5U A;  2JEJ A;  3TAD A;  1PZN A;  3ONN A;  1A6S A;  4ECW A;  5HML A;  4JV2 A;  5C5J A;  9ICS A;  5JU5 A;  2HW3 A;  3IHQ B;  5IIO A;  2WB1 F;  2E8N A;  2UVR A;  2VJ4 A;  4JK1 A;  1XO1 A;  4IS7 A;  1ZQD A;  5ALD A;  7ICG A;  2WB1 C;  4US8 A;  2BHN A;  1ZJM A;  5IIL A;  3PO4 A;  2AGP A;  3RJJ A;  4UAW A;  1BGX T;  1SV4 A;  1YZ6 A;  5KFZ A;  4PHP A;  3QE9 Y;  3ZDA A;  1ZD4 A;  2FLN A;  4I2G A;  2HHS A;  2KIW A;  7ICJ A;  5BOL A;  4DQI A;  1ZYQ A;  4C7Z A;  4DF8 A;  1LV5 A;  3H40 A;  1NNL A;  1TFR A;  2AU0 A;  5J0U A;  5KTQ A;  4YD1 A;  5J2G A;  2DKZ A;  4PGX A;  3CRX A;  4YN4 A;  1KSP A;  4IR9 A;  3GQC A;  1RYU A;  3SEI A;  4NV0 A;  4QW8 A;  4MEY A;  2QAR A;  4GC7 A;  2JHD A;  1S8O A;  4F93 B;  8ICS A;  2E8P A;  1PK1 B;  4YG2 A;  5KT4 A;  3D2S A;  1F0M A;  3T5H A;  1KBU A;  2AHO B;  1RYR A;  4OJO A;  4F5R A;  4BDP A;  1JXL A;  4ECZ A;  4I2F A;  2AGO A;  2KMD A;  3RAX A;  2BCU A;  4U6P A;  2ZG6 A;  2W8K A;  3NUQ A;  4O3Q A;  5DG9 A;  1Z1B A;  3H0M B;  2RHF A;  4NWI A;  2I6X A;  4NLK A;  4BX9 C;  2YY6 A;  1T7P A;  2E1E A;  2HVH A;  1IM4 A;  5J0P A;  4Y2Q A;  4DQQ A;  5CB1 A;  4CDG A;  3KTQ A;  5HR6 A;  1MQ2 A;  3KKA C;  1L7N A;  2W43 A;  4IQV A;  7ICU A;  1X9X A;  3HX0 A;  5ALY A;  4Y2J A;  3PW7 A;  1XSN A;  2MUT B;  3UMC A;  5DG7 A;  4NY8 A;  4RQ0 A;  5AM5 A;  1LVH A;  3ORY A;  2J6U A;  5DG8 A;  4C8L A;  4UAV A;  5KFN A;  3IRU A;  4FBU A;  4FS1 A;  4IQW A;  1SKW A;  3NVV A;  2BDP A;  3GII A;  3OSP A;  1PK3 A;  2I1Q A;  4ELT A;  2HBM A;  1DGS A;  4J9N A;  3K75 D;  3RBE A;  2HOQ A;  5HMM A;  1EXN A;  4US9 A;  1OW5 A;  2ZXH A;  4F91 B;  8ICP A;  5AM1 A;  3IV6 A;  2FLL A;  1O08 A;  2JEG A;  4ECY A;  2C28 A;  2BKE A;  4QZE A;  5KT7 A;  2W3R A;  3A0H U;  3AL0 B;  1KLN A;  1K1Q A;  3RB3 A;  2QLT A;  3BZC A;  2BCQ A;  3SAH A;  5HHI A;  2LYA A;  4DEZ A;  5CR0 A;  1F44 A;  5F3X B;  4R66 A;  2WF7 A;  4J03 A;  4DLG A;  3OPX A;  2Y0S F;  1NKB A;  2KN7 A;  5AK3 A;  4Y2Y A;  2EAM A;  4UB6 U;  5J2K A;  4C8M A;  2ISP A;  2Y0S C;  3UXP A;  2N1R A;  5L1M A;  5AM0 A;  1SWV A;  2KIC A;  3QUC A;  1KW4 A;  2M0N A;  5HNK A;  4TUR A;  2FJ6 A;  4EBD A;  1Z00 A;  1S10 A;  5CRX A;  1X9S A;  3RRH A;  2LKY A;  2A19 A;  2EZX A;  2XVT A;  4C8N A;  2XGQ A;  5AI0 A;  3N97 B;  1ED1 A;  2VKQ A;  8ICW A;  1O03 A;  5HHH A;  3I28 A;  3M6Z A;  2IOH A;  2NRV A;  2BCS A;  4GC6 A;  3RJG A;  4F5O A;  2UVV A;  4DSE A;  4R63 A;  2ZIV A;  2C2R A;  4M04 A;  5L1I A;  3C2L A;  4QZ9 A;  3MR6 A;  5KG4 A;  4DOB A;  4ECU A;  8ICL A;  1DOQ A;  4TUP A;  4ECS A;  9ICM A;  1L3V A;  4UB1 A;  1Q3V A;  2RDJ A;  2W8L A;  3H8M A;  2WF9 A;  2ZIW A;  9ICB A;  1KTQ A;  4OJL A;  4ED8 A;  4KLU A;  4DFD A;  2RP5 A;  4J9Q A;  4ECT A;  4ED7 A;  4K4I A;  4O3R A;  5KFR A;  2RLT A;  2HHQ A;  2MAX A;  3FYH A;  3B0X A;  2JGA A;  1ARO P;  4F4Y A;  4TQS A;  5JRT A;  5IIN A;  3PST A;  2FMQ A;  3IG5 A;  1HIW A;  5DLG A;  5BPC A;  1IG6 A;  5KFH A;  3GIL A;  3AQE A;  4C8O A;  4PGQ A;  5KT3 A;  3UXO A;  4Y2R A;  3UQ2 A;  3RJF A;  5J0Q A;  2RRD A;  3M9O B;  4GLX A;  4KX5 A;  2V4R A;  4YVZ A;  3Q8L A;  4RPX A;  3TAC B;  1SL2 A;  5IIJ A;  2FPM A;  3NS1 A;  4B9S A;  2V4Q A;  4USA A;  3F5E A;  3SD7 A;  2ATL A;  3F2D A;  2H3V A;  1ZQC A;  3WK9 A;  4M6W A;  1SXD A;  4ECR A;  1RG6 A;  4DO9 A;  1COK A;  4Q45 A;  1T8E A;  4RU9 A;  3KKA A;  1UT8 A;  2J6S A;  2YN4 A;  4Y2S A;  3OSN A;  5ALG A;  1TAM A;  4Y2V A;  2YMQ A;  1D9D A;  7ICI A;  2KSO B;  2K4P A;  5CHG A;  3N7P D;  4F50 A;  2A1J A;  7ICH A;  5AI9 A;  2FE9 A;  2Q4T A;  7ICN A;  4P0Q B;  5KG2 A;  2OH2 A;  5J2E A;  4J9S A;  1BPD A;  4EX6 A;  1N60 A;  2KFN A;  3H4B A;  3MAB A;  1RXW A;  3UXN A;  4NM1 A;  4CCH A;  1UT5 A;  2WAQ F;  4MHV A;  4F4W A;  2ZIX A;  4C0Z A;  3RJE A;  1S5L U;  5JUM A;  4DSL A;  4CGZ A;  2WAQ C;  1SWW A;  4PPX A;  1L7O A;  8ICN A;  2ZUC A;  1QLN A;  1L6N A;  2HOF A;  3O0F A;  1N61 A;  3ISB A;  5ALT A;  1ZQB A;  3ZDD A;  2HI0 A;  4F3O A;  2YB1 A;  4P2H A;  4RQ3 A;  1ZRM A;  1X6J A;  1BPX A;  3C2K A;  2ZUD A;  1SZH A;  2HHU A;  4KTQ A;  4GFJ A;  1SIJ A;  2A1A A;  4EZ6 A;  4DOC A;  5HR7 A;  3QUB A;  3GIJ A;  4Q8E A; 
#chains in the Genus database with same CATH homology
 8ICI A;  4RQ1 A;  3AU6 A;  2I9G A;  5J0X A;  4FO6 A;  1ZQE A;  2FMP A;  4M9H A;  2BCV A;  3JPQ A;  4M9J A;  2PFO A;  5J0R A;  4RT3 A;  9ICG A;  4K4H A;  3TFS A;  1BPE A;  1ZQS A;  9ICH A;  4UAY A;  4O9M A;  1MQ3 A;  4KLD A;  1KDH A;  4I28 A;  9ICU A;  1DK2 A;  9ICS A;  3RJH A;  4KLG A;  4MFA A;  3UQ0 A;  5IIO A;  5J29 A;  4M9G A;  4I2I A;  1KEJ A;  1ZQD A;  7ICG A;  4I2E A;  4TUQ A;  4O5K A;  5EOZ A;  7ICS A;  3RH4 A;  2ISO A;  1ZJM A;  5IIL A;  3RJJ A;  1ZQH A;  4UAW A;  3AU2 A;  7ICE A;  4PHP A;  3HWT A;  8ICM A;  4I2G A;  9ICR A;  4F5N A;  3ISC A;  8ICC A;  7ICJ A;  5BOL A;  8ICO A;  4UB4 A;  4O5E A;  4PHD A;  8ICX A;  4QZB A;  5J0U A;  2KP7 A;  4YD1 A;  4O5C A;  3V7L A;  5J2G A;  4F5P A;  4PHA A;  4RQ2 A;  1ZQQ A;  4PGX A;  4YN4 A;  4F5Q A;  9ICP A;  1ZQK A;  5D4B A;  1ZQM A;  9ICO A;  8ICS A;  4GXI A;  5J2C A;  3MDC A;  2PFQ A;  3JPN A;  3V72 A;  4F5R A;  4I2F A;  4KLT A;  7ICP A;  2BCU A;  3RH6 A;  5J0O A;  5J2D A;  4I2J A;  5DDY A;  4RPY A;  4KLJ A;  5J0T A;  3MBY A;  4KLE A;  3UPQ A;  4KLQ A;  4Z6F A;  1TV9 A;  4M0A A;  3JPS A;  4NLK A;  2PXI A;  4Z6E A;  7ICV A;  4MF8 A;  5DB9 A;  4KLS A;  5J0P A;  5CB1 A;  1BPZ A;  4JWM A;  5IIK A;  2IHM A;  5DKW A;  1MQ2 A;  5DB8 A;  3MGH A;  7ICO A;  4IQV A;  7ICU A;  9ICJ A;  1ZQA A;  4LZD A;  4KLL A;  3HX0 A;  3MGI A;  8ICZ A;  1XSN A;  2BPF A;  4I2A A;  4NY8 A;  4RQ0 A;  8ICA A;  5J0W A;  8ICJ A;  3JPT A;  5DBB A;  4YD2 A;  5J0Y A;  1ZQT A;  4NXZ A;  4IQW A;  5TZV A;  3TFR A;  9ICL A;  5CWR A;  4Z6C A;  4QZG A;  4XA5 A;  1BNP A;  2PFP A;  9ICT A;  8ICK A;  1XSP A;  7ICK A;  8ICF A;  4I27 A;  4QZ8 A;  3OGU A;  3C5F A;  9ICQ A;  5D49 A;  8ICP A;  3JPR A;  1TVA A;  7ICR A;  3B0Y A;  4NLN A;  4RPZ A;  4QZE A;  4RQ7 A;  9ICA A;  3PNC A;  2FMS A;  1ZQG A;  2BCQ A;  5HHI A;  3GDX A;  5J2B A;  4R66 A;  1DK3 A;  9ICN A;  4PHE A;  1XSL A;  1ZQF A;  4RQ5 A;  5DBC A;  5J2K A;  3HW8 A;  2ISP A;  3PMN A;  1NZP A;  4YMM A;  3UXP A;  2BPG A;  4KLH A;  4UBC A;  1JMS A;  4RQ6 A;  4LZG A;  4TUR A;  4NLZ A;  5III A;  4UB5 A;  4UB2 A;  3PML A;  9ICI A;  5J2A A;  4NM2 A;  4I2C A;  8ICW A;  3JPP A;  4RT2 A;  1HUO A;  5HHH A;  4YMN A;  4XUS A;  2BCS A;  3RJG A;  4F5O A;  4R63 A;  4KLF A;  4M04 A;  1BPY A;  4LVS A;  3C2L A;  2PFN A;  4QZ9 A;  4Z6D A;  1ZQP A;  4DOB A;  4M2Y A;  4M47 A;  8ICL A;  5J2H A;  4TUP A;  4IQT A;  9ICM A;  4UB1 A;  4KLI A;  9ICB A;  9ICW A;  4PH5 A;  4GXK A;  3LK9 A;  4KLU A;  5DB6 A;  9ICK A;  1ZQN A;  8ICQ A;  4K4I A;  9ICF A;  2GWS A;  4QZF A;  1ZQJ A;  8ICR A;  4QZA A;  3B0X A;  5J0S A;  8ICT A;  5IIN A;  4RQ4 A;  8ICG A;  3MDA A;  2FMQ A;  1ZQR A;  4QZI A;  3ISD A;  4UB3 A;  5BPC A;  4PGQ A;  8ICB A;  5J2I A;  3UXO A;  5J2F A;  4JWN A;  8ICH A;  4I2H A;  3UQ2 A;  3RJF A;  7ICF A;  5J0Q A;  5IIM A;  4KLO A;  2P66 A;  4YMO A;  4RPX A;  8ICY A;  5IIJ A;  9ICE A;  4I2D A;  3C5G A;  4UAZ A;  4X5V A;  5DBA A;  4QZD A;  1ZQC A;  3JPO A;  3RJK A;  4KLM A;  4DO9 A;  5D46 A;  5J2J A;  4GXJ A;  4M9N A;  4DOA A;  7ICM A;  7ICI A;  7ICQ A;  4I29 A;  7ICH A;  1ZQO A;  4K4G A;  4M9L A;  7ICN A;  1RZT A;  3V7J A;  4RQ8 A;  5J2E A;  1BPD A;  4QZH A;  5DB7 A;  4R64 A;  8ICE A;  1ZQI A;  9ICC A;  9ICX A;  4QZC A;  7ICT A;  3RH5 A;  2W9M A;  9ICV A;  3UXN A;  4NM1 A;  3V7K A;  4YCX A;  3RJE A;  1BNO A;  1ZJN A;  4MFC A;  4MF2 A;  4IQU A;  3AUO A;  3RJI A;  4PPX A;  1ZQL A;  4MFF A;  8ICN A;  1HUZ A;  8ICU A;  4R65 A;  4UBB A;  8ICV A;  1ZQB A;  3ISB A;  3C2M A;  2BCR A;  7ICL A;  4P2H A;  4I2B A;  4RQ3 A;  1BPX A;  3C2K A;  5BOM A;  4PGY A;  4DOC A;  4TUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...