1DK2A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 19
structure length 86
sequence length 86
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk2A00
4Z6DA 4KLSA 4K4GA 5HHIA 9ICVA 5CB1A 7ICNA 1ZQFA 5IIIA 4MF8A 4M9LA 4I28A 4UB1A 9ICCA 4PHDA 7ICKA 1BNPA 1ZQNA 5J2BA 3LK9A 5D46A 4Z6CA 1ZQKA 4Z6FA 5DB7A 3JPNA 1ZQAA 2FMPA 4KLDA 1ZQRA 4YN4A 8ICZA 3RH5A 4UB5A 4Z6EA 4KLOA 8ICTA 4UAZA 2BCVA 7ICHA 7ICOA 4RPZA 3PMNA 4F5QA 8ICPA 1TVAA 5DBBA 4RPYA 3UXPA 4IQUA 4RQ7A 1HUZA 2BCQA 9ICNA 9ICLA 4NLKA 4DOAA 1XSPA 3ISCA 4NXZA 8ICOA 2PFQA 3UXNA 1DK2A 5BPCA 5J0SA 3RJFA 4M9NA 4R66A 3UQ2A 4IQTA 9ICOA 4KLMA 4QZGA 4KLTA 4GXKA 8ICQA 1TV9A 1ZQOA 4KLLA 3C2MA 2PXIA 4UB2A 4KLQA 5D4BA 4F5OA 5J2FA 4K4IA 4I2GA 2BCRA 4KLFA 4IQVA 3MDCA 1ZJMA 4O5EA 4R63A 1ZQEA 4I2DA 7ICJA 1ZQQA 5IIJA 4UB4A 1ZQCA 4I2EA 4I2IA 2PFNA 9ICUA 1BNOA 3MGIA 4M9JA 5EOZA 4I2FA 5DDYA 4TUQA 4X5VA 9ICBA 4NLNA 4YMNA 5J0OA 1HUOA 5J0UA 1XSLA 4JWNA 3UQ0A 4QZCA 4YMOA 5DB8A 3AUOA 3JPTA 3PMLA 3JPOA 1ZQBA 8ICCA 4M0AA 4QZHA 5J2CA 4QZIA 4R64A 5HHHA 7ICGA 4DOBA 2PFPA 5J0TA 5J2IA 8ICBA 2ISOA 4YMMA 9ICHA 4YD2A 4LZGA 1XSNA 8ICVA 7ICPA 7ICQA 9ICSA 9ICFA 4YCXA 3RJJA 4YD1A 3HX0A 3B0XA 4M2YA 5J0PA 4P2HA 5IILA 3UXOA 4PHEA 4RT2A 4NM2A 5TZVA 3C2LA 5IIMA 1BPXA 5J2HA 4RQ3A 4GXJA 1RZTA 4QZDA 3HW8A 5D49A 4UBBA 4JWMA 9ICMA 7ICTA 4I2AA 3OGUA 4RQ4A 4F5NA 4F5RA 5J2EA 2W9MA 3AU6A 4PHAA 2PFOA 4K4HA 9ICGA 8ICAA 4M47A 4PH5A 8ICJA 5BOMA 1DK3A 4KLGA 4QZFA 4PPXA 8ICHA 4FO6A 3RJEA 4F5PA 4LVSA 1ZJNA 5J0WA 8ICMA 4QZAA 2BPGA 4R65A 1BPEA 2FMQA 4NM1A 2BPFA 3MDAA 3RH4A 4I27A 3B0YA 1BPDA 2I9GA 9ICPA 8ICNA 8ICRA 4PGYA 3V72A 1BPYA 7ICUA 5CWRA 4RQ5A 2ISPA 4RQ2A 8ICYA 8ICFA 5DB9A 8ICWA 4PGXA 7ICSA 4IQWA 5DBCA 4PHPA 1ZQTA 3JPQA 3RJIA 2BCSA 4RQ1A 4UAYA 4DOCA 4TUPA 5DBAA 8ICSA 9ICXA 5IIOA 1BPZA 4LZDA 5IIKA 7ICEA 4RQ8A 4KLEA 5J2JA 9ICTA 4M04A 1JMSA 5DKWA 3C5FA 4O9MA 1ZQGA 4DO9A 7ICFA 4KLIA 9ICQA 3V7KA 4I2CA 1KEJA 3C5GA 4I2BA 4QZ9A 4PGQA 1MQ2A 4M9GA 4TUSA 1ZQSA 4MFCA 1ZQLA 3MBYA 4I29A 7ICMA 5BOLA 3ISBA 4UAWA 5J0RA 8ICKA 9ICKA 9ICRA 1NZPA 8ICGA 4NLZA 4RPXA 7ICLA 2P66A 5J2DA 5J2GA 4KLJA 7ICIA 8ICLA 9ICIA 4M9HA 4O5KA 7ICVA 3PNCA 4TURA 1MQ3A 3V7LA 1ZQDA 4KLHA 5J0QA 5J0XA 3C2KA 3RJGA 1ZQPA 8ICXA 2GWSA 9ICWA 5J2KA 1KDHA 5DB6A 3JPPA 4O5CA 4XUSA 3RJHA 4RQ6A 9ICEA 9ICJA 3RH6A 9ICAA 5J0YA 3ISDA 4QZEA 4NY8A 4I2JA 3HWTA 3JPSA 1ZQJA 7ICRA 4KLUA 5J2AA 3RJKA 4GXIA 3V7JA 3GDXA 4MFAA 5J29A 1ZQMA 4QZBA 1ZQIA 4RQ0A 3TFRA 3TFSA 2KP7A 3AU2A 5IINA 4MFFA 4RT3A 3MGHA 8ICEA 3JPRA 3UPQA 4MF2A 4I2HA 2BCUA 4XA5A 8ICIA 4UB3A 2FMSA 1ZQHA 8ICUA 4UBCA 4QZ8A 2IHMA
chains in the Genus database with same CATH superfamily
5JTIA 4Q44A 1FFVA 4K4GA 2F44A 4MHVA 1WCNA 1NJXA 3KOOA 2DF4B 5CB1A 2G07A 5KFEA 5CA7A 7ICNA 4YG2A 2VKQA 3ZDAA 3GV5B 5IIIA 4MF8A 4ECUA 2ESEA 2C2RA 4UB1A 2RRDA 2FPLA 2E8PA 3GV8B 3SAHA 7ICKA 4EYHB 3FYHA 3MFHA 1V38A 1ZQNA 5D46A 4OJ5A 4DS4A 3JPNA 4J9LA 2XIDA 3WK4A 1RXVA 5ALOA 1N62A 3N7RC 3RH5A 5KFCA 4EZ9A 5DDMA 5C5JA 5J8YC 3RAXA 3HJEA 8ICTA 2JR5A 5AM0A 4DS5A 3V6JA 2QLTA 5ALLA 4UAZA 1XS9D 3IRUA 1JIHA 1UA0A 3IG5A 4B9SA 2ZG6A 5AK5A 3ICXA 5DBBA 5DQGA 2K4PA 1U4BA 3PO4A 3H8WA 4IQUA 2FLPA 2W9CB 2CXYA 2ZIXB 4NLKA 2I5HA 4RQNA 2Y0SF 2ASJA 4QW9A 4QWBA 3ISCA 4ZOHC 2FE9A 3DV9A 3QUTA 4IS7A 3QUQA 2AGQA 5BPCA 1QQ7A 2JRZA 3F2DA 3UQ2A 4IQTA 4KLTA 3TARA 4GXKA 8ICQA 4UASA 3SEIA 5KAFU 2E3TA 1ZQOA 5KFXA 3MR5A 3C2MA 2W8LA 1T4GA 4ED3A 1UT8A 4ACOA 5J2FA 1PK1B 2KIWA 1S97A 2KG5A 3BDPA 3PSPA 2LM1A 4R63A 5AI9A 1ZRNA 1Q8KA 4UB4A 3H8JA 1NK4A 9ICUA 1ZQ1C 1BNOA 5ALUA 2HHSA 3MGIA 5EOZA 2ZIWB 1SV0A 2L5YA 2R8HA 9ICBA 3PSTA 4CNQA 3VC8A 1HUOA 4FS2A 4CF5A 4JWNA 1ZQYA 3WKDA 2WTFA 4PL1A 5CHGA 2MRLA 4KN7A 2JH7A 3PMLA 3ETRA 2IHNA 3H4BA 3C1YA 5AI4A 1PK3A 5AIAA 5KFWA 4R64A 1CEZA 5HHHA 1LKYB 2W03A 1Z1BA 3U26A 4DOBA 4DQRA 1L3TA 1LB2B 2W3SA 2D3DA 2H3ZA 3B9JA 4YMMA 3EWAA 4F50A 3TACB 1T8EA 3RJJA 4BUGA 4YXMA 4F71A 3EZ5A 4NV0A 2JEJA 5KFQA 4RT2A 4J9MA 5ALDA 4DFMA 2H5XA 3Q8LA 3QEAZ 4O3NA 4F8RA 1S76D 5EWFA 1X2IA 2G09A 3BQ2A 1OW5A 1RZTA 3V6HA 3BQTA 2O6KA 4UBBA 1RYRA 4JWMA 9ICMA 1Z4OA 3KHHA 3UM9A 3PW5A 4DQPA 1SL0A 1COOA 4BDPA 5CR0A 5KFIA 1T3QA 3KTQA 5DQHA 2PFOA 4K4HA 2FI1A 1CRXA 3M8SA 2KJ9A 3NASA 5L1LA 2NRZA 5ALRA 1DK3A 1QCKA 3IV6A 3QYPA 4USAA 4LVSA 2WB1C 2KNJA 2ZUCA 1WWUA 4OJLA 4UAVA 1ZJNA 8ICMA 4QZAA 1J97A 3PZPA 4AP9A 3RFAA 4BXOB 4DFDA 3Q8RB 4ED2A 4EBDA 3RH4A 3L4PA 2I9GA 8ICRA 3SENA 3GIMA 2VJ4A 2JEIA 3V72A 2UVUA 1BPYA 3KBBA 3BQ7A 4UW9A 1UCVA 4ECVA 8ICWA 2A19A 4PGXA 5ALVA 2MUTB 4ECYA 1J2MA 1ZOLA 4PHPA 1ZQTA 3JPQA 3RRHA 2KZZA 2UVVA 4PJ0U 5KFFA 4EX7A 3Q8SB 4DOCA 1ZD4A 4UAYA 2WHEA 1KN5A 1KL9A 5KFBA 2EZXA 4C8OA 8ICSA 9ICXA 4YR2A 1WWVA 4R8UB 3H0MB 2G06A 4RQ8A 1ZRMA 5J2JA 9ICTA 2WF9A 2AXTU 4O9MA 3QU2A 4J9OA 1RM6C 2LBOA 3PX0A 9ICQA 1TAQA 1F5SA 4DF4A 1CUKA 2ODGA 2XC9A 1SZHA 2Y0SC 4I2BA 4QZ9A 1MQ2A 3F5AA 3WK7A 1B4FA 5KFAA 2KHVA 5J0RA 4TQSA 9ICKA 3AQFA 4BX9C 1ED1A 3KKAC 9ICRA 4EEKA 1S0MA 2ZIVB 2G5HB 2AU0A 1Y88A 3V6KA 5KAIU 4RPXA 3F53A 2P66A 3A0BU 1KFTA 2HOQA 1XWLA 4O5KA 7ICVA 2E8NA 4RUCA 4P0PB 4IRKA 2NO4A 1QSLA 1MSWD 2E8MA 2ZIUB 4DL6A 4KLHA 1U47A 5J0QA 2ZJ8A 3Q8MA 2ZUDA 4CF4A 5J0XA 1X9XA 1XNSA 8ICXA 3TADA 3Q8QB 1V9PA 9ICWA 3N7SC 5DB6A 2LMRA 1SIJA 3H0RB 1Z1VA 2JMGA 5HP4A 3SR6A 1U9LA 2F77X 2WFAA 4JV1A 5AIBA 2JH1A 9ICAA 5J0YA 1ZD2P 1PUZA 1N56A 3KD3A 1Z4NA 4DSKA 3M9NB 3AM9A 4DSIA 1JALA 1ZQJA 1NK8A 2A1JA 4UB6U 5J2AA 4GXIA 4JV0A 3V7JA 3FAHA 2WF7A 4MFAA 5J29A 4IL6U 5AK6A 2RHFA 2KP7A 3MGHA 8ICEA 1HJPA 4KX3A 1HIWA 3RF9A 4I2HA 4DL2A 2WF6A 1DOQA 4ED1A 1DGSA 3SD7A 8ICIA 4UB3A 1ZQHA 8ICUA 2W9BA 1MA7A 2NRVA 3G6YA 4Z6DA 1FIQA 5G5GA 4DWIA 2Z7JA 5HHIA 1TK8A 4P4OA 1QLNA 3M7DA 9ICVA 5DQIA 1ZQFA 4O3QA 2XY7A 4ELUA 2MAXA 2HHVA 9ICCA 2UVRA 4YP3A 4JUZA 4ED0A 5J2BA 4Z6CA 1N5XA 1ZQKA 1K1QA 4Z6FA 5KFYA 5DB7A 1ZQAA 2FMPA 3NVYA 3IN5A 5KFNA 5AK4A 4YN4A 3T5JA 1U45A 2KHQA 1L3UA 4UB5A 2VA2A 5AKHA 4Z6EA 4KLOA 1PVQA 3DEEA 4DQSA 4FZMA 4CGZA 4Y2RA 1ZD5A 4ECWA 3ZDEA 4A8EA 5KL1B 4DFPA 1MC8A 1TVAA 3RR8A 2FPKA 3ZI4A 3NRWA 4FBUA 4RNMA 1KQQA 5DGAA 1HUZA 1KRPA 2KZ3A 2I1QA 3L5KA 2R8JA 9ICNA 1XSPA 2RDJA 2WF5A 3PSIA 3BQ0A 1QSSA 3ED5A 3UXNA 1K1SA 5AM4A 2IOFA 5KFUA 3EW9A 5F9LA 1X40A 3UMCA 5ALNA 9ICOA 4KLMA 2PI5A 3RBDA 4C8LA 1N60A 2KN7A 2DQNB 3IG8A 1S0VA 5KG6A 2Y9TA 2MU2A 2ES6A 4M6WA 1SKSA 5CP2A 2M9NA 3O0FA 4K4IA 5AKXA 2BGWA 3MDCA 4EEYA 5AKJA 1JN3A 2XVTA 4EX6A 4I2DA 1ZQQA 1B0XA 2A1AA 3KHGA 3MR6A 3T5KA 4PL2A 4I2FA 3RB0A 4NLNA 1ZETA 3ORYA 1SL1A 4QZCA 3PO5A 2KKPA 4J9PA 2V4QA 4ZH4A 2KE7A 5A0LA 3CRXA 5KT7A 3AUOA 2OM6A 3CYMA 1ZQBA 8ICCA 4BWJA 4M0AA 2XCAA 2OHFA 1NKCA 3C29A 2BQ3A 5J2CA 2IMWP 4QZIA 2HCFA 2QB1A 2AJQA 2F1JA 4Y2UA 3PW2A 3T3FA 1B22A 5KFZA 2PFPA 2ZTEA 3LVVA 1B43A 2ISOA 1PVPA 4QWAA 4Y2PA 7ICPA 3C21A 4QJFB 4F91B 2KEYA 5ALIA 4YCXA 3NUQA 3I28A 4C4RA 4RU9A 1L7PA 2MSNA 1MN8A 4B6JA 4O3SA 4O0IA 5AK3A 1NKEA 4PHEA 3ZDCA 1RPLA 2AGOA 2H3VA 2EH9A 2XO7A 4EZ6A 1ZXIA 3FDSA 1D9FA 2AGPA 1BPXA 5ALZA 4RQ3A 2LYBA 4QZDA 2AQ0A 4FZLA 5K4LA 2XGQA 5D49A 2J6TA 5CEHA 1L8LA 3PX4A 4I2AA 4RQ4A 4CDGA 4UATA 4ED8A 3PY8A 4ELVA 3AU6A 4F72A 3GV7B 2Q4TA 4GC7A 4P0QA 4DSJA 2F1HA 9ICGA 4DSEA 4TQRA 8ICAA 1M6YA 4NL9A 3RRGA 8ICJA 1RXWA 4KLGA 4QZFA 5EE3A 4PPXA 3RJEA 3TAPA 2YMPA 2JHDA 3H8MA 3TKAA 4PZOA 2KIVA 2JEGA 4UB8U 4R65A 1BPEA 3T5LA 3CNHA 3HKZF 5KT3A 4NM1A 2W9AA 5AKZA 3K1ZA 1XO1A 4I27A 1BPDA 4AYBF 8ICNA 1UT5A 3WK8A 4PGYA 1JUDA 4NJ8A 1TKDA 3QEBZ 4B9UA 3WKEA 4C8MA 2J6SA 5CWRA 5ALSA 4RQ2A 1L7OA 2OCEA 8ICFA 4QNLA 2DFLA 4MEXA 3KZIU 3GIIA 5KFJA 5CRXA 1O08A 2EZYA 4ECQA 5ALXA 5ALWA 4LJXA 1KTQA 2KJ8A 3H0LB 5AKKA 2BCSA 2GH1A 4RQ1A 4DCCA 4C7ZA 2DGZA 2B6GA 3GZFA 1BPZA 1TE2A 5AI5A 1ECWA 1ZQZA 3WK9A 1JMSA 1O03A 1X9WA 3NVZA 4QWEA 1ZQGA 3NVWA 3AQEA 4DO9A 3RB4A 7ICFA 5KFHA 1Z00A 3IP4B 1X9SA 3V7KA 2VA3A 2ALZA 3K4GA 4I2CA 5ALKA 2DL0A 3UMBA 5DLGA 3CW2C 1Z19A 1SWVA 1COKA 4FE3A 4YQWA 1L7MA 4PGQA 1C20A 3THVA 5BOLA 1XC9A 3ISBA 3BS5A 8ICKA 2KVSA 2NRTA 3M6ZA 1NZPA 8ICGA 3CP8A 5KT4A 2WAQF 1EXNA 4KN4A 5JU5A 2PMZC 2A1JB 1IV8A 5J2GA 3T79A 9ICIA 2W55A 4QIWF 2QKQA 3QXGA 3TADC 3V7LA 1ZQDA 1RYUA 3MC1A 2HSZA 1YZ6A 2W9BB 2BDUA 5J2KA 1NJZA 4J9QA 4C8KA 2QARA 3LYSA 2ZXHA 3RJHA 4RQ6A 5E79U 4IRCA 2HHXA 9ICEA 3RH6A 2K60A 2YMLA 2ZJ5A 3M9OB 3KZXA 2K8CB 4EELA 1S77D 4U6PA 5L1IA 5KFMA 7ICRA 5HR6A 3PX6A 3TAQA 3RJKA 3UMGA 2XCPA 2E5SA 3GDXA 2C2DA 1ZQIA 2EQYA 3TFRA 2LHTA 1X42A 2W9CA 4MFFA 2FLLA 2CRXA 3HP6A 1VDVA 3UPQA 4C80A 3OSPA 3ETLA 2KK0A 1SL2A 4U7CA 1U48A 1KLNA 1C7YA 5ALTA 5L1KA 2W54A 5AI6A 1S8OA 1NOMA 2IHMA 2KICA 1WCLA 5KFKA 5EWGA 3SAGA 4US9A 1RQLA 1VJ5A 1KW4A 1X6IA 4DF8A 4M9LA 2G08A 2H3FA 4PHDA 1F0MA 1L5UA 4OO1J 2HHQA 4FZNA 1BGXT 4YR0A 4EBEA 2OXOA 4F4KA 1WG8A 2HBMA 2EAOA 1XO0A 3C23A 4KLDA 1ZQRA 2YQEA 4F92B 3OTQA 4FS1A 1NJYA 4M6WB 2HMXA 2QB0A 1KBUA 3H40A 2BCVA 3ZDBA 4XQ8A 4Q45A 7ICHA 2DWQA 5KT5A 4F2SA 4RPZA 7ICOA 5JUMA 3PMNA 1QH9A 8ICPA 2YMQA 1V97A 1DRGA 3UXPA 4RPYA 4YFKA 3QZ8A 1KSPA 2BCQA 2KFZA 3OHAA 4FBTA 2XI9A 1RYSA 3OJSA 3HKZC 3RB3A 2BR0A 1KFSA 3PR4A 1AQ6A 3TI0A 1NK7A 5KFGA 4DL5A 3H4DA 1ZD3A 2KSOB 2B21A 5J0SA 2OH2A 4JV2A 4UQGA 3F2CA 2C22A 4R66A 4QZGA 1SKWA 5KFTA 2F1IA 3H7IA 1WUDA 3L3FX 3NRZA 2HBLA 1TV9A 1P7DA 4KLLA 1NK6A 4ED6A 4MEYA 1AROP 4KLQA 3K75D 3FM9A 2I6XA 2C28A 1H38A 2LPEA 1SGGA 3WKBA 1TK5A 2BCRA 4I2GA 4KLFA 1D8BA 4IQVA 2W7PA 1IM4A 1ZJMA 2YB4A 2G0AA 2JV3A 5KNIA 4KMOB 2KOBA 1ZQEA 7ICJA 3GIKA 3SAFA 2ZTCA 4DFKA 4I2EA 2HOIA 4I2IA 4RQMA 4J9KA 1IG6A 1YT3A 2P6RA 3SV4A 1UHUA 4NLBA 2R8IA 4UAUA 5EE0A 2NO5A 2R8GA 4YMNA 5J0OA 2VJ5A 1UA1A 2D6FC 1Q3UA 4PZNA 4YMOA 3N7PD 5KFVA 5EE1A 4F2RA 1JXLA 5DB8A 3JPTA 5AI0A 2KD1A 3JPOA 3BS7A 2HBJA 1NK0A 5EWEA 1JROA 2WAQC 2JZBA 4F3OA 3H8SA 1NKBA 7ICGA 2GLEA 3LVWA 3RR7A 4QIWC 1NK9A 8ICBA 4P0QB 9ICHA 3VCBA 2YX8A 4P4MA 4LZGA 5F9NA 9ICFA 1TAMA 2EZZA 3DDHA 1JXEA 3M6KA 3RB6A 4YD1A 3HX0A 1NJWA 1FFUA 3Q8PB 5KG2A 5KG3A 5IILA 1Z3EB 3UXOA 5ALEA 4NM2A 5AM2A 3NTUA 5TZVA 5AKIA 3C2LA 3EPGA 3M8RA 5IIMA 4DL7A 5KFDA 5FP0A 1RQNA 5J2HA 3C28A 4DQQA 4GXJA 4OJ6A 3QU5A 1XU4A 2BKEA 4Y2XA 4F4XA 4Y2SA 3OGUA 5J2EA 2D8CA 1ZQUA 5KFSA 3RBEA 2YB1A 4M47A 3MR3A 2EAMA 5BOMA 1S5LU 2KZMA 3D2QA 1QSYA 3NVVA 3E0FA 8ICHA 4FO6A 5L1MA 4IC9A 4C8NA 2BZFA 3QUCA 5J0WA 4DSLA 1Z00B 1SV0C 2BPGA 2FMQA 2JXJA 1DXSA 3D6JA 2XY5A 2BPFA 3MDAA 2IBKA 2V4RA 4OCZA 3D2SA 9ICPA 4G9BA 3BS5B 2AHOB 4P0PA 4RQ5A 2KV2A 2IOHA 4Q8FA 7ICSA 3QZ7A 1NI3A 3MFIA 2ZXIA 5ALYA 2W8KA 5DBCA 3KHLA 2HBKA 1SWWA 2EDUA 2WB1F 4TUPA 1WYGA 5ALGA 5KG5A 4LZDA 2KTQA 5IIKA 4RNNA 2BQRA 4KLEA 4M04A 1VLBA 4J9RA 2F3NA 3MABA 4Y2JA 4BGDA 2HI0A 4Q43A 1UQVA 4DL3A 1KEJA 3C5GA 3SI8A 2QARB 2ZUBA 2ASLA 3HRDD 4JMUA 4GC6A 1SB3C 2Q0ZX 5HMLA 2IA6A 4F4ZA 4MFCA 1K5OA 3R9KA 1A6SA 4RUAA 4UAWA 1JRPA 2GOLA 4BJQA 4DLGA 4NLZA 4KLJA 7ICIA 3M9MB 8ICLA 1OXJA 2B0CA 3WK6A 4F4WA 1BVSA 3AL0B 3PNCA 3D2NA 1X66A 2VIXA 3QE9Y 1MQ3A 5DG8A 2YTUA 3GFKB 4DL4A 5KTQA 3C2KA 3RTVA 2W7OA 1N63A 5EE9A 1N61A 1S0OA 2HOFA 3RJGA 2E8OA 4ED7A 3ONNA 4OJPA 2W43A 4F93B 2GWSA 2BDPA 1FO4A 3IHQB 3JPPA 3F2BA 4O5CA 3NS1A 5KG4A 4C0ZA 5JRTA 1JX4A 4JB3A 4O3OA 3LWLA 3N28A 1S0NA 2Y1JA 1L7NA 4O3PA 3ISDA 4CE6A 2JEFA 4E0DA 4I2JA 3T5HA 2N1RA 1CI4A 3FC4A 3QX7A 2HVHA 4YR3A 4NWIA 5KG0A 2RP5A 4KLUA 5AKGA 2C2EA 2CN1A 4IR9A 2DUYA 2CPRA 5ALPA 3A0HU 4QZBA 5KG1A 2F2AB 1UPHA 4RQ0A 3TFSA 3AU2A 3ZD9A 2FDRA 4Q8EA 2W3RA 2NV3A 4RT3A 3S6JA 1N5WA 3JPRA 2FLNA 4MF2A 2QB0B 4YVZA 2A3VA 4GFJA 4OJOA 2AH5A 2IOFK 4QW8A 2BCUA 2FMSA 4UBCA 4B9LA 1X6JA 3PR5B 4KLSA 5TISU 1GO3F 1PZNA 2UVWA 2OYYA 4HAIA 3PSFA 3EYZA 2OEHA 2DPIA 3MGVA 2JGAA 4I28A 2DBYA 5AKYA 4EENA 5KL8B 5GTIU 2XY6A 3GIJA 2YMMA 3ZD8A 1F44A 2ZJAA 1BNPA 3C1ZA 2VANA 3LK9A 1TAUA 2FPMA 4EBCA 5KG7A 1HEKA 4B9VA 3BZKA 8ICZA 1N48A 4Y2TA 1ZQVA 4HYKA 5KT2A 3I76A 4Y2YA 4F5QA 5J8YA 3KHRA 3LDAA 2F76X 1TFRA 4EYIB 3QUBA 2LKYA 4RQ7A 5C0YA 9ICLA 1U49A 4DOAA 4NXZA 3OJUA 2BQUA 8ICOA 4YXJA 4ECRA 2PFQA 3I1YA 1JI7A 1DK2A 3RJFA 4M9NA 2HDOA 4ICAA 5KFOA 1S10A 2HW3A 4RNOA 5AKLA 5G5HA 2PXIA 2JZBB 4UB2A 1L3SA 5D4BA 4F5OA 4IR1A 2KJ5A 4KTQA 2K4HA 2E1EA 3QNMA 3SQIA 1SV4A 2P6UA 2WF8A 4CCHA 3KFUF 4O5EA 3GQCA 3WK5A 5IIJA 1ZQCA 3QU4A 2PFNA 3LWMA 2EAPA 5AHXA 5DG7A 2ZIXA 4CRXA 4M9JA 3WKAA 5DDYA 4TUQA 4KMUA 4X5VA 2ASDA 4O3MA 4QWDA 1KFDA 4BWMA 4IRDA 3K1RB 4UARA 4ECTA 4Y2VA 2K8BB 5J0UA 2H3IA 1XSLA 1QTMA 1ZQWA 1KKXA 2XGPA 3UQ0A 2BPCA 3HPOA 5DLFA 4O3RA 4DEZA 2K8AA 2NYVA 1LVHA 4NLCA 2W04A 4ELTA 1DGJA 4QZHA 3QU9A 1PVRA 2YY6A 1QQ6A 5AICA 2M0NA 1PK1A 2K4EA 5J0TA 3OPXA 5J2IA 2KMDA 4YD2A 4WJ3B 2R8KA 1XSNA 8ICVA 4ECZA 7ICQA 3PW4A 2ZTDA 9ICSA 5HR7A 5T14A 2YN4A 1D8LA 2ZIWA 5ALMA 3E2EA 1SXEA 4OD0A 3B0XA 4M2YA 2VA8A 2HHWA 5J0PA 4P2HA 5L1JA 1URJA 5B66U 3G6XA 2HVIA 2LYAA 5AM1A 3SV3A 2MA1A 4NLGA 2Y9UA 1D9DA 1D8YA 3NGDA 2RLTA 2LM4A 1Q46A 3BJYA 3AEVA 3OSNA 2ATLA 1ZYQA 3HW8A 7ICTA 1LKYA 4AYBC 1QQ5A 4F5RA 4F5NA 1L3VA 2KVCA 5GTHU 5ALQA 4ECSA 2W9MA 1SZPA 2Y1IA 3EUB2 4PHAA 1SXDA 3GILA 2KFNA 1J2NA 4PH5A 5HNKA 1BPBA 4CF3A 5DGBA 2RQ5A 1IIPA 3QU7A 3E58A 1LV5A 1A76A 4F5PA 5ALFA 2FJ6A 2RDIA 3ZDDA 4GLXA 2H3QA 2DKXA 1YZ7A 2K4IA 3PW7A 3AMZA 2HHUA 2LYHA 2XICA 5AI8A 1RDFA 3B0YA 2V9WA 3BZCA 3RAQA 5KFRA 1NK5A 5KFLA 3SYZA 2HHTA 7ICUA 1T94A 2ISPA 8ICYA 5DB9A 3IDWA 2DPJA 4IQWA 2G5IB 4KITB 1A77A 4FFDA 3SZ2A 5H2FU 3RJIA 1OUQA 4F4YA 4C7YA 5DBAA 3TANA 3M1YA 5IIOA 3ALRA 3PVXA 7ICEA 5DKWA 3C5FA 3BQ1A 4B9MA 2OWOA 2F8LA 2R18A 4KLIA 4ECXA 3TQ1A 3J81j 3G6VA 1X9MA 4BXOA 4C4SA 2EANA 1TK0A 4J9NA 4M9GA 4TUSA 1ZQSA 7ICMA 1ZQLA 3MBYA 4I29A 4Y2QA 5CJ7A 1A0PA 2E1FA 2PI4A 3N4MB 2LI6A 4C4TA 4JK1A 5B5EU 5KT6A 2MUTA 5ALJA 5F3XB 7ICLA 3KKAA 5J2DA 1L6NA 1V85A 2KKVA 4M9HA 5L9XA 3HILA 4DQIA 3N97B 1NZBA 4TURA 4R8UA 1T7PA 2W11A 2P35A 4NL9C 1FEZA 1NNLA 4US8A 1ZQPA 2J6UA 2BHNA 5KFPA 2GO7A 2AQ4A 4XRHA 1KDHA 4XUSA 4B9TA 1L8OA 3HT3A 9ICJA 4B9NA 3IM1A 3PV8A 4P4PA 4GIBA 5AM5A 2K89A 2PKEA 3WU2U 4QZEA 4NY8A 4J9SA 2PMZF 3MR2A 5AM3A 4G3IA 4QWCA 1SKRA 5AKEA 3PW0A 3HWTA 2ZIVA 3JPSA 4KX5A 3GU3A 4J03A 3AN1A 4DSFA 3F5EA 1ZQXA 1Q3VA 1IXRA 4RZRA 4DLEA 4DFJA 1ZQMA 2F8KA 1RG6A 5ALHA 2ZIUA 5DG9A 5IINA 5HMMA 2NRXA 2NRWA 3Q8KA 1S9FA 3SMVA 2DKZA 1T3NA 4XA5A 3WKCA 2KSOA 3EPIA 1N2XA 3OHBA 4QZ8A
chains in the Genus database with same CATH topology
4Z6DA 4KLSA 4K4GA 5HHIA 9ICVA 5CB1A 7ICNA 1ZQFA 5IIIA 4MF8A 4M9LA 4I28A 4UB1A 9ICCA 4PHDA 7ICKA 1BNPA 1ZQNA 5J2BA 3LK9A 5D46A 4Z6CA 1ZQKA 4Z6FA 5DB7A 3JPNA 1ZQAA 2FMPA 4KLDA 1ZQRA 4YN4A 8ICZA 3RH5A 4UB5A 4Z6EA 4KLOA 8ICTA 4UAZA 2BCVA 7ICHA 7ICOA 4RPZA 3PMNA 4F5QA 8ICPA 1TVAA 5DBBA 4RPYA 3UXPA 4IQUA 4RQ7A 1HUZA 2BCQA 9ICNA 9ICLA 4NLKA 4DOAA 1XSPA 3ISCA 4NXZA 8ICOA 2PFQA 3UXNA 1DK2A 5BPCA 5J0SA 3RJFA 4M9NA 4R66A 3UQ2A 4IQTA 9ICOA 4KLMA 4QZGA 4KLTA 4GXKA 8ICQA 1TV9A 1ZQOA 4KLLA 3C2MA 2PXIA 4UB2A 4KLQA 5D4BA 4F5OA 5J2FA 4K4IA 4I2GA 2BCRA 4KLFA 4IQVA 3MDCA 1ZJMA 4O5EA 4R63A 1ZQEA 4I2DA 7ICJA 1ZQQA 5IIJA 4UB4A 1ZQCA 4I2EA 4I2IA 2PFNA 9ICUA 1BNOA 3MGIA 4M9JA 5EOZA 4I2FA 5DDYA 4TUQA 4X5VA 9ICBA 4NLNA 4YMNA 5J0OA 1HUOA 5J0UA 1XSLA 4JWNA 3UQ0A 4QZCA 4YMOA 5DB8A 3AUOA 3JPTA 3PMLA 3JPOA 1ZQBA 8ICCA 4M0AA 4QZHA 5J2CA 4QZIA 4R64A 5HHHA 7ICGA 4DOBA 2PFPA 5J0TA 5J2IA 8ICBA 2ISOA 4YMMA 9ICHA 4YD2A 4LZGA 1XSNA 8ICVA 7ICPA 7ICQA 9ICSA 9ICFA 4YCXA 3RJJA 4YD1A 3HX0A 3B0XA 4M2YA 5J0PA 4P2HA 5IILA 3UXOA 4PHEA 4RT2A 4NM2A 5TZVA 3C2LA 5IIMA 1BPXA 5J2HA 4RQ3A 4GXJA 1RZTA 4QZDA 3HW8A 5D49A 4UBBA 4JWMA 9ICMA 7ICTA 4I2AA 3OGUA 4RQ4A 4F5NA 4F5RA 5J2EA 2W9MA 3AU6A 4PHAA 2PFOA 4K4HA 9ICGA 8ICAA 4M47A 4PH5A 8ICJA 5BOMA 1DK3A 4KLGA 4QZFA 4PPXA 8ICHA 4FO6A 3RJEA 4F5PA 4LVSA 1ZJNA 5J0WA 8ICMA 4QZAA 2BPGA 4R65A 1BPEA 2FMQA 4NM1A 2BPFA 3MDAA 3RH4A 4I27A 3B0YA 1BPDA 2I9GA 9ICPA 8ICNA 8ICRA 4PGYA 3V72A 1BPYA 7ICUA 5CWRA 4RQ5A 2ISPA 4RQ2A 8ICYA 8ICFA 5DB9A 8ICWA 4PGXA 7ICSA 4IQWA 5DBCA 4PHPA 1ZQTA 3JPQA 3RJIA 2BCSA 4RQ1A 4UAYA 4DOCA 4TUPA 5DBAA 8ICSA 9ICXA 5IIOA 1BPZA 4LZDA 5IIKA 7ICEA 4RQ8A 4KLEA 5J2JA 9ICTA 4M04A 1JMSA 5DKWA 3C5FA 4O9MA 1ZQGA 4DO9A 7ICFA 4KLIA 9ICQA 3V7KA 4I2CA 1KEJA 3C5GA 4I2BA 4QZ9A 4PGQA 1MQ2A 4M9GA 4TUSA 1ZQSA 4MFCA 1ZQLA 3MBYA 4I29A 7ICMA 5BOLA 3ISBA 4UAWA 5J0RA 8ICKA 9ICKA 9ICRA 1NZPA 8ICGA 4NLZA 4RPXA 7ICLA 2P66A 5J2DA 5J2GA 4KLJA 7ICIA 8ICLA 9ICIA 4M9HA 4O5KA 7ICVA 3PNCA 4TURA 1MQ3A 3V7LA 1ZQDA 4KLHA 5J0QA 5J0XA 3C2KA 3RJGA 1ZQPA 8ICXA 2GWSA 9ICWA 5J2KA 1KDHA 5DB6A 3JPPA 4O5CA 4XUSA 3RJHA 4RQ6A 9ICEA 9ICJA 3RH6A 9ICAA 5J0YA 3ISDA 4QZEA 4NY8A 4I2JA 3HWTA 3JPSA 1ZQJA 7ICRA 4KLUA 5J2AA 3RJKA 4GXIA 3V7JA 3GDXA 4MFAA 5J29A 1ZQMA 4QZBA 1ZQIA 4RQ0A 3TFRA 3TFSA 2KP7A 3AU2A 5IINA 4MFFA 4RT3A 3MGHA 8ICEA 3JPRA 3UPQA 4MF2A 4I2HA 2BCUA 4XA5A 8ICIA 4UB3A 2FMSA 1ZQHA 8ICUA 4UBCA 4QZ8A 2IHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6D A;  4KLS A;  4K4G A;  5HHI A;  9ICV A;  5CB1 A;  7ICN A;  1ZQF A;  5III A;  4MF8 A;  4M9L A;  4I28 A;  4UB1 A;  9ICC A;  4PHD A;  7ICK A;  1BNP A;  1ZQN A;  5J2B A;  3LK9 A;  5D46 A;  4Z6C A;  1ZQK A;  4Z6F A;  5DB7 A;  3JPN A;  1ZQA A;  2FMP A;  4KLD A;  1ZQR A;  4YN4 A;  8ICZ A;  3RH5 A;  4UB5 A;  4Z6E A;  4KLO A;  8ICT A;  4UAZ A;  2BCV A;  7ICH A;  7ICO A;  4RPZ A;  3PMN A;  4F5Q A;  8ICP A;  1TVA A;  5DBB A;  4RPY A;  3UXP A;  4IQU A;  4RQ7 A;  1HUZ A;  2BCQ A;  9ICN A;  9ICL A;  4NLK A;  4DOA A;  1XSP A;  3ISC A;  4NXZ A;  8ICO A;  2PFQ A;  3UXN A;  1DK2 A;  5BPC A;  5J0S A;  3RJF A;  4M9N A;  4R66 A;  3UQ2 A;  4IQT A;  9ICO A;  4KLM A;  4QZG A;  4KLT A;  4GXK A;  8ICQ A;  1TV9 A;  1ZQO A;  4KLL A;  3C2M A;  2PXI A;  4UB2 A;  4KLQ A;  5D4B A;  4F5O A;  5J2F A;  4K4I A;  4I2G A;  2BCR A;  4KLF A;  4IQV A;  3MDC A;  1ZJM A;  4O5E A;  4R63 A;  1ZQE A;  4I2D A;  7ICJ A;  1ZQQ A;  5IIJ A;  4UB4 A;  1ZQC A;  4I2E A;  4I2I A;  2PFN A;  9ICU A;  1BNO A;  3MGI A;  4M9J A;  5EOZ A;  4I2F A;  5DDY A;  4TUQ A;  4X5V A;  9ICB A;  4NLN A;  4YMN A;  5J0O A;  1HUO A;  5J0U A;  1XSL A;  4JWN A;  3UQ0 A;  4QZC A;  4YMO A;  5DB8 A;  3AUO A;  3JPT A;  3PML A;  3JPO A;  1ZQB A;  8ICC A;  4M0A A;  4QZH A;  5J2C A;  4QZI A;  4R64 A;  5HHH A;  7ICG A;  4DOB A;  2PFP A;  5J0T A;  5J2I A;  8ICB A;  2ISO A;  4YMM A;  9ICH A;  4YD2 A;  4LZG A;  1XSN A;  8ICV A;  7ICP A;  7ICQ A;  9ICS A;  9ICF A;  4YCX A;  3RJJ A;  4YD1 A;  3HX0 A;  3B0X A;  4M2Y A;  5J0P A;  4P2H A;  5IIL A;  3UXO A;  4PHE A;  4RT2 A;  4NM2 A;  5TZV A;  3C2L A;  5IIM A;  1BPX A;  5J2H A;  4RQ3 A;  4GXJ A;  1RZT A;  4QZD A;  3HW8 A;  5D49 A;  4UBB A;  4JWM A;  9ICM A;  7ICT A;  4I2A A;  3OGU A;  4RQ4 A;  4F5N A;  4F5R A;  5J2E A;  2W9M A;  3AU6 A;  4PHA A;  2PFO A;  4K4H A;  9ICG A;  8ICA A;  4M47 A;  4PH5 A;  8ICJ A;  5BOM A;  1DK3 A;  4KLG A;  4QZF A;  4PPX A;  8ICH A;  4FO6 A;  3RJE A;  4F5P A;  4LVS A;  1ZJN A;  5J0W A;  8ICM A;  4QZA A;  2BPG A;  4R65 A;  1BPE A;  2FMQ A;  4NM1 A;  2BPF A;  3MDA A;  3RH4 A;  4I27 A;  3B0Y A;  1BPD A;  2I9G A;  9ICP A;  8ICN A;  8ICR A;  4PGY A;  3V72 A;  1BPY A;  7ICU A;  5CWR A;  4RQ5 A;  2ISP A;  4RQ2 A;  8ICY A;  8ICF A;  5DB9 A;  8ICW A;  4PGX A;  7ICS A;  4IQW A;  5DBC A;  4PHP A;  1ZQT A;  3JPQ A;  3RJI A;  2BCS A;  4RQ1 A;  4UAY A;  4DOC A;  4TUP A;  5DBA A;  8ICS A;  9ICX A;  5IIO A;  1BPZ A;  4LZD A;  5IIK A;  7ICE A;  4RQ8 A;  4KLE A;  5J2J A;  9ICT A;  4M04 A;  1JMS A;  5DKW A;  3C5F A;  4O9M A;  1ZQG A;  4DO9 A;  7ICF A;  4KLI A;  9ICQ A;  3V7K A;  4I2C A;  1KEJ A;  3C5G A;  4I2B A;  4QZ9 A;  4PGQ A;  1MQ2 A;  4M9G A;  4TUS A;  1ZQS A;  4MFC A;  1ZQL A;  3MBY A;  4I29 A;  7ICM A;  5BOL A;  3ISB A;  4UAW A;  5J0R A;  8ICK A;  9ICK A;  9ICR A;  1NZP A;  8ICG A;  4NLZ A;  4RPX A;  7ICL A;  2P66 A;  5J2D A;  5J2G A;  4KLJ A;  7ICI A;  8ICL A;  9ICI A;  4M9H A;  4O5K A;  7ICV A;  3PNC A;  4TUR A;  1MQ3 A;  3V7L A;  1ZQD A;  4KLH A;  5J0Q A;  5J0X A;  3C2K A;  3RJG A;  1ZQP A;  8ICX A;  2GWS A;  9ICW A;  5J2K A;  1KDH A;  5DB6 A;  3JPP A;  4O5C A;  4XUS A;  3RJH A;  4RQ6 A;  9ICE A;  9ICJ A;  3RH6 A;  9ICA A;  5J0Y A;  3ISD A;  4QZE A;  4NY8 A;  4I2J A;  3HWT A;  3JPS A;  1ZQJ A;  7ICR A;  4KLU A;  5J2A A;  3RJK A;  4GXI A;  3V7J A;  3GDX A;  4MFA A;  5J29 A;  1ZQM A;  4QZB A;  1ZQI A;  4RQ0 A;  3TFR A;  3TFS A;  2KP7 A;  3AU2 A;  5IIN A;  4MFF A;  4RT3 A;  3MGH A;  8ICE A;  3JPR A;  3UPQ A;  4MF2 A;  4I2H A;  2BCU A;  4XA5 A;  8ICI A;  4UB3 A;  2FMS A;  1ZQH A;  8ICU A;  4UBC A;  4QZ8 A;  2IHM A; 
#chains in the Genus database with same CATH topology
 5JTI A;  4Q44 A;  1FFV A;  4K4G A;  2F44 A;  4MHV A;  1WCN A;  1NJX A;  3KOO A;  2DF4 B;  5CB1 A;  2G07 A;  5KFE A;  5CA7 A;  7ICN A;  4YG2 A;  2VKQ A;  3ZDA A;  3GV5 B;  5III A;  4MF8 A;  4ECU A;  2ESE A;  2C2R A;  4UB1 A;  2RRD A;  2FPL A;  2E8P A;  3GV8 B;  3SAH A;  7ICK A;  4EYH B;  3FYH A;  3MFH A;  1V38 A;  1ZQN A;  5D46 A;  4OJ5 A;  4DS4 A;  3JPN A;  4J9L A;  2XID A;  3WK4 A;  1RXV A;  5ALO A;  1N62 A;  3N7R C;  3RH5 A;  5KFC A;  4EZ9 A;  5DDM A;  5C5J A;  5J8Y C;  3RAX A;  3HJE A;  8ICT A;  2JR5 A;  5AM0 A;  4DS5 A;  3V6J A;  2QLT A;  5ALL A;  4UAZ A;  1XS9 D;  3IRU A;  1JIH A;  1UA0 A;  3IG5 A;  4B9S A;  2ZG6 A;  5AK5 A;  3ICX A;  5DBB A;  5DQG A;  2K4P A;  1U4B A;  3PO4 A;  3H8W A;  4IQU A;  2FLP A;  2W9C B;  2CXY A;  2ZIX B;  4NLK A;  2I5H A;  4RQN A;  2Y0S F;  2ASJ A;  4QW9 A;  4QWB A;  3ISC A;  4ZOH C;  2FE9 A;  3DV9 A;  3QUT A;  4IS7 A;  3QUQ A;  2AGQ A;  5BPC A;  1QQ7 A;  2JRZ A;  3F2D A;  3UQ2 A;  4IQT A;  4KLT A;  3TAR A;  4GXK A;  8ICQ A;  4UAS A;  3SEI A;  5KAF U;  2E3T A;  1ZQO A;  5KFX A;  3MR5 A;  3C2M A;  2W8L A;  1T4G A;  4ED3 A;  1UT8 A;  4ACO A;  5J2F A;  1PK1 B;  2KIW A;  1S97 A;  2KG5 A;  3BDP A;  3PSP A;  2LM1 A;  4R63 A;  5AI9 A;  1ZRN A;  1Q8K A;  4UB4 A;  3H8J A;  1NK4 A;  9ICU A;  1ZQ1 C;  1BNO A;  5ALU A;  2HHS A;  3MGI A;  5EOZ A;  2ZIW B;  1SV0 A;  2L5Y A;  2R8H A;  9ICB A;  3PST A;  4CNQ A;  3VC8 A;  1HUO A;  4FS2 A;  4CF5 A;  4JWN A;  1ZQY A;  3WKD A;  2WTF A;  4PL1 A;  5CHG A;  2MRL A;  4KN7 A;  2JH7 A;  3PML A;  3ETR A;  2IHN A;  3H4B A;  3C1Y A;  5AI4 A;  1PK3 A;  5AIA A;  5KFW A;  4R64 A;  1CEZ A;  5HHH A;  1LKY B;  2W03 A;  1Z1B A;  3U26 A;  4DOB A;  4DQR A;  1L3T A;  1LB2 B;  2W3S A;  2D3D A;  2H3Z A;  3B9J A;  4YMM A;  3EWA A;  4F50 A;  3TAC B;  1T8E A;  3RJJ A;  4BUG A;  4YXM A;  4F71 A;  3EZ5 A;  4NV0 A;  2JEJ A;  5KFQ A;  4RT2 A;  4J9M A;  5ALD A;  4DFM A;  2H5X A;  3Q8L A;  3QEA Z;  4O3N A;  4F8R A;  1S76 D;  5EWF A;  1X2I A;  2G09 A;  3BQ2 A;  1OW5 A;  1RZT A;  3V6H A;  3BQT A;  2O6K A;  4UBB A;  1RYR A;  4JWM A;  9ICM A;  1Z4O A;  3KHH A;  3UM9 A;  3PW5 A;  4DQP A;  1SL0 A;  1COO A;  4BDP A;  5CR0 A;  5KFI A;  1T3Q A;  3KTQ A;  5DQH A;  2PFO A;  4K4H A;  2FI1 A;  1CRX A;  3M8S A;  2KJ9 A;  3NAS A;  5L1L A;  2NRZ A;  5ALR A;  1DK3 A;  1QCK A;  3IV6 A;  3QYP A;  4USA A;  4LVS A;  2WB1 C;  2KNJ A;  2ZUC A;  1WWU A;  4OJL A;  4UAV A;  1ZJN A;  8ICM A;  4QZA A;  1J97 A;  3PZP A;  4AP9 A;  3RFA A;  4BXO B;  4DFD A;  3Q8R B;  4ED2 A;  4EBD A;  3RH4 A;  3L4P A;  2I9G A;  8ICR A;  3SEN A;  3GIM A;  2VJ4 A;  2JEI A;  3V72 A;  2UVU A;  1BPY A;  3KBB A;  3BQ7 A;  4UW9 A;  1UCV A;  4ECV A;  8ICW A;  2A19 A;  4PGX A;  5ALV A;  2MUT B;  4ECY A;  1J2M A;  1ZOL A;  4PHP A;  1ZQT A;  3JPQ A;  3RRH A;  2KZZ A;  2UVV A;  4PJ0 U;  5KFF A;  4EX7 A;  3Q8S B;  4DOC A;  1ZD4 A;  4UAY A;  2WHE A;  1KN5 A;  1KL9 A;  5KFB A;  2EZX A;  4C8O A;  8ICS A;  9ICX A;  4YR2 A;  1WWV A;  4R8U B;  3H0M B;  2G06 A;  4RQ8 A;  1ZRM A;  5J2J A;  9ICT A;  2WF9 A;  2AXT U;  4O9M A;  3QU2 A;  4J9O A;  1RM6 C;  2LBO A;  3PX0 A;  9ICQ A;  1TAQ A;  1F5S A;  4DF4 A;  1CUK A;  2ODG A;  2XC9 A;  1SZH A;  2Y0S C;  4I2B A;  4QZ9 A;  1MQ2 A;  3F5A A;  3WK7 A;  1B4F A;  5KFA A;  2KHV A;  5J0R A;  4TQS A;  9ICK A;  3AQF A;  4BX9 C;  1ED1 A;  3KKA C;  9ICR A;  4EEK A;  1S0M A;  2ZIV B;  2G5H B;  2AU0 A;  1Y88 A;  3V6K A;  5KAI U;  4RPX A;  3F53 A;  2P66 A;  3A0B U;  1KFT A;  2HOQ A;  1XWL A;  4O5K A;  7ICV A;  2E8N A;  4RUC A;  4P0P B;  4IRK A;  2NO4 A;  1QSL A;  1MSW D;  2E8M A;  2ZIU B;  4DL6 A;  4KLH A;  1U47 A;  5J0Q A;  2ZJ8 A;  3Q8M A;  2ZUD A;  4CF4 A;  5J0X A;  1X9X A;  1XNS A;  8ICX A;  3TAD A;  3Q8Q B;  1V9P A;  9ICW A;  3N7S C;  5DB6 A;  2LMR A;  1SIJ A;  3H0R B;  1Z1V A;  2JMG A;  5HP4 A;  3SR6 A;  1U9L A;  2F77 X;  2WFA A;  4JV1 A;  5AIB A;  2JH1 A;  9ICA A;  5J0Y A;  1ZD2 P;  1PUZ A;  1N56 A;  3KD3 A;  1Z4N A;  4DSK A;  3M9N B;  3AM9 A;  4DSI A;  1JAL A;  1ZQJ A;  1NK8 A;  2A1J A;  4UB6 U;  5J2A A;  4GXI A;  4JV0 A;  3V7J A;  3FAH A;  2WF7 A;  4MFA A;  5J29 A;  4IL6 U;  5AK6 A;  2RHF A;  2KP7 A;  3MGH A;  8ICE A;  1HJP A;  4KX3 A;  1HIW A;  3RF9 A;  4I2H A;  4DL2 A;  2WF6 A;  1DOQ A;  4ED1 A;  1DGS A;  3SD7 A;  8ICI A;  4UB3 A;  1ZQH A;  8ICU A;  2W9B A;  1MA7 A;  2NRV A;  3G6Y A;  4Z6D A;  1FIQ A;  5G5G A;  4DWI A;  2Z7J A;  5HHI A;  1TK8 A;  4P4O A;  1QLN A;  3M7D A;  9ICV A;  5DQI A;  1ZQF A;  4O3Q A;  2XY7 A;  4ELU A;  2MAX A;  2HHV A;  9ICC A;  2UVR A;  4YP3 A;  4JUZ A;  4ED0 A;  5J2B A;  4Z6C A;  1N5X A;  1ZQK A;  1K1Q A;  4Z6F A;  5KFY A;  5DB7 A;  1ZQA A;  2FMP A;  3NVY A;  3IN5 A;  5KFN A;  5AK4 A;  4YN4 A;  3T5J A;  1U45 A;  2KHQ A;  1L3U A;  4UB5 A;  2VA2 A;  5AKH A;  4Z6E A;  4KLO A;  1PVQ A;  3DEE A;  4DQS A;  4FZM A;  4CGZ A;  4Y2R A;  1ZD5 A;  4ECW A;  3ZDE A;  4A8E A;  5KL1 B;  4DFP A;  1MC8 A;  1TVA A;  3RR8 A;  2FPK A;  3ZI4 A;  3NRW A;  4FBU A;  4RNM A;  1KQQ A;  5DGA A;  1HUZ A;  1KRP A;  2KZ3 A;  2I1Q A;  3L5K A;  2R8J A;  9ICN A;  1XSP A;  2RDJ A;  2WF5 A;  3PSI A;  3BQ0 A;  1QSS A;  3ED5 A;  3UXN A;  1K1S A;  5AM4 A;  2IOF A;  5KFU A;  3EW9 A;  5F9L A;  1X40 A;  3UMC A;  5ALN A;  9ICO A;  4KLM A;  2PI5 A;  3RBD A;  4C8L A;  1N60 A;  2KN7 A;  2DQN B;  3IG8 A;  1S0V A;  5KG6 A;  2Y9T A;  2MU2 A;  2ES6 A;  4M6W A;  1SKS A;  5CP2 A;  2M9N A;  3O0F A;  4K4I A;  5AKX A;  2BGW A;  3MDC A;  4EEY A;  5AKJ A;  1JN3 A;  2XVT A;  4EX6 A;  4I2D A;  1ZQQ A;  1B0X A;  2A1A A;  3KHG A;  3MR6 A;  3T5K A;  4PL2 A;  4I2F A;  3RB0 A;  4NLN A;  1ZET A;  3ORY A;  1SL1 A;  4QZC A;  3PO5 A;  2KKP A;  4J9P A;  2V4Q A;  4ZH4 A;  2KE7 A;  5A0L A;  3CRX A;  5KT7 A;  3AUO A;  2OM6 A;  3CYM A;  1ZQB A;  8ICC A;  4BWJ A;  4M0A A;  2XCA A;  2OHF A;  1NKC A;  3C29 A;  2BQ3 A;  5J2C A;  2IMW P;  4QZI A;  2HCF A;  2QB1 A;  2AJQ A;  2F1J A;  4Y2U A;  3PW2 A;  3T3F A;  1B22 A;  5KFZ A;  2PFP A;  2ZTE A;  3LVV A;  1B43 A;  2ISO A;  1PVP A;  4QWA A;  4Y2P A;  7ICP A;  3C21 A;  4QJF B;  4F91 B;  2KEY A;  5ALI A;  4YCX A;  3NUQ A;  3I28 A;  4C4R A;  4RU9 A;  1L7P A;  2MSN A;  1MN8 A;  4B6J A;  4O3S A;  4O0I A;  5AK3 A;  1NKE A;  4PHE A;  3ZDC A;  1RPL A;  2AGO A;  2H3V A;  2EH9 A;  2XO7 A;  4EZ6 A;  1ZXI A;  3FDS A;  1D9F A;  2AGP A;  1BPX A;  5ALZ A;  4RQ3 A;  2LYB A;  4QZD A;  2AQ0 A;  4FZL A;  5K4L A;  2XGQ A;  5D49 A;  2J6T A;  5CEH A;  1L8L A;  3PX4 A;  4I2A A;  4RQ4 A;  4CDG A;  4UAT A;  4ED8 A;  3PY8 A;  4ELV A;  3AU6 A;  4F72 A;  3GV7 B;  2Q4T A;  4GC7 A;  4P0Q A;  4DSJ A;  2F1H A;  9ICG A;  4DSE A;  4TQR A;  8ICA A;  1M6Y A;  4NL9 A;  3RRG A;  8ICJ A;  1RXW A;  4KLG A;  4QZF A;  5EE3 A;  4PPX A;  3RJE A;  3TAP A;  2YMP A;  2JHD A;  3H8M A;  3TKA A;  4PZO A;  2KIV A;  2JEG A;  4UB8 U;  4R65 A;  1BPE A;  3T5L A;  3CNH A;  3HKZ F;  5KT3 A;  4NM1 A;  2W9A A;  5AKZ A;  3K1Z A;  1XO1 A;  4I27 A;  1BPD A;  4AYB F;  8ICN A;  1UT5 A;  3WK8 A;  4PGY A;  1JUD A;  4NJ8 A;  1TKD A;  3QEB Z;  4B9U A;  3WKE A;  4C8M A;  2J6S A;  5CWR A;  5ALS A;  4RQ2 A;  1L7O A;  2OCE A;  8ICF A;  4QNL A;  2DFL A;  4MEX A;  3KZI U;  3GII A;  5KFJ A;  5CRX A;  1O08 A;  2EZY A;  4ECQ A;  5ALX A;  5ALW A;  4LJX A;  1KTQ A;  2KJ8 A;  3H0L B;  5AKK A;  2BCS A;  2GH1 A;  4RQ1 A;  4DCC A;  4C7Z A;  2DGZ A;  2B6G A;  3GZF A;  1BPZ A;  1TE2 A;  5AI5 A;  1ECW A;  1ZQZ A;  3WK9 A;  1JMS A;  1O03 A;  1X9W A;  3NVZ A;  4QWE A;  1ZQG A;  3NVW A;  3AQE A;  4DO9 A;  3RB4 A;  7ICF A;  5KFH A;  1Z00 A;  3IP4 B;  1X9S A;  3V7K A;  2VA3 A;  2ALZ A;  3K4G A;  4I2C A;  5ALK A;  2DL0 A;  3UMB A;  5DLG A;  3CW2 C;  1Z19 A;  1SWV A;  1COK A;  4FE3 A;  4YQW A;  1L7M A;  4PGQ A;  1C20 A;  3THV A;  5BOL A;  1XC9 A;  3ISB A;  3BS5 A;  8ICK A;  2KVS A;  2NRT A;  3M6Z A;  1NZP A;  8ICG A;  3CP8 A;  5KT4 A;  2WAQ F;  1EXN A;  4KN4 A;  5JU5 A;  2PMZ C;  2A1J B;  1IV8 A;  5J2G A;  3T79 A;  9ICI A;  2W55 A;  4QIW F;  2QKQ A;  3QXG A;  3TAD C;  3V7L A;  1ZQD A;  1RYU A;  3MC1 A;  2HSZ A;  1YZ6 A;  2W9B B;  2BDU A;  5J2K A;  1NJZ A;  4J9Q A;  4C8K A;  2QAR A;  3LYS A;  2ZXH A;  3RJH A;  4RQ6 A;  5E79 U;  4IRC A;  2HHX A;  9ICE A;  3RH6 A;  2K60 A;  2YML A;  2ZJ5 A;  3M9O B;  3KZX A;  2K8C B;  4EEL A;  1S77 D;  4U6P A;  5L1I A;  5KFM A;  7ICR A;  5HR6 A;  3PX6 A;  3TAQ A;  3RJK A;  3UMG A;  2XCP A;  2E5S A;  3GDX A;  2C2D A;  1ZQI A;  2EQY A;  3TFR A;  2LHT A;  1X42 A;  2W9C A;  4MFF A;  2FLL A;  2CRX A;  3HP6 A;  1VDV A;  3UPQ A;  4C80 A;  3OSP A;  3ETL A;  2KK0 A;  1SL2 A;  4U7C A;  1U48 A;  1KLN A;  1C7Y A;  5ALT A;  5L1K A;  2W54 A;  5AI6 A;  1S8O A;  1NOM A;  2IHM A;  2KIC A;  1WCL A;  5KFK A;  5EWG A;  3SAG A;  4US9 A;  1RQL A;  1VJ5 A;  1KW4 A;  1X6I A;  4DF8 A;  4M9L A;  2G08 A;  2H3F A;  4PHD A;  1F0M A;  1L5U A;  4OO1 J;  2HHQ A;  4FZN A;  1BGX T;  4YR0 A;  4EBE A;  2OXO A;  4F4K A;  1WG8 A;  2HBM A;  2EAO A;  1XO0 A;  3C23 A;  4KLD A;  1ZQR A;  2YQE A;  4F92 B;  3OTQ A;  4FS1 A;  1NJY A;  4M6W B;  2HMX A;  2QB0 A;  1KBU A;  3H40 A;  2BCV A;  3ZDB A;  4XQ8 A;  4Q45 A;  7ICH A;  2DWQ A;  5KT5 A;  4F2S A;  4RPZ A;  7ICO A;  5JUM A;  3PMN A;  1QH9 A;  8ICP A;  2YMQ A;  1V97 A;  1DRG A;  3UXP A;  4RPY A;  4YFK A;  3QZ8 A;  1KSP A;  2BCQ A;  2KFZ A;  3OHA A;  4FBT A;  2XI9 A;  1RYS A;  3OJS A;  3HKZ C;  3RB3 A;  2BR0 A;  1KFS A;  3PR4 A;  1AQ6 A;  3TI0 A;  1NK7 A;  5KFG A;  4DL5 A;  3H4D A;  1ZD3 A;  2KSO B;  2B21 A;  5J0S A;  2OH2 A;  4JV2 A;  4UQG A;  3F2C A;  2C22 A;  4R66 A;  4QZG A;  1SKW A;  5KFT A;  2F1I A;  3H7I A;  1WUD A;  3L3F X;  3NRZ A;  2HBL A;  1TV9 A;  1P7D A;  4KLL A;  1NK6 A;  4ED6 A;  4MEY A;  1ARO P;  4KLQ A;  3K75 D;  3FM9 A;  2I6X A;  2C28 A;  1H38 A;  2LPE A;  1SGG A;  3WKB A;  1TK5 A;  2BCR A;  4I2G A;  4KLF A;  1D8B A;  4IQV A;  2W7P A;  1IM4 A;  1ZJM A;  2YB4 A;  2G0A A;  2JV3 A;  5KNI A;  4KMO B;  2KOB A;  1ZQE A;  7ICJ A;  3GIK A;  3SAF A;  2ZTC A;  4DFK A;  4I2E A;  2HOI A;  4I2I A;  4RQM A;  4J9K A;  1IG6 A;  1YT3 A;  2P6R A;  3SV4 A;  1UHU A;  4NLB A;  2R8I A;  4UAU A;  5EE0 A;  2NO5 A;  2R8G A;  4YMN A;  5J0O A;  2VJ5 A;  1UA1 A;  2D6F C;  1Q3U A;  4PZN A;  4YMO A;  3N7P D;  5KFV A;  5EE1 A;  4F2R A;  1JXL A;  5DB8 A;  3JPT A;  5AI0 A;  2KD1 A;  3JPO A;  3BS7 A;  2HBJ A;  1NK0 A;  5EWE A;  1JRO A;  2WAQ C;  2JZB A;  4F3O A;  3H8S A;  1NKB A;  7ICG A;  2GLE A;  3LVW A;  3RR7 A;  4QIW C;  1NK9 A;  8ICB A;  4P0Q B;  9ICH A;  3VCB A;  2YX8 A;  4P4M A;  4LZG A;  5F9N A;  9ICF A;  1TAM A;  2EZZ A;  3DDH A;  1JXE A;  3M6K A;  3RB6 A;  4YD1 A;  3HX0 A;  1NJW A;  1FFU A;  3Q8P B;  5KG2 A;  5KG3 A;  5IIL A;  1Z3E B;  3UXO A;  5ALE A;  4NM2 A;  5AM2 A;  3NTU A;  5TZV A;  5AKI A;  3C2L A;  3EPG A;  3M8R A;  5IIM A;  4DL7 A;  5KFD A;  5FP0 A;  1RQN A;  5J2H A;  3C28 A;  4DQQ A;  4GXJ A;  4OJ6 A;  3QU5 A;  1XU4 A;  2BKE A;  4Y2X A;  4F4X A;  4Y2S A;  3OGU A;  5J2E A;  2D8C A;  1ZQU A;  5KFS A;  3RBE A;  2YB1 A;  4M47 A;  3MR3 A;  2EAM A;  5BOM A;  1S5L U;  2KZM A;  3D2Q A;  1QSY A;  3NVV A;  3E0F A;  8ICH A;  4FO6 A;  5L1M A;  4IC9 A;  4C8N A;  2BZF A;  3QUC A;  5J0W A;  4DSL A;  1Z00 B;  1SV0 C;  2BPG A;  2FMQ A;  2JXJ A;  1DXS A;  3D6J A;  2XY5 A;  2BPF A;  3MDA A;  2IBK A;  2V4R A;  4OCZ A;  3D2S A;  9ICP A;  4G9B A;  3BS5 B;  2AHO B;  4P0P A;  4RQ5 A;  2KV2 A;  2IOH A;  4Q8F A;  7ICS A;  3QZ7 A;  1NI3 A;  3MFI A;  2ZXI A;  5ALY A;  2W8K A;  5DBC A;  3KHL A;  2HBK A;  1SWW A;  2EDU A;  2WB1 F;  4TUP A;  1WYG A;  5ALG A;  5KG5 A;  4LZD A;  2KTQ A;  5IIK A;  4RNN A;  2BQR A;  4KLE A;  4M04 A;  1VLB A;  4J9R A;  2F3N A;  3MAB A;  4Y2J A;  4BGD A;  2HI0 A;  4Q43 A;  1UQV A;  4DL3 A;  1KEJ A;  3C5G A;  3SI8 A;  2QAR B;  2ZUB A;  2ASL A;  3HRD D;  4JMU A;  4GC6 A;  1SB3 C;  2Q0Z X;  5HML A;  2IA6 A;  4F4Z A;  4MFC A;  1K5O A;  3R9K A;  1A6S A;  4RUA A;  4UAW A;  1JRP A;  2GOL A;  4BJQ A;  4DLG A;  4NLZ A;  4KLJ A;  7ICI A;  3M9M B;  8ICL A;  1OXJ A;  2B0C A;  3WK6 A;  4F4W A;  1BVS A;  3AL0 B;  3PNC A;  3D2N A;  1X66 A;  2VIX A;  3QE9 Y;  1MQ3 A;  5DG8 A;  2YTU A;  3GFK B;  4DL4 A;  5KTQ A;  3C2K A;  3RTV A;  2W7O A;  1N63 A;  5EE9 A;  1N61 A;  1S0O A;  2HOF A;  3RJG A;  2E8O A;  4ED7 A;  3ONN A;  4OJP A;  2W43 A;  4F93 B;  2GWS A;  2BDP A;  1FO4 A;  3IHQ B;  3JPP A;  3F2B A;  4O5C A;  3NS1 A;  5KG4 A;  4C0Z A;  5JRT A;  1JX4 A;  4JB3 A;  4O3O A;  3LWL A;  3N28 A;  1S0N A;  2Y1J A;  1L7N A;  4O3P A;  3ISD A;  4CE6 A;  2JEF A;  4E0D A;  4I2J A;  3T5H A;  2N1R A;  1CI4 A;  3FC4 A;  3QX7 A;  2HVH A;  4YR3 A;  4NWI A;  5KG0 A;  2RP5 A;  4KLU A;  5AKG A;  2C2E A;  2CN1 A;  4IR9 A;  2DUY A;  2CPR A;  5ALP A;  3A0H U;  4QZB A;  5KG1 A;  2F2A B;  1UPH A;  4RQ0 A;  3TFS A;  3AU2 A;  3ZD9 A;  2FDR A;  4Q8E A;  2W3R A;  2NV3 A;  4RT3 A;  3S6J A;  1N5W A;  3JPR A;  2FLN A;  4MF2 A;  2QB0 B;  4YVZ A;  2A3V A;  4GFJ A;  4OJO A;  2AH5 A;  2IOF K;  4QW8 A;  2BCU A;  2FMS A;  4UBC A;  4B9L A;  1X6J A;  3PR5 B;  4KLS A;  5TIS U;  1GO3 F;  1PZN A;  2UVW A;  2OYY A;  4HAI A;  3PSF A;  3EYZ A;  2OEH A;  2DPI A;  3MGV A;  2JGA A;  4I28 A;  2DBY A;  5AKY A;  4EEN A;  5KL8 B;  5GTI U;  2XY6 A;  3GIJ A;  2YMM A;  3ZD8 A;  1F44 A;  2ZJA A;  1BNP A;  3C1Z A;  2VAN A;  3LK9 A;  1TAU A;  2FPM A;  4EBC A;  5KG7 A;  1HEK A;  4B9V A;  3BZK A;  8ICZ A;  1N48 A;  4Y2T A;  1ZQV A;  4HYK A;  5KT2 A;  3I76 A;  4Y2Y A;  4F5Q A;  5J8Y A;  3KHR A;  3LDA A;  2F76 X;  1TFR A;  4EYI B;  3QUB A;  2LKY A;  4RQ7 A;  5C0Y A;  9ICL A;  1U49 A;  4DOA A;  4NXZ A;  3OJU A;  2BQU A;  8ICO A;  4YXJ A;  4ECR A;  2PFQ A;  3I1Y A;  1JI7 A;  1DK2 A;  3RJF A;  4M9N A;  2HDO A;  4ICA A;  5KFO A;  1S10 A;  2HW3 A;  4RNO A;  5AKL A;  5G5H A;  2PXI A;  2JZB B;  4UB2 A;  1L3S A;  5D4B A;  4F5O A;  4IR1 A;  2KJ5 A;  4KTQ A;  2K4H A;  2E1E A;  3QNM A;  3SQI A;  1SV4 A;  2P6U A;  2WF8 A;  4CCH A;  3KFU F;  4O5E A;  3GQC A;  3WK5 A;  5IIJ A;  1ZQC A;  3QU4 A;  2PFN A;  3LWM A;  2EAP A;  5AHX A;  5DG7 A;  2ZIX A;  4CRX A;  4M9J A;  3WKA A;  5DDY A;  4TUQ A;  4KMU A;  4X5V A;  2ASD A;  4O3M A;  4QWD A;  1KFD A;  4BWM A;  4IRD A;  3K1R B;  4UAR A;  4ECT A;  4Y2V A;  2K8B B;  5J0U A;  2H3I A;  1XSL A;  1QTM A;  1ZQW A;  1KKX A;  2XGP A;  3UQ0 A;  2BPC A;  3HPO A;  5DLF A;  4O3R A;  4DEZ A;  2K8A A;  2NYV A;  1LVH A;  4NLC A;  2W04 A;  4ELT A;  1DGJ A;  4QZH A;  3QU9 A;  1PVR A;  2YY6 A;  1QQ6 A;  5AIC A;  2M0N A;  1PK1 A;  2K4E A;  5J0T A;  3OPX A;  5J2I A;  2KMD A;  4YD2 A;  4WJ3 B;  2R8K A;  1XSN A;  8ICV A;  4ECZ A;  7ICQ A;  3PW4 A;  2ZTD A;  9ICS A;  5HR7 A;  5T14 A;  2YN4 A;  1D8L A;  2ZIW A;  5ALM A;  3E2E A;  1SXE A;  4OD0 A;  3B0X A;  4M2Y A;  2VA8 A;  2HHW A;  5J0P A;  4P2H A;  5L1J A;  1URJ A;  5B66 U;  3G6X A;  2HVI A;  2LYA A;  5AM1 A;  3SV3 A;  2MA1 A;  4NLG A;  2Y9U A;  1D9D A;  1D8Y A;  3NGD A;  2RLT A;  2LM4 A;  1Q46 A;  3BJY A;  3AEV A;  3OSN A;  2ATL A;  1ZYQ A;  3HW8 A;  7ICT A;  1LKY A;  4AYB C;  1QQ5 A;  4F5R A;  4F5N A;  1L3V A;  2KVC A;  5GTH U;  5ALQ A;  4ECS A;  2W9M A;  1SZP A;  2Y1I A;  3EUB 2;  4PHA A;  1SXD A;  3GIL A;  2KFN A;  1J2N A;  4PH5 A;  5HNK A;  1BPB A;  4CF3 A;  5DGB A;  2RQ5 A;  1IIP A;  3QU7 A;  3E58 A;  1LV5 A;  1A76 A;  4F5P A;  5ALF A;  2FJ6 A;  2RDI A;  3ZDD A;  4GLX A;  2H3Q A;  2DKX A;  1YZ7 A;  2K4I A;  3PW7 A;  3AMZ A;  2HHU A;  2LYH A;  2XIC A;  5AI8 A;  1RDF A;  3B0Y A;  2V9W A;  3BZC A;  3RAQ A;  5KFR A;  1NK5 A;  5KFL A;  3SYZ A;  2HHT A;  7ICU A;  1T94 A;  2ISP A;  8ICY A;  5DB9 A;  3IDW A;  2DPJ A;  4IQW A;  2G5I B;  4KIT B;  1A77 A;  4FFD A;  3SZ2 A;  5H2F U;  3RJI A;  1OUQ A;  4F4Y A;  4C7Y A;  5DBA A;  3TAN A;  3M1Y A;  5IIO A;  3ALR A;  3PVX A;  7ICE A;  5DKW A;  3C5F A;  3BQ1 A;  4B9M A;  2OWO A;  2F8L A;  2R18 A;  4KLI A;  4ECX A;  3TQ1 A;  3J81 j;  3G6V A;  1X9M A;  4BXO A;  4C4S A;  2EAN A;  1TK0 A;  4J9N A;  4M9G A;  4TUS A;  1ZQS A;  7ICM A;  1ZQL A;  3MBY A;  4I29 A;  4Y2Q A;  5CJ7 A;  1A0P A;  2E1F A;  2PI4 A;  3N4M B;  2LI6 A;  4C4T A;  4JK1 A;  5B5E U;  5KT6 A;  2MUT A;  5ALJ A;  5F3X B;  7ICL A;  3KKA A;  5J2D A;  1L6N A;  1V85 A;  2KKV A;  4M9H A;  5L9X A;  3HIL A;  4DQI A;  3N97 B;  1NZB A;  4TUR A;  4R8U A;  1T7P A;  2W11 A;  2P35 A;  4NL9 C;  1FEZ A;  1NNL A;  4US8 A;  1ZQP A;  2J6U A;  2BHN A;  5KFP A;  2GO7 A;  2AQ4 A;  4XRH A;  1KDH A;  4XUS A;  4B9T A;  1L8O A;  3HT3 A;  9ICJ A;  4B9N A;  3IM1 A;  3PV8 A;  4P4P A;  4GIB A;  5AM5 A;  2K89 A;  2PKE A;  3WU2 U;  4QZE A;  4NY8 A;  4J9S A;  2PMZ F;  3MR2 A;  5AM3 A;  4G3I A;  4QWC A;  1SKR A;  5AKE A;  3PW0 A;  3HWT A;  2ZIV A;  3JPS A;  4KX5 A;  3GU3 A;  4J03 A;  3AN1 A;  4DSF A;  3F5E A;  1ZQX A;  1Q3V A;  1IXR A;  4RZR A;  4DLE A;  4DFJ A;  1ZQM A;  2F8K A;  1RG6 A;  5ALH A;  2ZIU A;  5DG9 A;  5IIN A;  5HMM A;  2NRX A;  2NRW A;  3Q8K A;  1S9F A;  3SMV A;  2DKZ A;  1T3N A;  4XA5 A;  3WKC A;  2KSO A;  3EPI A;  1N2X A;  3OHB A;  4QZ8 A; 
#chains in the Genus database with same CATH homology
 4Z6D A;  4KLS A;  4K4G A;  5HHI A;  9ICV A;  5CB1 A;  7ICN A;  1ZQF A;  5III A;  4MF8 A;  4M9L A;  4I28 A;  4UB1 A;  9ICC A;  4PHD A;  7ICK A;  1BNP A;  1ZQN A;  5J2B A;  3LK9 A;  5D46 A;  4Z6C A;  1ZQK A;  4Z6F A;  5DB7 A;  3JPN A;  1ZQA A;  2FMP A;  4KLD A;  1ZQR A;  4YN4 A;  8ICZ A;  3RH5 A;  4UB5 A;  4Z6E A;  4KLO A;  8ICT A;  4UAZ A;  2BCV A;  7ICH A;  7ICO A;  4RPZ A;  3PMN A;  4F5Q A;  8ICP A;  1TVA A;  5DBB A;  4RPY A;  3UXP A;  4IQU A;  4RQ7 A;  1HUZ A;  2BCQ A;  9ICN A;  9ICL A;  4NLK A;  4DOA A;  1XSP A;  3ISC A;  4NXZ A;  8ICO A;  2PFQ A;  3UXN A;  1DK2 A;  5BPC A;  5J0S A;  3RJF A;  4M9N A;  4R66 A;  3UQ2 A;  4IQT A;  9ICO A;  4KLM A;  4QZG A;  4KLT A;  4GXK A;  8ICQ A;  1TV9 A;  1ZQO A;  4KLL A;  3C2M A;  2PXI A;  4UB2 A;  4KLQ A;  5D4B A;  4F5O A;  5J2F A;  4K4I A;  4I2G A;  2BCR A;  4KLF A;  4IQV A;  3MDC A;  1ZJM A;  4O5E A;  4R63 A;  1ZQE A;  4I2D A;  7ICJ A;  1ZQQ A;  5IIJ A;  4UB4 A;  1ZQC A;  4I2E A;  4I2I A;  2PFN A;  9ICU A;  1BNO A;  3MGI A;  4M9J A;  5EOZ A;  4I2F A;  5DDY A;  4TUQ A;  4X5V A;  9ICB A;  4NLN A;  4YMN A;  5J0O A;  1HUO A;  5J0U A;  1XSL A;  4JWN A;  3UQ0 A;  4QZC A;  4YMO A;  5DB8 A;  3AUO A;  3JPT A;  3PML A;  3JPO A;  1ZQB A;  8ICC A;  4M0A A;  4QZH A;  5J2C A;  4QZI A;  4R64 A;  5HHH A;  7ICG A;  4DOB A;  2PFP A;  5J0T A;  5J2I A;  8ICB A;  2ISO A;  4YMM A;  9ICH A;  4YD2 A;  4LZG A;  1XSN A;  8ICV A;  7ICP A;  7ICQ A;  9ICS A;  9ICF A;  4YCX A;  3RJJ A;  4YD1 A;  3HX0 A;  3B0X A;  4M2Y A;  5J0P A;  4P2H A;  5IIL A;  3UXO A;  4PHE A;  4RT2 A;  4NM2 A;  5TZV A;  3C2L A;  5IIM A;  1BPX A;  5J2H A;  4RQ3 A;  4GXJ A;  1RZT A;  4QZD A;  3HW8 A;  5D49 A;  4UBB A;  4JWM A;  9ICM A;  7ICT A;  4I2A A;  3OGU A;  4RQ4 A;  4F5N A;  4F5R A;  5J2E A;  2W9M A;  3AU6 A;  4PHA A;  2PFO A;  4K4H A;  9ICG A;  8ICA A;  4M47 A;  4PH5 A;  8ICJ A;  5BOM A;  1DK3 A;  4KLG A;  4QZF A;  4PPX A;  8ICH A;  4FO6 A;  3RJE A;  4F5P A;  4LVS A;  1ZJN A;  5J0W A;  8ICM A;  4QZA A;  2BPG A;  4R65 A;  1BPE A;  2FMQ A;  4NM1 A;  2BPF A;  3MDA A;  3RH4 A;  4I27 A;  3B0Y A;  1BPD A;  2I9G A;  9ICP A;  8ICN A;  8ICR A;  4PGY A;  3V72 A;  1BPY A;  7ICU A;  5CWR A;  4RQ5 A;  2ISP A;  4RQ2 A;  8ICY A;  8ICF A;  5DB9 A;  8ICW A;  4PGX A;  7ICS A;  4IQW A;  5DBC A;  4PHP A;  1ZQT A;  3JPQ A;  3RJI A;  2BCS A;  4RQ1 A;  4UAY A;  4DOC A;  4TUP A;  5DBA A;  8ICS A;  9ICX A;  5IIO A;  1BPZ A;  4LZD A;  5IIK A;  7ICE A;  4RQ8 A;  4KLE A;  5J2J A;  9ICT A;  4M04 A;  1JMS A;  5DKW A;  3C5F A;  4O9M A;  1ZQG A;  4DO9 A;  7ICF A;  4KLI A;  9ICQ A;  3V7K A;  4I2C A;  1KEJ A;  3C5G A;  4I2B A;  4QZ9 A;  4PGQ A;  1MQ2 A;  4M9G A;  4TUS A;  1ZQS A;  4MFC A;  1ZQL A;  3MBY A;  4I29 A;  7ICM A;  5BOL A;  3ISB A;  4UAW A;  5J0R A;  8ICK A;  9ICK A;  9ICR A;  1NZP A;  8ICG A;  4NLZ A;  4RPX A;  7ICL A;  2P66 A;  5J2D A;  5J2G A;  4KLJ A;  7ICI A;  8ICL A;  9ICI A;  4M9H A;  4O5K A;  7ICV A;  3PNC A;  4TUR A;  1MQ3 A;  3V7L A;  1ZQD A;  4KLH A;  5J0Q A;  5J0X A;  3C2K A;  3RJG A;  1ZQP A;  8ICX A;  2GWS A;  9ICW A;  5J2K A;  1KDH A;  5DB6 A;  3JPP A;  4O5C A;  4XUS A;  3RJH A;  4RQ6 A;  9ICE A;  9ICJ A;  3RH6 A;  9ICA A;  5J0Y A;  3ISD A;  4QZE A;  4NY8 A;  4I2J A;  3HWT A;  3JPS A;  1ZQJ A;  7ICR A;  4KLU A;  5J2A A;  3RJK A;  4GXI A;  3V7J A;  3GDX A;  4MFA A;  5J29 A;  1ZQM A;  4QZB A;  1ZQI A;  4RQ0 A;  3TFR A;  3TFS A;  2KP7 A;  3AU2 A;  5IIN A;  4MFF A;  4RT3 A;  3MGH A;  8ICE A;  3JPR A;  3UPQ A;  4MF2 A;  4I2H A;  2BCU A;  4XA5 A;  8ICI A;  4UB3 A;  2FMS A;  1ZQH A;  8ICU A;  4UBC A;  4QZ8 A;  2IHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...