1DL3A

Crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
191
Chain Sequence
MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVERVGVFVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVRPFAVDVSSGVEAFPGKKDHDSIKMFIKNAKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
publication title Structure and function of mutationally generated monomers of dimeric phosphoribosylanthranilate isomerase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Isomerase
total genus 65
structure length 191
sequence length 203
chains with identical sequence B
ec nomenclature ec 5.3.1.24: Phosphoribosylanthranilate isomerase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dl3A00
3NQEA 4O54A 1LRNA 1W5PA 4UFHA 5E93A 5BOOA 1DORA 4BI7A 2W79A 3L0NA 1EP3A 4IXHA 4BR1A 3R2GA 4CNPA 3I68A 2E77A 1IF2A 4RLIA 3R13A 2G97A 3ELFA 5KZDA 1DV7A 3NVTA 5EL1A 1WQ5A 2GUUA 1ICPA 1OFPA 4O11A 4JTHA 1K3UA 5EKYA 4FO4A 3SFKA 3BLIA 4BI5A 1TO3A 4QQ3A 2C3ZA 3G3MA 5MHBA 1HFBA 3TQ0A 4A29A 1B4KA 1S3HA 3MO7A 4MIMA 4WOQA 2C15A 2QUTA 3FFSA 1EX5A 3USBA 4JGDA 5LGXA 4MJZA 3PUOA 1JQXA 3W7KA 3L5AA 3KRZA 2GOUA 1B57A 4RXGA 3W71A 3I7SA 1JJKA 1O95A 2H6RA 4GWEA 4NQ1A 1N7KA 1OYAA 4CQ9A 2I14A 4QNEA 4XQ6A 3SECA 1YADA 3W7GA 1NFBA 4Z1DA 2Y62A 1KTCA 3WK2A 1ZAJA 3PBVA 3G3DA 1W54A 3NL2A 2NX9A 2PC4A 5EYWA 4QIUA 1TQJA 3TSMA 2JGYA 2VELA 1LRQA 3C2FA 1F73A 4FXRA 4JX5A 4LVDA 3G1DA 3IIZA 2V5LA 1XL9A 3MYOA 4RXFA 4MZYA 4DELA 1F7BA 1LROA 3BARA 5CZJA 4TU1A 4XBSA 3HPXA 6TIMA 2QCMA 4FX8A 1XUZA 1SSGA 2NXGA 3IEBA 3PBUA 4PEKA 1YXYA 1KFBA 2DZSA 5IBXA 5AC7A 3TDFA 2YGYA 5EY5A 3W1AA 1ME7A 5CPNA 1X6UA 1Z44A 3KFTA 5CZTA 3K30A 5K3VA 2Z1BA 3NQ8A 3UPBA 2WOQA 3FEMA 2VFGA 2OMAA 3NM1A 4IX0A 4UMCA 4B5NA 2O7SA 4AWTA 3UY8A 2QUVA 4MUZA 1FXQA 4FNSA 1SSDA 4N9EA 5AHLA 4O4WA 1FBAA 4BWLA 3F03K 3QW4B 1DJNA 1H1ZA 4LY8A 1X8FA 4FX6M 1SO5A 3EX3A 4AEOA 3G0SA 5AHFA 1W8SA 2B0MA 1HUVA 4M6QA 3FJLA 3C0JA 5D09A 3EKLA 4DBDA 1JCNA 4HNVA 2WV8A 4LUJA 4UR8A 2C18A 4IPIA 4UTHA 5DELA 2XN1A 1W5NA 3W88A 1I2PA 1WDWA 3STGA 3BG5A 4LS0A 4OE7A 1EUAA 3BW4A 3G1AA 3T55A 3PULA 5F4WA 3TAOA 3NQ6A 2F7FA 1M7OA 1KLZA 3W73A 3FLUA 3F4WA 3NQFA 3C52A 5FESA 1D3HA 3TMLA 4MZ8A 2X1SA 1LORA 1UBSA 3LI0A 3GKAA 4A2RA 4NXKA 1LBLA 4N6EA 5AHEA 2E6FA 4O18A 1K02A 1DHPA 4GBUA 2QCNA 1A5BA 1IXQA 3LLDA 4MY1A 4UTTA 3QYQA 3B03A 1AL8A 1TPC1 2EGZA 2VEMA 1OG0A 1DKWA 1OFAA 5HNRA 5I3GA 2J88A 3TCEA 4ZZ9A 2F84A 3GXTA 3MYPA 3O6YX 3M41A 4UFJA 2C16A 1VLIA 3GAYA 1W3NA 2D73A 1C29A 1GJPA 2Q8ZA 2TPSA 1NF0A 3EEGA 4XKYA 3W7RA 3HOJA 3N9SA 4FNPA 3P84A 5AOUA 4BFAA 3HPZA 4ALDA 2OT0A 1S5WA 2CFFA 1Z48A 4UFIA 4WOZA 3UQNA 2CW6A 3MW7A 1FX6A 1V5XA 1YDOA 3NGJA 1VJIA 3G0UA 3L5LA 1LM1A 5AYZA 4Z1AA 3GDTA 1JCXA 3DFNA 4AXKA 1FDYA 3W2KA 3P60A 1MXSA 4RX0A 3N34A 3RU6A 5AC8A 2H3DA 1H7WA 3LHWA 1NVMA 3O05A 4K7VA 3N19B 1G4SA 2QCFA 4FHAA 2BX7A 1TTIA 4HNTA 1TPDA 2DORA 2QKFA 4AWSA 4E2DA 2V2DA 1O94A 5K4ZA 1PS9A 5G2HA 1QOPA 3BK0A 4S1FA 1TREA 3TA6A 3N3MA 2FTPA 3NPWA 1KFKA 1Q6RA 3EWWA 4NJKA 3LXCA 5J5DA 4W9TA 5I3HA 3M7WA 5FF4A 4JTKA 4EOUA 4MZ1A 3W1NA 3ATYA 2HSAA 3NZ1A 3TXVA 3QJAA 2J27A 1GVSA 5LNSA 3GX9A 2WQPA 4PH6A 1H62A 3TW7A 3PSWA 2EHHA 1SZFA 2C14A 5CPLA 4LRSA 2YX0A 4BK9A 3TROA 4UR7A 2FIQA 1QPOA 2NUWA 3LDVA 3S5YA 4P61A 3INPA 3QRHA 1NSJA 3UY7A 4NU7A 4CLMA 3PG8A 1XC4A 1MZHA 1THFD 1TPVA 2NV1A 4GUFA 5EBUA 5HINA 1KM1A 3MWAA 2NWRA 4DF2A 2ZDRA 3ZR4A 4E0CA 4UFKA 1NAL1 3TSDA 3A23A 3PVFA 1GEQA 1TPEA 3M47A 3W2LA 1YLVA 3EXRA 4DO4A 5KITA 4AHQA 3WK3A 3OBKA 4FB7A 1K8ZA 4FEZA 4QM1A 3S1WA 1TJPA 1O4UA 3EXTA 3NM3A 2KZHA 3HGJA 1FCQA 1J2WA 3S6DA 2C19A 5AYXA 3G1YA 3NL3A 3UWVA 3LB0A 3W7HA 1Z42A 2NWSA 3GB6A 4DEFA 4DPQA 4GC4A 4UC5A 1TV8A 3WK1A 2ISSA 1PIIA 4FNUA 2EF9A 3MP5A 2Q3OA 3UXAA 1GVQA 3N2XA 3T4CA 1Q6OA 4IMEA 3R89A 1R2TA 2QJHA 1YYAA 1LLZA 3LCFA 2E1DA 2FQIA 2E68A 1A53A 1YDNA 2W6RA 4O12A 4LU0A 2FDSA 4MFEA 2YYTA 4JICA 2EPHA 4AAJA 3LHUA 4O10A 5D2XA 4KFPA 3QQ1A 3W7NA 1ZNNA 5FF0A 3CM4A 4FNTA 2X30A 1FWWA 3FYPA 1LZOA 2A7NA 1MEIA 1Q6QA 3NNTA 4GUIA 2CZFA 1IXPA 1AL7A 8TIMA 3M5XA 4PC8A 3PSVA 3W1TA 3NDOA 1JUBA 5LZLA 1BWKA 3BW2A 3SJ3A 1OFBA 4QJ1A 2A7RA 4Z1BA 3IIOA 3GVGA 3S1VA 1I2RA 1O60A 2Y63A 2Q3RA 1KTNA 3HO8A 4O0ZA 4Q32A 3LI1A 5AFDA 3W2NA 3L67A 3UWYA 1F05A 1LTDA 2CZDA 2PCQA 4LUIA 4AB4A 1OJXA 2DP3A 3QSTA 2E5CA 4KFOA 1TV5A 2ZA1A 4M7TA 3FOKA 3W2UA 4O14A 4MVAA 2ZZ3A 3BG9A 1ZAHA 5HWNA 1VLWA 1OABA 4LOCA 2OZ0A 3QMSA 5AN7A 4FNQA 4UTUA 3C2VA 4JX6A 4P2VA 3FYOA 4OQVA 3DI0A 2FJKA 1ADOA 2VEPA 1YXCA 5FI8A 3HMJG 2H3BA 1LP6A 4ZQMA 5SWUA 2ZRYA 4LS2A 1BKSA 3MBDA 3TKFA 4HNUA 5K7JA 4ZQRA 3PM6A 1AK5A 1VR6A 4R33A 2DJXA 1KM5A 2WNNA 7TIMA 1MEHA 3BW3A 3G8RA 1MEWA 5HUOA 4JIPA 5HWMA 1H5YA 2DJLA 3W7CA 2V0TA 3BLFA 4I7UA 3T44A 1PV8A 2Y70A 1QO2A 4K8EA 4CNOA 3ZS4A 4O15A 2VEIA 1ZAIA 5BNKA 1OYCA 5HUPA 1PVNA 4M5PA 2NXIA 2NUXA 4KWVA 3TU9A 4PODA 3DBPA 1L2UA 1QWGA 4JTEA 1VZWA 4FIRA 2E5DA 1VPXA 2AAMA 4Z1CA 3LOTA 4M7SA 3GDKA 3QM3A 4K39A 2A85A 4LVFA 4UNLA 1LBFA 1KFCA 3M0ZA 2CZ5A 1OF6A 2ZRUA 3NOEA 4K37A 3LTSA 1TYGA 3W7DA 3CIWA 4NX0A 4UXDA 2GVLA 4OBTA 2YYUA 3EWUA 3SIZA 4G1KA 2RH9A 3VCRA 2H8ZA 1TPUA 4JNMA 4TMBA 3U2OA 2JBMA 5KZMA 4JS3A 2E09A 2ATMA 4GUGA 1ML1A 2E6YA 5KTLA 1AW5A 3IVSA 2VKZG 2ZTKA 3I65A 3NQMA 3HGRA 4NZJA 1VCGA 1CW2A 2GJNA 1H61A 3RLUA 2YFOA 5D02A 3UXDA 4IMFA 3NZRA 3LCLA 2WKJA 4MYAA 1P1XA 3W87A 6ALDA 1QPQA 4N4QA 3BPWA 4JY9A 1IGSA 3W1MA 1KTBA 4PL1A 1RZMA 5DXYA 1OVDA 2P10A 3CU2A 4O0KA 3L9CA 3HIJA 3W6YA 1HO1A 1W37A 3R12A 1JVNA 4JXCA 2TRSA 5CPMA 1SO6A 2O7QA 1QOQA 4JTSA 5DY2A 1JUEA 1ZENA 3A21A 3C56A 3LGEA 2PRLA 3DAQA 4U4MA 1F2JA 3O8AA 3GAKA 4X3ZA 3LV6A 1K7XA 3P8IA 3RK8A 4JYEA 2YCEA 3NEVA 4K6AA 2RHGA 4NJJA 3M5VA 5G1TA 2JGQA 4JN6A 2JKAA 1EWDA 3TC7A 5DY3A 3LCGA 4O52A 3SR7A 1BTMA 1ONRA 5D2WA 3NG3A 3MUXA 1GOXA 3CPRA 1OX4B 2ZRZA 3GLCA 4KFNA 3B8DA 3ABSA 4LVBA 2QCCA 3H54A 4WUIA 2J9XA 3DKLA 3W2MA 1XBXA 4O50A 3KAOA 3JRKA 4ORIA 4JTIA 3R8RA 1KFEA 3W85A 3R5EA 3QF0A 3TSBA 1KV5A 4JTLA 3O15A 1C8VA 4JYFA 1IXNA 3JS3A 2G5WA 2FPTA 2LLEA 4O4VA 3TJXA 3WJWA 1YDVA 1KM4A 4IGHA 2VFIA 2WSRA 3E49A 2DZPA 4MJMA 4C1LA 1VGAA 4HSOA 2V81A 4XZ9A 3LTYA 3MP3A 4IWWA 3S0CA 3UNDA 2Z0IA 1FWTA 1KBIA 5D33A 2QAPA 1SW7A 1IIGA 3A5VA 4JTJA 2B7PA 1D9EA 5DCEA 4RKAA 1XKYA 4YWIA 3PS7A 1GVRA 2YR1A 4AF0B 5DBUA 2RDUA 4UTWA 3WJZA 2YW4A 3GNDA 3I6RA 3G0XA 4AVFA 1R46A 3QZEA 1B3OA 3STEA 3AJXA 3JR2A 1U5JA 3LBCA 1WOBA 4M19A 1DL3A 2QCLA 2NUYA 1EPXA 5D32A 3E96A 1DBTA 2QCGA 1OF8A 2X2GA 5LKYA 3LCXA 1PCKA 5CZSA 2Y7GA 2C1HA 3PB0A 3W7OA 1UB3A 4LC8A 5G1YA 5GVJA 4A2SA 4NT0A 1GVOA 4WZHA 3W72A 5CSSA 4E38A 1I2NA 1RV8A 2V8ZA 3L66A 1PHQA 2QUUA 4AHPA 1EP1A 5D05A 4CCDA 4X9SA 3LHTA 5C2XA 4NZFA 2B7NA 4WQ6A 4L4LA 1SZNA 1O5XA 2FB3A 2ZTJA 1SW3A 1Q3NA 1SFJA 3C6CA 1MO0A 5C6MA 1F5ZA 1FCVA 4UTLA 5I3KA 4DPPA 5KSWA 5F2IA 3E9AA 4EIVA 1H51A 2CLEA 1JCYA 5F2LA 3N14A 1QO5A 4O1CA 3NAVA 1XBYA 2EAWA 4KKXA 5D2TA 4WXYA 2QEZA 4JIQA 3D0CA 4JDBA 4UMBA 3TQKA 4HN4A 4DO5A 4O17A 4R34A 5HQEA 4A21A 3BG3A 1JRCA 1YTKA 3A9IA 4ZQNA 3EX2A 4O13A 2G95A 2JK2A 3CWOX 5LHEA 3STFA 1R30A 5AHIA 2WJZA 4ZQCA 4LWWA 2V30A 1YPFA 3W7MA 4LVAA 1FUYA 2ZCGA 4ORMA 1ICSA 4HHPA 4HSNA 5TBOA 4J9JA 2Y61A 2Q8LA 1LDCA 4IQLA 5D2YA 5L9FA 1P4CA 2AGKA 2CU0A 3U8GA 4JY8A 3RFAA 3EWXA 1QNVA 3A24A 5KMYA 1WV2A 3L0KA 2OJPA 1VRDA 3LX9A 4LS1A 3PWAA 4Y9AA 4LV9A 2FFCA 5G2IA 3ATZA 2QCDB 3PBWA 5I3IA 1IIHA 1K8XA 1GYLA 2GQ8A 2C13A 2DZUA 4DO6A 3PG9A 1ALDA 2NX3A 3KVMA 3HGSA 1BEUA 1TPH1 5I3JA 1ZCOA 4OGZA 1GYNA 4U28A 1ME9A 3Q94A 3B04A 3O63A 1PCWA 1K8YA 1RQEA 2Y89A 3FS2A 3UZJA 4NJIA 3C3NA 3S5ZA 1W1ZA 2DZXA 1VQTA 3RLVA 1PL9A 3DU0A 1SQ7A 3FKKA 5T26A 4XWUA 4DXVA 4TIMA 2V9DA 1FDZA 2VFDA 2WSYA 2Y7EA 3GDMA 5IM51 3L21A 4MKNA 3KRUA 1OK6A 2DZVA 4UFLA 4H4IA 3OG3A 3DHFA 5C55A 1FWRA 3LCHA 2QCEA 2ZQ0A 2YW3A 3GKFA 1XBZA 3MHFA 3SW6A 1W5MA 3UWQA 1YPIA 3GDRA 3DFTA 4PFMA 2A6NA 4K38A 3SY5A 3QPZA 3IGXA 4MYXA 1A5CA 2BZNA 3IIVA 3TC6A 4CCEA 2GVGA 3VKJA 3IRDA 5AYYA 2A1YA 4YCOA 3W22A 2A6LA 3HQ1A 3NXFA 1TRDA 1Y0EA 4HIBA 3LRMA 4OV9A 2WO5A 4O8RA 2A7PA 3DENA 4N9DA 4WJEA 2GPTA 3KVJA 3G22A 3P7YA 1WX0A 4JTFA 3W1XA 4NVTA 3CT7A 1CI1A 3P82A 2A5HA 2CLIA 4O28A 1RQHA 4NXSA 3NPUA 4ZVJA 3AO0A 3E12A 5G5IA 4O1BA 1G67A 3P80A 2H90A 1D3GA 4YXGA 4CQ8A 3HG2A 4LRTA 4LVGA 4MY9A 3IGUA 2J9YA 3ZWTA 1FCUA 4XTIA 3C4UA 2IQTA 3W23A 3NQAA 1UUMA 1VYPX 5BW6A 3M43A 1UJPA 1K7EA 1L6SA 1TMHA 3TR2A 4ZL1A 5E1QA 2E6DA 2QAFA 3RNDA 1KA9F 5HWJA 5CG7A 5HJLA 1SR9A 4WY0B 3VI2A 2A2IA 1XDMA 3U6WA 3G18A 4FXSA 1SPQA 3CQ0A 2WSQA 3G1FA 1XM3A 3EKZA 1XI3A 1G6CA 1SFLA 4JEQA 3H53A 5L6UA 4OWGA 5AHNA 5C54A 1H7OA 1TIMA 3I7QA 1XBVA 3W3OA 1T8XA 4HT3A 2Z6JA 1FDJA 3KXQA 2CLFA 1LOQA 3OEXA 5DN1A 3W7JA 3KRSA 3C2RA 3IVUA 1BWLA 3NQVA 3YPIA 2J6XA 1WA3A 2TSYA 2NV2A 3LXAA 3OVRA 4UIOA 4RV8A 3L2IA 1X7FA 5J5RA 1S5VA 2Y85A 2A0NA 4TMCA 2ALDA 1R2SA 4K8HA 3EB2A 3HG4A 5IBXC 1GT8A 2VOMA 4QISA 3SZ8A 2E6AA 3QPYA 4O19A 4QSHA 3CEUA 2PURA 3WJSA 1KM3A 3THAA 3P74A 1OX4A 1Q6LA 4K7YA 3M6YA 4UNKA 3C61A 1W56A 2CWNA 1H60A 4ADUA 1X1ZA 5DCBA 1F6KA 2C6QA 3KHJA 1XUUA 2OT1A 2VFFA 3LRKA 2HS8A 2XN2A 1T99A 3VNDA 3B0UX 3W7PA 4MPQA 5FF2A 3T7VA 3BVJA 3LERA 4BWLC 3LBMA 1QR7A 1X1OA 5HR7A 4RZ5A 1EB3A 1I2QA 3LHZA 1S5TA 1A5AA 3MMTA 4EVZA 1I45A 3T40A 1G7VA 2YXGA 1A5SA 1F76A 3BO9A 3M1ZA 1GPWA 1KBJA 1KM2A 1JCJA 2Y88A 3TXZA 2X1TA 5KINA 2FB2A 3SGUA 2HS6A 3NL6A 2EKCA 5LHFA 3PB2A 4GXMA 1KV8A 2BTMA 3P62A 1E51A 1VC4A 1GG1A 4IJBA 5EA9A 1KW1A 4RZ6A 5EPDA 1G4EA 4JD4A 2V2CA 5TIMA 1WBHA 1SW0A 1FWNA 1RVGA 3DI1A 3TW6A 3PR2A 4QITA 3W07A 2NXHA 4RJEA 4UFMA 3W9ZA 1AW2A 4Q4KA 5BMXA 1KFLA 2ZZ4A 4IMDA 3NL5A 2DU2A 4WY0F 3G1HA 4RR4A 4TX9A 4UCGA 3GIYA 3WJYA 4AF0A 4GUJA 3HG3A 3PUEA 4UTTC 4UMAA 4XBKA 4I7VA 3PBYA 3P67A 2RKXA 1HO4A 1SO3A 4XTDA 1I4NA 1GVFA 3CTLA 1SUXA 4IXXA 5D04C 1W3TA 3GR8A 5CPOA 1G69A 1UASA 4FF7A 4NNAA 5E0KA 2V82A 2UV8G 5U7SA 4AHOA 1L6YA 3NQ7A 3TUUA 2FLIA 4PL2A 3W2JA 4RZ4A 3O6DA 4BI6A 3TQVA 4L4MA 2VFEA 1VHCA 3NYZA 3GXNA 4PCFA 1YXDA 5DBTA 1B9BA 4MY8A 4Z0JA 4JDYA 5FEWA 1TRIA 1TCDA 3LTPA 3I7RA 1T96A 4OT7A 3LXBA 1UCWA 4EWND 3CLMA 3NPXA 2BWGA 1P5BA 3M9YA 2NLIA 1AMKA 3NQGA 3P61A 3DXIA 4JX4A 3C2EA 3WFAA 2CLMA 1KM0A 3B05A 3Q58A 2BXVA 2DZWA 4N9BA 2ZZ5A 4D2JA 4N4PA 1EIXA 5F1VA 3EWBX 3P81A 4IUOA 1K7FA 1VHNA 5CGQA 1KM6A 3DZ1A 5D2VA 3HJZA 3QFEA 3N2MA 4NJGA 1UUOA 4ONVA 3IIXA 1P0KA 1VCFA 4ADSA 4DBEA 3G24A 1H7NA 1LRTA 1WAUA 3PUDA 3ANYA 2ABAA 1Q45A 3PF3A 3OVPA 1B4EA 2X16A 1L9WA 3GK0A 1O5KA 2R8WA 5LGZA 4RK8A 1RD5A 4CCCA 1ME8A 5DXXA 5K9DA 2VXNA 5AC6A 1M6JA 4MLRA 3HG5A 3FIGA 2XFWA 3IV3A 3S8HA 5LNRA 3GYEA 1TSIA 3UYCA 2TMDA 1OK4A 3LLFA 4I9AA 4TR9A 3KX6A 2HMCA 3W7LA 5BMWA 1TTJA 1Z41A 3EXSA 2X1UA 1H7RA 2ZRWA 3MP4A 2Z2UA 1LBMA 4OHQA 2X1RA 3TX9A 3DHDA 2QCDA 2ZZ2A 3NQCA 2Y7FA 3W75A 1H7XA 3LRLA 1FWSA 4I7WA 2ZRXA 3KVKA 3G1VA 3ZWSA 1VH7A 4N02A 3CC1A 1T0OA 3W1UA 1W5QA 3L68A 4ADTA 2ABBA 3P8JA 4YL2A 2ZRVA 3HPSA 4HKPA 5F4XA 5K9XA 3GZ3A 3HBLA 4TO8A 3TIMA 1W31A 4NX5A 1LOSA 2E5BA 1DVJA 5LSMA 5H2ZA 4O1DA 2ZZ7A 1RPXA 1G7UA 4AH7A 3LM7A 4AMAA 3W70A 3SSJA 2V2HA 4IMCA 3TJLA 3LHVA 5F2GA 1H7PA 4IPJA 5LNWA 1LOLA 3QSRA 2JKPA 5G4WA 3W84A 3L5MA 3OHIA 1XDLA 3CHVA 2PE4A 1N8FA 1ZJIA 4JR5A 5AB3A 3UWZA 2Z6IA 3TNOA 5D38A 1QPRA 1QFEA 4Q33A 3S5NA 1JCLA 3TAKA 1GTEA 1TPB1 1TQXA 1ZFJA 4GNJA 4HPXA 1K03A 2VFHA 4AWUA 3M5ZA 5HULA 4E2BA 4UTIA 4FX7A 4NNCA 3GXPA 1JUKA 3M44A 4Y6GA 3B0PA 1LCOA 3WJXA 3DGRA 3LV5A 1WBJA 4R53A 1WXJA 3W1PA 1GZGA 3C2OA 2B7QA 4GJ1A 2CLOA 4YCPA 5TQLA 2VEKA 1A50A 4NJHA 3UWUA 2J24A 4HNNA 1G4PA 4CQAA 4WD0A 2XN0A 3O1NA 1HG3A 4M6VA 4Y96A 3W7IA 1EWEA 3T78A 2PRMA 3W7EA 3DKJA 3LCWA 4QNWA 4LTSA 2A4AA 4BF9A 1V7YA 4YMZA 1NF7A 2RDWA 1GG0A 2QR6A 3W83A 4IMGA 5K9CA 3ABQA 1M7PA 4R7JA 4EF9A 4N9CA 4MFDA 4H6KA 4CNNA 3GR7A 3W7QA 4GRSA 1XXXA 2OCZA 3LHYA 3QW3A 5FEZA 4N6FA 2ZBTA 4WY0A 3CB8A 4Y90A 4DQWA 4IOTA 1F74A 3O06A 4NNBA 5I3FA 2CLKA 2OX1A 1JCMP 3PY2A 4ZQOA 1OHLA 1JQVA 4FIQA 2YPIA 3G8EA 2Y7DA 3V1PA 4S2BA 3EX4A 1KLYA 4JTUA 1TV7A 4MLJA 4LW7A 3W86A 5LNVA 2ZA2A 4RCXA 1DJQA 4PTNA 3QC3A 3HGOA 2RDTA 1DOSA 3DFOA 1ICQA 1QMLA 3A22A 3W1RA 1SZGA 3RMJA 4NUWA 5C5YA 1QCWA 3E02A 3IVTA 3IGSA 2R94A 4OV4A 2NX1A 3NQ2A 4LT9A 5K2ZA 4O57A 4JTGA 2ZFAA 4UUIA 3Q2DA 2B4GA 3S42A 3QEZA 3DH7A 2H8XA 4ICNA 1I8JA 1SO4A 1U83A 1FXPA 3GDLA 3QH2A 5KZEA 1RR2A 3TK7A 2WNQA 2R14A 1H63A 5D37A 5FEXA 4JTTA 2V5BA 3NQDA 3CIXA 4IX2A 5BRBA 1KFJA 5CZ0A 1TJRA 5HR6A 2QCHA 4LNYA 2ZZ1A 1JULA 4GFSA 3P5YA 1I2OA 1N55A 3F1QA 1FCBA 2QJGA 3L0GA 2BSLA 3ABOA 3TH6A 2YSWA 3CWNA 2C0AA 4DF1A 3FA5A 2NZLA 2ZA3A 1R2RA 4S2CA 3MI3A 2Y6ZA 1OYBA 5F2MA 1VYRA 1AG1O 1SZEA 3MJYA 3FJ6A 2A21A 4Z0SA 1M5WA 5FF3A 3DFSA 1EP2A 1FQ0A 2ISWA 2RFGA 1DQXA 1JR1A 3M16A 3SI9A 3EX1A 1FY6A 3O07A 5F4SA 3W76A 1PE1A 2JKEA 1OFQA 1R47A 1SU5A 3VE7A 1HL2A 1C9DA 1WYIA 4POCA 3CEPA 2YZRA 1DQWA 5CKSA 2I1OA 3E0IA 2FPVA 3EWYA 2GJLA 1J4EA 1AW1A 2CLHA 4XKYB 1CX9A 3UWWA 4ML9A 3N73A 1YTEA 1OFDA 2QF7A 3VE9A 4ZMGA 3W74A 2W0UA 2BLEA 1MSSA 2ATSA 4HPJA 2G96A 1TTPA 4ZQPA 3NO5A 2QDGA 1J5TA 1HTIA 3Q37A 1TPFA 1XCFA 3ZFHA 3HF3A 4K36A 4X22A 5ABTA 4C1KA 3C8FA 3ABRA 1F6PA 3PC0A 3G1XA 2TYSA 3TMQA 2VENA 4A3UA 4FNRA 1VS1A 4A22A 3MBFA 3L65A 3UPWA 1ZHAA 1W3IA 3A5FA 2YDAA 4M6PA 1PHWA 3BLEA 3G1SA 3BV4A 5LNUA 2QDHA 1OX5A 1VYSX 4LC6A 3QMRA 1GWJA 1GTHA 2GQ9A 1TPWA 2DZTA 1QAPA 5FF7A 3STCA 2AQWA 4O16A 3IIPA 3PAJA 2CZEA 3S1XA 4O1AA 4MOZA 3NA8A 5U4NA 3V75A 1YTDA 1EA0A 3QQ0A 3S9YA 1XFBA 1H50A 2P0OA 4X2RA 1OFEA 4UTMA 1NEYA 4GE8A 4XUGA 4UTJA 3H55A 1EEPA 4KWWA 3KOFA 1EUNA 3KVLA 1G4TA 3O16A 4UTWC 2QJIA 1QPNA 4GUHA 1JRBA 5DLCA 3FKRA 3N9RA 3B06A 3S1UA 2WPBA 4QAIA 4LV4A 3P5ZA 4WXZA 4Z08A 3TV8A 3UZ5A 1VCVA 4UTKA 4O53A 4H3DA 3W1QA 4Y8FA 5D03A 5F1UA 1LYXA 1TTQA 3DFQA 1IXOA 5DCDA 1W0MA 3UD6A 3EWZA 2R91A 5H91A 4DF0A 3OVQA 3OA3A 3NPVA 2HTMA 4JYDA 5FEPA 1RQBA 3BGGA 3HB9A 1OFRA 3B0VC 2ZZ6A 4WX2A 5G2WA 3DFPA 3LCIA 2VC6A 3GNNA 1ZALA 5A5WA 3S5OA 5EMUA 3QMTA 1OFOA 1W5OA 3NR0A 3W1LA 3EX6A 4N2YA 3F4NA 4YLWA 3B4UA 3MI6A 1P0NA 1TB3A 1QDSA 2P1FA 3BGJA 5D30A 2ZYFA 5A8GA 2WNZA 4EF8A 3THQA 3TFCA 3RF9A 2I9EA 4PA8A 3M5YA 3O6CA 3MHUA 2YFNA 2CLLA 1OX6A 3MHGA 3VFLA 1GQNA 5G4EA 2GQAA 3SGZA 1ZY9A 2GVJA 1L6WA 2B7OA 1WOAA 2PRHA 3MI2A 3WK0A 2FPYA 5CSRA 1H1YA 5HMSA 3OIXA 3TE9A 2J9ZA 5AHMA 1LLWA 2ISVA 3TFXA 5K4XA 4OU1A
chains in the Genus database with same CATH superfamily
3IARA 1LRNA 4REQA 4WDXA 2FJUB 5IDZA 1DORA 2W79A 3IACA 4YTSA 3R2GA 2D0HA 4PE8A 4HCDA 4RLIA 3ELFA 4EWJA 2XJ7A 3FEQA 1J96A 3MSGA 3K2GA 2OQHA 3KL0A 2ISDA 3ZVIA 4L7ZA 1DP0A 1V0NA 1K3UA 2BVYA 1W6TA 3EB4A 4NI3A 2C3ZA 4JFUA 4EK7A 1ZSXA 5MHBA 4A29A 4CQBA 4RW3A 3CZGA 1F61A 3H70A 4M6UA 3VFCA 1F3XA 4WOQA 2GGGA 8CGTA 2ZXBA 1RLCL 4MJZA 3PUOA 4H8VA 1JQXA 3W7KA 3L5AA 4G9PA 4QEEA 4DUXA 4A35A 3V3WA 1B57A 2QMKA 3CUZA 3QYSA 1JJKA 3CNYA 3KOYA 1O95A 4MWAE 1OYAA 2I14A 3N9KA 4G7EA 4YIWA 4D8LA 3U9IA 5AVNA 1Q66A 3NL2A 2NX9A 2WCGA 3VC5A 2PC4A 5EYWA 2G3IA 3SURA 1HKMA 3G1DA 1YNPA 2V5LA 5DRIA 4F0HA 1XL9A 5JBEA 1LROA 3GUWA 4QQUA 4TU1A 1XUZA 1SSGA 3VIFA 1JAKA 3CV1A 3IEBA 2GWGA 1GJUA 1JGIA 2CBUA 3NO1A 2YXOA 4ATWA 2HPMA 1RY8A 2YGYA 1XIMA 1AVAA 1CLXA 1DXEA 2RGLA 5EY5A 3W1AA 1JFXA 5BXTA 1M9HA 1ZRQA 4JAWA 4UMCA 1EO5A 3E5BA 3UY8A 1FXQA 4FNSA 3H2CA 2V3EA 5AHLA 4O4WA 4JFWA 1UBPC 2P53A 2JEQA 1E5JA 1TE6A 1E0UA 1XR2A 1XDJA 1H1ZA 1DJZA 4PMUA 4L6DA 1FWIC 3T2QA 3EX3A 3QR1A 2Z7KA 3DG6A 3BZJA 4WDUA 2E8ZA 3L12A 1NJJA 3V18A 4ZCWA 3WBWA 4NAFA 1UZDA 3CPUA 2C91A 4UTHA 4FALA 4EAYA 3UFYA 1I2PA 3STGA 3MA8A 2DH3A 3WQCA 3V1HA 3PBMA 1EUAA 5D9NA 4MDPA 4HZ7A 3WNMA 1M7OA 1KLZA 3W73A 3F4WA 3NQFA 1M01A 3I4KA 1R87A 2VNCA 2CHOA 4D6HA 4MWAD 3N12A 4LY4A 4A2RA 2W61A 1LBLA 3OB8A 5G4HC 1DHPA 2YL8A 4JN7A 2QCNA 1A5BA 3LLDA 4MY1A 3QYQA 3VD5A 3IK4A 1TPC1 4QS5A 1XLKA 3WNKA 2OYKA 4JIHA 1OG0A 5I2UA 2QW5A 1OFAA 1VJSA 3VA8A 1XICA 3TCEA 3WDQA 5FJIA 2F84A 3REQA 2HWGA 2C16A 2MUCA 3N1AA 1EBGA 1GJPA 3K4AA 1O12A 5JIPA 3W7RA 1HL9A 1PZ1A 2IXVA 3FGCB 1NH6A 5EFFA 2BDQA 3HPZA 2OT0A 4DJDC 1H0GA 4JL2A 4JQ2A 1OQFA 1Z48A 4UFIA 4WOZA 3UQNA 2ZADA 1FX6A 3CUGA 3L5LA 4Z1AA 3QV9A 3OQEA 4UOQA 2BHYA 5A2AA 3MDWA 1MXSA 3ECQA 2NSXA 1MI3A 3N34A 2V3FA 3K13A 1EOMA 2ACRA 3O05A 4GI9A 4Z1YA 4WDTA 2HZGA 2YZ5A 3PZNA 3RILA 3ERPA 1TPDA 4J3VA 2QKFA 3NTYA 4G8TA 4F4RA 1IWBA 1QOPA 5E9AA 1KFKA 9XIAA 3EWWA 1E0WA 5J5DA 4A8NA 5FF4A 4EOUA 2HSAA 3GNOA 2FMNA 4TVCA 1HVXA 2XFFA 4HNCA 3D6NA 1H62A 3NVDA 1XIIA 3PSWA 3WCZA 1SZFA 2C14A 3AU6A 4CD8A 5EMKA 5FCZA 4F0LA 2PCEA 2NUWA 3LDVA 1E3ZA 1HKJA 3CZKA 4B15A 3IJ7A 4W5UA 1F9CA 1QHOA 3W25A 3QGAC 2YDSA 1XC4A 5FJJA 3WMBA 5JUVA 1THFD 1TPVA 3ABZA 4GI8A 4GUFA 2E3ZA 3V16A 5HINA 2E67A 1IEIA 3WLLA 1XFCA 1F3EA 1R3QA 3K8LA 3PVFA 2BODX 1GEQA 3M47A 5FJTA 1JF5A 3KW3A 3PZQA 5M5DA 4FEZA 4U3CA 1TJPA 1O4UA 3S1WA 3HGJA 3KCLA 5I5RA 4NIRA 3S6DA 4NY2A 3WQDA 2W4XA 3NSXA 2VD9A 1OGGA 4DEFA 4MHBA 5LA0A 2PTXA 4UC5A 1TV8A 3WK1A 4IPLA 2FGZA 3SQSA 3UXAA 1Q6OA 2XGZA 3LCFA 2QJJA 4NKCA 3REQB 3OLEA 4ZB0A 1CT5A 1UHVA 4LU0A 5I7GA 3B40A 1F8MA 1C90A 4GGHA 3LHUA 5LIXX 4KFPA 3QQ1A 3U2CA 5HMEA 3WFLA 5FF0A 2X30A 1FWWA 1XLHA 3FYYA 3HTWA 4TX8A 1FWHC 4ZTXA 4LYQA 1TUXA 1SYTA 3SCNA 3VXGA 3M5XA 2BB0A 5CC6A 4PC8A 3TA9A 3UNTA 3GU9A 3BW2A 4LBRA 3SJ3A 4DBUA 4INFA 1IEXA 2DT0A 4Z1BA 4DBWA 3I3EA 1A3XA 3GVGA 1O60A 4PULA 2Q3RA 1KTNA 3LENA 1A4MA 4PSPA 1LL7A 1FWFC 4I3GA 3W2NA 3UWYA 1F05A 3H4GA 1KFWA 2CZDA 3HMCA 4E8DA 1OJXA 4XZLX 1V3KA 1XSIA 3EOSA 1TX2A 4M7TA 4GYKA 1PX4A 2W27A 4MVAA 2ZZ3A 2YA2A 3A4WA 1PBGA 4LOCA 3QMSA 4PB3A 3ALFA 4RNFA 3I6TA 4YVVA 2FJKA 1GEHA 1UP0A 2EPOA 3BCJA 3HMJG 1LP6A 1AQMA 1Q63A 1BKSA 2DVUA 1HX0A 1PKLA 3IJQA 4BZYA 1AK5A 4R33A 3AWOA 4NYUA 1KWGA 2SFPA 5E5CA 1OSEA 2WVVA 2QHAA 4JIPA 3EMQA 5TAOA 2X0HA 1AQFA 3U48A 2V0TA 3T44A 2GGJA 1MRAA 2FTWA 1PV8A 1GW9A 3BTNA 1JXKA 5HUPA 2NXIA 3A4AA 3KCOA 3VIKA 1PB0A 3E2VA 4KWVA 4DI9A 1FVPA 4ZFMA 1QWGA 3FDKA 4FIRA 2E5DA 3LOTA 1YIXA 2WZTA 1VBUA 1KFCA 3NOEA 3RX3A 3CIWA 4E6MA 1XW8A 4UXDA 2YYUA 3VCRA 1TPUA 3N13A 1BWVA 1UR1A 4TMBA 3U2OA 4RE3A 4JS3A 1O6IA 3DYPA 1MYRA 1VJZA 5KTLA 3T0TA 2ZTKA 3I65A 2XM1A 1VCGA 1CW2A 1PEZA 1RXOB 2Z1VA 5D9MA 5D02A 1R3RA 2VGBA 4W7WA 3UXDA 4MYAA 1P1XA 6ALDA 4LPCA 3BPWA 4HA1A 4JY9A 1IGSA 1JF6A 2Y5JA 4PL1A 1UQYA 4XAZA 4IJRA 4FOKA 4X61A 1R5YA 3NSNA 3WKZA 4DB7A 1EPVA 3NGFA 5T91A 1FFRA 1QOQA 3LY0A 2XH7A 3R8HA 4X3ZA 4HU4A 3LV6A 3VIMA 1A0CA 3SCWA 5IRPA 1PDYA 1XRFA 2RJHA 2O9TA 4NJJA 3M5VA 4P7OA 1CIUA 1ISXA 4GINA 2JGQA 3VD9A 4I8YA 3E3HA 4KWSA 3KLLA 4WSHA 1VFSA 5DY3A 3LCGA 1OT2A 3BH4A 3TTEA 5JBFA 1QXLA 2V5JA 1OX4B 5C7HA 4LVBA 2QCCA 4DN1A 1BXNA 1LJYA 4F0RA 1ENUA 1PYFA 2WVVB 4WUIA 1E0XA 1US3A 2PBOA 4GABA 4KERA 2XZ7A 3SAZA 2ZX9A 1R3YA 5DMMA 1J6OA 7ENLA 4PCPA 1EDQA 1JEZA 1TMQA 3VIOA 3V0UA 4LYKA 2I7GA 3T42A 3OBEA 2EXOA 4HJWA 2IKGA 1JZ5A 4ORIA 5CPQA 1P48A 2OPJA 1VB9A 2DGAA 3R8RA 1V93A 5F7UA 4FMVA 1TX0A 1O1HA 1IXNA 1I1XA 3JS3A 3S9IA 4B5SA 3MT1A 3E49A 5HQLA 2DZPA 3H2AA 3ANVA 1BVZA 2V81A 3LTYA 1KQYA 2VP8A 2O4QA 1A5NC 2Z0IA 3M4HA 1FWTA 1TKKA 3RRXA 2WVTA 1WO2A 3TOYA 1SW7A 1J11A 1EJVC 4CEXC 2B7PA 4PTWA 1XKYA 4YWIA 1JZ3A 3U4AA 2RDUA 1UP3A 3WJZA 2EQDA 3H24A 2GL5A 2VX5A 2G50A 2OSXA 1U5JA 4M19A 1WOBA 3S2JA 3RCYA 5A2CA 3N18A 1PCKA 3OHMB 3CGTA 5G1YA 1G94A 1GCYA 1XWYA 3GW0A 3TYZA 3A3XA 5GVJA 4NT0A 1XKJA 2FZDA 3W72A 4R27A 2WMFA 4EAMA 1R8LA 4I5RA 4FZIA 3DDMA 4AD4A 4C7GA 3WF2A 4IFRA 1SZNA 1O5XA 2JALA 2ZTJA 1Q3NA 3CPGA 2VZTA 3WQOA 1EBHA 1F5ZA 4JZ5A 2J6VA 4B5UA 3IJDA 4DPPA 3MU7A 5HA7A 3T0AA 2NVDA 4CN1A 2PMQA 1XV8A 3N14A 4RW5A 4O1CA 1A5OC 2EPNA 2BMBA 4KKXA 4OBSA 1CGVA 2WM0A 2PLMA 3TQKA 5XINA 4DO5A 1CGYA 1EQCA 1QW8A 5HQEA 4YVXA 4H9YA 1YTKA 3LN3A 2GK1B 4ZQNA 2JIEA 4O13A 2G95A 2JK2A 3CWOX 3QBUA 1R30A 5AHIA 5FSEC 2OLAA 4ZQCA 3WLKX 4LWWA 2V30A 1YPFA 4W88A 3GXIA 2ZCGA 4B2DD 2GFTA 4HSNA 4YYFA 2Q8LA 1LDCA 1XIDA 3VZXA 4BEUA 1EA9C 2C1IA 4S3AA 4JY8A 3A24A 6XIAA 3BCFA 3IV8A 3LX9A 4Y9AA 2FFCA 3LQLA 5I3IA 1AJZA 2QQ6A 4EPDC 1PTDA 4P8VA 2HISA 1W1IE 2DIJA 2C13A 1XRTA 1GW1A 1ZPTA 2JE8A 1JI1A 4HA4A 1ME9A 3Q94A 3E2SA 3PZVA 4EX4A 4UQAA 1PCWA 3R10A 1UOZA 4NJIA 5A69A 3S5ZA 3BCDA 4WR3A 4ERGA 1W1ZA 2DZXA 5LIUX 3W28A 3QHOA 3T0BA 4ZB5A 3F2CA 1E9IA 2WSYA 1J0KA 4P7RA 4AYGA 3JU2A 3GDMA 1NOUA 5B7ZA 3QY7A 3L21A 3ITCA 4UFLA 1ONWA 2PODA 1XG3A 3VX0A 1VIWA 4WSKA 1YNQA 2QDEA 2J66A 2QCEA 2ZQ0A 1PTAA 3MHFA 4MNJA 1NARA 2ICSA 3DFTA 2A6NA 4K38A 3QPZA 4C6IA 3VINA 1HJWA 2BZNA 3IIVA 4JOMA 3HPFA 2A1YA 3CAKA 3NXFA 1TRDA 3LRMA 1E3XA 3FHQA 2A7PA 2YXXA 3RJXA 1G1YA 5TD4A 1KRCC 3G22A 3P7YA 4D6FA 4PN2A 4JTFA 4GZ7A 4NVTA 4C7FA 1EEXA 3P82A 2E9LA 4FLOA 1P0DA 4MAZA 1UROA 3E12A 1G67A 5BWFA 1UD5A 1VP5A 2H90A 3B9AA 4YXGA 2I56A 1OBAA 1X38A 3WQGA 3PJTA 1BYDA 4KEVA 3CQIA 4TOQA 3NQAA 1UUMA 3M43A 4P8UA 3BOFA 3RU8X 4PMXA 5CH9A 4QG9A 4ZL1A 3M0KA 2D20A 3RNDA 4IG2A 3VAVA 2E0PA 5T8GA 1W9VA 6A3HA 5MKGA 1SPQA 3KRBA 3S6TA 3MO4A 2PP1A 5BZAA 1WDRA 4ZODA 1KCLA 4PR4A 3EKZA 1SFLA 1XHGA 5AHNA 1H7OA 1X6LA 3I7QA 1NY1A 3F2BA 3KXQA 3PN8A 4Q8OA 3NZQA 5DN1A 1DTUA 5DANA 1HF6A 4IGSA 5EBAA 3LXAA 5I24A 1T40A 3D46A 4DXXA 4WJXA 4JNYA 1S5VA 3AUJA 5BU9A 3EB2A 1T8QA 3QZAA 3SZ8A 2GDQA 1VEOA 4QSHA 1XCWA 2Z28A 1V77A 1Q6LA 4K7YA 4U5KA 3VGGA 4A3RA 4NL1A 3VKKA 2EO7A 1GORA 4ADUA 5I07A 1W3JA 5HATA 1F4AA 2C6QA 3CS2A 2YDRA 1XUUA 3VKAA 2OT1A 2VFFA 3B0UX 4P8XA 1T99A 1DXIA 2OR2A 4I6VA 2DV0A 1I2QA 1EOKA 3LHZA 2AKMA 2UY5A 1L8NA 4M29A 2QIWA 1V6WA 5I79A 3TYUA 3AZSA 2FB2A 2HS6A 1K6WA 4Y9PA 2BTMA 3P62A 4HTYA 3EDEA 3M0MA 3U7VA 4IJBA 1F3WA 1KW1A 4RZ6A 1G4EA 3UEQA 1SW0A 3GU1A 3B9EA 4AWEA 1FWNA 1RLDA 1TJ1A 1E9ZB 4QITA 4RJEA 3GR4A 1HJQA 5GNXA 1DXFA 1AW2A 5BMXA 2UY4A 2DU2A 4WY0F 3GVWA 4FLQA 4S39A 4HYRA 4AF0A 1UD4A 3HG3A 3PUEA 2YA0A 3C5QA 2VRQA 2NV9A 3P67A 4IG2B 4XTDA 1GVFA 3CTLA 1UIOA 5D04C 3GH7A 4E8CA 1UASA 4MNLA 1FWDC 4NNAA 5LIYX 2V82A 2UV8G 1L6YA 1K1DA 2HXTA 2VL4A 2IPFA 4L4MA 3MWCA 2OQYA 5A6JA 3SUVA 2E28A 3C0SA 3WMSA 5FL1A 2W67A 1TRIA 2WC4A 2VEFA 4OT7A 4GGBA 2PF8A 1Q8JA 3LZ5A 3M9YA 3FSTA 4S38A 4S3BA 2MANA 1R6WA 3BQ6A 4DJFA 4IIEA 1Y8BA 2QVHA 3WFAA 2CLMA 3EA1A 2WZEA 3MKVA 1TWZA 4N4PA 3E2QA 3GNPA 3P81A 1IEWA 1VFUA 3UJFA 2I9UA 3QFEA 6REQA 4NJGA 4MB1A 1PTGA 1VCFA 3GBEA 2PDPA 4G7FA 3AAMA 3GNXA 4FXJA 1BPLB 3CB3A 5ABGA 4KT2A 2OSYA 4Q6JA 4Q4RA 3PUDA 3KEHA 1U30A 3OVPA 1B4EA 3UVIA 4DWSC 4M80A 2FZNA 1TA3B 3VOHA 1XLGA 1ME8A 5K9DA 4R3UA 1CB7B 1ZBWA 3FIGA 3B8SA 1V51A 3UYCA 2YDQA 3KX6A 5DEZA 3OZYA 1V03A 2ZOXA 2JF7A 1MUMA 3MP4A 1LT8A 3TYBA 1VBGA 2X1RA 3GVVA 3DHDA 4CD7A 2QCDA 3NQCA 4GBDA 3W27A 2OSWA 3MQTA 1JD9A 3KVKA 3G1VA 1VH7A 4N02A 1P6BA 1BRLA 2O9PA 1EF3A 4ADTA 3GH5A 2ZRVA 3E0VA 4LJ3A 2BG5A 3CHFA 2IXUA 2GSJA 3AIVA 5H2ZA 4QG8A 3SDOA 1ZBVA 4AIEA 1T6MA 1G7UA 2YBUA 4AMAA 4C6QA 2V2HA 3TJLA 4GG9A 3LHVA 1C9WA 5LNWA 3NCOA 1C92A 1JDFA 4M1RA 2DSWA 5G4WA 4JFSA 2OYMA 3R11A 3S1GA 2BOEX 1REQA 1AZ2A 4US6A 1K6AA 5AB3A 4WJ8A 1Q2SA 5HNTA 3TAKA 3M5ZA 5HULA 4UTIA 4JQAA 4NNCA 3GXPA 4DYEA 3S2LA 1U5HA 1JZ6A 3B0PA 4F79A 4W93A 3KBMA 2AQVA 2G4FA 4OIFA 2WBGA 4D6GA 2CLOA 4PFHA 4NJHA 2CBJA 2J24A 1G4PA 3WLPA 4CQAA 1NWUA 2XN0A 2ZX7A 2RGMA 4M8UA 3B0YA 3W7IA 1EWEA 1KC7A 5KZ6A 3WF3A 3W7EA 4GVHA 2VWSA 4XD5A 4A3HA 3GTHA 4WVXA 3PZ9A 4MJ2A 1QOXA 2UBPC 5ABFA 3T08A 2BBFA 1C91A 7REQB 3DHPA 1GG0A 5DRCA 2QR6A 2TODA 5K9CA 3ABQA 1M7PA 1D7KA 4H6KA 3WSUA 4GIAA 3P3BA 1WUFA 3QW3A 4B5WA 3VUPA 4N6FA 4IPPA 1UKTA 4TVDA 2P3EA 1EZWA 3RGTA 3EOLA 2OX1A 2XIJA 3PY2A 1NIUA 4OFCA 3F4DA 2IKIA 1RH9A 1JQVA 3CT2A 1OCBA 2J8TA 2Y7DA 4S2BA 1KLYA 2CHRA 1BYBA 3RX2A 4AEFA 4PEEA 4LW7A 1XLAA 2ZA2A 3RX4A 1DJQA 4PTNA 4NZ5A 2C7FA 1SZRA 1DOSA 1YDYA 1ISZA 3W1RA 1SZGA 3AS0A 2I5QA 1Z89A 4KRUA 5C5YA 4HZMA 1JZ2A 3SO7A 1DJYA 1HKIA 5FJRA 5HK4A 4L1XA 3NQ2A 4LT9A 4PCTA 1J93A 3Q2DA 2B4GA 3SN4A 4DJDD 3LZ3A 3DG3A 2H8XA 4IGMA 1I8JA 5GNYA 4GXWA 2NT0A 3QH2A 3IAQA 4L5ZA 5KZEA 1UWTA 1XYAA 2WNQA 4V33A 1JPMA 1H63A 4P5UA 5FEXA 1J2BA 1C8XA 4Q4SA 2FGLA 3RO8A 4IX2A 1MXGA 5HR6A 4GIRA 2W91A 3CQHA 2OOGA 3F1QA 3ITXA 5CG0A 4HK7A 1FWGC 1TV3A 3TH6A 2C0AA 4Z2LA 4R88A 4KWOA 4X2PA 4QCEA 2ZA3A 1R2RA 1KR0A 1FTXA 1AG1O 3ES8A 4YTUA 3MS8A 4Z0SA 1M5WA 4U5IA 1WZMA 5FF3A 3QHNA 1DWJM 2ISWA 2VVNA 3PZGA 1DQXA 1JR1A 5LYRA 3XIMA 3W82A 3AHTA 3EMCA 2ZUSA 3LGGA 3L4WA 1SU5A 3BANA 1YNYA 4QSFA 3NEHA 4EKJA 3QKZA 4C1NB 1P1MA 2FPVA 2Q71A 1XQKA 1KCXA 4QHRA 3V35A 1OFDA 5CCZA 1OC6A 3VE9A 4ZMGA 1CGUA 3W74A 2BLEA 1MSSA 1GHRA 3CASA 4ZQPA 3ITVA 3NO5A 2QDGA 1EYWA 2OKTA 2HNHA 1XCFA 2PWFA 1A5KC 1GGOA 9RUBA 4CVWA 5D9PA 4GKLA 5AYBA 2VENA 2YLAA 4FNRA 1VS1A 3L65A 1ZHAA 3BLEA 3AHYA 4H04A 2VURA 4H1ZA 1HGWA 2HPIA 1OX5A 1VYSX 3I10A 3WLRA 3VIGA 3VZYA 3VGFA 5BROA 1NOWA 4E3VA 3STCA 2F61A 4I5UA 3AMCA 1L0PA 3AISA 4O16A 4UQDA 3PAJA 4UR9A 4RPPA 4O1AA 4J7RA 4PGLA 1EGVA 3BAXA 5U4NA 3G1RA 4I5XA 3QQ0A 1EJUC 4NSBA 1KGUA 4IFOA 1V02A 3CH0A 4XUGA 4MB3A 3WMCA 3H55A 1EEPA 4KWWA 1F4HA 3KOFA 4N0RA 1EUNA 3KVLA 1TR1A 3OODA 2WANA 1KRBC 4AFYA 1H11A 2YCKX 1BHGA 1UPMB 4B16A 5I0DA 3APTA 1IR2A 4AX7A 4W4QA 3UZ5A 4JCLA 2CC0A 3N29A 3N6JA 2FVKA 4O53A 1DQUA 4Y8FA 1LYXA 1XPGA 1CECA 5DCDA 3SY1A 1Z3NA 3OVGA 5H91A 3OA3A 4QE4A 1BYAA 3QFWA 1XLEA 1DWGM 1RQBA 3VD4A 1OFRA 1K70A 3GY1A 2VC6A 2OU4A 5A5WA 5EMUA 1FHUA 2RAGA 4N2YA 1IEQA 1BF6A 4PMQA 1TB3A 3FAWA 2VCCA 3VOIA 4E4FA 2Z26A 3WDRA 2VDGA 3RF9A 4ZBCA 4H8HA 4H9VA 2CLLA 4PTVA 1XH1A 2OG9A 1GQNA 1XYMA 5C8BB 5GJNA 3TONA 2GVJA 3WL1A 2PTWA 2VC7A 2FPYA 3AIBA 1W91A 5AHMA 3BAKA 1E40A 4OU1A 8XIAA 4HU3A 3NQEA 3PPFA 1IEVA 3MTWA 4JNZA 4UFHA 4GK8A 2Z29A 2ACSA 2INFA 6CGTA 4YHGA 4ZGYA 2WCAA 3I68A 1HJVA 3R13A 4RNJA 4D6EA 3QZ6A 1MMFA 5KZDA 1TE1A 5D8ZA 3CZJA 4DAIA 3NVTA 1CLVA 1ICPA 3HQNA 4O11A 3UVAA 4ZOCA 4FO4A 1BQGA 3SFKA 4BI5A 3WLIA 3E1F1 3G3MA 3LNPA 2ZC8A 3QV6A 1HFBA 2PD9A 2ZUTA 1B4KA 2PP0A 2C15A 1MFVA 2QUTA 2VGIA 3ZLGA 5HBFA 1RY0A 4JGDA 4XZMX 3STPA 2C79A 4YJ5A 1UUQA 3FDGA 3BAIA 4Z2IA 2CNCA 2CKRA 5GNZA 5EB8A 2DUXA 2XTKA 1J0YA 4IH3A 2L5HA 3LPOA 3W7GA 5A6AA 2Y62A 3V4BA 3GFXA 1T41A 3WK2A 4QIUA 1SFTA 2VELA 2EG7A 1ZJHA 2OKOA 4LVDA 1CWYA 4Q7NA 3M46A 4RXFA 3TYCA 1F7BA 4P8WA 1J0IA 4R9OA 3BARA 5HQMA 4XBSA 3VU2A 6TIMA 3BXWA 4XZNX 3V5FA 1YXYA 3WD0A 1B3WA 1XYCA 3PTMA 1Z44A 1NP2A 2Z1BA 4PUKA 2PS2A 3UPBA 4TVUA 5BRPA 2OMAA 4CNUA 2O7SA 3VGBA 3VX1A 3LLXA 1V6XA 1E15A 1DJWA 1GONA 2ODOA 2I57A 1BKHA 2AL2A 1R3SA 4BWLA 1GYMA 1V3MA 4LGXA 2CESA 1O7AA 4LY8A 3ONBA 4WGXA 3SGGA 3AXKA 5A3HA 2W92A 4FX6M 1SO5A 4AEOA 3G0SA 1CXKA 2B0MA 4H9UA 3C0JA 5D09A 4DBDA 1JCNA 4A3QA 1PKNA 2WV8A 5DELA 2BHUA 1S39A 4QLLA 2ASHA 2BP1A 3W88A 2VVSA 1CBGA 1FWAC 1BAGA 3L4YA 4XAFA 3BG5A 4LS0A 4OE7A 4OECA 4BF7A 3SCRA 1NDZA 2OLHA 1OEPA 4J35A 2ZUUA 3H4XA 3FLUA 1D3HA 4MZ8A 2JF6A 5DX7A 2X1SA 2DT2A 3LI0A 3GKAA 3KS5A 1W3LA 2R6OA 5AHEA 1K02A 1IXQA 4UTTA 4IIBA 4FI4A 4YN5A 2EGZA 2VEMA 3B0XA 4H8UA 1DKWA 5I3GA 6PTDA 4ZZ9A 3MYPA 4UFJA 4GNKB 3WH8A 1DIEA 3KUMA 3GAYA 3MKKA 2D73A 4HYVA 3AUOA 3EEGA 4XKYA 3N9SA 1P7TA 3P84A 5AOUA 2TAAA 1H1NA 2J25A 1HP5A 2CW6A 4DXKA 4HBKA 3MW7A 2HVNA 4BY3A 3LG3A 4QDWA 1LLOA 3U5UA 4K8GA 3P60A 4Q4MA 4JKKA 2ZICA 3E38A 5AC8A 2FKPA 1UA7A 5CAHA 4GQQA 3BMWA 3N19B 4L9XA 5HMFA 3OYZA 2BX7A 4XD6A 4HNTA 2ZX5A 5CJMA 4AWSA 4JQ1A 1P0BA 2V2DA 4JTCA 3W29A 2DVTA 3NPWA 1XYBA 4W9TA 5I3HA 3M7WA 3W1NA 3ATYA 1C3FA 2WVUA 3TXVA 4KQNA 3GX9A 2WQPA 4PH6A 2PWDA 4LRSA 2YX0A 4BK9A 4UR7A 1XSJA 2H9AA 1TZZA 1QPOA 3S5YA 1RD6A 3INPA 5CGTA 4B92A 3M0VA 2IMRA 1MUCA 1K8CA 2VZUA 3KS6A 2Z25A 5EBUA 2IKHA 3MWAA 3O6AA 2IQDA 4E0CA 2R1KA 1ZL1A 4IISA 3W2LA 1QNQA 3RLHA 3EXRA 4DO4A 1U1UA 4NRRA 3WK3A 4FB7A 4QM1A 2WPGA 1XPYA 2C19A 3UWVA 3AWNA 1M7XA 3IK2A 3UGVA 1Z42A 4ICCX 3RPMA 2D22A 2ISSA 2PTDA 4W7UA 2Q3OA 3DOPA 2WSPA 3T4CA 3TJIA 1YYAA 4DHGA 3O3RA 1XLLA 1A53A 1YDNA 2W6RA 4O12A 1A5MC 3DN5A 3SCPA 3ARXA 4KPLA 2EPHA 4AAJA 3KTCA 1KXHA 1J01A 1ZNNA 3URBA 2HROA 4FS9A 2A7NA 3NNTA 4KW2A 2HXUA 1TWDA 3C3UA 3NDOA 1JUBA 3UJ2A 3GXFA 1RJPA 4QEHA 2PDXA 3EA3A 3Q4DA 3S1VA 2Y63A 3GS6A 1US0A 3AYRA 3GBDA 2F9RA 3QLDA 4ENLA 3HO8A 3QOKA 5IXEA 2PGEA 2G3FA 5AFDA 2QT3A 2QV4A 1B3ZA 3MJMA 3Q65A 1NDYA 1T7LA 5C9ZA 4KEMA 4DLMA 3QSTA 3B97A 4HGXA 4A4AA 1TV5A 4US5A 3W2UA 4O14A 1ZAHA 2HVOA 2OWXA 4OZOA 5AN7A 2H9AB 1AODA 3DI0A 4J3UA 1W9DM 2VEPA 1DJIA 5FI8A 1UR0A 2VCBA 3T2OA 4ZQMA 5SWUA 4LS2A 5J8LA 3G2GA 3UXLA 4AZHA 3H26A 4ZQRA 1E4LA 1QK2A 1KM5A 4I90A 2CXGA 2WAGA 3T0DA 4OKDA 4HHHA 1MEWA 5HUOA 3U57A 3SRDA 3W7CA 3BLFA 3AMLA 1QO2A 4K8EA 4CNOA 2VEIA 4GH1A 2GJRA 3H22A 1GNXA 2OX4A 3T6CA 1TZ9A 4F0SA 1VPXA 4B4FA 1V4YA 3GDKA 4K39A 3ZM8A 4AIOA 1J0ZA 1LBFA 2CZ5A 1OF6A 4K37A 4KF1A 3LTSA 3W7DA 4NX0A 3EWUA 2RH9A 2Z24A 4JNMA 5KZMA 4C6EA 1FHVA 2E09A 2ATMA 3POHA 2XFYA 4DUVA 1ML1A 1W17A 1AW5A 2VKZG 3VOCA 1JPKA 1MNZA 3NQMA 1DWFM 4NAEB 3W0KA 4E5TA 2CITA 3AQUA 1HW6A 3NZRA 1XGEA 4Q8QA 4ZXLA 3W87A 1QPQA 4PMRA 3W1MA 1RZMA 3CAQA 3TJ4A 4H9MA 1NU5A 4O0KA 3IJ6A 1W37A 3RM9A 3AMGA 3AXMA 1DIKA 2TRSA 5CPMA 2WWCA 2J7EA 4TQTA 2XIQA 1PSCA 3RUBL 5DQPA 4XKMA 2DZAA 3A21A 4PUUA 2BS9A 2KX9A 3RK8A 2V67A 3NEVA 4O8AA 3QV7A 2RHGA 3LPGA 5G1TA 2VEGA 3T4WA 3IUIA 3TC7A 4GPNA 1YQ2A 1JG9A 1RJQA 5A8NA 1PKYA 3SR7A 1BTMA 1ONRA 3AIQA 1SJCA 1RUSA 3NG3A 3GD6A 2CHNA 3HURA 3GLCA 4KFNA 3B8DA 1N82A 1YPXA 3ABSA 3LMYA 4H19A 3WF0A 4H6RA 1UR3M 2BOFX 2J9XA 4GZJA 1ZTVA 3DKLA 2HE8A 1CNVA 3KAOA 4N7QA 4FR1A 1CXIA 4EXBA 1QPKA 4KCTA 2XH0A 3D5HA 4JTIA 3VNJA 4JTLA 1ADSA 3O15A 3F5LA 3WJWA 2GJPA 3TJXA 2RUSA 1YDVA 3SUWA 3B9OA 3UXKA 3WH5A 2WMGA 4IWWA 3S0CA 5IDIA 4YYCA 1W1VA 3PK7A 3CL7A 5I6SA 1EJ7L 4JTJA 1B9ZA 5DCEA 3W00A 5CBJA 1FHDA 1Q6DA 3WLNA 2YR1A 2D3LA 1U1JA 4UTWA 3NZGA 2YW4A 4AVFA 2PWGA 3AJXA 1E4IA 1EJRC 1K9DA 4LAOA 3IANA 4X0NA 2X2GA 4GQRA 5CZKA 1RJRA 3LCXA 1OCNA 2C1HA 3TEVA 1WDPA 4E4PA 4WZHA 3GC2A 4NZ1A 4QR6A 1RV8A 2OEKA 2NQJA 2QUUA 2Z1WA 4C6PA 3GXMA 5D05A 4B5VA 4JCMA 1QK0A 2AGTA 4XVDA 4L4LA 4XIMA 4DNMA 5LXEA 4ECLA 1TUFA 3RMEA 3W6MA 3GHRA 5CLTA 4B5TA 4WF7A 3E5PA 4CNTA 4P7NA 1PYMA 2ZXQA 2CLEA 1JCYA 1EC7A 3EA2A 5C71A 3NAVA 2EAWA 1QASA 4WXYA 1B3YA 2VZSA 4RDVA 3D0CA 4UMBA 1GJWA 1WKYA 4FSAA 4A21A 1JRCA 1QRQA 1M03A 1BG9A 3A9IA 3UG5A 3ISIX 1DHKA 1SGJA 4L56A 3KL3A 1E6ZA 5JH1A 1GOWA 1FUYA 4V27A 1ICSA 2P0IA 5AYIA 5TBOA 4J9JA 5L9FA 1P4CA 2WMIA 4LCRA 2CU0A 3M6DA 3U8GA 3UGRA 4U31A 4HOXA 3L0KA 3WEMA 2OJPA 3WLMA 4LV9A 1FH9A 1IIHA 2W66A 4C65A 4CKQA 2INEA 2VR5A 4DO6A 3PG9A 2WJEA 1AFSA 2R1NA 5IHSA 3KVMA 3WY1A 5D8WA 2PDUA 2DT3A 4OGZA 3I4EA 1UIPA 2HJPA 2WCSA 3O63A 1C7SA 1K8YA 1RQEA 2Y89A 3FS2A 3CQKA 3WX7A 2WZMA 2XSAA 4F40A 1PL9A 3DU0A 2VTFA 4H9XA 5T26A 1JAEA 3QOMA 3WNNA 2Y7EA 4Y8EA 4Y9NA 2DSKA 4J3WA 3WQWA 4F3HA 4MKNA 3KRUA 1HKWA 4H4IA 3OG3A 5C55A 1PIFA 1ZZMA 5ENLA 2WJDA 3CYVA 3G6LA 1FWRA 2QMJA 4HPNA 3LCHA 3RJYA 4IP7A 2YW3A 1XBZA 2CLPA 1W5MA 3OZPA 2Y2WA 1UR8A 4UQ9A 3GDRA 1E6NA 3RCMA 4PB5A 3SY5A 1EHAA 4W8LA 1A5CA 3TC6A 4CCEA 2GVGA 5AYYA 2IS7A 1MQPA 4YCOA 3HQ1A 1HVQA 5H1WA 2CYGA 4HIBA 4JL1A 3B8TA 4UNIA 2WO5A 2XPKA 1WZAA 4V1YA 3DENA 4YS1A 3KVJA 2DW7A 1WX0A 2C8NA 1EQPA 1UD3A 3W1XA 4Q4PA 3RITA 1CI1A 2CLIA 3E0LA 4ZVJA 2PC8A 3BV7A 5G5IA 4DI8A 3P80A 4IL2A 1GKRA 4MY9A 3UCQA 2J9YA 3ZWTA 1FCUA 4XTIA 3C4UA 3THCA 2J79A 4CNSA 2PDNA 1R9ZA 5BW6A 3UR7A 1K7EA 3IUHA 5E1QA 3RAOA 2E6DA 3ZSTA 2QAFA 4S3KA 3AYTA 2A2IA 3U6WA 2G41A 1VAHA 3Q45A 3S5SA 3GRIA 1RBLA 1BFNA 4F2TA 1XM3A 5L6UA 2ESCA 3H53A 4OWGA 2PDMA 1R0MA 5GQBA 1TIMA 1Q4WA 2Z6JA 4Q22A 2VC9A 2CLFA 1LOQA 2VZVA 1AH3A 4AZ5A 3W7JA 3C2RA 3IVUA 3NQVA 2XIMA 4X60A 1Y65A 4RV8A 5J5RA 1X7FA 4M56A 3UJEA 1JYVA 4TMCA 3N2CA 4FK9A 3QTPA 4K8HA 4WLCA 3CQJA 3HG4A 3SCUA 1GT8A 2J75A 1Q7ZA 2VOMA 2ZWYA 2F6KA 4HB7A 3KBJA 1WKEA 3WJSA 3UBPC 1KM3A 5CPSA 1S2AA 2J62A 3THAA 3P74A 1ZLPA 2VM8A 3PJUA 4LALA 5H8UA 1X1ZA 1CZ1A 1J12A 2A3LA 3KHJA 4LUTA 3LRKA 1ONXA 4IIDA 4MPQA 1SMAA 3LBMA 1Q8AA 3KOXA 1EB3A 1KXQA 4XSMA 2VWTA 1LT7A 3MMTA 1I45A 1GKPA 3T40A 1A5SA 2HVMA 1F76A 5LA2A 3TLQA 2FHBA 1KM2A 1JCJA 1KXVA 3TCSA 5AY7A 1FWJC 2X40A 1EXBA 2WXDM 3NL6A 4U10A 4H2HA 5LHFA 4GXMA 4DLFA 1KV8A 3MSRA 4HZ8A 1E51A 2GWNA 5EA9A 1C8QA 4AZIA 4JD4A 1BF2A 3URQA 2GUBA 1RVGA 4C6NA 1E6SM 2NVCA 3TW6A 3V0TA 3WENA 2C0HA 2NXHA 3ARTA 2ZKMX 1KFLA 4IIFA 1SJAA 4M24A 2DSZA 3SCQA 1V0LA 2WYSA 4GUJA 1K9TA 3C2YA 4XBKA 1XQLA 1YHTA 1HO4A 1XGDA 1I4NA 2XGBA 5CJNA 4GO9A 1SUXA 4IXXA 4AVOA 1W3TA 5CPOA 2FH8A 3T8LA 4FF7A 5E0KA 4UQEA 3K4WA 5U7SA 2Y4SA 3NQ7A 3TUUA 3O6DA 1K9FA 1QJWA 2NT1A 4HPHA 1B30A 3NYZA 1WPCA 1YXDA 2OOFA 1UD8A 5A6BD 5FEWA 3LTPA 4XVEA 1T96A 1LG1A 3NPXA 2J7GA 2BGSA 4WKAA 3QV8A 3WDPP 5REQA 3V5CA 1AQHA 4DJEA 1P6WA 3NQGA 5HXMA 3P61A 2OELA 3BJTA 3DXIA 5M1TA 4JX4A 1JZ8A 3NIYA 3LS9A 3B05A 1MUWA 2BXVA 3Q58A 4N9BA 4XZWA 3UW6A 1UWQA 1EIXA 5F1VA 2PWEA 4B90A 3N11A 2QGHA 2FZBA 3JW7A 5CGQA 1KM6A 3M07A 1VRXA 1OINA 3DZ1A 5D2VA 3HJZA 2V69A 3N2MA 4ONVA 1P0KA 3L7RA 5C9XA 1LRTA 4AYSA 2OEMA 3ANYA 1A5UA 3PF3A 3TTSA 5A2BA 3MSDA 3SFWA 1PX3A 4WHBA 4AZ6A 1M6JA 3S8HA 3GYEA 1TSIA 2TMDA 3CZ8A 4FXFA 2HMCA 1OIMA 3EWCA 3EXSA 1LBMA 4OHQA 4CD5A 3TX9A 3VIHA 4QDMA 1FKXA 2QYGA 3LRLA 3W38A 3H7RA 2YOCA 4QBXA 3CC1A 4DZIA 2AQOA 4NILA 3W1UA 3L68A 4P7QA 4YL2A 3HPSA 3I3DA 5K9XA 1W31A 3AIEA 2E5BA 3U2EA 2EKGA 4O1DA 1UW9A 1Q6CA 5C7VA 3LM7A 3W70A 1JCTA 3SSJA 7A3HA 4IMCA 3UZYA 4FLSA 3QSRA 2EG6A 3MZ2A 3DX5A 4RDZA 1XJBA 4JHMA 1N8FA 4ROQA 1ZJIA 4REQB 3UWZA 2Z6IA 5D38A 2Y8KA 1QPRA 4S3JA 1JCLA 3GWQA 3WQ4A 1GTEA 1KRMA 1GVYA 4E2BA 3N25A 4AD1A 3QGVA 4FX7A 3VIIA 4NG3A 2PBGA 3M44A 1TG7A 3CHEA 4NRSA 3WJXA 2C1GA 1SVDA 4R53A 4H8NA 3OA5A 1WXJA 2W9MA 1CTNA 3LBOA 4G6CA 5TQLA 4RNHA 2VEKA 1A50A 4QE1A 5AKQA 3VMPA 3VNIA 3UWUA 4QP0A 1E9LA 3O1NA 1HG3A 3FK4A 3T78A 4DVOA 3DKJA 1H3GA 3TYAA 4J3SA 3GU2A 3OW1A 2WNWA 4LTSA 2A4AA 4QRNA 3WH7A 1V7YA 5I77A 4YMZA 1NF7A 2HK0A 3VCCA 1QI2A 3W83A 4IMGA 2V3DA 1GOQA 1B31A 4RE4A 2G37A 4L6OA 3IS4A 4N9CA 5IHRA 4LNCA 4G7EB 3GR7A 1HL8A 1XXXA 2OCZA 1W1PA 3LHYA 3ICJA 4GH3A 2X41A 4M1BA 5FEZA 2ZBTA 1YBQA 4WY0A 1MVYA 4Y90A 4GNVA 4XZBA 4DQWA 2V63A 4NNBA 3GDBA 5I3FA 2CLKA 1JCMP 3KLKA 4ZQOA 1CB2A 1QWKA 1OHLA 4FIQA 1JYNA 3G8EA 3SRKA 3DC8A 3BMXA 1TV7A 2IPGA 4DY1A 4MLJA 2HBVA 2WMJA 3W86A 5LNVA 1FH7A 4AIBA 3R0DA 4RCXA 2ZXAA 1W8GA 2ZE0A 3QC3A 2NQHA 3BGAA 4AISA 3HGOA 2RDTA 4M51A 4US5D 3EPNA 3DYMA 3DFOA 4MSSA 3A22A 2B31A 3CL6A 4NUWA 2FHFA 3E0WA 3E02A 1W9PA 1R3VA 3EDFA 5BYWA 1JZ7A 3IGSA 1DTNA 4MKSA 4O57A 2ZFAA 1XIBA 3L4TA 1QU4A 1HKKA 3G6MA 1FXPA 4BQ3A 2PAJA 2G4JA 2R14A 2V5BA 3CIXA 5BRBA 4NAFB 1KFJA 1UWAA 4Y9OA 2W5FA 4DAFA 4GFSA 5HPOA 1I2OA 1VBJA 1UKSA 2RJGA 1FCBA 1XRVA 2QJGA 3CWNA 2V68A 1P6CA 2WKLA 4DF1A 1K9EA 3WBYA 2NZLA 2Y8VA 4MWAA 3LM3A 1MQRA 2WMHA 1OYBA 5F2MA 3EDJA 4HP5A 3MJYA 4QFUA 1HJSA 4PRTA 3DECA 1EP2A 1FQ0A 4ZO9A 1ECEA 4KBXA 2WW5A 4LBSA 3EX1A 1Q5MA 2NQ9A 3PZUA 3AI0A 1Z7AA 3VE7A 1HL2A 3BJSA 4IMAA 2YLLA 2I1OA 3RG6A 3ZMRA 1I60A 2A3AA 3WMLA 2FVLA 3H6OA 3A9BA 2CLHA 5CSUA 3UWWA 2XM2A 4PZVA 4ML9A 3VILA 1F3TA 4YVPA 1GQKA 4PUDA 2QF7A 3EGJA 4FA3A 3H23A 1B3XA 3ITTA 1ZCCA 4MADA 1J5TA 1HTIA 1NQ6A 1SMDA 3Q37A 3IJ8A 1TPFA 3GIPA 2OZ3A 3ZFHA 3WL0A 3S47A 3HF3A 4ES4A 5ABTA 3AXIA 3C8FA 1XH0A 3ABRA 4GJJA 2TYSA 3PFRA 3TMQA 3MBFA 2CBIA 3G1SA 3BV4A 2X1IA 3FVDA 5HANA 3HU7A 3PJWA 2J8FA 1EJSC 3EDKA 4DUWA 3NXLA 1NDWA 4XG1A 1W9XA 2EPMX 2A3BA 3UXIA 2GUYA 4W86A 1GTHA 2GQ9A 2DZTA 2PPGA 3A64A 4L9YA 5FF7A 1EYEA 1DPMA 4GCAA 1VBRA 2CZEA 3KTXA 4MOZA 3NA8A 1EA0A 4YPJA 1M68A 4DYJA 3SB0A 3S9YA 1XFBA 3D47A 1H50A 3CO8A 3NSMA 1WKDA 2P0OA 4X2RA 5JMUA 4OJYA 4UTMA 2Z1KA 2ZUMA 4A8IA 4GE8A 3ZVHA 3VNZA 2BY3A 3GC5A 1Q85A 4XB3A 5FJUA 3A12A 1SJDA 4GUHA 1JRBA 5DLCA 3L23A 2YB1A 1XSKA 4GMEA 2WPBA 4LV4A 2DIEA 4NZCA 4Z08A 3TV8A 4PUNA 3MVTA 1FKWA 4UTKA 4DUOA 3QXBA 1LQAA 3N6QA 1H4PA 1OCQA 3S4TA 2F8QA 3POCA 3BLPX 3LSBA 5ECVA 2R91A 1RBOB 5JBDA 4JEJA 3GG0A 1JZ4A 3S2MA 3PZOA 4JTAA 5C9WA 3TN5A 3HB9A 4NASA 3APGA 2ZZ6A 4WX2A 4U2ZA 3R0UA 3QMTA 2OXNA 1OFOA 1W5OA 1UD6A 3EX6A 3KM8A 1JDCA 5DMYA 3MI6A 1P0NA 4GY0A 2PWUA 3WH9A 4CD6A 2XDFA 2D2JA 4EF8A 3THQA 4PA8A 1OX6A 3MHGA 3LNMA 2PUZA 2WZHA 3NFUA 1ZY9A 1L6WA 2POZA 2D3NA 1EH9A 3CYJA 3WK0A 1L8PA 2BXZA 1H1YA 3OIXA 4HA0A 2J9ZA 1LUCA 4O54A 1U22A 5E93A 5EMYA 5BOOA 4BI7A 3PPGA 1G01A 4BR1A 2XWDA 4V28A 1AH0A 4ZO8A 4IJCA 4IP5A 4R5EA 1TELA 3SN0A 2OWCA 1WQ5A 2GUUA 1OFPA 4AX6A 4CEUC 4JTHA 3ZSSA 4UOZA 1TO3A 4QQ3A 4MGGA 3PP7A 4F2BA 3BOXA 5KEZA 3GVQA 2OVLA 3TYEA 3TQ0A 1S3HA 3UYIA 2OGYA 3FFSA 3APYA 4PMNA 2VUNA 2XIBA 3S3GA 4G2DA 4BQ2A 1NM9A 1OZMA 1S2CA 1SFSA 3B9NA 2G3NA 2WHLA 3I7SA 3MV11 2H6RA 4GWEA 1NQKA 3LA4A 4NQ1A 1WXYA 4CQ9A 4W7VA 4QNEA 4XQ6A 1YADA 2I5IA 1NFBA 1KTCA 1PIGA 4PUJA 3CK5A 1V08A 3AIRA 4KETA 1BXBA 1US2A 3CV7A 4JFTA 3TSMA 1LRQA 1JNEA 2ZX6A 3C2FA 3H2EA 4FXRA 5TF0A 3F2DA 3IIZA 3MYOA 4DELA 4MZYA 4IL0A 3PZMA 3CZLA 3UERA 3HPXA 2QCMA 3AU2A 4WEVX 4MB5A 4BQ4A 3C8NA 1KFBA 4UB9A 5IBXA 4XAGA 3TDFA 3HJEA 2AKZA 5EGRA 1ME7A 2IKJA 4L61A 4ASTA 1CCWB 1V3HA 3KFTA 1NWTA 3K30A 5K3VA 3MCNA 3NQ8A 4J5NA 3FEMA 2VFGA 3HV8A 4AZCA 3NM1A 4B5NA 2O92A 4AWTA 2QUVA 4GD0A 4N9EA 3GIQA 4D72A 1GOOA 4KRTA 4CVUA 1FBAA 3S2CA 3TOPA 3HPAA 1Z69A 3L4ZA 3TP4A 4IIGA 3F4CA 1HKVA 2GSEA 1GVIA 4WKFA 5CC5A 4H7ZA 2W63A 4LUSA 4BA0A 2ZIDA 1W8SA 1Y5WA 1E56A 4H2CA 4NHVA 5FA5A 4LUJA 1JYWA 3RYSA 1W5NA 1H0IA 3K1GA 5A6TC 4DM1A 3OO2A 3G1AA 3PULA 5F4WA 3TAOA 3NQ6A 2QPXA 1B5TA 4A8RA 3KE0A 3C52A 5FESA 5HMDA 3TMLA 3M0HA 1LORA 3RDKA 4C91A 3WBXA 2PDFA 3AZRA 4O18A 1E1CA 4QJ3B 1QTWA 5I3DA 3PHAA 1UH3A 1M41A 1QBBA 4EPBC 1FOBA 4Z2HA 2D0FA 2OB3A 3LK6A 3WQFA 3W37A 4AY1A 4XD4A 2WHMA 2IW0A 2WBKA 3O6YX 3M41A 2GGIA 3T07A 1BSIA 2BV9A 1MZRA 3W4RA 1CGTA 1W3NA 1C29A 2Q8ZA 1XG4A 2TPSA 2J8GA 3HOJA 2Q02A 1RAKA 4FNPA 4BQ5A 1HP4A 3CV6A 1OM0A 1S5WA 2CFFA 4KEZA 3II1A 4UTFA 3RHGA 2MNRA 1WDQA 1V5XA 1YDOA 3ITLA 3NGJA 3WQ6A 1VJIA 3G0UA 1LM1A 5AYZA 3PANA 1JCXA 3DFNA 4LCQA 3KZSA 4Y9MA 4IFKA 1KBBA 3S9ZA 4CUCA 1H7WA 4X63A 2PWHA 3LHWA 1LWHA 2X8RA 4I9JA 3TVAA 3R43A 3AHVA 3MUAA 3OZMA 1G4SA 3PFMA 1Q6FA 1XH2A 4FHAA 4LCSA 1TTIA 2DORA 3SUSA 2REQA 1POKA 3W6LA 1O94A 4AZCB 5AZ1A 2O56A 5G2HA 3BK0A 1TREA 2ZE3A 2FTPA 3QHMA 1Q6RA 4UZUA 4NJKA 3LXCA 2X42A 1IT8A 4JTKA 4MZ1A 1J0HA 2XSBA 3QJAA 1A47A 2J27A 1GVSA 5LNSA 3AFBA 3L4XA 4D6JA 5CPLA 1IYXA 1UPPA 2EEXA 2PDYA 2FIQA 4AD3A 1S2VA 5DO8A 1QI0A 3V0SA 1UD2A 4P61A 3L2MA 2E8YA 3KOZA 3M0XA 4WDWA 2FMOA 5I02A 3VDBA 4H7CA 3HM7A 4GX9A 4ZEPA 1CGWA 2NWRA 1S2UA 2ZDRA 3DHUA 1PAMA 3TYDA 4UFKA 1NAL1 1SJBA 3A23A 3RN6A 2DUAA 4JTRA 1YLVA 3R7MA 5KITA 1QHPA 1K8ZA 5XIMA 2EJ1A 3RRAA 1R85A 3NM3A 1FCQA 2PDKA 4QG6A 4GFIA 5AYXA 3G1YA 3PPHA 1UKPA 2NWSA 5CQ1A 3GB6A 4IF2A 4DPQA 4K68A 1PIIA 4FNUA 4WSJA 2EF9A 3MP5A 4IHCA 1AA1B 3SIMA 3N2XA 4IMEA 2QLYA 1LLZA 5M2FX 2E1DA 5GPRA 1Q7MA 1WDSA 4MFEA 3ZQ9A 4JQ3A 4DJFC 4L64A 3OG2A 5D2XA 3J7HA 2BY1A 5HPCA 1E6RA 3CM4A 4GHRA 2J7BA 2WLZA 3O7UA 1Q6QA 4GUIA 2CZFA 1VD6A 3XINA 1IXPA 4B2DA 4QROA 5LZLA 1S3TC 3DEQA 4BHYA 3H2MA 3SADA 1BWKA 4QCFA 1OFBA 2UWFA 2A7RA 2I5GA 5DMNA 3N04A 3IIOA 1S5NA 1I2RA 5EFDA 4AW7A 3SQLA 1VPYA 2REQB 4Q32A 3LI1A 3EB3A 3L67A 4IZGA 3SCTA 4CU7A 2PCQA 1IZCA 2UY3A 3L4VA 4GYPA 1WNOA 3HFYA 3WDHA 2E5CA 4KFOA 2ZA1A 1VBHA 3VC6A 3HV9A 3FOKA 5HWNA 3LU2A 3BC9A 4L4PA 5LXXA 4JHOA 4CD4A 1OABA 4UTUA 3GNRA 4OQVA 1E72M 1ADOA 3TZNA 1YXCA 2PLCA 2D23A 3UCDA 3RCNA 1OG6A 3TKFA 3GFYA 3PM6A 3ZR5A 3HA1A 2V38A 2WNNA 2PDGA 3BQ5A 7TIMA 2OGJA 3WF1A 5ABEA 1C93A 4F0MA 4JIEA 1H5YA 2DJLA 1V3JA 4J1OA 4HOWA 3TWAA 5CLWA 3O2LA 1MRQA 3ZS4A 4AD5A 3MB9A 5BNKA 1OYCA 3E74A 3UR8A 2NUXA 1ZJBA 3KDOA 1UP2A 1X8CA 3DBPA 1L2UA 3H2FA 4JTEA 1VZWA 2AAMA 1DJGA 4M7SA 3AMKA 1FWBC 4LVFA 3M0ZA 3GO2A 4DX3A 1AD1A 1U5VA 3SIZA 4DZHA 4MDOA 4Z42C 1V79A 2GLKA 1PZ2A 1O5RA 5LIWX 4GUGA 3GG7A 1E71M 1BLIA 3NURA 2E6YA 4J27A 2ISFA 1UKOA 1WDDA 3IVSA 4PUEA 4MTVA 3GVRA 1M3UA 5C2GA 5BXRA 1MNSA 3AS2A 4R9XA 3RLUA 3GH4A 4YU1A 5LIKX 1K4HA 3SUTA 1JL8A 2GDVA 4IMFA 4MG4A 3LCLA 1GUVA 1FFQA 3ZJ8A 2WKJA 4ZB2A 1IWPA 4TV5A 4C6LA 5MKGB 4L1GA 5DXYA 5HNUA 1QI4A 2P10A 3CHCA 1MW3A 3CU2A 3L9CA 3HIJA 3VKCA 3W6YA 5DF0A 3R12A 4JN8A 4W84A 5BU6A 1KKRA 4GI4A 2QUMA 1TFVA 2X0SA 3THDA 1SO6A 1TVLA 2PZ0A 5DY2A 1JUEA 3C56A 3WUGA 4U4MA 1F2JA 3GAKA 4GZIA 4HQVA 3M64A 2YCEA 4K6AA 4RDYA 3B8UA 4JN6A 2JKAA 1HN1A 4JIRA 1CYGA 3M0IA 4O52A 3R8GA 3UZWA 2DY3A 2OEJA 1NDVA 5I09A 2CIPA 4HMEA 1GOXA 2WWDA 4PMDA 2ZRZA 1E6QM 2YCJA 4PMOA 5JXQA 3H54A 3E2RA 3FGCA 3EKGA 3A13A 3JZEA 2WVSA 2Q09A 1RP9A 3QF0A 3S46A 3TSBA 1KV5A 4JYFA 3UZZA 2YCLA 5FACA 4GZEA 4PCSA 3GHUA 1KM4A 4GVGA 2VFIA 4IGHA 3TN4A 3HZ3A 1VGAA 1X6NA 4HSOA 1F8IA 3F4VA 4XZ9A 3MP3A 3WD4A 2QVNA 1LL4A 3KWXA 3UNDA 1LWIA 4J4KA 1X7IA 3DBNA 1KBIA 1BYCA 5D33A 4O0QA 7XIMA 3A5VA 4B91A 4NI8A 4Q8WA 3VOFA 4AF0B 3UF9A 3GNDA 3G0XA 3LBCA 1ODZA 1DL3A 2QCLA 4C90A 2NUYA 1EPXA 5D32A 1DBTA 1VFHA 2QCGA 1ECQA 2PGRA 5LKYA 2VZOA 2WC7A 2Y7GA 5E09A 3VPLA 2WZIA 5CSSA 3SJNA 3GG1A 3SY8A 4GVIA 4E38A 1I2NA 4LQ1A 1O5QA 1RK5A 4LB3A 1XLFA 2XINA 1I9CB 3U5YA 1Y5VA 4HCHA 3VOGA 4CCDA 3JUGA 3MUZ1 3LPFA 4JBRA 3N3TA 2FB3A 1SW3A 2PDBA 3HFTA 1ZU8A 3C6CA 1MO0A 1L6FA 1GOIA 1KQZA 1RVKA 4BKNA 5KSWA 1EZ2A 1V0MA 5F2LA 4HD5A 3U2ZA 1QO5A 3QPEA 2YA1A 3NJ3A 6REQB 1XBYA 1M1BA 1AQ0A 5D2TA 2BY2A 2QEZA 2XG9A 4JIQA 3KTSA 1ZQ5A 2PA6A 3OLGA 1ESWA 4O17A 3I6EA 1R86A 4R34A 4AU0A 2HRWA 3I3BA 3W81A 4W8AA 4XAPA 3N15A 1LF1A 1KD0A 3W7MA 4LVAA 1HJUA 2DQXA 3HQOA 4H01A 3AC0A 1P0EA 2Y61A 1XIEA 5D2YA 2YCLB 2Z2AA 3BE7A 2AGKA 3O9NA 5HAOA 5CAKA 1VRDA 3C86A 3UWEA 3PWAA 5G2IA 2QCDB 3OLIA 3PBWA 1K8XA 2CZVA 1GYLA 2GQ8A 2VCAA 4WGHA 1K4GA 4C6BA 1NWSA