1DL3A

Crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
191
Chain Sequence
b'MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVERVGVFVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVRPFAVDVSSGVEAFPGKKDHDSIKMFIKNAKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
publication title Structure and function of mutationally generated monomers of dimeric phosphoribosylanthranilate isomerase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Isomerase
total genus 65
structure length 191
sequence length 203
chains with identical sequence B
ec nomenclature ec 5.3.1.24: Phosphoribosylanthranilate isomerase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dl3A00
1W37A 3FEMA 4WQ6A 4FB7A 1VLIA 1VYPX 2Y63A 3G8RA 3OVRA 4JTSA 4BK9A 1JUKA 3LDVA 5TIMA 5BW6A 1FDJA 3AJXA 4LVDA 4NX0A 1O5XA 4M5PA 3Q58A 1SZNA 4BR1A 4NQ1A 3R13A 1W3IA 2E6AA 1XBVA 5LHFA 3TXVA 3DGRA 3UZ5A 2NX3A 1O4UA 3W75A 2VFFA 3UXAA 1MO0A 3USBA 1KTBA 4UTUA 4UTIA 2A7NA 5AYYA 3G1FA 1W54A 3IGXA 3UNDA 4WJEA 4BI5A 1YDNA 1Q6OA 5G4EA 4K37A 4WX2A 3U2OA 3C61A 2IQTA 1GTHA 3RMJA 1ICQA 4O53A 2CLFA 3NG3A 3NM1A 3NVTA 5DXXA 4JX4A 4EWND 2GJNA 3LRLA 2WKJA 2DZSA 1AK5A 3TSDA 5CZ0A 2Y89A 4OU1A 1KM5A 1YXYA 5BMWA 3RFAA 3PG9A 1I45A 1SZFA 1B4KA 1X6UA 3N34A 1VR6A 1YTEA 1Q6QA 3SIZA 4MZYA 4UTJA 2PCQA 5F1VA 4NXKA 4GJ1A 5AHIA 4MIMA 4MYAA 3N19B 3NQ2A 3RK8A 3MJYA 2F84A 1VH7A 1JVNA 2E5BA 4HPXA 4I9AA 4NUWA 4IMEA 5U7SA 3S42A 4TMBA 1JRBA 2PC4A 5LSMA 3EX1A 3PS7A 5LHEA 4TU1A 3HGRA 4IOTA 1KLZA 1U83A 2R91A 3QPZA 1LOQA 4Z0SA 3MHGA 5DXYA 4JYDA 1G7VA 4X22A 5F4WA 4AWUA 2YX0A 3MI3A 5D30A 5K4XA 1DQWA 3CQ0A 1TPWA 4CNOA 4DBEA 3F1QA 1SPQA 3FOKA 4PTNA 1TTJA 3W7KA 2J9ZA 2FJKA 4Y9AA 3UWVA 4M7SA 5G2WA 5FF3A 3BG3A 1SQ7A 3JS3A 2E5CA 3C2OA 2P0OA 1H5YA 1TV5A 3S1VA 1R2SA 2ISSA 3MI6A 1AW1A 1HO4A 1Z48A 3WJZA 4I7VA 1TRIA 3N2XA 5FESA 2VENA 5KTLA 3M5YA 2NXIA 5A5WA 1ZY9A 3PULA 3W9ZA 3M9YA 4FNRA 3P61A 3LHTA 4AHQA 3TROA 2CLMA 3LTPA 4UFHA 3B0VC 3W7RA 5KZEA 1AMKA 3F4NA 3PWAA 3L0KA 4QNWA 2ISVA 4MZ1A 3E49A 4LC8A 2QJGA 1M7PA 1RQHA 1SU5A 1JCNA 1ADOA 2YW3A 2Z6JA 1HG3A 2NV2A 2NUWA 1EIXA 2A1YA 3W88A 4CNPA 1ZALA 3V1PA 2A4AA 4PL1A 2ZA3A 5LNRA 5F4SA 1QO2A 1TQXA 5AOUA 4S2BA 4AF0A 4UTMA 4YCPA 1QAPA 4GUJA 5CPOA 5CPNA 3HGSA 3NQEA 4NJJA 3SY5A 3W72A 1C29A 1TJPA 5D02A 1TIMA 1UUOA 1YYAA 4I7WA 1KBIA 3PR2A 1A53A 1JRCA 4UFJA 3W2JA 1XBXA 5I3IA 4JDBA 1ONRA 1F2JA 1TPEA 2F7FA 2ALDA 1NVMA 5IM51 2C16A 3S5YA 3IVSA 3LCFA 3UY7A 1D3GA 2Y62A 2JGQA 3P74A 1TMHA 3B8DA 1OYCA 4O8RA 4JY9A 5ABTA 4RV8A 2QJHA 5DLCA 4JR5A 3VKJA 3M47A 3L66A 4O57A 3STGA 1M7OA 5LGXA 4AF0B 4ZQRA 3GKFA 1F6KA 2QKFA 3KVJA 4CQ9A 1FBAA 2QCCA 1T99A 2E6YA 3GDMA 2ZZ4A 4HNTA 1KV5A 3FJLA 4NJKA 1IIGA 3IIOA 5FEZA 2QCHA 3UXDA 1ME8A 1R30A 2OZ0A 2ATMA 5KZDA 5D2TA 1K8YA 1KM4A 3A24A 4RCXA 4ZQNA 1FWTA 3LERA 3Q37A 1O95A 1S5VA 1RPXA 3NQDA 3NEVA 3HPZA 1P1XA 4RXFA 4IXHA 5FF0A 2ZBTA 1JCLA 1L2UA 5J5DA 1ZHAA 3LHUA 3QM3A 3K30A 5AFDA 5DBTA 2YDAA 4JTLA 3THAA 3TJLA 3UZJA 3VE9A 4M6QA 2ZTJA 4GUFA 3RLUA 5HR6A 4XZ9A 3KHJA 5I3FA 4JTGA 1F05A 2NXHA 4DELA 4HSNA 1DVJA 2BTMA 2X16A 2H3DA 3UD6A 3V75A 4UFMA 4JXCA 4AMAA 3WK3A 3M1ZA 3TIMA 3DKJA 3NOEA 1MZHA 1KFJA 4OQVA 4JIQA 1UCWA 2DJLA 2X2GA 3SSJA 2FPVA 3NDOA 2Y7EA 1PIIA 2DZVA 3TJXA 3TXZA 5I3GA 4FX6M 3LLDA 3LBMA 2ZDRA 4JN6A 3HF3A 3G24A 1VS1A 1TB3A 4CLMA 3QEZA 5LGZA 1ME7A 1IF2A 4OT7A 1BTMA 3DZ1A 3ABOA 2Y85A 3G3DA 2D73A 1AW5A 1F6PA 3EB2A 3IIVA 4JX5A 3NQ7A 3NNTA 3LCXA 4JX6A 1UASA 3DU0A 3RLVA 3MP5A 1WQ5A 3TR2A 1KM6A 3P60A 4IQLA 5K9CA 3EXSA 2WSQA 2YSWA 1W5NA 4UMBA 5LNVA 4NZJA 1IGSA 3QW3A 1YDVA 2TYSA 2BLEA 4K36A 4Y6GA 3I7QA 2C13A 3H53A 1I2QA 2GVJA 5AYXA 3TX9A 3DAQA 2YFNA 5DCEA 3TAKA 3G1HA 1P5BA 3BGGA 1FXQA 5DY2A 2GUUA 4BI6A 5F2LA 3STEA 2XFWA 3DKLA 3LX9A 1VCGA 1EX5A 3S6DA 3W7GA 1UJPA 4DQWA 5CG7A 1D3HA 3O16A 2TMDA 3B05A 1OYAA 3B0PA 2A85A 4AWTA 1VCFA 3EWWA 3W1MA 5DCDA 4UNKA 2B4GA 3M5XA 4UXDA 2VFHA 3DFOA 4H4IA 4QJ1A 4ZQOA 1EA0A 3DI1A 3QRHA 4CCDA 1R2RA 3UY8A 4AWSA 1JCYA 5J5RA 4KFOA 1QWGA 3O8AA 3R89A 2CW6A 2HMCA 4IX0A 2WV8A 3W7HA 3U6WA 5FEPA 1YPFA 5AC6A 3LXBA 4PC8A 1VYSX 1JCXA 2VELA 2FTPA 3LTYA 1FX6A 3QSRA 4WD0A 1QPOA 4MLRA 2P1FA 4MY9A 5G2HA 4Z1DA 4NJIA 4MJMA 4AAJA 1OG0A 2WPBA 1F5ZA 3LHZA 3N9SA 2H8XA 3S5OA 2XN2A 1C9DA 2DORA 4Z1BA 2NXGA 2B7OA 3DXIA 4Y8FA 3CWOX 3LV6A 3C6CA 3G1XA 4AXKA 3CM4A 3LGEA 2WOQA 3R12A 5H91A 4XTDA 2YR1A 1LROA 4HSOA 4XQ6A 4JYEA 3MP4A 3W2UA 1FWRA 4N02A 5D2WA 3IGSA 5F2GA 1TV7A 3NQGA 4O1BA 1JCJA 4RKAA 3PSVA 1P0KA 1D9EA 3HJZA 4JTJA 3W71A 1KFBA 2KZHA 3FJ6A 4GUIA 4DPQA 3SJ3A 3EKZA 1TPC1 3W7LA 1HTIA 1KFKA 1CW2A 1ZCOA 5IBXA 3GAKA 1I8JA 2DP3A 2CLIA 4M6VA 4WOQA 1G4EA 2X1SA 3EX4A 4IPJA 4O12A 1EWEA 2V5BA 5AHEA 1YPIA 4A2SA 1WDWA 1B57A 3GLCA 3E02A 3PB0A 1L6SA 1G4PA 2ZTKA 3LHWA 4FX7A 2EHHA 4O19A 4LUIA 5KSWA 3W7QA 1TTIA 2ZQ0A 1EWDA 2ZZ6A 4UFKA 3F03K 1PL9A 2WNNA 3W7MA 4K6AA 4LC6A 3BLEA 3QQ0A 5C6MA 5E0KA 2AGKA 3B4UA 4JYFA 2CU0A 4RZ4A 4YMZA 1RVGA 2VEPA 2VEKA 4JIPA 4DEFA 1N55A 2OT1A 2FFCA 3O06A 4DF0A 4E0CA 3OBKA 2WNZA 2EKCA 1UB3A 4O10A 1KFLA 4JEQA 4ZL1A 4PA8A 3EWBX 2VFEA 3VE7A 4NVTA 3ANYA 2A6LA 3MUXA 4R53A 4RZ5A 2J9XA 3SW6A 3W1UA 4QITA 4PCFA 1F74A 1B9BA 2FPTA 2NX1A 4ZVJA 3TH6A 1XBYA 3PBVA 2QCLA 4MOZA 1W3NA 5G5IA 4LNYA 3G18A 4NZFA 4N6EA 1OFPA 2QF7A 4E38A 3G1VA 3W7JA 2FB2A 1VC4A 1S5TA 2GVLA 4EIVA 3L21A 1GTEA 2JKAA 4K7VA 2V8ZA 3S1WA 1YTKA 1H7RA 3NL6A 3BV4A 3EX2A 4IPIA 3WK0A 3BG5A 4R33A 1K3UA 5SWUA 3QZEA 3RU6A 1C8VA 4UCGA 3OVPA 3LLFA 4QQ3A 5EPDA 3LXCA 2ZRYA 3BLIA 2P10A 2V82A 4LVFA 1OHLA 1P0NA 1TTQA 2CWNA 4H6KA 4O52A 4AHOA 1K02A 4ZMGA 1XC4A 2CLLA 4PFMA 1QFEA 1MEWA 1S5WA 1YADA 1SO3A 1VQTA 1LZOA 1H7OA 1VLWA 3M5ZA 4JICA 3MBFA 3N14A 1YDOA 4MFEA 3O07A 5D09A 3W7PA 1KTCA 2QR6A 1OK4A 3W1NA 3HOJA 3T40A 3P84A 4TIMA 4ZQPA 6TIMA 4WXZA 2YZRA 2PURA 4Z0JA 1W1ZA 3G1SA 1OFAA 1GOXA 1HL2A 1W31A 3HGOA 4TMCA 2QCMA 5CSRA 5CSSA 2PRMA 5E93A 5LKYA 2CLOA 3PVFA 2BX7A 1EP2A 2WO5A 3G0UA 1DV7A 4MY1A 1O5KA 2XN1A 3UPWA 2C15A 4WOZA 2BXVA 1GVFA 4HHPA 3BK0A 2H8ZA 3IVTA 1TPUA 3PUEA 1KLYA 1PCWA 1SZEA 2O7QA 4JTTA 4LV4A 4ORIA 3IIXA 1CI1A 1OJXA 3LHVA 1KV8A 3IEBA 2A0NA 1GVSA 4WUIA 4NX5A 5HUPA 4XWUA 1TREA 1VCVA 4FNUA 1XBZA 2V2DA 3NL5A 1IXQA 1DJNA 1FDZA 5EBUA 3A23A 5CPMA 2GQ9A 3OG3A 1NF7A 2Y7FA 3W73A 1H63A 2ZZ3A 3QMRA 3CT7A 4O14A 3QFEA 3MO7A 3WJYA 4UTLA 3I7SA 1QR7A 3TU9A 3W85A 3M43A 4GUHA 1A5AA 2C18A 5F2IA 2E6FA 2C3ZA 3W22A 3KVMA 4AHPA 3EXTA 3W1PA 4JTFA 3TNOA 3TQVA 2ZRZA 4O4WA 5DCBA 1PVNA 3NQMA 4OHQA 1ZENA 1LOLA 4ADUA 1NFBA 2Y7GA 4UTWA 2H6RA 1KM3A 3T7VA 4C1KA 5MHBA 3OIXA 3R5EA 4O0ZA 1NF0A 3MW7A 1SO4A 2NX9A 1OFBA 2YYUA 3HPXA 5FF7A 3EKLA 1RD5A 2GQAA 3GNDA 4IXXA 2Z6IA 3FA5A 3YPIA 5D33A 3FFSA 3GIYA 4YXGA 1XL9A 3N3MA 1PCKA 1TV8A 4GC4A 2I9EA 4AVFA 3IIZA 3L5MA 3SGUA 5EYWA 3LXAA 3NPXA 2RDWA 3W83A 3W7CA 4ALDA 1M6JA 4CNNA 3W2LA 3DFPA 2QCEA 1IXPA 1IIHA 1RQEA 1Z44A 4GBUA 1XFBA 3MYOA 4WZHA 2YCEA 5BNKA 1DQXA 1WBJA 3I7RA 5AB3A 3M7WA 5F1UA 4LW7A 1JULA 1XDLA 3GDTA 5AN7A 1MEIA 4UNLA 3WK1A 2ZCGA 3W7NA 3GVGA 3HO8A 4JNMA 1FWWA 3R2GA 5AHNA 5LNWA 1W3TA 2Y7DA 5LNSA 4DBDA 1OX5A 1FDYA 1X7FA 1FWNA 4HIBA 3CB8A 5CGQA 1G69A 1JR1A 1ZAIA 5C55A 4ZQCA 2Q3RA 4MYXA 3W7IA 3TQKA 3C8FA 1NAL1 3PBYA 4FIRA 2GVGA 1VHNA 3QF0A 2PRLA 3O6YX 1L6YA 3VFLA 4DF1A 2QCNA 4Q32A 1QPRA 4NNAA 4FF7A 1MSSA 3GR7A 3KOFA 2GQ8A 3B0UX 5AHFA 3UWQA 1FY6A 3MYPA 5KINA 4YLWA 4BWLA 3NQFA 1EB3A 3ABSA 2R94A 2NWRA 3T55A 3KXQA 3UPBA 4UTTC 1SO5A 3PM6A 3LCGA 1LBMA 4QM1A 1W56A 1LYXA 1EP3A 3NA8A 1TQJA 1ZNNA 4PL2A 1CX9A 3NL3A 1WAUA 1OFRA 2E09A 3KVKA 1H61A 3EWYA 3HGJA 3P8JA 3W76A 1OFQA 3SZ8A 4O1CA 4DO5A 1HFBA 1SUXA 4XTIA 1PE1A 4M19A 1JJKA 3DFSA 1OVDA 5G1TA 2A7PA 3LOTA 1EUNA 2AQWA 3P5YA 4ML9A 4LVBA 5L6UA 1KA9F 4MLJA 4O0KA 4FNQA 3LRKA 1TPH1 2X1TA 3EEGA 5HWJA 3W2NA 3QMSA 4HNNA 2HS8A 3MMTA 3E0IA 1MXSA 1DOSA 3LI0A 4CQ8A 4DPPA 3HB9A 1ZAHA 4Y96A 2ZRXA 3PBUA 4NNCA 3G8EA 5HMSA 4C1LA 2W6RA 1HUVA 3IV3A 1LLZA 4AH7A 3AO0A 2E6DA 3O63A 4XBKA 5L9FA 5EL1A 3Q2DA 5DN1A 4U28A 2Z1BA 1T96A 2BSLA 3C52A 4ONVA 4FNSA 1JCMP 1L9WA 1SSDA 2PRHA 5D2VA 3BG9A 2NV1A 4D2JA 5E1QA 1YXCA 3G0XA 3ZS4A 2Y6ZA 1WBHA 3MWAA 3ELFA 1AL7A 1GT8A 2RH9A 3G1AA 2AAMA 1DORA 1KBJA 2VC6A 4TO8A 1LM1A 4YWIA 3W70A 3GNNA 3BW4A 1LCOA 1SW3A 3P8IA 3FIGA 3NQVA 4K8EA 1TJRA 2ABAA 2B7PA 3TV8A 4RR4A 4J9JA 4OGZA 2C19A 3GKAA 4LV9A 3DBPA 3CU2A 2YYTA 3NQAA 5KZMA 2ZZ2A 3TUUA 3PG8A 2R8WA 3NZ1A 2CZFA 1SR9A 2DZPA 3FYPA 4CQAA 1I2PA 3HBLA 4LY8A 1ML1A 7TIMA 3D0CA 2VFGA 3BPWA 4Z1AA 3S1XA 4IGHA 3STFA 3RNDA 1GVOA 2J27A 3CIWA 4IMFA 3C2EA 4DO6A 2TPSA 4LS0A 3ATZA 2Y61A 1QPNA 1PHQA 3NPUA 1W5QA 1BWKA 4EOUA 3KFTA 4DO4A 3N73A 3A5VA 5D04C 1KFEA 2H90A 3W23A 1BKSA 3CPRA 2QEZA 4OWGA 5FEXA 4IJBA 3W2KA 3ABRA 1TPFA 4K39A 4OV9A 4MVAA 3QSTA 2OT0A 2LLEA 5BMXA 3GK0A 5HINA 5D2XA 3UWWA 4NJHA 1SW7A 4IMDA 3W1QA 1XUZA 3O1NA 3PSWA 5KITA 1H1YA 5D38A 5C2XA 4LTSA 3W84A 1LRQA 3HMJG 1B4EA 1G6CA 3GDRA 2FB3A 2JKPA 2ISWA 4QAIA 2JKEA 2I14A 2X30A 5KMYA 3T4CA 1QCWA 2ZZ7A 4RX0A 2VKZG 2J24A 4NT0A 2CFFA 2NUYA 3C3NA 1FCUA 3W1TA 2Q3OA 4ADTA 3GAYA 1V5XA 4GNJA 3O15A 5AHLA 2W79A 1A5CA 6ALDA 2CZ5A 4PODA 4MZ8A 4POCA 4NNBA 3SFKA 4N4PA 3OVQA 3DHDA 1RR2A 2OJPA 2V9DA 4N6FA 1YLVA 1P4CA 5HNRA 4EF9A 4G1KA 1LOSA 4OBTA 4M7TA 3A21A 3TSBA 2J88A 3I6RA 4O1AA 1XCFA 4NJGA 4KWVA 3NAVA 4FNPA 3PUDA 1J5TA 1KM1A 4EVZA 5H2ZA 4QSHA 2TSYA 4FO4A 3ZR4A 3TDFA 5I3KA 1KTNA 1XM3A 2NZLA 2VOMA 4FEZA 1OABA 3QYQA 1H50A 2HS6A 1X1ZA 3HG4A 3L5LA 4N9CA 1I4NA 3C2VA 3LBCA 4LVGA 4E2BA 5DBUA 4K38A 4IMGA 4B5NA 3PY2A 8TIMA 5FI8A 2VEMA 5AYZA 1IXNA 1GG1A 5G2IA 3MI2A 1RQBA 1ME9A 3N2MA 2J6XA 1FXPA 4UC5A 3VI2A 2W0UA 1GPWA 3G0SA 4N9EA 3GX9A 4FXRA 1FWSA 2FLIA 4HNVA 3TW6A 1T0OA 5HQEA 3JRKA 3W2MA 4UTHA 2NUXA 4A29A 2NWSA 5K9DA 2NLIA 4IUOA 3KRUA 1LRNA 5EY5A 4HN4A 5DY3A 2H3BA 3TAOA 4N9BA 4RXGA 1TTPA 3EWXA 2G96A 4N9DA 3EX3A 4ICNA 1KW1A 3H55A 5LNUA 3IVUA 3WJSA 1PV8A 5F4XA 1DBTA 2RDTA 3OHIA 3M5VA 4Z1CA 2BZNA 1MEHA 3S9YA 2V81A 1K7FA 2YFOA 2VEIA 4MKNA 2WQPA 3P82A 3P67A 1A5SA 4XBSA 5D05A 4Q33A 1EPXA 4MFDA 1FQ0A 1X1OA 1J4EA 1IXOA 1H7NA 1QNVA 2Z0IA 3L0GA 2UV8G 4I7UA 4LVAA 3M6YA 3O6DA 1JUBA 1UBSA 4O1DA 1WV2A 2QDHA 4X2RA 4JTEA 4UR8A 4O17A 4GXMA 1OYBA 1XI3A 1WXJA 5CPLA 1EUAA 2FIQA 3ZFHA 1R47A 1TPB1 3U8GA 3OEXA 2XN0A 3FYOA 1LP6A 1PS9A 1SZGA 4JS3A 1SW0A 4N2YA 4XKYA 3W07A 1ZFJA 2V30A 3EXRA 1A5BA 1OX6A 2E1DA 5EMUA 3BLFA 4GUGA 2TRSA 1H7WA 1GEQA 3LTSA 4YCOA 2E77A 3I65A 3KAOA 1AG1O 4UFIA 2C0AA 3EX6A 1KM2A 3O6CA 4WY0A 4KWWA 5FF2A 4WY0F 1RZMA 3FS2A 5CZJA 3W1AA 1W5OA 1Z41A 4FIQA 5K7JA 1ZAJA 3THQA 4O54A 5LZLA 3GB6A 4XKYB 1WYIA 3C0JA 4JTUA 4O50A 3N9RA 1OF8A 4LWWA 1DJQA 4EF8A 4S2CA 1Q6RA 2HSAA 3W1XA 2A7RA 4H3DA 1XDMA 3NQCA 2QUVA 4P2VA 1VJIA 3B03A 4AEOA 2RFGA 2WSRA 3C2FA 2QCDA 3CTLA 4WY0B 4JY8A 1QDSA 4R34A 2ZRVA 4A2RA 1TSIA 1NSJA 5TBOA 3MBDA 2QCFA 4MJZA 2V2HA 1J2WA 3HG3A 3W7OA 4IWWA 4UIOA 2C1HA 3UWZA 1A50A 1NEYA 5G4WA 3P81A 1OX4A 4UTWC 2G95A 4O13A 1WA3A 5I3HA 3JR2A 2G5WA 4WXYA 1Q6LA 3EWUA 3C2RA 4LU0A 3L67A 5G1YA 4GE8A 5GVJA 1R2TA 3DFQA 4NU7A 3NPVA 1QO5A 2CZEA 1LORA 4FXSA 3G22A 3DFNA 1WX0A 4IMCA 4JTKA 2QCDB 3QMTA 1OFOA 3PF3A 1K7XA 4N4QA 2V2CA 5HJLA 2ZYFA 2VFDA 3B04A 4QISA 5AC7A 1TYGA 1G4TA 1H60A 3BVJA 1EP1A 3HG2A 1H51A 2A21A 5D03A 3ZWSA 3LRMA 1GG0A 3FKKA 4W9TA 1I2NA 2OX1A 2QDGA 5D37A 3CC1A 5HR7A 4KFNA 4BI7A 2DU2A 1OX4B 3PBWA 3L0NA 2DZWA 4L4LA 3W7EA 1F7BA 2GJLA 1QPQA 1GQNA 3WJXA 1W8SA 3TMQA 4UTKA 1H7XA 4LT9A 3DHFA 3M0ZA 3W1LA 3STCA 4GRSA 3GXPA 1WOBA 3WFAA 2YW4A 1KM0A 1W0MA 2E68A 2GPTA 3G1DA 5TQLA 3CIXA 3HIJA 1E51A 1TPVA 2DZUA 1FCVA 1I2OA 3LB0A 5HWMA 3PUOA 3WK2A 3LCIA 1W5PA 1H7PA 1XXXA 1DKWA 1LBFA 3QW4B 2QJIA 3TKFA 3S5ZA 3HPSA 1F76A 1GYLA 1R46A 3BW2A 4BWLC 3LI1A 3NO5A 2QAPA 4JGDA 2VFIA 2G97A 3E9AA 3CLMA 3UQNA 2Y70A 3TCEA 2X1RA 1K8XA 5HUOA 4GFSA 3SECA 4K7YA 4QNEA 1H1ZA 1SSGA 2DJXA 2FQIA 3MHFA 2EF9A 1S3HA 1GWJA 3E96A 3UYCA 4LOCA 4FNTA 4L4MA 3QH2A 2YXGA 2O7SA 3GYEA 4A22A 3GDLA 5CKSA 4O16A 1ALDA 1LTDA 1FCBA 1I2RA 3TE9A 4UTTA 4KFPA 1F73A 3NL2A 3CHVA 2OMAA 2QUTA 5K9XA 2VXNA 3T44A 2R14A 3LM7A 4RJEA 3A9IA 5EA9A 1LDCA 1JQXA 1TRDA 1TCDA 4ZZ9A 4E2DA 3SI9A 4O18A 1O60A 5D32A 4HPJA 1HO1A 2ZZ1A 1FUYA 3WJWA 5BOOA 2V0TA 5CZTA 4LUJA 1N7KA 3GXNA 1VPXA 3BARA 4HKPA 3NZRA 4Y90A 2ZZ5A 1UUMA 3W74A 5HWNA 3GZ3A 1LBLA 3MP3A 5K4ZA 3W6YA 1RV8A 1Z42A 4RK8A 3G1YA 1YXDA 5AC8A 1T8XA 2QAFA 1OK6A 3QC3A 1GZGA 4P61A 5D2YA 4JD4A 1VZWA 5A8GA 2Q8ZA 4AB4A 1GVRA 2V5LA 2ABBA 3A22A 5BRBA 1THFD 4JTHA 4X9SA 5K2ZA 3DH7A 1GJPA 4OE7A 5EKYA 1KFCA 3IGUA 3KRZA 1SFLA 2EGZA 1G7UA 2WSYA 3MHUA 2YGYA 3T78A 4BF9A 5DELA 2J9YA 4OV4A 2A5HA 1JQVA 4UUIA 3L65A 4K8HA 3LV5A 3BO9A 3LCHA 4ADSA 3CEUA 2ZA2A 4PEKA 3H54A 3M16A 2QCGA 2CLKA 3W3OA 2RHGA 3KX6A 3I68A 3DI0A 1OFDA 4UMCA 3TFCA 1K8ZA 4QIUA 5CZSA 1DHPA 1G4SA 1N8FA 4JDYA 3S0CA 4LRTA 4HT3A 3O05A 1U5JA 4UFLA 4IX2A 3TSMA 1TO3A 3UWUA 1QOQA 4LS1A 3LHYA 2JBMA 3TK7A 2FPYA 2WJZA 3NXFA 3TFXA 1X8FA 3PB2A 3NPWA 3L5AA 2DZTA 4Z08A 3PAJA 1L6WA 2ZA1A 3FLUA 1BWLA 3TC6A 3DFTA 4CCCA 2DZXA 3UWYA 3C56A 4DF2A 5C5YA 1OF6A 2I1OA 4HNUA 4LS2A 4CCEA 4R7JA 3VNDA 3A5FA 4PH6A 3G3MA 5AHMA 5F2MA 2C6QA 2E5DA 3P7YA 4O11A 1TPDA 4A21A 2Z2UA 3BGJA 3FKRA 4LRSA 4Q4KA 3M44A 1K03A 4S1FA 3PC0A 2CLHA 2C14A 2GOUA 2BWGA 3P5ZA 2Q8LA 2Y88A 1XKYA 3KRSA 3NR0A 3CWNA 3R8RA 1VYRA 3NM3A 5T26A 1AW2A 3W86A 3ATYA 2JK2A 3TA6A 2X1UA 3IIPA 1Y0EA 2EPHA 4UMAA 4O4VA 1JUEA 1VHCA 1B3OA 1O94A 4RZ6A 2RKXA 2QUUA 2FDSA 3TQ0A 5K3VA 3NQ6A 3S1UA 1ICSA 1W5MA 5IBXC 4GWEA 4TX9A 4X3ZA 1BEUA 1QMLA 3HQ1A 1XUUA 4UR7A 3SR7A 3BW3A 1YTDA 1AL8A 4YL2A 1SFJA 5U4NA 4KKXA 5HULA 2YPIA 3W7DA 3TW7A 4RLIA 4FHAA 1LRTA 1OFEA 3NGJA 2CLEA 4DXVA 3DENA 5C54A 2B7QA 1VGAA 2CZDA 2HTMA 3W87A 1VRDA 3W1RA 3GXTA 4O28A 1EEPA 4MPQA 1Q3NA 3LCWA 2ZRWA 2WNQA 3QJAA 3IRDA 3M41A 3P80A 2JGYA 5I3JA 2A2IA 5FEWA 3S8HA 3HG5A 1SO6A 3L9CA 2ZFAA 3LCLA 2A6NA 3F4WA 2RDUA 1PHWA 1FCQA 1ICPA 3E12A 3KVLA 3P62A 4XUGA 1G67A 4U4MA 4MUZA 3ZWTA 2OCZA 1K7EA 3NYZA 3C4UA 3TMLA 3GR8A 1DL3A 1V7YA 1QOPA 3CEPA 4ORMA 3S5NA 5FF4A 1GYNA 1H62A 4BFAA 3B06A 3L68A 2B7NA 1GVQA 3QQ1A 1LLWA 4FX8A 4MY8A 2ATSA 2PE4A 3NQ8A 4JTIA 1ZJIA 2EAWA 4NXSA 4O15A 4ZQMA 3QPYA 2B0MA 3EWZA 3L2IA 2ZRUA 4TR9A 3Q94A 4A3UA 3GDKA 1M5WA 3RF9A 3OA3A 1Q45A 3VCRA 3TC7A 4M6PA 3SGZA 3INPA 1WOAA 3ABQA
chains in the Genus database with same CATH superfamily
4FB7A 1VLIA 3G8RA 3HV8A 4HYRA 5TIMA 3NSMA 5BW6A 1FDJA 1WKDA 4S3JA 1A0DA 1EDTA 1A5MC 1W3IA 3MSYA 1TR9A 3UZ5A 2J7GA 4YU1A 2VFFA 3HPAA 1MO0A 4P7QA 3USBA 1KTBA 1LL4A 2AOSA 1OT2A 2IPWA 2C8NA 4UTIA 1EQCA 2D2OA 1YDNA 4Q4RA 4Q8TA 5G4EA 1KWKA 4K37A 2HVNA 4DWSC 4RW5A 4WX2A 4GIEA 4C6OA 4EPEC 3U2OA 4MWAA 3RMJA 2A3CA 3D3FA 2CLFA 4O53A 5D9PA 4J5NA 2CZVA 2UZ9A 4OKDA 4JX4A 1XRSA 3WEZA 3RR4A 1AK5A 4JL2A 3TSDA 1JF6A 2OELA 2HE8A 1S46A 5CZ0A 4OU1A 2X05A 2RUSA 1WDRA 2WMKA 4MUPA 4UTJA 2PCQA 4NXKA 4GJ1A 5GJMA 1H0IA 5GNXA 3KOYA 1TMQA 2D24A 3HZ3A 4HPXA 4I9AA 4NUWA 4IMEA 4PMRA 3B8TA 5F7UA 3MJMA 2PC4A 5LSMA 3PS7A 3WQEA 4TU1A 1EJTC 3LNPA 1LOQA 2YXXA 4Z0SA 3EOSA 1C7TA 3PZUA 3T8QA 1M7JA 2YX0A 3K8KA 3MI3A 3CQ0A 1OGSA 3W7KA 2J9ZA 4M7SA 3N2BA 4UNIA 3BG3A 1G5AA 2XH0A 5DX7A 1Q2RA 4XD3A 2QDDA 3MI6A 4H6RA 4IFRA 4J4KA 1HX0A 1UR0A 2PGRA 1FWGC 4I9TA 3A3WA 1EJXC 2WCSA 3P61A 2MUCA 5BXPA 4AHQA 3TROA 4QJ5B 4RNIA 2CLMA 4UFHA 3B0VC 1AQMA 4OJYA 1AMKA 3QYSA 4GG9A 4J28A 3SCSA 3E49A 1M7PA 1RQHA 2D20A 1F8IA 4S23A 3G6LA 4PMUA 3AYRA 2ZE0A 1HG3A 3DG6A 1DXFA 3EKGA 2A1YA 3W88A 3IPWA 2A4AA 4XAFA 4B91A 4PL1A 4Z2HA 2ZA3A 5LNRA 1JZ4A 5F4SA 1X6LA 3ARSA 4S2BA 2OO0A 4WCJA 5CPOA 4ICMA 3W72A 1TJPA 3PZGA 1JYWA 3H70A 5C9RA 4I7WA 4YHGA 2OSXA 1XBXA 5EMJA 1F2JA 4HOXA 2F7FA 3UESA 2OG9A 2ALDA 2X40A 3R7MA 3VA8A 5IM51 2CESA 1PTGA 2IKHA 3GHSA 2C16A 4PN2A 3MV11 3IVSA 1D3GA 4DAIA 5HJYA 3P74A 2XZ7A 3B8DA 4WHBA 1PO9A 4RV8A 3GM8A 4JR5A 3L66A 3ABXA 4F2TA 2OQYA 5CLTA 2QKFA 5FA5A 3WCZA 2WPGA 4CQ9A 1FBAA 3N11A 2BP1A 5HK4A 2E6YA 3GDMA 3DYMA 4GBDA 3GC4A 1KV5A 3B9OA 1R9XA 1SFSA 3IIOA 3UXDA 5KZDA 5D2TA 4LXFA 3WMSA 3A24A 3H8AA 3Q37A 3CHDA 1O12A 3C0QA 1KKOA 3NQDA 1XFCA 3W02A 3V16A 3AZTA 1XD1A 3QR0A 5J5DA 1XQLA 1Y8BA 5C9WA 3II1A 1NY1A 2X2YA 2YDAA 1JD9A 1KGXA 4GO8A 1LG2A 2AAAA 2ZTJA 3EWCA 4LX4A 1CPUA 4JOMA 4JTGA 1DWGM 2VI0A 3PPHA 1HJQA 2NXHA 3GHTA 2ACQA 1AJ2A 4ZE5A 3TTSA 3M0YA 2H3DA 3V75A 1M04A 3VDGA 4UFMA 2DV0A 1E0WA 3N15A 3DC0A 3M1ZA 1GOQA 3URQA 1SVDA 3GBEA 2P76A 4C91A 1CYGA 3MUY1 3AS1A 1TJ1A 1WDSA 4FX6M 3LLDA 3QEZA 1HGYA 4J3TA 4GJIA 3DZ1A 3NYDA 2Y85A 2NSXA 2C1GA 3OZMA 4JX5A 5HMFA 2G3IA 3NQ7A 3HTWA 5EB8A 3DU0A 3AHYA 3MP5A 4ZB5A 3DYPA 4AZBA 3DYOA 4B9YA 2A3BA 5K9CA 1W5NA 4UMBA 3D47A 5LNVA 4NZJA 1IGSA 1DJWA 3QW3A 4RV3A 2BLEA 1R85A 2ZUVA 4EP8C 3SB0A 3I7QA 2PDHA 2GVJA 2V5KA 3S1GA 3BAKA 5AYXA 4BEQA 2YFNA 5DCEA 3AI0A 4YVXA 4BI6A 3CMGA 2POZA 3FGCA 1WUEA 5CPSA 3O2LA 2XGIA 4M82A 3ZVHB 1MW1A 3VUPA 1XLEA 2YOCA 5BWAA 4AWTA 3EWWA 3M5XA 2WHLA 1BSIA 1LL6A 1R87A 4MDPA 1VB9A 4PTWA 3L4VA 1L6FA 3B0YA 3QRHA 1TVNA 2Y0FA 3KW3A 2VJXA 3WQCA 3A3HA 5DF0A 4Q3MA 4W8LA 3QGAC 1CEOA 2OWCA 5J5RA 1QWGA 3R89A 2PTWA 5EBAA 3AWNA 4P8VA 1EGZA 4AY7A 5FEPA 3S47A 3WLOA 5FAGA 4W8AA 3RX4A 2OZ3A 2PU0A 1F6YA 4DZIA 8XIAA 4C7DA 1V3LA 1QPOA 4Y9MA 1UKSA 2JEQA 4J1OA 4FXFA 3WLKX 1DTNA 1FHVA 4AAJA 2WPBA 1F5ZA 1JZ3A 2XN2A 1JZ6A 4OECA 4KIRA 3EDDA 4GCXA 2OYKA 4Y8FA 3VX0A 4B5XA 4XTDA 3V18A 1KO0A 4HSOA 2VEGA 4JYEA 5D2WA 4H19A 1SJCA 3IGSA 4PB5A 3EA1A 2QDEA 1NIUA 3HJZA 4TV6A 2CKSA 4JTJA 1ODZA 4RDYA 4WJXA 4HPHA 2Z28A 3VDCA 1TPC1 2CKRA 4WDUA 2YCKX 4IIBA 1KFKA 4ACYA 3GAKA 1I8JA 5A3HA 4EXAA 1JCTA 4WOQA 4C6IA 3EX4A 4DUWA 5E0FA 4AW7A 3TYDA 3GLCA 3KP1A 1G4PA 4MSSA 2GUBA 3CZGA 2GFTA 3WBXA 3W7QA 1TTIA 2ZQ0A 4A6GA 2EG7A 5E6YA 1UD3A 4QTGA 2A3HA 2WSKA 4PUUA 2IUZA 3W7MA 3R79A 3CIVA 3BLEA 3QQ0A 2PEVA 3WDRA 5E0KA 3NGFA 1WKEA 2AGKA 3B4UA 4IG2B 1PIGA 2CU0A 1XIIA 4YMZA 1RVGA 4JIPA 4DEFA 2FFCA 3OBKA 3G2GA 4F0RA 3VOGA 5EMKA 4F0LA 4R53A 2CBJA 1IWAA 3SW6A 2XZ9A 1QXLA 3VNJA 2FPTA 4ZVJA 3TH6A 4KEVA 4GZIA 3JZUA 3GXMA 1PDZA 3CV7A 8XIMA 1KB3A 3BH4A 3EOLA 3BURA 4E38A 1P0BA 1PSCA 1CGUA 1ISZA 1S5TA 1GTEA 4K7VA 4WR3A 4Q8OA 2CETA 1I1XA 3UVIA 3S1WA 4S3EA 1NFPA 4ZFMA 4GJJA 3NIYA 2QYGA 2J74A 3QZEA 3UETA 2DH2A 3CASA 2ZRYA 4NY2A 4LVFA 3ANUA 1TV4A 1P0NA 4ZO6A 2CWNA 5IHRA 2BNJA 2FHFA 3R94A 4RDWA 4PFMA 4CEXC 1EZ2A 2WZIA 1S5WA 4QJ3B 2WLZA 4GH1A 2G3NA 4KWSA 2AL2A 2CXGA 1UW9A 1TWZA 2REQA 3N14A 4MFEA 4W7VA 1E5JA 3UXLA 4TIMA 4ZQPA 3WLQA 1V02E 2DUZA 4DWSA 4GKTA 5C8BB 4Z0JA 2FVKA 4DRSA 3VIOA 1GOXA 1V0NA 1W31A 3HGOA 1BD0A 7REQA 3FEQA 1H4PA 5JVLA 2BX7A 3RO6A 2WO5A 4XKMA 4FALA 1Q66A 3HM7A 3N4AA 1UWTA 1TG7A 4H04A 3I6EA 4LUSA 4JTTA 4W85A 3THCA 4HMNA 3IIXA 4XSMA 4W88A 3TN5A 3CGTA 2OZ8A 4WKFA 2FHBA 2KX9A 2XIMA 3ES8A 4NX5A 3WNLA 1E70M 1VCVA 4FNUA 1XBZA 1OD0A 1A3HA 4GGBA 5HAOA 3M0LA 1PDYA 2WMHA 1FWBC 1CIUA 4IQDA 4C1NA 1U22A 3RN6A 2FZMA 5CC7A 5DRCA 4HOZA 1A5AA 1WKYA 2O4MA 2C18A 3W22A 3UG3A 3W1PA 4WDXA 3NQMA 4OHQA 2Y7GA 5MHBA 3R5EA 4HP5A 3SUVA 1BLIA 3AIQA 1NF0A 1C3FA 4IL0A 4A8NA 1SO4A 4AD4A 2YYUA 3HPXA 5FF7A 4ZXOA 1RD5A 3QZ6A 4YXGA 4W8BA 1XCWA 3N3MA 1PCKA 1EFZA 3IJLA 4J27A 2I5QA 3IIZA 3L5MA 4QG9A 4I90A 4AIBA 1US3A 3HQOA 3SQLA 5GJNA 3VCNA 2BODX 3W83A 1ZJBA 1ITQA 4ALDA 1OB0A 3VIPA 3W2LA 2PDCA 2Y24A 4A8RA 1MXGA 2O56A 4XZIA 1DQXA 1X38A 1Z69A 1OY0A 5AB3A 1A5NC 3CV6A 4LW7A 1JI2A 3GDTA 4JCLA 5EGRA 4UNLA 3L2MA 3GVGA 2O9TA 5LNWA 4UQCA 5LNSA 3CB8A 3ORWA 1JR1A 1ZAIA 5C55A 2Q3RA 1VBGA 2VOTA 3C8FA 3VGGA 3WSUA 9XIMA 1EJ7L 3SCTA 4ZGYA 3AAMA 3VFLA 1NDYA 2QCNA 1TJ0A 3RR1A 3CXOA 3N1AA 2WWDA 5AHFA 4YLWA 3ZT7A 2CYGA 1MRAA 2PP0A 1EB3A 2R94A 4CN1A 2NWRA 1SYTA 3T55A 3V36A 4OTKA 4YWSA 1H5VA 1OIFA 4J3VA 3WNKA 1ODUA 3CV2A 3T0TA 1W56A 3NA8A 1ZNNA 4U5IA 3NL3A 3S2LA 4GQQA 1PPIA 4JKMA 3EWYA 2BXZA 3HGJA 4NZCA 4GXPA 1KCKA 1SUXA 5G1MA 1JJKA 1ADSA 3IARA 2ACUA 1OVDA 1GQLA 2A7PA 1EUNA 5EFDA 1GW9A 4OBRA 1LG1A 3BGAA 1YMYA 3TLLA 5E6ZA 4YIWA 3LRKA 3B0XA 3EEGA 3W2NA 4F3HA 1UIOA 2HS8A 3OVGA 2BXYA 5MF5A 2XSAA 1ZAHA 9CGTA 2ZRXA 4NNCA 4C1LA 1LLZA 2QS8A 5LIUX 3WH8A 5CAKA 3AYTA 2FYMA 1LLOA 3NDZA 3R11A 4EANA 3PN8A 1E6XM 5J8LA 2Z1BA 1T96A 3C52A 4ONVA 2ZUUA 4B2DA 4JNZA 5AZ1A 4ATLA 2PRHA 3S9IA 5D2VA 3VNIA 4E3VA 3CQHA 1F9CA 4GO9A 1JZ5A 4BY3A 4OOZA 3ELFA 3F4DA 4KS0A 4D6EA 3HURA 3G1AA 3MCMA 1DORA 1HGWA 3CV1A 1UR9A 4ZENA 5BOEA 3NQVA 2ON3A 5BRQA 4PB4A 4H8UA 2B7PA 3ENLA 3RG6A 3P14A 5GPRA 1J8VA 4PULA 1NOFA 1DWIM 2C19A 3GKAA 2ZZ2A 4TQTA 2CZFA 3FJNA 5E5CA 1I2PA 4LY8A 3FNDA 3BPWA 2PPGA 4IICA 1S5MA 1GQJA 4IMFA 3SQMA 3A4JA 3ATZA 2Y61A 4QDWA 1QUMA 4DO4A 3N73A 3S83A 1KFEA 3I4KA 1XGDA 2JQXA 3QSTA 2OT0A 3URNA 1RAKA 4BQ4A 3GK0A 3S6TA 5C0QA 3UWWA 2BVWA 4AX6A 1KKRA 4B5VA 4RZBA 1HN1A 5D38A 5C2XA 1R3TA 4MWAD 3W84A 3PNZA 4JQ1A 3ZYZA 3MUZ1 1LRQA 2JF7A 5C9XA 4W86A 3SUTA 2GSJA 2QMJA 3SURA 2R6OA 1DJIA 3THDA 1CDGA 2E7FA 4LANA 4RX0A 3T07A 3HJEA 3SN4A 2BS9A 3UR5A 4NT0A 1IEIA 3VIGA 4JIEA 1WDPA 3H26A 4ADTA 1JIBA 1E40A 2YDRA 1A5CA 1FTXA 1HKWA 4Z2LA 4GVFA 1R6WA 2VMFA 3WQ5A 3NSNA 3WX7A 3EPOA 3OBEA 1BTCA 4KCUA 1IR1A 2PDLA 3DHDA 1RR2A 2OJPA 4KRUA 2ZVRA 3PZQA 2V9DA 4N6FA 1YLVA 3PJWA 1ZPTA 4EF9A 2F38A 3TSBA 2J88A 4GYKA 2VDGA 2WANA 1XCFA 4MJ2A 3T08A 3N2OA 2XFRA 3WQ4A 3NAVA 4PMNA 4FNPA 3PUDA 5CAHA 4CU6A 1PJ9A 3M46A 2TSYA 4O8AA 1KTNA 1XM3A 4FEZA 3ZVIA 1OABA 3QYQA 2HS6A 2B81A 3LBCA 2FZ8A 4LVGA 4IMGA 2XG9A 1O5RA 1GG1A 4N42A 4Z42C 4U2ZA 1ZBVA 1HJXA 1BFNA 4UC5A 4CNUA 4XD6A 1E1CB 3VI2A 5I09A 3G0SA 1UKQA 1WPCA 3TW6A 4GPNA 3RRAA 4TV5A 4RDZA 5K9DA 1E6PA 3WUEA 5EY5A 5DY3A 4N9BA 5IDZA 4JL1A 3QKZA 4INFA 1TTPA 3EX3A 1QHOA 4XAPA 1KW1A 4ERAA 5F4XA 2RDTA 2P53A 1FKWA 5I2UA 3OJGA 2V81A 1K7FA 2Y8UA 3LZ3A 1OBAA 5I7GA 4KMQA 5D05A 4NRSA 2CEQA 1FQ0A 3IJ6A 2XFYA 1J4EA 2YA2A 1QNVA 3SQSA 4DN1A 4XVEA 4CD5A 4LVAA 2PGWA 2WM0A 1UBSA 1WV2A 2YXOA 4O17A 5CPLA 3EAUA 2FIQA 1A4LA 3O0KA 3OEXA 2I16A 4MB5A 1LP6A 1E9LA 3PJXA 3KP0A 2OYLA 3TCSA 3W07A 2V30A 2VX4A 1A5BA 2QPUA 3ARXA 4MB1A 1KWGA 5FKYA 2BB0A 3GTNA 3WNPA 2UY5A 1J0JA 1KM2A 3O6CA 4QLLA 5FAJA 5DANA 5FF2A 2ZWYA 4WY0F 2OZTA 3W1AA 5K7JA 2PAJA 3THQA 2XYLA 4HD5A 2R1MA 1ECEA 3IJ7A 4P5UA 1W9VA 5CJMA 3ALFA 4O50A 2ZKMX 4HA1A 1OF8A 4LWWA 1DJQA 1W1B1 4WJ8A 2A7RA 4H3DA 4NL1A 5I5RA 2POTA 4AZCB 1RK5A 1VJIA 2RFGA 2WSRA 4WY0B 5I23A 4OZOA 1W1A1 4A2RA 3LS9A 1SJAA 5AY7A 1J2WA 2HK0A 3LPPA 2VNCA 2Z1KA 4UQAA 4G6CA 1A50A 4NP7A 4M8UA 4OFCA 3W0KA 3VD7A 4O13A 5I3HA 1E4LA 1R7AA 1Q6LA 3C2RA 3L67A 5G1YA 3E0FA 5GVJA 4NU7A 3EGJA 4HGXA 1LORA 1J6PA 1I9CB 3EMZA 4IMCA 4NILA 2QCDB 4N4QA 3LPOA 1K7XA 4KWOA 2VFDA 3SFWA 3WZ0E 5AC7A 1G4TA 4XAYA 1EP1A 1H51A 4HK7A 3LRMA 5CBIA 3WLRA 1TA3B 2OX1A 4G9PA 5D37A 3FN9A 4IMAA 2J75A 4KFNA 2DU2A 1OX4B 3PBWA 3ZZ1A 3L0NA 2DZWA 3GIPA 3W7EA 1F7BA 2PZ0A 4J2PA 1GGOA 3WJXA 2XH4A 3B8WA 1H7XA 4LT9A 1AQ0A 3STCA 3LNMA 4XO6A 4GRSA 3GXPA 3W6MA 1R9YA 4L1GA 1UC5A 5LIYX 3SUWA 3G1DA 3HIJA 3SY1A 1TPVA 3PUOA 3PK7A 1E1FA 3E2RA 1H7PA 1NWUA 4GYFA 1DKWA 3P2VA 3RX3A 2QJIA 4MB4A 1GYLA 1R46A 3BW2A 4PCNA 4QLKA 3NO5A 4FSAA 1M01A 3H22A 1VJSA 1RCXB 2WBGA 1XLBA 4GFSA 3TYUA 3SECA 1NELA 2PA6A 4Y9NA 1H1ZA 2ZUWA 2W62A 1EBGA 3MHFA 1V6UA 4Z2JA 4ZTYA 1GWJA 3E96A 4UZSA 3UYCA 3CMFA 3W81A 4NAEA 4KIEA 4PTDA 1Q8JA 4FNTA 2YBUA 1NDVA 4YN5A 5BXSA 1XRFA 3ID7A 2INZA 2VCBA 1XIBA 3GDLA 4GQGA 4O16A 2C1IA 5JH1A 3S9ZA 1YBQA 2E4TA 3GC5A 4UOQA 1NQ6A 1OINA 4KFPA 5LIXX 1X96A 3PAOA 1RJQA 3CHVA 3LM7A 5DMLA 2CNCA 4D1IA 4GX8A 3SI9A 2BGQA 3WNNA 2PDXA 5A8MA 1IE7C 3Q65A 1UIPA 3SY8A 4Y90A 2R1NA 5E70A 3W74A 1LBLA 3MP3A 2BY3A 3B8UA 3R0KA 4RK8A 5I0DA 3AIEA 1LWJA 1OK6A 2WVVA 2XIIA 1V6VA 1GZGA 1JEZA 4S3AA 3M07A 2ABBA 5BRBA 1F3XA 4DX3A 4FMVA 3SCRA 5K2ZA 4L4PA 3M7SA 2EGZA 3JW7A 2YGYA 1X98A 4EXBA 2J9YA 4OV4A 4L9YA 4YVVA 3BO9A 2VP8A 3LCHA 3COTA 4PEKA 4OUIA 3M16A 4F0MA 2QCGA 3MS8A 3GFYA 7ODCA 1A49A 4P7RA 1SMDA 3TFCA 4QIUA 3RCYA 4HYWA 5FL1A 4JDYA 3S0CA 6REQA 1U5JA 3BSHA 3K1DA 3UWUA 4LS1A 3WF4A 5HNNA 1JNEA 1T8QA 2ZE3A 3WBAA 3PB2A 1MUMA 4I6KA 4Z08A 3VGHA 2ZA1A 1BWLA 3TC6A 3UCDA 4P8XA 5C5YA 1XLIA 4HNUA 2GZXA 2VUYA 3VNDA 5I07A 3A5FA 4XZHA 3G3MA 1W32A 1AQHA 3OB8A 3WQGA 3NTYA 4B3ZA 4XB3A 1EJRC 2J8TA 4CUCA 3FKRA 2QV4A 4CNSA 4HBKA 5LIKX 1K03A 4S1FA 3P5ZA 2PGFA 4A3HA 1TX2A 3P3BA 4D8ZA 4QG6A 1VYRA 1QNQA 1W9BM 1XYBA 3DN5A 3OZYA 2XGBA 5EFFA 2XM2A 3BLLA 4Q22A 1Q85A 2FDSA 4CQBA 2AKZA 1JPMA 3BJFA 5K3VA 3NQ6A 4ML4A 1ICSA 3OW1A 4FXJA 4GWEA 4OVXA 3U7VA 1UWQA 3S3GA 2QJNA 2Q09A 3WDJA 3BW3A 1YTDA 1AL8A 3T0BA 1FP8A 4YL2A 4KKXA 2P3EA 3V0UA 3W7DA 4WGXA 8A3HA 3TW7A 4W89A 1KQYA 2PGEA 1EA9C 5JUVA 2G4JA 3NGJA 4AZGA 1LWHA 1XJBA 2ZVIA 3CZEA 3OP2A 4DXVA 1TFVA 3DENA 3AUOA 7XIMA 1K9EA 2HTMA 2Q6ZA 3IJQA 3RRXA 4D6GA 1EHNA 2QVHA 4DUVA 1VJZA 3OIHA 1E15A 2A3EA 4AZ5A 4H6QA 1K77A 5I3JA 3K8MA 3WQOA 4JPGA 3KBVA 2GGIA 3LCLA 3EMCA 4A05A 2C7FA 1ZP3A 3E12A 1RP8A 4JAWA 1G67A 2YLAA 1ZRQA 4KCVA 3ZWTA 4FAMA 2XTKA 1FKXA 4U3AA 1K7EA 3C4UA 5HMEA 2PFHA 1OSEA 2XIQA 4H8VA 4LGXA 1DL3A 1BPLB 1V7YA 1CGTA 3AIBA 5GNZA 4LCRA 4ORMA 3F4VA 4KGLA 3B06A 2W92A 2V63A 4FX8A 2ATSA 2HNEA 2PE4A 1U1JA 4E4UA 3OGRA 1ZJIA 1IZJA 4UQDA 2OPJA 4ICCX 3QPYA 3MTWA 2R1PA 4M0XA 1PZ3A 2MANA 4TR9A 3M64A 3Q94A 3AS0A 4A3UA 5AC4A 1XG3A 1M5WA 2DW6A 2O4QA 1QI5A 3INPA 1WOAA 3PBMA 2VD9A 2WMJA 3GD6A 1V77A 3ONCA 3MSDA 2VEFA 9RUBA 3WENA 4DAFA 2VRKA 4JTSA 4DWDA 4V1YA 1RALA 2CHOA 1O5XA 1E4IA 4BR1A 4NQ1A 3R13A 5LIWX 1ZQ5A 5LHFA 3TXVA 3GR4A 4LUTB 1DIEA 1O4UA 3U4AA 1DWFM 3AFBA 3TR9A 3GG8A 3OLIA 3IGXA 1ECQA 4WJEA 4BI5A 3R6IA 4H6EA 4S3CA 4QE5A 3PZVA 2DSUA 2E67A 1BQGA 5JBFA 1O6IA 1L8NA 2OYMA 1QW9A 1UP2A 2GJNA 3P6LA 3B9EA 2GWGA 2WKJA 2DZSA 4C60A 1NH6A 1KM5A 2ZC8A 4IPPA 3PG9A 1H11A 3GFZA 1X6UA 3KOZA 3IV8A 3N34A 4JQ3A 3SIZA 4MZYA 2ZICA 2R1LA 4JNYA 3NQ2A 5CG0A 5FD0A 3MJYA 3BWWA 3WDQA 2F84A 1TR1A 3GYCA 3FXYA 2OOGA 1VH7A 3EOEA 5FL0A 2E5BA 5U7SA 3CJPA 4CGTA 2ZX5A 4HJFA 2PTZA 4GINA 5LHEA 3HGRA 4IOTA 3SJNA 1U83A 3QPZA 1R38A 4JYDA 4AWUA 4LBRA 1XQKA 1DQWA 1TPWA 3IUHA 2WKGA 3L4WA 4YTQA 1B31A 3JS3A 1TELA 2Q02A 4WSHA 3BMXA 1TMLA 1PKYA 3A64A 1HO4A 1Z48A 1VPQA 1HF6A 3W01A 3WJZA 5FESA 3TW9A 3M5YA 2NXIA 5A5WA 3T0DA 4FOKA 4F8XA 3M9YA 4FNRA 5FJPA 2AQVA 3K4WA 5CZKA 3W26A 3LHTA 3CWHA 4M1BA 3LTPA 4PUMA 4I5UA 5KZEA 3L0KA 5KZ6A 4JKKA 3XINA 4GX9A 2V68A 2I5IA 3OU8A 4L9XA 1FWEC 1NFGA 3T81A 2Z6JA 3SO7A 4MKSA 1WXYA 1EIXA 3RM8A 4X2PA 1ZALA 2V3EA 3RIKA 4HN8A 4IGNA 3AICA 5AOUA 4UTMA 4YCPA 1QAPA 4GUJA 1XPYA 2HRWA 1C29A 4HVXA 4PRWA 1OT1A 3M0XA 2YL8A 3SADA 3PBGA 3BL3A 1SZRA 1KBIA 3PR2A 1A53A 1XLFA 2IPFA 3MKCA 2SFPA 5I3IA 4JDBA 4LNCA 5A6KA 3WLSA 3ARZA 4YTTA 1Q7QA 3S5YA 1R3SA 1HJUA 4LBUA 3AALA 4O8RA 1ZBCA 1LJYA 2QJHA 5DLCA 3M47A 4O57A 3STGA 1IT0A 1NOUA 4ZBCA 2HPMA 3FA4A 5LGXA 4ZQRA 1XIEA 1F6KA 1FWIC 3KVJA 2YLLA 3MKVA 1DJZA 4GY7A 2QCCA 1NWSA 2WCGA 4MB3A 1YW1A 4GVHA 4N0RA 2JIEA 5FEZA 2VVSA 4AC1X 3H2CA 2ATMA 2CPUA 1K8YA 3CLWA 4ZQNA 3RHGA 5B7ZA 1S5VA 1RPXA 1YE6A 4AXNA 4RXFA 5C7HA 4HHHA 2ZBTA 1JCLA 4QX4A 3WD2A 4L4OA 5XINA 4IIEA 1ZHAA 3LHUA 5AFDA 4C6LA 1QI2A 1PX8A 5DBTA 2I5GA 3R58A 4M6QA 4UR9A 5A6MA 1VEPA 5HR6A 4KCTA 1NWRA 1R5YA 4XZ9A 4HCHA 3KHJA 1OGGA 2V5DA 3GW3A 2WMIB 3RPMA 3K8LA 3GNRA 4NRRA 2DZAA 1BGGA 4DELA 4HSNA 1DVJA 4CQCA 2PDJA 4KPLA 4AMAA 3FV9A 3GHRA 5EMLA 5CGMA 5XIMA 1A5UA 3DKJA 1N82A 3NOEA 1VENA 2ZX6A 1KFJA 1XIJA 1UCWA 3SSJA 2FPVA 2YL5A 1Q6DA 2Y7EA 1VPYA 2Z1WA 2GJRA 1B90A 1CB7B 3TXZA 1XYMA 4PMVA 1UMYA 1WCGA 2ZDRA 1X1NA 3HF3A 4QROA 1QWKA 3AS3A 5LGZA 4FPSA 1ME7A 4QEEA 4OT7A 3AIVA 1AW5A 1T5AA 3ZVHA 5FSDC 1CGYA 1UASA 2WZTA 1K6WA 1WQ5A 3QV8A 5CJNA 3WBYA 1KM6A 3P60A 1W17A 2WSQA 3U0HA 2YSWA 4GVIA 2NW0A 4FA3A 2VZOA 4FZIA 2Z1XA 2JE8A 2C13A 4R7WA 4US6A 3H53A 1DJGA 3VD5A 4KH2A 2GQ3A 4H01A 3DAQA 1XSKA 1P5BA 3BGGA 1W2PA 3K5XA 2GUUA 1PX3A 1KRMA 3UERA 3DKLA 3JUGA 1EOKA 3GXDA 1VCGA 1C8YA 4FOJA 1RHCA 1UJPA 2G3MA 4IQJA 3APYA 1XSIA 1UWIA 2TMDA 3B05A 1OYAA 3B0PA 2A85A 4K2SA 3W1MA 4UNKA 2VFHA 6TAAA 2I9UA 4H4IA 2Z29A 4QJ1A 5BROA 3EEZA 1UR3M 1UWUA 5DQPA 1R2RA 1KXTA 1JCYA 2FVMA 2DVTA 3AU6A 4KFOA 5IRPA 1IHIA 1UQZA 4IX0A 3OQEA 2WV8A 3N2TA 1UOKA 3U6WA 3OO2A 2ZX8A 4HMEA 1VYSX 2VELA 1FX6A 4MLRA 2P1FA 1WE5A 4IHCA 4TX8A 4UQ9A 4MY9A 2DVUA 4KEMA 1UKPA 3K2GA 1YNPA 4ZCWA 1DE6A 2H8XA 3S5OA 2YA0A 2EG6A 2EPKX 2NXGA 3QV7A 2OTDA 4QJ4B 2EG8A 1DYSA 4JHMA 4D6FA 1WUFA 1K8CA 3R12A 1YNQA 2YR1A 1Z89A 1TWSA 3CHEA 3NURA 1AMYA 3VZYA 4RKAA 4L5ZA 2QT3A 3M6DA 1QNRA 2PWUA 2VR5A 3G77A 1UZHA 5LA1A 4IG2A 3SJ3A 1JZ8A 1UR1A 3OQ8A 1CW2A 3JZEA 2CLIA 4M6VA 1E6NA 2X1SA 4IPJA 4H9UA 4O12A 2V5BA 7CGTA 1YPIA 3IK2A 4NYUA 3RLGA 1WDWA 4ZB2A 3H4GA 3LHWA 2EHHA 1JPDX 3SN0A 1S38A 1DXEA 1V3IA 4UFKA 3ZM8A 4GH3A 4PMXA 1O5QA 1POKA 3BAXA 3I6TA 4JYFA 4I5XA 3QV6A 2ISFA 2E40A 1YQ2A 3JU2A 3GS6A 1UKTA 5AVHA 1UZ4A 2OT1A 3O06A 5AVNA 5H8MA 4HNOA 4BCEA 1E0UA 3P0XA 4ZL1A 4PA8A 3EWBX 1K9TA 3DERA 4X63A 3VDAA 3TZNA 3W1UA 2OODA 1EHAA 1V3KA 3WLIA 1W3LA 1XBYA 3EBVA 1YEYA 4P7OA 1RBOB 3DGBA 3MT1A 3DG7A 5JXQA 1B30A 3JVAA 3G18A 3GE7A 1PYMA 3G1VA 4BKNA 1ESWA 1J96A 3TZFA 2GVLA 1RLDA 3L21A 2JKAA 1OZQA 1FVPA 3AXKA 2WHKA 1PAMA 1E6ZA 4RE3A 3VZZA 3NL6A 3BV4A 3EX2A 2F2HA 1KGWA 2QJMA 1P7TB 4C7FA 4R33A 4FF5A 3UXIA 1C8VA 3PPCA 1VD6A 4ZOBA 3LLFA 4J3WA 5DRIA 2XIOA 1M7XA 3LXCA 3BLIA 1RVKA 3FYYA 4MWAC 3POHA 2Y5JA 1Q6GA 3UJFA 1BVWA 3WEOA 4H6KA 4LAOA 4MNJA 1DIDA 4X0NA 1MEWA 1BVNP 1ZZMA 1YADA 4DUOA 1SO3A 1VQTA 4XISA 1KCZA 2VX5A 3WQPA 3P0WA 1ZTVA 3AHZA 1JDAA 1KTCA 1ZJAA 3L4ZA 5ECUA 1ADDA 2XU2A 2VC5A 3WMCA 2PDFA 1QI0A 2PURA 3G1SA 2DT3A 3TLQA 1OFAA 2QCMA 5CSSA 2PRMA 3MVTA 5E93A 2V5CA 2CLOA 3PVFA 5IHSA 3PTMA 4REQB 3G0UA 4MY1A 1O5KA 3BSMA 5A6AA 3UPWA 1CLXA 4JQAA 5TF0A 4W5ZA 1D8WA 4LQ1A 4HHPA 3BK0A 4HK6A 3PUEA 1KLYA 1SZEA 1O66A 4PMJA 3UU0A 4ORIA 2WQDA 1FWCC 3VYLA 2HCVA 1OJXA 1KV8A 3F5LA 2A0NA 1GVSA 3PP7A 1WKFA 5HUPA 1MUWA 4XWUA 4H9XA 1TREA 3NL5A 1IXQA 3GH5A 4L6HA 4X9YA 1DJNA 2JFEX 4ZB0A 5FJOA 4R85A 1LT8A 4MWAE 1FDZA 3C8NA 5HPOA 4BEUA 1X8CA 3E0WA 1XH2A 3OG3A 3N9KA 4HPGA 1KBLA 3CT7A 4O14A 1OEPA 5FJTA 3QFEA 1GOWA 1MQRA 3I7SA 1QR7A 3RM9A 3TU9A 3W85A 5F2IA 2E6FA 2C3ZA 4XZMX 3TNOA 3N04A 1RY0A 4U3CA 4M6UA 4A4AA 3SCUA 1ZENA 4ZE4A 4UTWA 4C1KA 4WDWA 4O0ZA 5BOFA 5REQB 1D2KA 5DEZA 1QATA 4IXXA 4R7OA 3YPIA 3LZ5A 1TV8A 5BYWA 2CCRA 2VCAA 3EDEA 3CS2A 3NDYA 4IUGA 4FS9A 4LY4A 3L12A 3LXAA 5CPQA 3KBMA 1NDZA 1M6JA 1MFUA 2PMQA 1IXPA 4HOWA 1IIHA 1RQEA 3BAWA 4JTCA 3MYOA 4QSFA 4WZHA 1AUSL 2YCEA 1WBJA 1A80A 1EF3A 3M7WA 5F1UA 1MEIA 4G8TA 1F3EA 4EE9A 4JNMA 4GFIA 1W3KA 2Y7DA 4AIOA 2GDUA 4QP0A 1OX5A 1FDYA 1RJPA 1FWNA 5CGQA 1TV3A 1G69A 1F07A 4ZQCA 3PNUA 1J18A 4MYXA 1O68A 2QZRA 2XWDA 3AS2A 2P8CA 1NAL1 4FIRA 2GVGA 1VHNA 3QF0A 2PRLA 1VFMA 4DUXA 4NNAA 1XR2A 4FF7A 1MSSA 3GR7A 3KOFA 5E09A 3UWQA 5DMMA 5KINA 3NQFA 2ZOXA 3EB3A 3C2YA 3RPDA 3UPBA 4UTTC 1SO5A 3LA4A 4H9ZA 3PM6A 2INEA 3LCGA 4GYPC 4LB3A 3BMWA 1LBMA 3VKCA 3UXKA 1EP3A 1CX9A 4MHBA 3EA2A 1WAUA 4E8DA 2PDQA 1S2TA 3P8JA 3UZWA 2ACSA 2ZX9A 1HFBA 3UCCA 1W9UA 1KBBA 3AXMA 3QOKA 3CAKA 1GJWA 3P5YA 4LVBA 5L6UA 4O0KA 3LBOA 1TPH1 1UKOA 2X1TA 1QW8A 3I3DA 1UWAA 4M1RA 3KBJA 4AZ6A 1J9YA 2WNWA 2XUCA 3CUHA 3G8EA 2W6RA 1VKFA 3IV3A 1CXHA 4P8WA 4AISA 1QI4A 4AH7A 2VURA 4B3LA 3O63A 4UOJA 4XBKA 5EL1A 1ZB5A 4RUBA 4HTBA 4A35A 3AOFA 4FNSA 1L9WA 3HU7A 1EJWC 3KWXA 1O7AA 1VAHA 3S2CA 1ONEA 4ES4A 5CH9A 3ITCA 3CQKA 3QY7A 4D2JA 3ZS4A 3BCFA 3GSMA 2XM1A 1AL7A 1M03A 4HZMA 4Q8NA 2ZUSA 2ISDA 3PFRA 4F2BA 1UR8A 2BY2A 3GNNA 1Q7ZA 1J6OA 1SW3A 3TWBA 1A3WA 2VZUA 5CEWA 2ABAA 3ITYA 2XSBA 5PTDA 4J9JA 1V3HA 4OGZA 3CU2A 2YYTA 3NQAA 2BHUA 3VGBA 5XIAA 5KZMA 5DFAA 3TUUA 3NZ1A 4JEJA 3QLDA 1KNWA 4CQAA 1EJSC 2VFGA 1QBBA 1XD0A 4Q8UA 2FZBA 3V0TA 3RNDA 3NCOA 2HQAA 3QC0A 3NPUA 1BWKA 2YCIX 3CUJA 4EOUA 3KFTA 3W23A 2QEZA 5FEXA 1GUVA 4QAWA 4OV9A 4K68A 2HROA 4HZ8A 4NHVA 4QS6A 2J6VA 4C5YA 4H1ZA 2VWSA 3WQDA 1MW2A 1G6CA 2FB3A 2JKPA 3VK5A 5JBDA 3PZTA 5A6TC 4J3XA 3VKBA 1XIHA 3T4CA 1QCWA 2ZZ7A 4H41A 4PCTA 3BTNA 2R9RA 1ZCCA 2Q3OA 3VPLA 4GNJA 3O15A 3ARUA 2VQTA 4K3ZA 2WMGA 1GQIA 3VGDA 4PODA 4MZ8A 4NNBA 3OVQA 2ZUNA 4EACA 2IKIA 1HJWA 4JCMA 4Q8MA 1E1CA 2XDFA 1Z8AA 3BUVA 3MY9A 5HNRA 1LOSA 4MNMA 4MNLA 3LSCA 3CO8A 2NT1A 5JIWA 1A5LC 3WG6A 1KM1A 5H2ZA 4QSHA 1HP5A 1MW3A 2YL9A 1RK6A 3MKKA 4LYRA 2NZLA 2VOMA 3AU2A 1H50A 3VTRA 2Q71A 1X1ZA 2PDBA 4N9CA 3VIKA 4E2BA 4B5NA 3PY2A 8TIMA 5FI8A 4XZLX 4AU0A 3MPGA 3N2MA 4G7EB 2J6XA 1FXPA 1HP4A 1GPWA 4N9EA 4LH8A 1VFTA 1M1BA 3IGHX 5HQEA 4XUYA 4UTHA 1XLJA 2NLIA 3NO3A 4IUOA 1LRNA 4ZSTA 1C7SA 3ZR6A 5D8WA 4CD4A 4RXGA 5CLWA 3VD9A 2G96A 4N9DA 1Q4NX 4ICNA 4E6MA 3BAYA 3IVUA 2JEPA 1DBTA 1CBGA 3M5VA 1MEHA 2ADAA 1BRLB 4MKNA 2WQPA 3P82A 4M29A 2IQDA 3GH7A 4JFTA 5T91A 3V35A 1DTUA 1EPXA 4MFDA 1A5KC 2XINA 3VUSA 1CB2A 4AMCA 1IXOA 1RBAA 1H7NA 2X8RA 4R5EA 2ZXBA 4G56A 3DESA 1V6WA 4BHYA 3M6YA 4X2RA 4JTEA 1Q4WA 2QV5A 1XI3A 4QBXA 1K70A 3IACA 1R47A 3U8GA 1UR4A 3FYOA 1PS9A 2PZNA 3B4YA 4DXKA 3WN6A 1PKMA 4H9MA 3W29A 4LEFA 3EOUA 1ZFJA 2FFIA 1OX6A 3SRKA 3WF0A 2R82A 4GUGA 1P0DA 1H7WA 3LTSA 2E8ZA 4YCOA 4PUWA 3MMDA 4AZCA 1DWHM 3I65A 1GKQA 4UFIA 4UTFA 2C0AA 3EX6A 4WY0A 1JL8A 4DM1A 3GVRA 2HZGA 1MDRA 1IQ8A 3UGRA 1UH2A 4FIQA 3GO2A 1ZAJA 4DJFA 4O54A 2PTYA 4XKYB 1KXHA 1WYIA 3C0JA 2V6AA 2O0TA 3EOOA 4DWSB 1EYWA 1QNOA 1WB0A 4S2CA 1Q6RA 5C9UA 3OZOA 2ACRA 3GU1A 1HJVA 2J62A 3NQCA 1PZ1A 4P2VA 3UA4A 4IT1A 3C2FA 3ZJKA 2QCDA 3B8VA 2G3FA 4JY8A 2BVTA 4AEEA 1HKMA 4R34A 2ZRVA 1TSIA 1DE5A 2C79A 3VMNA 4QEHA 4TTGA 1C91A 1M9HA 4C6PA 2V2HA 2WAGA 2GVEA 1TA3A 4HMCA 4IWWA 1CT5A 1XRTA 4YYFA 3E0LA 3NXLA 1NEYA 1W1VA 4AD5A 3P81A 1OX4A 2PDPA 2G95A 4WSKA 4S38A 2BGSA 4QDPA 3ABZA 4Q6XA 3ONBA 5D9MA 1U5VA 2V3DA 4PRTA 4K8GA 2BHYA 1PX4A 2WSPA 3L4TA 3NPVA 1QO5A 3VIHA 4DZAA 1Q13A 4FXSA 1EQPA 3G22A 4GNKB 3DFNA 3QMTA 3PF3A 2V2CA 2ZYFA 2RDXA 4AQLA 3BVJA 3HG2A 4I8YA 3E2QA 2A21A 4PBFA 4BZYA 1DWJM 3AQUA 2BASA 1TUFA 1GZ1A 4PTMA 1NOWA 1RH9A 1W8SA 3TMQA 4UTKA 3DHFA 1JXJA 3WFAA 4PUJA 2YW4A 3WY1A 1O1ZA 1D7KA 1W0MA 3PWIA 2E68A 4IFKA 3LEPA 2GPTA 4ZOCA 4DZHA 5TQLA 5DT7A 2VHLA 1CXKA 4DI9A 3BCJA 4QCEA 1A5OC 3LK6A 3QW4B 4L9ZA 4HPNA 1C93A 3TKFA 1XINA 4CVUA 4MM1A 3AZRA 1J2BA 3UQNA 2YJQA 1BHGA 2OEKA 4K7YA 4QNEA 3NO1A 1W1IE 3GHUA 4XD4A 1BKHA 4PMDA 4RE4A 3S6OA 2FQIA 3SCOA 4D8AA 3GVWA 1S3HA 2HBVA 3TN4A 4IP4A 4L7ZA 1XS2A 2E8YA 3VGEA 5I24A 1RD6A 2XIJA 4A22A 1OC5A 2Z25A 3V7PA 1ALDA 3R1ZA 2E1WA 1QJWA 3TE9A 4UTTA 1F73A 3GTIA 2HPIA 1IEXA 2OMAA 1WZLA 4GYPA 4H9TA 4RJEA 3U4FA 2RJGA 2GGEA 3U2ZA 1TRDA 4BQ2A 3APTA 1EC8A 2OOFA 4GA8A 1WP6A 1HO1A 3FCPA 5FJJA 1T6MA 2J7DA 2ZZ1A 1QNSA 4NZ4A 5BOOA 3BZGA 3QTPA 2G50A 1N7KA 3BLPX 4HKPA 3OA5A 1S2CA 5CCZA 1KD0A 1Z3NA 3GZ3A 2GVYA 5K4ZA 4R3UA 2PSNA 1Z42A 3T9PA 5JH2A 1CTNA 5BU9A 5AC8A 3XIMA 1T8XA 3IRSA 3QC3A 3TNBA 3PZ9A 3W27A 3ZLFA 5D2YA 2D23A 1JFHA 3OG2A 3IJIA 5A8GA 2V5LA 4RE2A 2BOEX 3ZR5A 3LSBA 1THFD 3VIFA 4X9SA 3DH7A 1GJPA 4OE7A 1KFCA 2FMNA 4FLOA 1SFLA 3ERPA 2VRJA 3CZ8A 4DBUA 2WSYA 2H9AB 1XLLA 4ZTXA 5HNUA 2AKMA 4ADSA 3LG3A 3H54A 2CLKA 3W3OA 2ASHA 4RL3A 3DI0A 3M0VA 1OFDA 4I6VA 4Q8PA 3IJDA 1K8ZA 5CZSA 1DHPA 1G4SA 2KAUC 4LRTA 4HT3A 4IX2A 1TO3A 1QOQA 3LHYA 2JBMA 3R8HA 3TK7A 1OIMA 2WJZA 3TFXA 4H00A 3L5AA 2DZTA 2VWTA 3PAJA 1L6WA 3VGFA 3FLUA 3DFTA 4YPJA 2DZXA 3UWYA 2OWXA 2I1OA 3CUZA 4LAZA 2OWWA 4J3ZA 3T09A 4CCEA 5MKGB 4PH6A 2EBNA 5AHMA 5F2MA 2E5DA 3P7YA 3BZJA 2Z2UA 3DG3A 1V03A 4LRSA 3LN3A 4GGHA 3WMLA 1QW7A 5A6SA 1YDYA 2Y88A 4F0HA 1XKYA 3WDHA 4GMEA 2XH2A 3NR0A 4URIA 3ZMRA 2GK1B 1XYLA 4GZEA 2CIPA 1BYAA 1Y0EA 2OX4A 4WGHA 5G4HC 4F48A 2RKXA 3ZJ8A 1HT6A 3LENA 4AZ7A 2PDGA 3VVGA 4PFHA 4EWJA 3TQ0A 1W5MA 5IBXC 3H7UA 1FWHC 4TX9A 2NQ9A 3VOHA 2PWEA 3V0SA 3ARTA 1GPFA 3H2OA 3VAVA 1FFQA 2HVOA 4HCLA 4MADA 5HULA 3UVAA 4RLIA 1LRTA 1CXIA 2CLEA 2I7GA 1I1WA 2GJXB 2A3AA 3QBUA 5C54A 2B7QA 4XZBA 1W1TA 3FY1A 3GWQA 4B92A 1AA1B 2Z1VA 2DQXA 4H7CA 3GXTA 3RJXA 2UY2A 4O28A 1SJDA 4JIRA 3LCWA 4DBWA 1Y5XA 4DBSA 1AQFA 3IRDA 1I0DA 2OQLA 4PCPA 4UQBA 3D6NA 5FEWA 3NUKA 3HG5A 1SO6A 3IJ9A 3L9CA 4B4HA 2ZFAA 4YTUA 4QR6A 2QULA 3ZOAA 3P62A 3TQPA 4MUZA 1EJVC 1E6QM 2FVLA 3GRIA 4YVPA 3VOIA 5DMYA 3BQ5A 1G0CA 4W4QA 4GIAA 1Z32X 1H62A 6A3HA 2B7NA 4LUTA 4ACZB 3T1GA 5CSUA 3M0IA 4JTIA 4O15A 2EAWA 1EPVA 3HFYA 2X7WA 5CGTA 3L2IA 3V4BA 1UG6A 1E6RA 3GDKA 1RY8A 4CD6A 1Q45A 3VCRA 4M6PA 3SGZA 4P7LA 1R3VA 4H7ZA 4W5UA 4EX4A 4GI6A 3FEMA 4HU4A 3T2QA 1JZ2A 3OVRA 4GQBA 4BK9A 1JUKA 7ENLA 3PANA 4UZUA 3AJXA 4NX0A 4M5PA 3Q58A 1SZNA 4Q7IA 2PDUA 3E2SA 3U5UA 4ZO7A 2E6AA 4HJWA 1XH0A 3DGRA 2E0PA 4PUDA 2NX3A 5M17A 1AJZA 3UXAA 1PTAA 1W9DM 4G2DA 1EGMA 2YBTA 4UTUA 1F4AA 1KRCC 2VX6A 1GVIA 1XDJA 2GYIA 3CHFA 1YIXA 3UNDA 1HW6A 2WHMA 2X0HA 1BGAA 4QRNA 2IQTA 1GTHA 1ICQA 3OYZA 3NM1A 3R25A 2VCCA 2Y89A 3FAWA 1YXYA 1I45A 1KBKA 4LCSA 1SZFA 1B4KA 1Y65A 4D6JA 1VR6A 4AD3A 1YTEA 5A94A 1DEDA 4HCDA 5F1VA 5AHIA 4LB4A 1QNPA 3N19B 3RK8A 5ENLA 2BHZA 1TKKA 3T05A 4HZ6A 1JVNA 3F5KA 3FVDA 2FHCA 4TMBA 4HA0A 3ARRA 2Y8VA 3EX1A 2EPOA 3TP4A 2JF6A 4R27A 3UG4A 5DXYA 1G7VA 4X22A 5F4WA 1ZUAX 3NEHA 5D30A 2VZTA 4JTRA 4DBEA 1SPQA 3FOKA 1TTJA 3PZOA 3UWVA 1XYCA 2FTWA 1SQ7A 3BXWA 2E5CA 1L0PA 3C2OA 1V7AA 4LJ3A 4PUNA 1IT8A 3AJ7A 2BMBA 1E71M 2VR4A 1TV5A 3S1VA 1R2SA 1ISYA 1BYBA 3F2CA 1UC4A 2PDYA 4UQEA 4B3KA 2OLSA 5KTLA 3S2MA 3AZSA 1BG9A 1ZY9A 2CC0A 2HWGA 4D6CA 2YDSA 1V3JA 3L7RA 3W7RA 3F4NA 2Y8KA 3PWAA 4QNWA 4PGLA 4MZ1A 1J10A 3M0KA 3PUGA 3UGVA 3UP8A 1ADOA 2YW3A 4X61A 3OODA 4CNPA 5I78A 4GHRA 1M3UA 1J0HA 1DP0A 5JMUA 1QO2A 1BWVA 1K9DA 5HBFA 1JPKA 2Y2WA 3CPUA 3HGSA 5CPNA 4NJJA 3SY5A 1PTDA 1VP5A 2WK2A 2BOFX 3QR1A 2QXWA 3UJEA 4Q7BA 1UHVA 3SDOA 1YYAA 3ME3A 1JRCA 3WQ6A 3RAOA 3W2JA 4BF7A 1ONRA 2CHNA 1OADA 4WRHA 3DC8A 3BJTA 2OVLA 3BE7A 2IXVA 4IFOA 3LCFA 4C6CA 3H24A 1E9IA 2HBXA 1D8CA 1OYCA 4JY9A 5ABTA 2VYOA 3VKJA 4XVDA 1MVYA 2QVNA 1GVYA 5AYBA 1HJSA 3ARWA 4AF0B 4LAMA 1PKNA 3QVQA 5J04A 4EPKA 1T99A 2WMIA 2V38A 2ZZ4A 1XIDA 4HNTA 3WLPA 1EH9A 1IIGA 1ME8A 1R30A 1Z9AA 2OZ0A 3QHMA 5AKQA 2D2GA 5LXXA 1KM4A 4RCXA 4ZO9A 3LERA 1O95A 4YYCA 1JPHA 1JF5A 4XAGA 2Y1HA 3GG7A 4R88A 3GNOA 4IXHA 3VD3A 4HQVA 5FF0A 1VIWA 1L2UA 3QM3A 3BAIA 3TJLA 4GISA 4F0KA 3VE9A 1E9YB 4PSRA 2V3FA 3RLUA 1R3YA 1I60A 4MJ4A 1QI3A 3FXGA 4H7VA 4O0QA 1F05A 4F9DA 1J0ZA 1B3YA 1ONWA 5CBJA 2BTMA 2X16A 3CHCA 3DFHA 3MCOA 4JXCA 2QNEA 3TWAA 3WK3A 2WW5A 4F4RA 1MZHA 4OQVA 2PC8A 4JIQA 2DJLA 1LUCB 2DZVA 3EPNA 3TJXA 5I3GA 2CHRA 2OGJA 3DFYA 5I79A 4JN6A 4HSHA 1TB3A 2PDWA 2PB1A 1IF2A 1BTMA 3VNYA 3G3DA 2D73A 1EL3A 4NI3A 3EB2A 5T9CE 4MTVA 4JX6A 3W6LA 3T42A 1EO7A 2F9RA 3A4XA 3CO4A 3FSUA 1B9ZA 3CQIA 3AC0A 4RNFA 4IQLA 3EXSA 2PTDA 2YKKA 2TYSA 2E3ZA 4Y6GA 4TXEA 3KRBA 3BOXA 1RCQA 1AH4A 3KTCA 4L65A 4NZ5A 3PZIA 4V1XA 3THUA 2J13A 3STEA 2WZEA 4D6HA 2ZUTA 4TVDA 2Z24A 3W7GA 2VZVA 1UD5A 1OZMA 1WZMA 3O16A 4Y7EA 1VEOA 2DSZA 4JTDA 5FCZA 4GLEA 1IZKA 5DCDA 2B4GA 1UD4A 3L4YA 4RPPA 3VDBA 3DFOA 4S3BA 2WVTA 3U5YA 2PWVA 3DI1A 4CCDA 5HJXA 3N4FA 2D22A 2VR2A 3R0UA 2HV5A 3O8AA 3KDNA 2XPKA 2HMCA 3VO0A 3WDPP 4XX6A 4HNCA 1YPFA 5AC6A 3LXBA 3N2CA 4E4FA 4MGGA 3R8GA 1JCXA 4O1FA 2CITA 1X7IA 4NJIA 4MJMA 3I3BA 3LHZA 3N9SA 2DDXA 1K1DA 4Z1BA 2B7OA 3DXIA 5IXEA 1PWMA 3LV6A 2F6UA 3G1XA 4LPCA 3CM4A 2WOQA 4C90A 5H91A 1OM0A 3C5QA 3WO8A 2WM1A 1NU5A 3W2UA 1FWRA 4N02A 5F2GA 1JPIA 4F2UA 4O1BA 2QUMA 5EU9A 3PSVA 4XD5A 1P0KA 3PHAA 1XLMA 3PTQA 3W71A 1VFOA 1MNZA 4DPQA 1EZWA 3WUGA 3DHPA 5C9ZA 1IV8A 3W7LA 4G7FA 1HTIA 3WH6A 4DJFD 3F5JA 2WKLA 3E1F1 5IBXA 2HE5A 2DP3A 3SRDA 1G4EA 1EWEA 4O1EA 1M65A 3N17A 2FZ9A 5FJIA 4KEUA 1NTHA 4A2SA 1RSCA 1B57A 3AROA 2VGFA 3E02A 3PB0A 1B0IA 1V0KA 5DT5A 4FX7A 4C6NA 5LXEA 3RDKA 5IFPA 3WUFA 1PYFA 5KSWA 3VXGA 5JBEA 2ZZ6A 1Q8AA 3F03K 4TVUA 1PL9A 3SCPA 1LF1A 4K6AA 4LC6A 3KBWA 2XVNA 4RZ4A 2GSEA 2VEKA 1N55A 3ITLA 4D6DA 1KFLA 4JEQA 1E73M 1P7TA 4LBSA 2Y4SA 4M24A 3ANYA 1M41A 2A6LA 4RZ5A 5M5DA 5LA2A 4NAFB 3WD0A 4ZOAA 4QITA 1F74A 1B9BA 1E4MM 1YE4A 1G9HA 1EBHA 3PBVA 2VC7A 4XV0A 1W3NA 1XYAA 3KOXA 4I9JA 1RXOB 2WVSA 4NZFA 4HHLA 1W8GA 3GU9A 3W7JA 2FB2A 1VC4A 3LPFA 1KCLA 2VDHA 2V8ZA 5H8PA 4IPIA 4PE8A 2Z2BA 5SWUA 3RU6A 1H09A 3NZPA 1N8IA 3OVPA 4IJCA 2R24A 1BXBA 5EPDA 4QQ3A 4MF4A 2D0HA 2J77A 2XVGA 3MV01 6ENLA 3BOFA 3QV9A 1VBUA 1TTQA 4O52A 2X42A 4AHOA 1BAGA 4REQA 2CLLA 3R0DA 3VNMA 1QFEA 3ARQA 3UG8A 4V28A 1QTWA 2ZIDA 3WBWA 3VC5A 3UCQA 2G37A 4GYJA 4LFYA 3M5ZA 3MBFA 2PWGA 3W7PA 2QR6A 2O9PA 2NSOA 3W1NA 3HOJA 1IT7A 3ZT5A 3P84A 3VD4A 4PEEA 3GG1A 2UY3A 4WXZA 2YCLB 4OUEA 2YZRA 1W1ZA 1MW0A 5CSRA 2WWCA 4TMCA 5LKYA 3MA8A 1EP2A 2ZC1A 4R9OA 2WLYA 4RW3A 2C15A 3IK4A 2NQLA 1GW1A 1PZ2A 3A9BA 1ZBWA 1PXGA 1TPUA 3UJRA 1DJXA 2ONEA 3ZQ9A 2CWXA 1CI1A 1V93A 5JIPA 3LHVA 1WXZA 1DIOA 3IEBA 3E6EA 1XISA 5AECA 2PWDA 5A8PA 2V2DA 3CUFA 3MZ2A 3AUJA 2QHAA 2Z00A 4FI4A 5EBUA 3A23A 5B7YA 1BF6A 4RDVA 4Q6JA 5CPMA 5REQA 2D1ZA 4AUBA 2GQ9A 1NDWA 1NF7A 1CGXA 4DNHA 3W73A 3CUGA 2GSHA 3QMRA 1Q5MA 1TJ2A 3URBA 2HISA 4UTLA 3LLXA 4UOZA 2FKPA 4NF7A 3VX1A 4K1WA 4K1GA 2W91A 1J11A 3TYZA 3O0FA 4CU8A 3KVMA 3EXTA 4C7GA 3TQVA 2ZRZA 4EPBC 1EGVA 1PVNA 5ECVA 1LOLA 2BG5A 4ADUA 3I10A 1NFBA 1XLDA 2H6RA 1KM3A 3PFMA 2PWHA 3U7BA 3QY8A 4XSLA 1L6GA 3MW7A 2NX9A 4NSBA 1V8EA 2PCEA 1OFBA 3W82A 3CBWA 3GNDA 3MANA 2PODA 1CXLA 3KS6A 5BRPA 3QPEA 1Q63A 4AVFA 1EDQA 3SGUA 3T4WA 1ENUA 4IH3A 1K9FA 4BJHA 3NPXA 3W7CA 3VFCA 6PTDA 3IAPA 2QIIA 1MUCA 3UZXA 2QCEA 3T2OA 1SMAA 1Z44A 4GBUA 4AY1A 1CXEA 1E0XA 5BNKA 3I7RA 2GOKA 3RM4A 1JULA 1CXFA 4NG3A 5AN7A 1EOMA 3V5CA 3OPSA 3W7NA 2WZHA 1FWWA 2VD8A 4M51A 4S3KA