1DK4A

Crystal structure of mj0109 gene product inositol monophosphatase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title MJ0109 is an enzyme that is both an inositol monophosphatase and the 'missing' archaeal fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 68
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1dk4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1dk4A02
1DBZA 1LBXA 1NUZA 1FPGA 5I3SA 1FBFA 4H46A 2CZIA 1FPEA 1NUYA 4I40A 2FIXA 3BIHA 4AS5A 2JJKA 3KBZA 3KC1A 2QFLA 5IZ1A 1KZ8A 1FSAA 3D1RA 1CNQA 1DCUA 1IMAA 2P3VA 5ET7A 1FJ9A 3IFCA 4GWUA 5EQ7A 4GX4A 1LBYA 1KA1A 3KC0A 1LBZA 4I3YA 5F24A 2QVRA 1YXIA 1FTAA 1IMCA 1FBDA 3QMFA 3B8BA 2CZKA 2FIEA 4PTKA 1FBEA 4O7IA 5IZ3B 1IMFA 4QXDA 4GX6A 1FBPA 5IZ3A 4MJOA 2FBPA 1RDYA 3A29A 4IR8A 5ET5A 1FPIA 5J16A 2FHYA 1FBCA 1IMEA 3T0JA 1NV1A 1NI9A 5ESYA 5LDZA 4GBWA 4N81A 2HHMA 1NV0A 1G0IA 2CZHA 3ROJA 1FPFA 1NUWA 1Q9DA 4GWZA 3IFAA 4AS4A 2Q74A 1NV4A 1LBVA 1LEVA 1EYJA 1AWBA 1NV2A 2OWZA 1KA0A 1FPKA 1RDZA 5A5LA 2GQ1A 1JP4A 1EYKA 1SPIA 2VT5A 3LV0A 5DW8A 1NUXA 1LBWA 1YZ0A 2BJIA 2FVZA 2OX3A 2DDKA 2WBBA 1FJ6A 1NV6A 2Y5LA 2PCRA 1DK4A 1K9ZA 1IMDA 4KXPA 1FPDA 1FPJA 4GX3A 4HE0A 5EYHA 5FBPA 1RDXA 4GWWA 2WBDA 2Y5KA 4GWSA 1BK4A 5EQ9A 4HE1A 1IMBA 4HE2A 1K9YA 5ET8A 4GBVA 2WEFA 1FBGA 1FPBA 5ET6A 1NV3A 4H45A 3RPLB 3RYDA 1FBHA 1QGXA 4GWYA 1G0HA 4HXVA 4FBPA 1FRPA 2P3NA 5T3JA 2F3BA 3LUZA 2QVVA 3RPLA 1NV7A 1D9QA 4I3EA 1INPA 4GWXA 1VDWA 1NV5A 5EQAA 4G61A 5EYGA 2QVUA 5EQ8A 2F3DA 1YYZA 3BIGA 1EYIA 2R8TA 1FPLA 1XI6A 2Q8MA 3FBPA
chains in the Genus database with same CATH superfamily
4FAJA 1NUZA 3K4UA 2I4CA 3ECRA 2PFYA 2P1SA 3JZJA 3KC1A 2QFLA 3O28A 3ZKKA 4AB6A 4ELOA 5IAIA 4GWUA 4L17A 2XWKA 1KA1A 4NF8B 4I3YA 1YXIA 4F19A 3QMFA 3TZAA 1NNPA 1NKXA 4FEBA 3K0VA 1B7HA 2AL5A 2PBWA 4ZZAA 3NOHA 1MQJA 4PAIA 1POY1 1LAGE 1ZTYA 2VD3A 1RYXA 1FQBA 4R74A 4FE8A 4H0WA 1NUWA 1Q9DA 4ND9A 2F34A 3H06B 4ELRA 2VPOA 4P1LA 4ONYA 1H43A 2FVZA 2KLFA 2DQVA 5IZZA 1VR5A 1IIWA 3DLNA 1SVXB 4ISUA 1ZIUA 1RDXA 2OPEA 3LSWA 3OO6A 2Y5KA 1MG1A 3R26A 4PFIA 4PFYA 2B4MA 5ITPA 4HCWA 1LFIA 4U21A 3IOWA 4PC9A 3TEPA 3RPLB 4G68B 4P8BA 3QAXA 2XA5A 5ICQA 2I48A 4QF9A 1NV5A 5CC2A 2QVUA 3I6VA 3VVFA 4YAHX 1O63A 4H8JA 1ZU0A 1NUYA 4NMYA 3VDFA 1QW0A 4F29A 2XHDA 4MIJA 1MPCA 4ZDMA 1HSLA 1Y9UA 1FJ9A 4GIZA 4JWOA 1B05A 1B3GA 4ZEIA 4BLAA 1J1NA 1SI1A 3THIA 1QUIA 3HV1A 1FBEA 2I6EA 3CRBA 3UP9A 1XHYA 1MXVA 4GX6A 1KWHA 1MPDA 1IUDA 4NF6B 4R72A 1NH7A 1PBPA 1EH3A 2HEUA 3KEIA 4P0GA 2WX9A 4MJOA 3U65A 4C1TA 3SETA 1F9BA 1LGBC 2KQZA 1P1QA 1NV1A 2HAVA 5FTHA 4NAPA 1MQGA 4RY1A 5I58B 4PAKA 4WKMA 4GWZA 4OMBA 5ISUA 2WKYA 5AA3A 1A8FA 3UA8A 2F7CA 2Q2CA 1RDZA 2F7BA 2GQ1A 3MW0A 1SPIA 2ESNA 3MZ1A 4OEVA 5F1QA 2WBBA 4R6KA 3K6XA 3IOUA 4F18A 5EYHA 4PBHA 2G93A 1QUJA 4NE4A 3TPAA 5EQ9A 4X9TA 3W15C 3Q28A 3T93B 2DXYA 1IQ7A 2ALUA 3T66A 1FTLA 4OENA 4NF4A 1MDQA 3RPLA 4G68A 4U22A 4PETA 4PGPA 4NG7A 4H1XA 4GL8A 1MQDA 2H98A 1URGA 1UIUA 2Y7WA 5H8QB 3OEKA 2H99A 1EZOA 5IZ1A 3TDJA 5K2YA 2HAUA 2V3QA 2VD2A 4IY5A 3KC0A 2QVRA 3A3UA 4QBAA 4DXUA 3RPWA 1B5JA 1JQFA 4DDDA 4PDHA 3K1NA 4QXDA 2XWIA 1A8EA 4X1DA 4OETA 3Q26A 4R9FA 3IO6A 4NF6A 4NTLA 1FQCA 4JVCA 1SD3A 4N81A 1MY2A 2DE3A 2DE4A 4TOZA 1FPFA 2I0CA 1T0KA 5I58A 4FORA 1UTBB 2OWZA 4THIA 3UORA 4EXKA 1AL3A 4E0WA 1BLFA 4MNCA 1IITA 3PUWE 2ZYKA 5JK4A 1IXCA 3KN8A 4KI0E 4ZECA 3GZGA 4LZ8A 3G3JA 4PE3A 4Q5TA 4GWSA 3SEUA 3TMGA 1ZJLA 4GBVA 2YJPA 3PMXA 2HZKA 4IO5A 4MLQA 4G2ZA 4LVQA 2Z22A 1G0HA 2RC8A 3QXMA 2XD3A 3OSQA 3IK6B 4P47A 3MVZA 4JWYA 3G3FA 4JB7A 2X26A 4PE5B 3TKDA 3FXRA 3FBPA 2F5XA 2IA4A 3VFJA 1LBXA 4M1VA 1MY4A 2DS9A 3G3GA 1DPPA 2FIXA 4PF6A 5H8QA 3CR9A 4QHQA 4F39A 4F3PA 4LZ7A 2QJEA 5KCJA 5IGAA 2Z8DA 4DIGA 4EXLA 1QKBA 1A99A 4QSCA 4PTKA 2B4LA 2HZLA 1A54A 4I1DA 4ZEKA 3DELB 3U92A 4Z7EA 1N3XA 3L6GA 3M3LA 3W9VA 4HCYA 4GBWA 4PCDA 1N7WA 2I0BA 5FHOA 2CZHA 4KQPA 4PAFA 4JXIA 3CG1A 3CFXA 4U1OA 5J1DA 3C34A 5AA4B 4IGRA 1OQHA 1Y3QA 4DI3D 1PBQA 3MSTA 3C36A 5ITOA 1MXZA 1NV6A 4LZ5A 2XX7A 4Q0CA 5BWJA 4OQOA 2Q8JA 4Q30B 4G77A 3LSXA 5I56B 4NQ8A 5DVJA 2QSXA 4P56A 4LONB 3U72A 3V5AA 3EN3A 2QMWA 1MQHA 4YKPA 1IMBA 2ZZXA 1VFDA 4R2FA 3O29A 4XKPA 3ILUB 1BP5A 1XC1A 4FBPA 2DXRA 5T3JA 1DSNA 3K1PA 5H8NA 3OO9A 2ZYMA 1AIVA 3T9XB 2OPDA 2DWHA 2DWJA 4OYVA 2XXXA 1DTGA 5EHMA 1FPLA 5I3SA 4MAGA 1FBFA 4H46A 4N6PA 5H8FB 2R71A 4Z0IA 3PPQA 1MPBA 1XVYA 3OMBA 2RF1A 2V3UA 3KZGA 5I2NB 2UVGA 1UQWA 5CBRA 4N4UA 2XWVA 3PPRA 3PTYA 1A55A 4XKQA 1OVBA 3FJMA 4UA8A 2DVZA 1QKAA 4PFRA 4QFPA 4O94A 2R9JA 1TFDA 1GTKA 1NNTA 2HFBA 2ZNUA 4IR8A 3FXQA 2HXWA 5TPAB 1SW2A 5AE4A 4N15A 1USYH 1R9LA 4GOTA 1Y1MA 3M8UA 3TQLA 4MNPA 2WYKA 3H6UA 1JW1A 5AA4A 3T96B 1PC3A 3FGSA 4HTGA 5A5LA 4GQOA 3HSTA 3RNNA 1FQEA 2NOOA 1FW0A 3LV0A 1UTHB 1H3DA 2GH9A 1FJ6A 1B32A 5DTBA 1PDAA 4HE0A 1JETA 4U2RA 3CG3A 4XKNA 1BK4A 1XOCA 2NVUB 1Y20A 5I56A 3MVWA 4OTEA 3OXNA 4G8MA 4F31B 4RPOA 1LBBA 3MWBA 3E79A 3CIJA 2XXIA 2F7AA 4I3EA 3FASA 3CFLA 3KSXA 1B3EA 3CVGA 3E78A 3W9WA 4N13A 4ESWA 3LR1A 2YLNA 3T9UA 3H6TA 1OVTA 1H76A 5K2XA 5H8FA 4G68C 1Y3PA 1P1OA 1DCUA 4MBPA 3DP6A 4KCDA 3O6IA 4KYDA 4MHFA 1Y1ZA 4TLMB 3Q27A 3O97A 4RXLA 4JBZA 1FTMA 5IKBA 3C4MA 3KJ7A 1URDA 4XTCQ 4YKKA 2PX1A 2FHYA 1B7UA 3U8QA 4DI4B 2XXPA 5LDZA 5TPAA 3KN3A 4GRKA 2CMOA 2ZXTA 1MRPA 3K02A 4ZEFA 2AL4A 4MLVA 5DVIA 1DMBA 1LFGA 3BFUA 4X48A 4POXA 1FPKA 1EZ9A 2PT1A 3IJXB 1LBCA 4MCOA 5DW8A 1JW5A 1A7LA 3QYTA 1VSOA 4YB5A 2B3FA 2Y5LA 3RT6B 1XT8A 1DK4A 1K9ZA 1UTHA 5FBPA 5IM2A 4P1EA 2NWJA 2D21A 4OVQA 4HE1A 4AQ4A 1JVYA 3VVDA 4GLIA 1JNFA 3KBRA 2WEFA 4NF5B 4IB2A 4QSDA 1FBHA 3SEYA 1B1HA 3TTKA 1MXUA 1Q35A 4GF8A 1JVXA 3BBRA 2OLBA 2V3TA 1L5TA 5EQ8A 3Q25A 3O66A 4KPTA 2R8TA 1FQAA 1GGGA 1YPNA 3CSBA 1FPGA 3OD7A 3S2VA 2FA7A 5CM6A 4KCCA 4UABA 4NF4B 4H5FA 4PDDA 1SDXA 4OWDA 2RCBA 1PB8A 5AA2D 4NWCA 3PD8A 3CHGA 2QS3A 3Q29A 2A5TB 4YICA 2O1LA 3VV5A 4WEPA 3MUQA 1ZKBA 4GVOA 3MP1A 2CZKA 2ZMBA 2FIEA 4JSOA 4DCXA 1I6BA 5IZ3B 4FATA 3HO7A 4YKJA 1S7YA 1DOTA 1B6HA 2THIA 1SW5A 4I9DA 2L5VA 2QPQA 2AIXA 5CMBA 3AXFA 3HHGA 2I58A 4AS4A 2Q74A 4C1UA 4F2OA 1NV2A 3RT8A 1URSA 1NUXA 3MVXA 3H6VA 4LN5A 4IO7A 2F35A 3FV2A 4KYSA 2PVUA 3PUZE 4N07A 3M3FA 1TFAA 2Z23A 5M2VA 4NF5A 4NF0A 2F8DA 2I3WA 1N04A 1RYOA 4UACA 1D9QA 4JVDA 1INPA 5EQAA 1N7XA 1B7ZA 5F7VA 3EKIA 4MMPA 3UGWA 4I40A 4H6DA 2X7QA 1DTZA 4DCYA 4Q8RA 3FJGA 5ET7A 2R6GE 2Y7IA 2Z8FA 3PD9A 4U4XA 2A5TA 4BDLA 1BKAA 4IO4A 5FTIA 3OENA 2Q9TA 4QFOA 4O8MA 4BDMA 1WVJA 3IL1B 3MPKA 5IZ3A 4F3BA 1S9TA 2FBPA 4GL0A 4OVRA 5KZTA 5KCJB 3T0JA 2OK2A 4YMBA 4HW8A 1GR2A 3IFAA 3IO4A 5EYFA 3DP4A 4YMAA 3WAFA 5AA1A 4DLDA 2ABHA 1EYKA 2OJTA 3K01A 1SBPA 3QIMA 3TTLA 1YZ0A 1B0HA 3QK6A 4LP2B 3UIFA 4ZS9A 4BDQA 1FPJA 3GYYA 1B5HA 1MS7A 5DEXB 1OLCA 2O68A 1B4HA 3PMWA 2F6GA 4HE2A 4EQ9A 3MP8A 4F1YA 2QS2A 4FIMA 3SESA 1MY0A 2ZNSA 5DVFA 1NNFA 3E13X 1BTJA 4I62A 4O3CA 1ATGA 1YTVA 4DZ1A 3C35A 3OEMA 3G3KA 3WAEA 1MDP1 2O7IA 4AS5A 1WODA 4MNIA 3D1RA 1CNQA 1YAEA 2D3IA 3A3CA 2CEXA 5H8NB 3KN7A 3TUSA 5EQ7A 2NUVA 3D4GA 3S4UA 3IJOB 3FVNA 4PF8A 1M5EA 1EU8A 4POWA 3V8XB 3MVYA 5ELVA 1LCTA 2G29A 5ET5A 2H5YA 2I4BA 1B9JA 4OVSA 4ESXA 2HHMA 1MXWA 1G0IA 3EHUA 2PT2A 3TODA 1SYHA 2F36A 1SI0A 2UVJA 2H25A 3TELA 2F78A 3C31A 4U23A 4EDPA 3CI8A 3TQWA 1LB9A 2XX8A 1B4ZA 2DWAA 3KGCA 3H6WA 4ECFA 2ZNTA 1B3FA 1MQIA 1MXYA 3FIRA 2DDKA 3PUVE 1JW4A 4MF3A 4G4PA 3P7IA 3FVGA 3OO8A 5KDTB 5DEXA 2UYEA 1K9YA 1B2HA 4TQUQ 2E1SA 4N8YA 3SEWA 1Z7ME 3TCHA 2VHAA 1CE2A 2DP8A 2QVVA 2CZLA 4OA4A 2DVCA 3LUYA 4H5GA 4G61A 3S9EA 1YYZA 3BIGA 3ZS6A 4ZZEA 1XI6A 4IO3A 5CMKA 2PYYA 1B3LA 2GHBA 2CZIA 3K6UA 3MC2A 3HN0A 3E9XA 1VE4A 1VFEA 3FVKA 2X7PA 1IMAA 2F97A 2P3VA 2VGQA 3UN6A 2QMXA 3KJTA 3S9LC 4MFIA 1MXXA 4RK2A 2O6AA 1FTAA 3EF7A 4RK9A 4XXUA 3PUXE 4G8NA 3PUYE 2WYPA 3LC8A 1NFTA 1MM6A 3SERA 2ZYOA 1MY1A 2OBGA 2XXYA 3EPEA 4KHZE 1IZ1A 5HBCA 3GXAA 1LCFA 4X04A 1NV0A 4GXAA 2V93A 4DXCA 3EQ1A 2Q2AA 2B65A 3MZ9A 5HPQA 1IXIA 5I5PA 3G7WA 4X1BA 5L9OA 4JVIA 1Z7NE 3OOAA 4N91A 1N3WA 4N8GA 1NL5A 4YU0A 5L8DA 4LQ5A 4N17A 4KXPA 4GX3A 5DT6A 3LBSA 3H7MA 2UYFA 1B0LA 2P0SA 3MBPA 3QUFA 4BDNA 4NWDA 2Q88A 2REGA 2RC7A 4KD5A 5KDTA 5ET8A 2Y7KA 4PFTA 4ZEDA 3RYDA 5I7IA 3ODBA 4N6KA 4YB7A 1FRPA 5LTCA 3JV9A 2XXHA 5EYGA 1D9VA 3E3KA 3BKIB 2Q8MA 3PPNA 1O64A 2ONRA 1YCJA 1LAFE 3EHSA 4F22A 1KZ8A 4O3AA 4WEDA 3KSJA 2ONKE 1LBYA 3C9HA 4OVJA 1B51A 3FXBA 3ISPA 3V89B 3TTRA 3LSLA 4EQBA 1ZLQA 3H4ZA 4ELPA 1ZMGA 3A29A 4OHNA 1FPIA 1FBCA 5L9MA 2UXAA 1OMPA 2FYIA 3T9HB 1N76A 4F3GA 2GFEA 2GRVA 2E0SA 2OWSA 1PEBA 2VP1A 4KR5A 3MJNA 3K6WA 1H45A 3M3KA 1B52A 3E4RA 4NX1A 4U4SA 1FPDA 3GLBA 1TT1A 4ZE9A 1Q1KA 4TLLB 3K6VA 1B46A 1II5A 1FPBA 2DSFA 4OANA 2F3BA 4F1VA 5AA2A 2XXVA 2NXOA 4PP0A 1MH3A 5BUUA 4R6YA 4PGNA 2KR0A 2RCAA 3FD3A 4LATA 4R9GA 2F6PA 5JTYA 5LOMA 2RKMA 2I49A 4OFJA 1TWYA 4ZE8A 4O7IA 3IOTA 1IMFA 4JDFA 2XXQA 3IB1A 3PU5A 4RA1A 5H8HB 1M5FA 3L6HA 3KOTA 3OO7A 4QFKA 4F3SA 2XX9A 3FVOA 3U93A 5ESYA 4IGTA 2QL3A 1MM7A 3SZPA 5FHNA 3SEVA 1H44A 2HCAA 3PPOA 4OVTA 4H65A 5HM4B 4OZ9A 1LEVA 4OEUA 1EYJA 4MEVA 4XEQA 2W7YA 1DPEA 2OCUA 1M5CA 5B7DA 1I6QA 3K00A 2A5SA 1FTJA 3H03A 3FJ7A 2QS4A 1SW1A 1MY3A 3RTFB 5CMCA 4PFUA 1IEJA 1ANFA 5ET6A 2P2AA 3CFZA 4LUBA 3PPPA 3U94A 1R9QA 2PFZA 4GXSB 1VDWA 4YB6A 1B40A 5DYHA 2H9BA 4NF8A 1EYIA 3ILTB 1XVXA 1JEUA 2DWIA 2REJA 2ZZWA 1Y4TA 3BIHA 2JJKA 3KBZA 1LLSA 4ELQA 1FSAA 1I6AA 4EQ7A 2QRYA 4EUOA 3TYHA 3HFUA 2ZYNA 4GX4A 4IO2A 2XXUA 4I8CA 3B6WA 3RY3A 3QUJA 3VLUA 2I3VA 2O7UA 3B8BA 4LQ2A 2XWOA 5I57B 1QUKA 3LSFB 4H8IA 4AB5A 2H4IA 4XIGQ 3HCQA 3FATA 3ONMA 1P1WA 5H8HA 3FV1A 4MH5A 3TFLA 4H67A 4IO6A 4RPNA 4RYAA 4QRZA 1NI9A 3VVEA 1IXHA 4PFWA 4R6HA 2DYXA 2XD2A 3ZSFA 1EZPA 3KOSA 4OXVA 2XXKA 2FNCA 3UK4A 4U1ZA 2Y7PA 1NV4A 3GBBA 5EHSA 2DE2A 4OFOA 5A5XB 5B70A 1US5A 1LBWA 2BJIA 3N26A 2OX3A 3N6TA 1N84A 2RC9A 4GWWA 4RNSA 3PV0E 4ZEBA 1PB7A 2VPNA 1UIVA 4XFEA 3V83A 1FBGA 1QJMA 1FTKA 4GWOA 4QFNA 3K2DA 3R6UA 4NGUA 3D4CA 3LUZA 1QULA 2V84A 3TCGA 3IX1A 1D4NA 4QFLA 3IR1A 1OLAA 3FZVA 5I59B 1AMFA 2QS1A 4NEDA 3BFTA 3MYUA 3R7XA 4P3LA 2DOJA 1P1UA 1POTA 1GV8A 3IORA 3N5LA 3OELA 3VXCA 4OFLA 1IMCA 1FBDA 1D3KA 1SW4A 1TXFA 4F1UA 5I57A 4JSDA 2B3BA 2LAOA 1WDNA 3KG2A 4P11A 3O6HA 3S9MC 4DE8A 1FTOA 3VXBA 1IMEA 2CEYA 2RINA 1FQDA 4MX6A 4PBQA 1BIYA 1LB8A 2O69A 3IOVA 3B50A 1S50A 4BDRA 1LBVA 2O1MA 1AWBA 3ZKLA 3VE1B 5I2KB 5A5XA 5TU0A 3PMVA 4M4GA 2V4CA 3RN8A 5ICTA 3TAJA 3IB0A 3KFMA 2O84X 4R2BA 2Q89A 5CRYA 4E0XA 2O51A 5CMMA 3OSRA 4PQJA 1Y4CA 1LAHE 1QGXA 3HPIA 3S9NC 2P3NA 1NV7A 2VOZA 3N94A 1GVCA 1OIBA 3TTMA 1MH4A 3VLWA 3N6UA 2HPGA 4K3FA 4FJPA 4OESA 5I59A 4QSEA 2XXWA 3DM0A 3RLFE 1PB9A 4GFRA 3RTWB 3H3GA 4NN3A 2Y84A 2GHAA 1P1NA 2PMSA 4O3BA 1SQYA 1QVSA 3B6QA 2ONSA 1RKMA 2Y7RA 1R1NA 4JWXA 1N0TA 2XXRA 2ZZVA 5TP9B 1HSJA 1FBPA 3TTNA 1NMUA 1D9YA 1UTBA 2HQ0A 4LA9A 4X8RA 3O6GA 1RDYA 5CI5A 1NNKA 1FQFA 1XS5A 3RQTA 1B58A 2UVHA 3MQ9A 4O7MA 3ROJA 1CB6A 1R6ZA 2HXRA 3A09A 1FCKA 4FEDA 3RGYA 3MAMA 2M8CA 3K1MA 3O9PA 4BDOA 1JEVA 1OQGA 3HHFA 4RJZA 2VT5A 3B7DA 5I2KA 1M5BA 1B3HA 3F11A 4DXBA 4R73A 1LAXA 2WBDA 4YKIA 4F2QA 3DP8A 3I3VA 5JEIA 2MKZA 3MP6A 4XF5A 4H45A 4GWYA 1LSTA 4HXVA 1Y3NA 2F3DA 3C33A 2ANJA 2V25A 4R75A 1DBZA 4WXJA 3T1BA 5CBSA 4GD5A 3FUZA 1FPEA 2D5WA 1ZBMA 5FHMA 3G3IA 3SDFA 4P0IA 3EHTA 3O2AA 2UVIA 4EF2A 5AA2B 3I5OA 3T9VA 1B1XA 3IFCA 3B6TA 1LBZA 4EF1A 5F24A 1HSEA 3CSGA 4N6DA 1IXGA 4NHBA 5TP9A 5JTYB 1B5IA 3VLVA 1AH5A 1NH8A 5J16A 3IAZA 1USYE 4G8HA 3JYRA 3G3HA 1P99A 2XXTA 3MPLA 3RUMA 5H8SA 3IB2A 3SKPA 4C0RA 4IY6A 4YZZA 4XKRA 4KYEA 1M5DA 4KFQA 2OWTA 1KA0A 2OZZA 1JP4A 5L9SA 2BJJX 5I84A 3QSLA 1AOVA 1US4A 2PCRA 1IMDA 4PFBA 4P9KA 3TCFA 4HS7A 3SEXA 4FECA 1SYIA 3PGFA 3U1OA 4OERA 1NV3A 3MZBA 3GBAA 1I69A 2AYSA 5I2NA 1A40A 2IEEA 4OVPA 2Z8EA 4GWXA 3C32A 3USDA 1O7TA 3FXUA 3T22A 1ELJA 2YPNA 1LFHA
chains in the Genus database with same CATH topology
1NUZA 5I3SA 4MAGA 1FBFA 4H46A 2PFYA 2ZZWA 3BIHA 4AS5A 2JJKA 3KBZA 3KC1A 2QFLA 4MNIA 3D1RA 1FSAA 1CNQA 2CEXA 3HFUA 4GWUA 5EQ7A 4GX4A 2XWKA 1KA1A 4I3YA 4N4UA 1YXIA 4F19A 2XWVA 3QMFA 3B8BA 2XWOA 3PTYA 4PF8A 2DVZA 4PFRA 4O94A 3NOHA 4IR8A 5ET5A 4PAIA 4N15A 1NI9A 4OVSA 2HHMA 1G0IA 2XXKA 1NUWA 1Q9DA 4MNPA 2WYKA 1NV4A 2DE2A 2VPOA 4P1LA 5A5LA 3LV0A 1LBWA 2BJIA 2FVZA 2OX3A 2DDKA 1FJ6A 5IZZA 4HE0A 1RDXA 4GWWA 2Y5KA 4PFIA 1BK4A 2B4MA 2VPNA 4HCWA 1K9YA 4XFEA 4PC9A 1FBGA 4N8YA 3RPLB 4P8BA 2XA5A 4NGUA 3LUZA 3E79A 2QVVA 4I3EA 4OA4A 1NV5A 4G61A 2QVUA 3E78A 3W9WA 1YYZA 3BIGA 1XI6A 2CZIA 1NUYA 3MYUA 4MIJA 4P3LA 1DCUA 1IMAA 2P3VA 1FJ9A 4MHFA 1FTAA 1IMCA 1FBDA 1FBEA 2WYPA 4F1UA 4GX6A 2WX9A 4MJOA 3U65A 2FHYA 4DI4B 1IMEA 2CEYA 2KQZA 1NV1A 4MX6A 5LDZA 4PBQA 4X04A 1NV0A 4NAPA 3B50A 4PAKA 4GWZA 5I5PA 1LBVA 4JVIA 1AWBA 4N91A 1FPKA 1RDZA 2GQ1A 1SPIA 4MCOA 5DW8A 4N8GA 2V4CA 2WBBA 2Y5LA 4N17A 1DK4A 1K9ZA 4KXPA 4GX3A 4F18A 5EYHA 5FBPA 4PBHA 5IM2A 4P1EA 4OVQA 5EQ9A 4X9TA 4HE1A 5ET8A 2WEFA 3RYDA 1FBHA 1QGXA 5I7IA 4N6KA 1FRPA 2P3NA 5LTCA 3RPLA 1NV7A 4PETA 4PGPA 4NG7A 5EYGA 5EQ8A 2R8TA 2HPGA 2Q8MA 1FPGA 5CM6A 5IZ1A 1KZ8A 4UABA 4PDDA 4NN3A 3CHGA 2V3QA 1LBYA 4YICA 3KC0A 2QVRA 4QBAA 3FXBA 3ISPA 2ZZVA 2CZKA 2FIEA 4PDHA 5IZ3B 4QXDA 2XWIA 1FBPA 4X8RA 1RDYA 3A29A 1FPIA 1FBCA 2L5VA 2QPQA 4JVCA 4N81A 4O7MA 2DE3A 3ROJA 2DE4A 1FPFA 2HXRA 4AS4A 2Q74A 1NV2A 2OWZA 2VT5A 4MNCA 1NUXA 5JK4A 4NX1A 1FPDA 4LN5A 4PE3A 2WBDA 4GWSA 4GBVA 2MKZA 1FPBA 2HZKA 4XF5A 4H45A 4GWYA 4OANA 1G0HA 4HXVA 4NF0A 2F3BA 1D9QA 4JVDA 1INPA 4F1VA 4P47A 5EQAA 2F3DA 4PGNA 2KR0A 3FBPA 1DBZA 2F5XA 3T1BA 3EKIA 1LBXA 4MMPA 4M1VA 1FPEA 4I40A 2FIXA 4PF6A 5ET7A 3IFCA 5IGAA 1LBZA 5F24A 4N6DA 4PTKA 4O7IA 2Q9TA 4O8MA 2B4LA 1IMFA 2HZLA 4NHBA 5IZ3A 2FBPA 5J16A 4OVRA 3W9VA 3T0JA 4HCYA 5ESYA 4GBWA 4PCDA 3SZPA 2CZHA 4PAFA 4YZZA 4OVTA 5J1DA 3IFAA 1LEVA 4DI3D 1EYJA 3MSTA 4MEVA 4XEQA 1KA0A 1JP4A 1EYKA 1YZ0A 1NV6A 2PCRA 1IMDA 4PFBA 4P9KA 1FPJA 3GYYA 4NQ8A 4P56A 1IMBA 4HE2A 2ZZXA 5ET6A 1NV3A 4FBPA 5T3JA 4OVPA 2PFZA 4GWXA 1VDWA 1EYIA 1FPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBZ A;  1LBX A;  1NUZ A;  1FPG A;  5I3S A;  1FBF A;  4H46 A;  2CZI A;  1FPE A;  1NUY A;  4I40 A;  2FIX A;  3BIH A;  4AS5 A;  2JJK A;  3KBZ A;  3KC1 A;  2QFL A;  5IZ1 A;  1KZ8 A;  1FSA A;  3D1R A;  1CNQ A;  1DCU A;  1IMA A;  2P3V A;  5ET7 A;  1FJ9 A;  3IFC A;  4GWU A;  5EQ7 A;  4GX4 A;  1LBY A;  1KA1 A;  3KC0 A;  1LBZ A;  4I3Y A;  5F24 A;  2QVR A;  1YXI A;  1FTA A;  1IMC A;  1FBD A;  3QMF A;  3B8B A;  2CZK A;  2FIE A;  4PTK A;  1FBE A;  4O7I A;  5IZ3 B;  1IMF A;  4QXD A;  4GX6 A;  1FBP A;  5IZ3 A;  4MJO A;  2FBP A;  1RDY A;  3A29 A;  4IR8 A;  5ET5 A;  1FPI A;  5J16 A;  2FHY A;  1FBC A;  1IME A;  3T0J A;  1NV1 A;  1NI9 A;  5ESY A;  5LDZ A;  4GBW A;  4N81 A;  2HHM A;  1NV0 A;  1G0I A;  2CZH A;  3ROJ A;  1FPF A;  1NUW A;  1Q9D A;  4GWZ A;  3IFA A;  4AS4 A;  2Q74 A;  1NV4 A;  1LBV A;  1LEV A;  1EYJ A;  1AWB A;  1NV2 A;  2OWZ A;  1KA0 A;  1FPK A;  1RDZ A;  5A5L A;  2GQ1 A;  1JP4 A;  1EYK A;  1SPI A;  2VT5 A;  3LV0 A;  5DW8 A;  1NUX A;  1LBW A;  1YZ0 A;  2BJI A;  2FVZ A;  2OX3 A;  2DDK A;  2WBB A;  1FJ6 A;  1NV6 A;  2Y5L A;  2PCR A;  1DK4 A;  1K9Z A;  1IMD A;  4KXP A;  1FPD A;  1FPJ A;  4GX3 A;  4HE0 A;  5EYH A;  5FBP A;  1RDX A;  4GWW A;  2WBD A;  2Y5K A;  4GWS A;  1BK4 A;  5EQ9 A;  4HE1 A;  1IMB A;  4HE2 A;  1K9Y A;  5ET8 A;  4GBV A;  2WEF A;  1FBG A;  1FPB A;  5ET6 A;  1NV3 A;  4H45 A;  3RPL B;  3RYD A;  1FBH A;  1QGX A;  4GWY A;  1G0H A;  4HXV A;  4FBP A;  1FRP A;  2P3N A;  5T3J A;  2F3B A;  3LUZ A;  2QVV A;  3RPL A;  1NV7 A;  1D9Q A;  4I3E A;  1INP A;  4GWX A;  1VDW A;  1NV5 A;  5EQA A;  4G61 A;  5EYG A;  2QVU A;  5EQ8 A;  2F3D A;  1YYZ A;  3BIG A;  1EYI A;  2R8T A;  1FPL A;  1XI6 A;  2Q8M A;  3FBP A; 
#chains in the Genus database with same CATH topology
 4FAJ A;  1NUZ A;  3K4U A;  2I4C A;  3ECR A;  2PFY A;  2P1S A;  3JZJ A;  3KC1 A;  2QFL A;  3O28 A;  3ZKK A;  4AB6 A;  4ELO A;  5IAI A;  4GWU A;  4L17 A;  2XWK A;  1KA1 A;  4NF8 B;  4I3Y A;  1YXI A;  4F19 A;  3QMF A;  3TZA A;  1NNP A;  1NKX A;  4FEB A;  3K0V A;  1B7H A;  2AL5 A;  2PBW A;  4ZZA A;  3NOH A;  1MQJ A;  4PAI A;  1POY 1;  1LAG E;  1ZTY A;  2VD3 A;  1RYX A;  1FQB A;  4R74 A;  4FE8 A;  4H0W A;  1NUW A;  1Q9D A;  4ND9 A;  2F34 A;  3H06 B;  4ELR A;  2VPO A;  4P1L A;  4ONY A;  1H43 A;  2FVZ A;  2KLF A;  2DQV A;  5IZZ A;  1VR5 A;  1IIW A;  3DLN A;  1SVX B;  4ISU A;  1ZIU A;  1RDX A;  2OPE A;  3LSW A;  3OO6 A;  2Y5K A;  1MG1 A;  3R26 A;  4PFI A;  4PFY A;  2B4M A;  5ITP A;  4HCW A;  1LFI A;  4U21 A;  3IOW A;  4PC9 A;  3TEP A;  3RPL B;  4G68 B;  4P8B A;  3QAX A;  2XA5 A;  5ICQ A;  2I48 A;  4QF9 A;  1NV5 A;  5CC2 A;  2QVU A;  3I6V A;  3VVF A;  4YAH X;  1O63 A;  4H8J A;  1ZU0 A;  1NUY A;  4NMY A;  3VDF A;  1QW0 A;  4F29 A;  2XHD A;  4MIJ A;  1MPC A;  4ZDM A;  1HSL A;  1Y9U A;  1FJ9 A;  4GIZ A;  4JWO A;  1B05 A;  1B3G A;  4ZEI A;  4BLA A;  1J1N A;  1SI1 A;  3THI A;  1QUI A;  3HV1 A;  1FBE A;  2I6E A;  3CRB A;  3UP9 A;  1XHY A;  1MXV A;  4GX6 A;  1KWH A;  1MPD A;  1IUD A;  4NF6 B;  4R72 A;  1NH7 A;  1PBP A;  1EH3 A;  2HEU A;  3KEI A;  4P0G A;  2WX9 A;  4MJO A;  3U65 A;  4C1T A;  3SET A;  1F9B A;  1LGB C;  2KQZ A;  1P1Q A;  1NV1 A;  2HAV A;  5FTH A;  4NAP A;  1MQG A;  4RY1 A;  5I58 B;  4PAK A;  4WKM A;  4GWZ A;  4OMB A;  5ISU A;  2WKY A;  5AA3 A;  1A8F A;  3UA8 A;  2F7C A;  2Q2C A;  1RDZ A;  2F7B A;  2GQ1 A;  3MW0 A;  1SPI A;  2ESN A;  3MZ1 A;  4OEV A;  5F1Q A;  2WBB A;  4R6K A;  3K6X A;  3IOU A;  4F18 A;  5EYH A;  4PBH A;  2G93 A;  1QUJ A;  4NE4 A;  3TPA A;  5EQ9 A;  4X9T A;  3W15 C;  3Q28 A;  3T93 B;  2DXY A;  1IQ7 A;  2ALU A;  3T66 A;  1FTL A;  4OEN A;  4NF4 A;  1MDQ A;  3RPL A;  4G68 A;  4U22 A;  4PET A;  4PGP A;  4NG7 A;  4H1X A;  4GL8 A;  1MQD A;  2H98 A;  1URG A;  1UIU A;  2Y7W A;  5H8Q B;  3OEK A;  2H99 A;  1EZO A;  5IZ1 A;  3TDJ A;  5K2Y A;  2HAU A;  2V3Q A;  2VD2 A;  4IY5 A;  3KC0 A;  2QVR A;  3A3U A;  4QBA A;  4DXU A;  3RPW A;  1B5J A;  1JQF A;  4DDD A;  4PDH A;  3K1N A;  4QXD A;  2XWI A;  1A8E A;  4X1D A;  4OET A;  3Q26 A;  4R9F A;  3IO6 A;  4NF6 A;  4NTL A;  1FQC A;  4JVC A;  1SD3 A;  4N81 A;  1MY2 A;  2DE3 A;  2DE4 A;  4TOZ A;  1FPF A;  2I0C A;  1T0K A;  5I58 A;  4FOR A;  1UTB B;  2OWZ A;  4THI A;  3UOR A;  4EXK A;  1AL3 A;  4E0W A;  1BLF A;  4MNC A;  1IIT A;  3PUW E;  2ZYK A;  5JK4 A;  1IXC A;  3KN8 A;  4KI0 E;  4ZEC A;  3GZG A;  4LZ8 A;  3G3J A;  4PE3 A;  4Q5T A;  4GWS A;  3SEU A;  3TMG A;  1ZJL A;  4GBV A;  2YJP A;  3PMX A;  2HZK A;  4IO5 A;  4MLQ A;  4G2Z A;  4LVQ A;  2Z22 A;  1G0H A;  2RC8 A;  3QXM A;  2XD3 A;  3OSQ A;  3IK6 B;  4P47 A;  3MVZ A;  4JWY A;  3G3F A;  4JB7 A;  2X26 A;  4PE5 B;  3TKD A;  3FXR A;  3FBP A;  2F5X A;  2IA4 A;  3VFJ A;  1LBX A;  4M1V A;  1MY4 A;  2DS9 A;  3G3G A;  1DPP A;  2FIX A;  4PF6 A;  5H8Q A;  3CR9 A;  4QHQ A;  4F39 A;  4F3P A;  4LZ7 A;  2QJE A;  5KCJ A;  5IGA A;  2Z8D A;  4DIG A;  4EXL A;  1QKB A;  1A99 A;  4QSC A;  4PTK A;  2B4L A;  2HZL A;  1A54 A;  4I1D A;  4ZEK A;  3DEL B;  3U92 A;  4Z7E A;  1N3X A;  3L6G A;  3M3L A;  3W9V A;  4HCY A;  4GBW A;  4PCD A;  1N7W A;  2I0B A;  5FHO A;  2CZH A;  4KQP A;  4PAF A;  4JXI A;  3CG1 A;  3CFX A;  4U1O A;  5J1D A;  3C34 A;  5AA4 B;  4IGR A;  1OQH A;  1Y3Q A;  4DI3 D;  1PBQ A;  3MST A;  3C36 A;  5ITO A;  1MXZ A;  1NV6 A;  4LZ5 A;  2XX7 A;  4Q0C A;  5BWJ A;  4OQO A;  2Q8J A;  4Q30 B;  4G77 A;  3LSX A;  5I56 B;  4NQ8 A;  5DVJ A;  2QSX A;  4P56 A;  4LON B;  3U72 A;  3V5A A;  3EN3 A;  2QMW A;  1MQH A;  4YKP A;  1IMB A;  2ZZX A;  1VFD A;  4R2F A;  3O29 A;  4XKP A;  3ILU B;  1BP5 A;  1XC1 A;  4FBP A;  2DXR A;  5T3J A;  1DSN A;  3K1P A;  5H8N A;  3OO9 A;  2ZYM A;  1AIV A;  3T9X B;  2OPD A;  2DWH A;  2DWJ A;  4OYV A;  2XXX A;  1DTG A;  5EHM A;  1FPL A;  5I3S A;  4MAG A;  1FBF A;  4H46 A;  4N6P A;  5H8F B;  2R71 A;  4Z0I A;  3PPQ A;  1MPB A;  1XVY A;  3OMB A;  2RF1 A;  2V3U A;  3KZG A;  5I2N B;  2UVG A;  1UQW A;  5CBR A;  4N4U A;  2XWV A;  3PPR A;  3PTY A;  1A55 A;  4XKQ A;  1OVB A;  3FJM A;  4UA8 A;  2DVZ A;  1QKA A;  4PFR A;  4QFP A;  4O94 A;  2R9J A;  1TFD A;  1GTK A;  1NNT A;  2HFB A;  2ZNU A;  4IR8 A;  3FXQ A;  2HXW A;  5TPA B;  1SW2 A;  5AE4 A;  4N15 A;  1USY H;  1R9L A;  4GOT A;  1Y1M A;  3M8U A;  3TQL A;  4MNP A;  2WYK A;  3H6U A;  1JW1 A;  5AA4 A;  3T96 B;  1PC3 A;  3FGS A;  4HTG A;  5A5L A;  4GQO A;  3HST A;  3RNN A;  1FQE A;  2NOO A;  1FW0 A;  3LV0 A;  1UTH B;  1H3D A;  2GH9 A;  1FJ6 A;  1B32 A;  5DTB A;  1PDA A;  4HE0 A;  1JET A;  4U2R A;  3CG3 A;  4XKN A;  1BK4 A;  1XOC A;  2NVU B;  1Y20 A;  5I56 A;  3MVW A;  4OTE A;  3OXN A;  4G8M A;  4F31 B;  4RPO A;  1LBB A;  3MWB A;  3E79 A;  3CIJ A;  2XXI A;  2F7A A;  4I3E A;  3FAS A;  3CFL A;  3KSX A;  1B3E A;  3CVG A;  3E78 A;  3W9W A;  4N13 A;  4ESW A;  3LR1 A;  2YLN A;  3T9U A;  3H6T A;  1OVT A;  1H76 A;  5K2X A;  5H8F A;  4G68 C;  1Y3P A;  1P1O A;  1DCU A;  4MBP A;  3DP6 A;  4KCD A;  3O6I A;  4KYD A;  4MHF A;  1Y1Z A;  4TLM B;  3Q27 A;  3O97 A;  4RXL A;  4JBZ A;  1FTM A;  5IKB A;  3C4M A;  3KJ7 A;  1URD A;  4XTC Q;  4YKK A;  2PX1 A;  2FHY A;  1B7U A;  3U8Q A;  4DI4 B;  2XXP A;  5LDZ A;  5TPA A;  3KN3 A;  4GRK A;  2CMO A;  2ZXT A;  1MRP A;  3K02 A;  4ZEF A;  2AL4 A;  4MLV A;  5DVI A;  1DMB A;  1LFG A;  3BFU A;  4X48 A;  4POX A;  1FPK A;  1EZ9 A;  2PT1 A;  3IJX B;  1LBC A;  4MCO A;  5DW8 A;  1JW5 A;  1A7L A;  3QYT A;  1VSO A;  4YB5 A;  2B3F A;  2Y5L A;  3RT6 B;  1XT8 A;  1DK4 A;  1K9Z A;  1UTH A;  5FBP A;  5IM2 A;  4P1E A;  2NWJ A;  2D21 A;  4OVQ A;  4HE1 A;  4AQ4 A;  1JVY A;  3VVD A;  4GLI A;  1JNF A;  3KBR A;  2WEF A;  4NF5 B;  4IB2 A;  4QSD A;  1FBH A;  3SEY A;  1B1H A;  3TTK A;  1MXU A;  1Q35 A;  4GF8 A;  1JVX A;  3BBR A;  2OLB A;  2V3T A;  1L5T A;  5EQ8 A;  3Q25 A;  3O66 A;  4KPT A;  2R8T A;  1FQA A;  1GGG A;  1YPN A;  3CSB A;  1FPG A;  3OD7 A;  3S2V A;  2FA7 A;  5CM6 A;  4KCC A;  4UAB A;  4NF4 B;  4H5F A;  4PDD A;  1SDX A;  4OWD A;  2RCB A;  1PB8 A;  5AA2 D;  4NWC A;  3PD8 A;  3CHG A;  2QS3 A;  3Q29 A;  2A5T B;  4YIC A;  2O1L A;  3VV5 A;  4WEP A;  3MUQ A;  1ZKB A;  4GVO A;  3MP1 A;  2CZK A;  2ZMB A;  2FIE A;  4JSO A;  4DCX A;  1I6B A;  5IZ3 B;  4FAT A;  3HO7 A;  4YKJ A;  1S7Y A;  1DOT A;  1B6H A;  2THI A;  1SW5 A;  4I9D A;  2L5V A;  2QPQ A;  2AIX A;  5CMB A;  3AXF A;  3HHG A;  2I58 A;  4AS4 A;  2Q74 A;  4C1U A;  4F2O A;  1NV2 A;  3RT8 A;  1URS A;  1NUX A;  3MVX A;  3H6V A;  4LN5 A;  4IO7 A;  2F35 A;  3FV2 A;  4KYS A;  2PVU A;  3PUZ E;  4N07 A;  3M3F A;  1TFA A;  2Z23 A;  5M2V A;  4NF5 A;  4NF0 A;  2F8D A;  2I3W A;  1N04 A;  1RYO A;  4UAC A;  1D9Q A;  4JVD A;  1INP A;  5EQA A;  1N7X A;  1B7Z A;  5F7V A;  3EKI A;  4MMP A;  3UGW A;  4I40 A;  4H6D A;  2X7Q A;  1DTZ A;  4DCY A;  4Q8R A;  3FJG A;  5ET7 A;  2R6G E;  2Y7I A;  2Z8F A;  3PD9 A;  4U4X A;  2A5T A;  4BDL A;  1BKA A;  4IO4 A;  5FTI A;  3OEN A;  2Q9T A;  4QFO A;  4O8M A;  4BDM A;  1WVJ A;  3IL1 B;  3MPK A;  5IZ3 A;  4F3B A;  1S9T A;  2FBP A;  4GL0 A;  4OVR A;  5KZT A;  5KCJ B;  3T0J A;  2OK2 A;  4YMB A;  4HW8 A;  1GR2 A;  3IFA A;  3IO4 A;  5EYF A;  3DP4 A;  4YMA A;  3WAF A;  5AA1 A;  4DLD A;  2ABH A;  1EYK A;  2OJT A;  3K01 A;  1SBP A;  3QIM A;  3TTL A;  1YZ0 A;  1B0H A;  3QK6 A;  4LP2 B;  3UIF A;  4ZS9 A;  4BDQ A;  1FPJ A;  3GYY A;  1B5H A;  1MS7 A;  5DEX B;  1OLC A;  2O68 A;  1B4H A;  3PMW A;  2F6G A;  4HE2 A;  4EQ9 A;  3MP8 A;  4F1Y A;  2QS2 A;  4FIM A;  3SES A;  1MY0 A;  2ZNS A;  5DVF A;  1NNF A;  3E13 X;  1BTJ A;  4I62 A;  4O3C A;  1ATG A;  1YTV A;  4DZ1 A;  3C35 A;  3OEM A;  3G3K A;  3WAE A;  1MDP 1;  2O7I A;  4AS5 A;  1WOD A;  4MNI A;  3D1R A;  1CNQ A;  1YAE A;  2D3I A;  3A3C A;  2CEX A;  5H8N B;  3KN7 A;  3TUS A;  5EQ7 A;  2NUV A;  3D4G A;  3S4U A;  3IJO B;  3FVN A;  4PF8 A;  1M5E A;  1EU8 A;  4POW A;  3V8X B;  3MVY A;  5ELV A;  1LCT A;  2G29 A;  5ET5 A;  2H5Y A;  2I4B A;  1B9J A;  4OVS A;  4ESX A;  2HHM A;  1MXW A;  1G0I A;  3EHU A;  2PT2 A;  3TOD A;  1SYH A;  2F36 A;  1SI0 A;  2UVJ A;  2H25 A;  3TEL A;  2F78 A;  3C31 A;  4U23 A;  4EDP A;  3CI8 A;  3TQW A;  1LB9 A;  2XX8 A;  1B4Z A;  2DWA A;  3KGC A;  3H6W A;  4ECF A;  2ZNT A;  1B3F A;  1MQI A;  1MXY A;  3FIR A;  2DDK A;  3PUV E;  1JW4 A;  4MF3 A;  4G4P A;  3P7I A;  3FVG A;  3OO8 A;  5KDT B;  5DEX A;  2UYE A;  1K9Y A;  1B2H A;  4TQU Q;  2E1S A;  4N8Y A;  3SEW A;  1Z7M E;  3TCH A;  2VHA A;  1CE2 A;  2DP8 A;  2QVV A;  2CZL A;  4OA4 A;  2DVC A;  3LUY A;  4H5G A;  4G61 A;  3S9E A;  1YYZ A;  3BIG A;  3ZS6 A;  4ZZE A;  1XI6 A;  4IO3 A;  5CMK A;  2PYY A;  1B3L A;  2GHB A;  2CZI A;  3K6U A;  3MC2 A;  3HN0 A;  3E9X A;  1VE4 A;  1VFE A;  3FVK A;  2X7P A;  1IMA A;  2F97 A;  2P3V A;  2VGQ A;  3UN6 A;  2QMX A;  3KJT A;  3S9L C;  4MFI A;  1MXX A;  4RK2 A;  2O6A A;  1FTA A;  3EF7 A;  4RK9 A;  4XXU A;  3PUX E;  4G8N A;  3PUY E;  2WYP A;  3LC8 A;  1NFT A;  1MM6 A;  3SER A;  2ZYO A;  1MY1 A;  2OBG A;  2XXY A;  3EPE A;  4KHZ E;  1IZ1 A;  5HBC A;  3GXA A;  1LCF A;  4X04 A;  1NV0 A;  4GXA A;  2V93 A;  4DXC A;  3EQ1 A;  2Q2A A;  2B65 A;  3MZ9 A;  5HPQ A;  1IXI A;  5I5P A;  3G7W A;  4X1B A;  5L9O A;  4JVI A;  1Z7N E;  3OOA A;  4N91 A;  1N3W A;  4N8G A;  1NL5 A;  4YU0 A;  5L8D A;  4LQ5 A;  4N17 A;  4KXP A;  4GX3 A;  5DT6 A;  3LBS A;  3H7M A;  2UYF A;  1B0L A;  2P0S A;  3MBP A;  3QUF A;  4BDN A;  4NWD A;  2Q88 A;  2REG A;  2RC7 A;  4KD5 A;  5KDT A;  5ET8 A;  2Y7K A;  4PFT A;  4ZED A;  3RYD A;  5I7I A;  3ODB A;  4N6K A;  4YB7 A;  1FRP A;  5LTC A;  3JV9 A;  2XXH A;  5EYG A;  1D9V A;  3E3K A;  3BKI B;  2Q8M A;  3PPN A;  1O64 A;  2ONR A;  1YCJ A;  1LAF E;  3EHS A;  4F22 A;  1KZ8 A;  4O3A A;  4WED A;  3KSJ A;  2ONK E;  1LBY A;  3C9H A;  4OVJ A;  1B51 A;  3FXB A;  3ISP A;  3V89 B;  3TTR A;  3LSL A;  4EQB A;  1ZLQ A;  3H4Z A;  4ELP A;  1ZMG A;  3A29 A;  4OHN A;  1FPI A;  1FBC A;  5L9M A;  2UXA A;  1OMP A;  2FYI A;  3T9H B;  1N76 A;  4F3G A;  2GFE A;  2GRV A;  2E0S A;  2OWS A;  1PEB A;  2VP1 A;  4KR5 A;  3MJN A;  3K6W A;  1H45 A;  3M3K A;  1B52 A;  3E4R A;  4NX1 A;  4U4S A;  1FPD A;  3GLB A;  1TT1 A;  4ZE9 A;  1Q1K A;  4TLL B;  3K6V A;  1B46 A;  1II5 A;  1FPB A;  2DSF A;  4OAN A;  2F3B A;  4F1V A;  5AA2 A;  2XXV A;  2NXO A;  4PP0 A;  1MH3 A;  5BUU A;  4R6Y A;  4PGN A;  2KR0 A;  2RCA A;  3FD3 A;  4LAT A;  4R9G A;  2F6P A;  5JTY A;  5LOM A;  2RKM A;  2I49 A;  4OFJ A;  1TWY A;  4ZE8 A;  4O7I A;  3IOT A;  1IMF A;  4JDF A;  2XXQ A;  3IB1 A;  3PU5 A;  4RA1 A;  5H8H B;  1M5F A;  3L6H A;  3KOT A;  3OO7 A;  4QFK A;  4F3S A;  2XX9 A;  3FVO A;  3U93 A;  5ESY A;  4IGT A;  2QL3 A;  1MM7 A;  3SZP A;  5FHN A;  3SEV A;  1H44 A;  2HCA A;  3PPO A;  4OVT A;  4H65 A;  5HM4 B;  4OZ9 A;  1LEV A;  4OEU A;  1EYJ A;  4MEV A;  4XEQ A;  2W7Y A;  1DPE A;  2OCU A;  1M5C A;  5B7D A;  1I6Q A;  3K00 A;  2A5S A;  1FTJ A;  3H03 A;  3FJ7 A;  2QS4 A;  1SW1 A;  1MY3 A;  3RTF B;  5CMC A;  4PFU A;  1IEJ A;  1ANF A;  5ET6 A;  2P2A A;  3CFZ A;  4LUB A;  3PPP A;  3U94 A;  1R9Q A;  2PFZ A;  4GXS B;  1VDW A;  4YB6 A;  1B40 A;  5DYH A;  2H9B A;  4NF8 A;  1EYI A;  3ILT B;  1XVX A;  1JEU A;  2DWI A;  2REJ A;  2ZZW A;  1Y4T A;  3BIH A;  2JJK A;  3KBZ A;  1LLS A;  4ELQ A;  1FSA A;  1I6A A;  4EQ7 A;  2QRY A;  4EUO A;  3TYH A;  3HFU A;  2ZYN A;  4GX4 A;  4IO2 A;  2XXU A;  4I8C A;  3B6W A;  3RY3 A;  3QUJ A;  3VLU A;  2I3V A;  2O7U A;  3B8B A;  4LQ2 A;  2XWO A;  5I57 B;  1QUK A;  3LSF B;  4H8I A;  4AB5 A;  2H4I A;  4XIG Q;  3HCQ A;  3FAT A;  3ONM A;  1P1W A;  5H8H A;  3FV1 A;  4MH5 A;  3TFL A;  4H67 A;  4IO6 A;  4RPN A;  4RYA A;  4QRZ A;  1NI9 A;  3VVE A;  1IXH A;  4PFW A;  4R6H A;  2DYX A;  2XD2 A;  3ZSF A;  1EZP A;  3KOS A;  4OXV A;  2XXK A;  2FNC A;  3UK4 A;  4U1Z A;  2Y7P A;  1NV4 A;  3GBB A;  5EHS A;  2DE2 A;  4OFO A;  5A5X B;  5B70 A;  1US5 A;  1LBW A;  2BJI A;  3N26 A;  2OX3 A;  3N6T A;  1N84 A;  2RC9 A;  4GWW A;  4RNS A;  3PV0 E;  4ZEB A;  1PB7 A;  2VPN A;  1UIV A;  4XFE A;  3V83 A;  1FBG A;  1QJM A;  1FTK A;  4GWO A;  4QFN A;  3K2D A;  3R6U A;  4NGU A;  3D4C A;  3LUZ A;  1QUL A;  2V84 A;  3TCG A;  3IX1 A;  1D4N A;  4QFL A;  3IR1 A;  1OLA A;  3FZV A;  5I59 B;  1AMF A;  2QS1 A;  4NED A;  3BFT A;  3MYU A;  3R7X A;  4P3L A;  2DOJ A;  1P1U A;  1POT A;  1GV8 A;  3IOR A;  3N5L A;  3OEL A;  3VXC A;  4OFL A;  1IMC A;  1FBD A;  1D3K A;  1SW4 A;  1TXF A;  4F1U A;  5I57 A;  4JSD A;  2B3B A;  2LAO A;  1WDN A;  3KG2 A;  4P11 A;  3O6H A;  3S9M C;  4DE8 A;  1FTO A;  3VXB A;  1IME A;  2CEY A;  2RIN A;  1FQD A;  4MX6 A;  4PBQ A;  1BIY A;  1LB8 A;  2O69 A;  3IOV A;  3B50 A;  1S50 A;  4BDR A;  1LBV A;  2O1M A;  1AWB A;  3ZKL A;  3VE1 B;  5I2K B;  5A5X A;  5TU0 A;  3PMV A;  4M4G A;  2V4C A;  3RN8 A;  5ICT A;  3TAJ A;  3IB0 A;  3KFM A;  2O84 X;  4R2B A;  2Q89 A;  5CRY A;  4E0X A;  2O51 A;  5CMM A;  3OSR A;  4PQJ A;  1Y4C A;  1LAH E;  1QGX A;  3HPI A;  3S9N C;  2P3N A;  1NV7 A;  2VOZ A;  3N94 A;  1GVC A;  1OIB A;  3TTM A;  1MH4 A;  3VLW A;  3N6U A;  2HPG A;  4K3F A;  4FJP A;  4OES A;  5I59 A;  4QSE A;  2XXW A;  3DM0 A;  3RLF E;  1PB9 A;  4GFR A;  3RTW B;  3H3G A;  4NN3 A;  2Y84 A;  2GHA A;  1P1N A;  2PMS A;  4O3B A;  1SQY A;  1QVS A;  3B6Q A;  2ONS A;  1RKM A;  2Y7R A;  1R1N A;  4JWX A;  1N0T A;  2XXR A;  2ZZV A;  5TP9 B;  1HSJ A;  1FBP A;  3TTN A;  1NMU A;  1D9Y A;  1UTB A;  2HQ0 A;  4LA9 A;  4X8R A;  3O6G A;  1RDY A;  5CI5 A;  1NNK A;  1FQF A;  1XS5 A;  3RQT A;  1B58 A;  2UVH A;  3MQ9 A;  4O7M A;  3ROJ A;  1CB6 A;  1R6Z A;  2HXR A;  3A09 A;  1FCK A;  4FED A;  3RGY A;  3MAM A;  2M8C A;  3K1M A;  3O9P A;  4BDO A;  1JEV A;  1OQG A;  3HHF A;  4RJZ A;  2VT5 A;  3B7D A;  5I2K A;  1M5B A;  1B3H A;  3F11 A;  4DXB A;  4R73 A;  1LAX A;  2WBD A;  4YKI A;  4F2Q A;  3DP8 A;  3I3V A;  5JEI A;  2MKZ A;  3MP6 A;  4XF5 A;  4H45 A;  4GWY A;  1LST A;  4HXV A;  1Y3N A;  2F3D A;  3C33 A;  2ANJ A;  2V25 A;  4R75 A;  1DBZ A;  4WXJ A;  3T1B A;  5CBS A;  4GD5 A;  3FUZ A;  1FPE A;  2D5W A;  1ZBM A;  5FHM A;  3G3I A;  3SDF A;  4P0I A;  3EHT A;  3O2A A;  2UVI A;  4EF2 A;  5AA2 B;  3I5O A;  3T9V A;  1B1X A;  3IFC A;  3B6T A;  1LBZ A;  4EF1 A;  5F24 A;  1HSE A;  3CSG A;  4N6D A;  1IXG A;  4NHB A;  5TP9 A;  5JTY B;  1B5I A;  3VLV A;  1AH5 A;  1NH8 A;  5J16 A;  3IAZ A;  1USY E;  4G8H A;  3JYR A;  3G3H A;  1P99 A;  2XXT A;  3MPL A;  3RUM A;  5H8S A;  3IB2 A;  3SKP A;  4C0R A;  4IY6 A;  4YZZ A;  4XKR A;  4KYE A;  1M5D A;  4KFQ A;  2OWT A;  1KA0 A;  2OZZ A;  1JP4 A;  5L9S A;  2BJJ X;  5I84 A;  3QSL A;  1AOV A;  1US4 A;  2PCR A;  1IMD A;  4PFB A;  4P9K A;  3TCF A;  4HS7 A;  3SEX A;  4FEC A;  1SYI A;  3PGF A;  3U1O A;  4OER A;  1NV3 A;  3MZB A;  3GBA A;  1I69 A;  2AYS A;  5I2N A;  1A40 A;  2IEE A;  4OVP A;  2Z8E A;  4GWX A;  3C32 A;  3USD A;  1O7T A;  3FXU A;  3T22 A;  1ELJ A;  2YPN A;  1LFH A; 
#chains in the Genus database with same CATH homology
 1NUZ A;  5I3S A;  4MAG A;  1FBF A;  4H46 A;  2PFY A;  2ZZW A;  3BIH A;  4AS5 A;  2JJK A;  3KBZ A;  3KC1 A;  2QFL A;  4MNI A;  3D1R A;  1FSA A;  1CNQ A;  2CEX A;  3HFU A;  4GWU A;  5EQ7 A;  4GX4 A;  2XWK A;  1KA1 A;  4I3Y A;  4N4U A;  1YXI A;  4F19 A;  2XWV A;  3QMF A;  3B8B A;  2XWO A;  3PTY A;  4PF8 A;  2DVZ A;  4PFR A;  4O94 A;  3NOH A;  4IR8 A;  5ET5 A;  4PAI A;  4N15 A;  1NI9 A;  4OVS A;  2HHM A;  1G0I A;  2XXK A;  1NUW A;  1Q9D A;  4MNP A;  2WYK A;  1NV4 A;  2DE2 A;  2VPO A;  4P1L A;  5A5L A;  3LV0 A;  1LBW A;  2BJI A;  2FVZ A;  2OX3 A;  2DDK A;  1FJ6 A;  5IZZ A;  4HE0 A;  1RDX A;  4GWW A;  2Y5K A;  4PFI A;  1BK4 A;  2B4M A;  2VPN A;  4HCW A;  1K9Y A;  4XFE A;  4PC9 A;  1FBG A;  4N8Y A;  3RPL B;  4P8B A;  2XA5 A;  4NGU A;  3LUZ A;  3E79 A;  2QVV A;  4I3E A;  4OA4 A;  1NV5 A;  4G61 A;  2QVU A;  3E78 A;  3W9W A;  1YYZ A;  3BIG A;  1XI6 A;  2CZI A;  1NUY A;  3MYU A;  4MIJ A;  4P3L A;  1DCU A;  1IMA A;  2P3V A;  1FJ9 A;  4MHF A;  1FTA A;  1IMC A;  1FBD A;  1FBE A;  2WYP A;  4F1U A;  4GX6 A;  2WX9 A;  4MJO A;  3U65 A;  2FHY A;  4DI4 B;  1IME A;  2CEY A;  2KQZ A;  1NV1 A;  4MX6 A;  5LDZ A;  4PBQ A;  4X04 A;  1NV0 A;  4NAP A;  3B50 A;  4PAK A;  4GWZ A;  5I5P A;  1LBV A;  4JVI A;  1AWB A;  4N91 A;  1FPK A;  1RDZ A;  2GQ1 A;  1SPI A;  4MCO A;  5DW8 A;  4N8G A;  2V4C A;  2WBB A;  2Y5L A;  4N17 A;  1DK4 A;  1K9Z A;  4KXP A;  4GX3 A;  4F18 A;  5EYH A;  5FBP A;  4PBH A;  5IM2 A;  4P1E A;  4OVQ A;  5EQ9 A;  4X9T A;  4HE1 A;  5ET8 A;  2WEF A;  3RYD A;  1FBH A;  1QGX A;  5I7I A;  4N6K A;  1FRP A;  2P3N A;  5LTC A;  3RPL A;  1NV7 A;  4PET A;  4PGP A;  4NG7 A;  5EYG A;  5EQ8 A;  2R8T A;  2HPG A;  2Q8M A;  1FPG A;  5CM6 A;  5IZ1 A;  1KZ8 A;  4UAB A;  4PDD A;  4NN3 A;  3CHG A;  2V3Q A;  1LBY A;  4YIC A;  3KC0 A;  2QVR A;  4QBA A;  3FXB A;  3ISP A;  2ZZV A;  2CZK A;  2FIE A;  4PDH A;  5IZ3 B;  4QXD A;  2XWI A;  1FBP A;  4X8R A;  1RDY A;  3A29 A;  1FPI A;  1FBC A;  2L5V A;  2QPQ A;  4JVC A;  4N81 A;  4O7M A;  2DE3 A;  3ROJ A;  2DE4 A;  1FPF A;  2HXR A;  4AS4 A;  2Q74 A;  1NV2 A;  2OWZ A;  2VT5 A;  4MNC A;  1NUX A;  5JK4 A;  4NX1 A;  1FPD A;  4LN5 A;  4PE3 A;  2WBD A;  4GWS A;  4GBV A;  2MKZ A;  1FPB A;  2HZK A;  4XF5 A;  4H45 A;  4GWY A;  4OAN A;  1G0H A;  4HXV A;  4NF0 A;  2F3B A;  1D9Q A;  4JVD A;  1INP A;  4F1V A;  4P47 A;  5EQA A;  2F3D A;  4PGN A;  2KR0 A;  3FBP A;  1DBZ A;  2F5X A;  3T1B A;  3EKI A;  1LBX A;  4MMP A;  4M1V A;  1FPE A;  4I40 A;  2FIX A;  4PF6 A;  5ET7 A;  3IFC A;  5IGA A;  1LBZ A;  5F24 A;  4N6D A;  4PTK A;  4O7I A;  2Q9T A;  4O8M A;  2B4L A;  1IMF A;  2HZL A;  4NHB A;  5IZ3 A;  2FBP A;  5J16 A;  4OVR A;  3W9V A;  3T0J A;  4HCY A;  5ESY A;  4GBW A;  4PCD A;  3SZP A;  2CZH A;  4PAF A;  4YZZ A;  4OVT A;  5J1D A;  3IFA A;  1LEV A;  4DI3 D;  1EYJ A;  3MST A;  4MEV A;  4XEQ A;  1KA0 A;  1JP4 A;  1EYK A;  1YZ0 A;  1NV6 A;  2PCR A;  1IMD A;  4PFB A;  4P9K A;  1FPJ A;  3GYY A;  4NQ8 A;  4P56 A;  1IMB A;  4HE2 A;  2ZZX A;  5ET6 A;  1NV3 A;  4FBP A;  5T3J A;  4OVP A;  2PFZ A;  4GWX A;  1VDW A;  1EYI A;  1FPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...