1DKXA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFDELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
total genus 68
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkxA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkxA01
4JN4A 3DPOA 4EZSA 1DKYA 3T4AG 4EZYA 4EZVA 1DKZA 4E81A 1DG4A 4EZNA 5TKYA 4EZXA 4WV5A 3L3OM 1U00A 4HYBA 3H0XA 4R5IA 4EZPA 3C7NB 3DOBA 4EZRA 4EZUA 4H6HA 4H6IA 4EZOA 1DKXA 2QXLA 2WINM 4EZQA 4R5GA 3N8EA 3DPQA 4PO2A 4EZWA 3DPPA 3D2EA 4WV7A 4EZZA 4JNEA 2OP6A 4R5LA 3T46A 4B9QA 4F00A 4R5JA 1BPRA 3DQGA 4JWDA 4JWEA 4F01A 4JWCA 2BPRA 2V7YA 4HY9A 3OHXM 3D2FA 3T48A 3QNJA 7HSCA 4JWIA 1YUWA 2QFFA 4EZTA 2KHOA 3C7NA 5E84A 1Q5LA 4FL9A 3T47A 4JNFA 1CKRA 4R5KA 3T49A
chains in the Genus database with same CATH superfamily
1R34A 1SU8A 1QWNA 3SOGA 1Y2OA 2JNKA 1R5EA 1PS3A 3I2WA 2ZXQA 4PO2A 3DPPA 3T46A 3M3WA 2Z0NA 4JWIA 3DDGA 2PY6A 2ND1A 2Q13A 3BUBA 3OWGA 2Z0OA 4IWOA 3BVVA 4WV5A 4JL9A 1I4TA 4D8JA 2C08A 4JNEA 3EJSA 4IWQA 3D2FA 1OAOA 2RAKA 4R5KA 3ACOA 4UDXX 1LQ7A 2YI9A 3O3NB 4AZCB 2X3XA 2WINM 4E3CA 3Q84A 3CKDA 2LXYA 1GNLA 3DYTA 1TQSA 4JWCA 3BVUA 4IM3A 3D4YA 3BVTA 2EX3B 3I39X 3DPOA 1OA1A 5TKYA 3VKHA 2WYIA 3ZEFA 3BUDA 2YIBA 4G6QA 4EZZA 1SUFA 4R5JA 3T48A 3G9GA 1YUWA 1Q5LA 3HAIA 3HAHA 4ATMA 3OK8A 1I4DA 3C7NB 1O7DB 2X3WA 2FICA 4WPCA 4R5LA 3BVXA 1X04A 3D50A 4ILHB 3BUPA 5FLEX 4EZSA 3VEAA 2RAIA 3H0XA 3DOBA 4HR1A 2V0OA 4MQDA 3RV1A 2WYHA 4HY9A 4FL9A 2O0I1 4EZTA 5E84A 2LM0A 2YI8A 4EZYA 4HYBA 1TQTA 2Z0VA 3N8EA 3DPQA 4NSWA 3GI7A 3SYVA 1GNTA 1BPRA 3ER8C 3BUQA 1E2UA 2ND0A 5KBPA 1UPXA 3EJRA 5FIGA 2F7QA 1DKZA 4M0MA 4JLCA 4NQIA 2EFLA 3LMFA 4EZWA 3HAJA 3CZNA 3RV0A 4F01A 4ILIA 2QFFA 3DX3A 4HR1B 2GA9D 2YLLA 1CKRA 2YL8A 3FD9A 3UITA 4EZNA 2N3KA 3DX4A 2OBMA 3L3OM 3L3PA 4H6HA 4EZQA 4WPEA 5C5BA 3A98A 3D2EA 3DDFA 3QWEA 3VEBA 2EWFA 2YKTA 2D4CA 3ER9B 3LLLA 4IM2A 3BLBA 1OA0A 4H8SA 1I49A 3T49A 1ZWWA 3SBSA 3QE6A 2EFKA 3KAWA 4EZPA 2QXLA 4R5GA 3QA8A 3ERCC 2YIAA 3DX2A 1I4LA 3KDRA 4F00A 1HWWA 2F7OA 3CZSA 3QNIA 4AZ6A 3DX1A 3O3OB 1TQVA 4BNEA 1DG4A 3D52A 3B52X 3PLTA 4AZ5A 4DCNC 3EJTA 4NPHA 2YLAA 1SU7A 1TQUA 1WDZA 2OW7A 4ILGA 2MI7A 3BVWA 1W9MA 4IWPA 2OZNB 1SU6A 1DKYA 4DYLA 2F1BA 2F18A 4I43A 4EZOA 1DKXA 1X03A 1JQKA 2YL9A 3DQGA 2Z8YA 2V7YA 1QWUA 2D1LA 2YL6A 3D4ZA 1ZYLA 2GF4A 4AVMA 2QKWA 2OW6A 3T4AG 3I01A 4FZOA 4IM0A 1U00A 4KIKA 3Q0KA 4R5IA 3I04A 4EZRA 4EZUA 1YWMA 2FYVA 3LVTA 1TQWA 3EJPA 4FM3A 4JWDA 3CV5A 2OO2A 2X3VA 3OHXM 3C7NA 2ALWA 3T47A 4JNFA 3B51X 2GAFD 1MJGA 4JN4A 2JNSA 3EJQA 4AZHA 4EZVA 4E81A 4FZSA 2X5CA 4AKVA 1R33A 3CVRA 4IW0A 4WV7A 2OP6A 3B53X 1HTYA 2BPRA 2F1AA 4B9QA 1O7DC 2YL5A 4FZPA 2F7PA 3KAVA 3EJUA 3O3MB 4AZ7A 2ELBA 1GN9A 3CAZA 4JWEA 4KIKB 2YIVX 3QNJA 2RAJA 2KHOA 1QX1A 3F7WA 1URUA 4AZBA 3DX0A 4EZXA 2RT6A 2F7RA 4H6IA 3RPMA 4AZGA 2NCZA 1E9VA 4UDYX 3D51A 4I1QA 1E1DA 7HSCA 2PMRA 1HXKA 3ZEDA 4AZCA 2Q12A 4AZIA 5C5BB 2OBLA 3SBTB 3BUIA 3ABHA
chains in the Genus database with same CATH topology
3UITA 1SU8A 3T4AG 3I01A 4EZNA 2N3KA 4IM0A 2OBMA 3L3OM 1U00A 4KIKA 4R5IA 3C7NB 3I04A 4EZRA 4EZUA 4H6HA 4EZQA 4PO2A 3A98A 3DPPA 3D2EA 4R5LA 3T46A 3VEBA 2EWFA 4FM3A 4JWDA 3OHXM 4JWIA 3C7NA 4ILHB 3ER9B 4IM2A 3T47A 2PY6A 1OA0A 2ND1A 4JNFA 3B51X 2GAFD 3T49A 5FLEX 1MJGA 4JN4A 4EZSA 2JNSA 3VEAA 3SBSA 4EZVA 3OWGA 4E81A 3KAWA 4IWOA 4WV5A 4JL9A 3H0XA 2X5CA 4EZPA 3DOBA 4HR1A 2QXLA 4R5GA 3QA8A 4IW0A 4MQDA 3ERCC 4D8JA 3RV1A 4WV7A 2YIAA 4JNEA 3KDRA 4F00A 3B53X 2OP6A 4IWQA 2BPRA 4HY9A 3D2FA 4FL9A 4EZTA 1OAOA 5E84A 3O3OB 2LM0A 2YI8A 4R5KA 4B9QA 4UDXX 4EZYA 1DG4A 3B52X 2YI9A 3KAVA 4HYBA 3O3NB 2WINM 3O3MB 4E3CA 3N8EA 3DPQA 1GN9A 3GI7A 1GNLA 1GNTA 1BPRA 4NPHA 4JWEA 3ER8C 4KIKB 4JWCA 1SU7A 2YIVX 3QNJA 4IM3A 2KHOA 1E2UA 2ND0A 4ILGA 3F7WA 1W9MA 4IWPA 1UPXA 2EX3B 3I39X 3DPOA 5FIGA 1SU6A 1OA1A 1DKYA 1DKZA 4M0MA 5TKYA 4EZXA 4JLCA 2RT6A 3VKHA 4I43A 4H6IA 4EZOA 1DKXA 3ZEFA 3LMFA 2YIBA 4G6QA 4EZWA 1JQKA 2NCZA 1E9VA 4UDYX 4EZZA 1SUFA 3DQGA 4R5JA 2Z8YA 3RV0A 4F01A 4ILIA 2V7YA 1E1DA 3T48A 7HSCA 1YUWA 2QFFA 4HR1B 1Q5LA 3ZEDA 2GA9D 1CKRA 2OBLA 1ZYLA 3SBTB 3FD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN4 A;  3DPO A;  4EZS A;  1DKY A;  3T4A G;  4EZY A;  4EZV A;  1DKZ A;  4E81 A;  1DG4 A;  4EZN A;  5TKY A;  4EZX A;  4WV5 A;  3L3O M;  1U00 A;  4HYB A;  3H0X A;  4R5I A;  4EZP A;  3C7N B;  3DOB A;  4EZR A;  4EZU A;  4H6H A;  4H6I A;  4EZO A;  1DKX A;  2QXL A;  2WIN M;  4EZQ A;  4R5G A;  3N8E A;  3DPQ A;  4PO2 A;  4EZW A;  3DPP A;  3D2E A;  4WV7 A;  4EZZ A;  4JNE A;  2OP6 A;  4R5L A;  3T46 A;  4B9Q A;  4F00 A;  4R5J A;  1BPR A;  3DQG A;  4JWD A;  4JWE A;  4F01 A;  4JWC A;  2BPR A;  2V7Y A;  4HY9 A;  3OHX M;  3D2F A;  3T48 A;  3QNJ A;  7HSC A;  4JWI A;  1YUW A;  2QFF A;  4EZT A;  2KHO A;  3C7N A;  5E84 A;  1Q5L A;  4FL9 A;  3T47 A;  4JNF A;  1CKR A;  4R5K A;  3T49 A; 
#chains in the Genus database with same CATH topology
 1R34 A;  1SU8 A;  1QWN A;  3SOG A;  1Y2O A;  2JNK A;  1R5E A;  1PS3 A;  3I2W A;  2ZXQ A;  4PO2 A;  3DPP A;  3T46 A;  3M3W A;  2Z0N A;  4JWI A;  3DDG A;  2PY6 A;  2ND1 A;  2Q13 A;  3BUB A;  3OWG A;  2Z0O A;  4IWO A;  3BVV A;  4WV5 A;  4JL9 A;  1I4T A;  4D8J A;  2C08 A;  4JNE A;  3EJS A;  4IWQ A;  3D2F A;  1OAO A;  2RAK A;  4R5K A;  3ACO A;  4UDX X;  1LQ7 A;  2YI9 A;  3O3N B;  4AZC B;  2X3X A;  2WIN M;  4E3C A;  3Q84 A;  3CKD A;  2LXY A;  1GNL A;  3DYT A;  1TQS A;  4JWC A;  3BVU A;  4IM3 A;  3D4Y A;  3BVT A;  2EX3 B;  3I39 X;  3DPO A;  1OA1 A;  5TKY A;  3VKH A;  2WYI A;  3ZEF A;  3BUD A;  2YIB A;  4G6Q A;  4EZZ A;  1SUF A;  4R5J A;  3T48 A;  3G9G A;  1YUW A;  1Q5L A;  3HAI A;  3HAH A;  4ATM A;  3OK8 A;  1I4D A;  3C7N B;  1O7D B;  2X3W A;  2FIC A;  4WPC A;  4R5L A;  3BVX A;  1X04 A;  3D50 A;  4ILH B;  3BUP A;  5FLE X;  4EZS A;  3VEA A;  2RAI A;  3H0X A;  3DOB A;  4HR1 A;  2V0O A;  4MQD A;  3RV1 A;  2WYH A;  4HY9 A;  4FL9 A;  2O0I 1;  4EZT A;  5E84 A;  2LM0 A;  2YI8 A;  4EZY A;  4HYB A;  1TQT A;  2Z0V A;  3N8E A;  3DPQ A;  4NSW A;  3GI7 A;  3SYV A;  1GNT A;  1BPR A;  3ER8 C;  3BUQ A;  1E2U A;  2ND0 A;  5KBP A;  1UPX A;  3EJR A;  5FIG A;  2F7Q A;  1DKZ A;  4M0M A;  4JLC A;  4NQI A;  2EFL A;  3LMF A;  4EZW A;  3HAJ A;  3CZN A;  3RV0 A;  4F01 A;  4ILI A;  2QFF A;  3DX3 A;  4HR1 B;  2GA9 D;  2YLL A;  1CKR A;  2YL8 A;  3FD9 A;  3UIT A;  4EZN A;  2N3K A;  3DX4 A;  2OBM A;  3L3O M;  3L3P A;  4H6H A;  4EZQ A;  4WPE A;  5C5B A;  3A98 A;  3D2E A;  3DDF A;  3QWE A;  3VEB A;  2EWF A;  2YKT A;  2D4C A;  3ER9 B;  3LLL A;  4IM2 A;  3BLB A;  1OA0 A;  4H8S A;  1I49 A;  3T49 A;  1ZWW A;  3SBS A;  3QE6 A;  2EFK A;  3KAW A;  4EZP A;  2QXL A;  4R5G A;  3QA8 A;  3ERC C;  2YIA A;  3DX2 A;  1I4L A;  3KDR A;  4F00 A;  1HWW A;  2F7O A;  3CZS A;  3QNI A;  4AZ6 A;  3DX1 A;  3O3O B;  1TQV A;  4BNE A;  1DG4 A;  3D52 A;  3B52 X;  3PLT A;  4AZ5 A;  4DCN C;  3EJT A;  4NPH A;  2YLA A;  1SU7 A;  1TQU A;  1WDZ A;  2OW7 A;  4ILG A;  2MI7 A;  3BVW A;  1W9M A;  4IWP A;  2OZN B;  1SU6 A;  1DKY A;  4DYL A;  2F1B A;  2F18 A;  4I43 A;  4EZO A;  1DKX A;  1X03 A;  1JQK A;  2YL9 A;  3DQG A;  2Z8Y A;  2V7Y A;  1QWU A;  2D1L A;  2YL6 A;  3D4Z A;  1ZYL A;  2GF4 A;  4AVM A;  2QKW A;  2OW6 A;  3T4A G;  3I01 A;  4FZO A;  4IM0 A;  1U00 A;  4KIK A;  3Q0K A;  4R5I A;  3I04 A;  4EZR A;  4EZU A;  1YWM A;  2FYV A;  3LVT A;  1TQW A;  3EJP A;  4FM3 A;  4JWD A;  3CV5 A;  2OO2 A;  2X3V A;  3OHX M;  3C7N A;  2ALW A;  3T47 A;  4JNF A;  3B51 X;  2GAF D;  1MJG A;  4JN4 A;  2JNS A;  3EJQ A;  4AZH A;  4EZV A;  4E81 A;  4FZS A;  2X5C A;  4AKV A;  1R33 A;  3CVR A;  4IW0 A;  4WV7 A;  2OP6 A;  3B53 X;  1HTY A;  2BPR A;  2F1A A;  4B9Q A;  1O7D C;  2YL5 A;  4FZP A;  2F7P A;  3KAV A;  3EJU A;  3O3M B;  4AZ7 A;  2ELB A;  1GN9 A;  3CAZ A;  4JWE A;  4KIK B;  2YIV X;  3QNJ A;  2RAJ A;  2KHO A;  1QX1 A;  3F7W A;  1URU A;  4AZB A;  3DX0 A;  4EZX A;  2RT6 A;  2F7R A;  4H6I A;  3RPM A;  4AZG A;  2NCZ A;  1E9V A;  4UDY X;  3D51 A;  4I1Q A;  1E1D A;  7HSC A;  2PMR A;  1HXK A;  3ZED A;  4AZC A;  2Q12 A;  4AZI A;  5C5B B;  2OBL A;  3SBT B;  3BUI A;  3ABH A; 
#chains in the Genus database with same CATH homology
 3UIT A;  1SU8 A;  3T4A G;  3I01 A;  4EZN A;  2N3K A;  4IM0 A;  2OBM A;  3L3O M;  1U00 A;  4KIK A;  4R5I A;  3C7N B;  3I04 A;  4EZR A;  4EZU A;  4H6H A;  4EZQ A;  4PO2 A;  3A98 A;  3DPP A;  3D2E A;  4R5L A;  3T46 A;  3VEB A;  2EWF A;  4FM3 A;  4JWD A;  3OHX M;  4JWI A;  3C7N A;  4ILH B;  3ER9 B;  4IM2 A;  3T47 A;  2PY6 A;  1OA0 A;  2ND1 A;  4JNF A;  3B51 X;  2GAF D;  3T49 A;  5FLE X;  1MJG A;  4JN4 A;  4EZS A;  2JNS A;  3VEA A;  3SBS A;  4EZV A;  3OWG A;  4E81 A;  3KAW A;  4IWO A;  4WV5 A;  4JL9 A;  3H0X A;  2X5C A;  4EZP A;  3DOB A;  4HR1 A;  2QXL A;  4R5G A;  3QA8 A;  4IW0 A;  4MQD A;  3ERC C;  4D8J A;  3RV1 A;  4WV7 A;  2YIA A;  4JNE A;  3KDR A;  4F00 A;  3B53 X;  2OP6 A;  4IWQ A;  2BPR A;  4HY9 A;  3D2F A;  4FL9 A;  4EZT A;  1OAO A;  5E84 A;  3O3O B;  2LM0 A;  2YI8 A;  4R5K A;  4B9Q A;  4UDX X;  4EZY A;  1DG4 A;  3B52 X;  2YI9 A;  3KAV A;  4HYB A;  3O3N B;  2WIN M;  3O3M B;  4E3C A;  3N8E A;  3DPQ A;  1GN9 A;  3GI7 A;  1GNL A;  1GNT A;  1BPR A;  4NPH A;  4JWE A;  3ER8 C;  4KIK B;  4JWC A;  1SU7 A;  2YIV X;  3QNJ A;  4IM3 A;  2KHO A;  1E2U A;  2ND0 A;  4ILG A;  3F7W A;  1W9M A;  4IWP A;  1UPX A;  2EX3 B;  3I39 X;  3DPO A;  5FIG A;  1SU6 A;  1OA1 A;  1DKY A;  1DKZ A;  4M0M A;  5TKY A;  4EZX A;  4JLC A;  2RT6 A;  3VKH A;  4I43 A;  4H6I A;  4EZO A;  1DKX A;  3ZEF A;  3LMF A;  2YIB A;  4G6Q A;  4EZW A;  1JQK A;  2NCZ A;  1E9V A;  4UDY X;  4EZZ A;  1SUF A;  3DQG A;  4R5J A;  2Z8Y A;  3RV0 A;  4F01 A;  4ILI A;  2V7Y A;  1E1D A;  3T48 A;  7HSC A;  1YUW A;  2QFF A;  4HR1 B;  1Q5L A;  3ZED A;  2GA9 D;  1CKR A;  2OBL A;  1ZYL A;  3SBT B;  3FD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...