1DL3A

Crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
191
Chain Sequence
MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVERVGVFVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVRPFAVDVSSGVEAFPGKKDHDSIKMFIKNAKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of mutationally generated monomers of dimeric phosphoribosylanthranilate isomerase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Isomerase
molecule keywords PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
total genus 65
structure length 191
sequence length 203
chains with identical sequence B
ec nomenclature ec 5.3.1.24: Phosphoribosylanthranilate isomerase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dl3A00
4OWGA 1QR7A 4U28A 3NQMA 2GQ8A 3CQ0A 1TMHA 4O1BA 5KZMA 4K7YA 3TUUA 1MO0A 4WY0B 4AWUA 3CC1A 3TKFA 3ABSA 3MHGA 3S5OA 2F7FA 3EX2A 4O10A 4OT7A 3GAYA 3M6YA 4HPXA 5K4ZA 5KZDA 4KWVA 1ICQA 2WNQA 4LNYA 1GQNA 5EYWA 5D37A 3QMTA 2BZNA 3IIVA 3W86A 3NPWA 4NXSA 1Q6OA 4QSHA 1GT8A 3W1XA 4JIQA 1K3UA 3NYZA 4LT9A 4A29A 3PAJA 4NX5A 3HGOA 1LROA 2I1OA 3HB9A 4CCDA 1KM2A 1IXQA 3DFPA 3PBWA 1T0OA 3O63A 3IIXA 4BWLA 4H6KA 4LS1A 2EAWA 3HG5A 4A2SA 3N14A 4O1CA 4O1AA 3DFOA 1WBHA 1VHNA 3T7VA 2QDGA 5KMYA 3KX6A 2H3DA 2X30A 3P60A 4YL2A 2Y6ZA 3DFQA 3DAQA 2BLEA 4DQWA 2CU0A 4BF9A 4K8HA 3EWXA 1LTDA 4GWEA 3W1LA 5KSWA 1O4UA 3DFNA 1P5BA 5F2LA 1FX6A 1H1YA 5J5DA 4MY8A 3IVSA 3CWOX 5L6UA 1LORA 4MY9A 3EXRA 4RJEA 4M19A 4JY9A 1OFRA 1PCKA 4GBUA 3DZ1A 4I9AA 4QQ3A 5I3GA 1AL8A 4IX2A 3MYPA 1T96A 1FWRA 2P0OA 2QCDB 1V7YA 4EF9A 3S42A 4JX6A 1JCYA 2YSWA 4MJZA 3P61A 3RLUA 1TV7A 3LCXA 3BO9A 4BI7A 1MEIA 4P2VA 3M16A 1D3HA 4E38A 2DJLA 1RV8A 4BK9A 1JCNA 2DZWA 1X1ZA 4MJMA 2KZHA 3P80A 4RX0A 1G69A 1OFQA 1JUBA 5GVJA 2ISSA 1YPIA 3S9YA 4ZQOA 3G1HA 1FDYA 2DZUA 2WPBA 4R34A 3TW6A 4JTJA 4BR1A 3O1NA 1EIXA 2CLIA 3NZRA 4KFOA 4CNNA 3INPA 2QCEA 3TV8A 3O6DA 4ZQMA 3GR7A 3DGRA 3SGUA 2GJNA 1ONRA 2E1DA 1PHWA 4RXGA 4NVTA 4O19A 4XZ9A 3CIXA 2DZPA 5F2IA 1G4EA 2P1FA 3NQ7A 3GK0A 5FF3A 1OX4B 2QCLA 3W7HA 2AAMA 5D05A 2FPVA 3W9ZA 3BW3A 3IGXA 3PUOA 2YDAA 2GVGA 3MP3A 5K2ZA 3NZ1A 4LTSA 4N9BA 3HIJA 4IUOA 5MHBA 3OVPA 2JBMA 2WSYA 4WY0A 4O4WA 1TSIA 3N73A 2OX1A 1TRDA 2ZQ0A 4HHPA 3EXTA 4JN6A 1LRTA 1NSJA 2ZZ4A 4K6AA 3ZS4A 3DI1A 3GDMA 3WJYA 1XC4A 2NV2A 4MLRA 2VC6A 1KM5A 2E6YA 2WQPA 2TPSA 3MHUA 1QAPA 3C2FA 2Y62A 4JDYA 4DPPA 4WOZA 2J27A 2NUWA 2QJIA 1IXOA 1Q6LA 1XBXA 3L21A 3CEPA 1GYNA 3L5AA 3W7IA 1DKWA 2WO5A 2YW4A 4XBSA 1RQEA 1DOSA 2ZZ2A 2NV1A 3SFKA 3DBPA 1CW2A 1XDLA 4OGZA 5K3VA 3NR0A 1IXNA 3L68A 4LU0A 3DFSA 4GUFA 3LHZA 3O07A 2V8ZA 3HO8A 3P8IA 5AFDA 5D2VA 2FJKA 1H7XA 1KFKA 1XUZA 2A1YA 5AHMA 3W2NA 3TMQA 4AMAA 1DHPA 4NX0A 3OVRA 5G4EA 3KVKA 3QFEA 2A6LA 3S1VA 1K8YA 2DZVA 1ADOA 1U83A 4LV9A 5HR7A 3MUXA 3UWZA 3PR2A 1XBVA 1IIHA 2QUUA 3FEMA 3TMLA 3TC7A 1VRDA 3FOKA 3KOFA 1L6SA 4IJBA 3UWWA 4HIBA 2VFFA 5FF0A 2ALDA 2NUXA 2RDTA 3HPSA 4S1FA 3ANYA 3NQFA 3LRMA 3NO5A 2Y88A 4YMZA 4DO5A 3DFTA 3LTYA 5K4XA 3P5ZA 2B4GA 3KVJA 1OFOA 3G1YA 1ZJIA 3OHIA 3CHVA 4XBKA 4LOCA 3ZR4A 2CZEA 4GUHA 1FDJA 2V81A 4FB7A 5D02A 1EP1A 1Y0EA 3P81A 2YGYA 2G5WA 1C29A 1XDMA 3FS2A 4AB4A 1M7OA 2RFGA 2V30A 3ABOA 3GZ3A 1TIMA 2BX7A 2Y70A 2I9EA 4Y96A 1GYLA 1M7PA 4HNTA 4JR5A 1LRQA 4ZQCA 2E5CA 3K30A 1E51A 3FJLA 3KHJA 2WNZA 3B03A 3S5ZA 2A7PA 4N2YA 3BVJA 4MUZA 2FB3A 2VKZG 4HNUA 1EUNA 1X7FA 3EXSA 4JTUA 2YR1A 2EPHA 4UTHA 3W75A 1RQBA 4O57A 2X1RA 2D73A 4ZVJA 4QITA 3W2MA 4O13A 4ONVA 5LNSA 4K8EA 3TSBA 3HGRA 4OQVA 5D2YA 3OIXA 5F4SA 4GRSA 1KM0A 1ICSA 1HO1A 3W1AA 4HN4A 1QFEA 3PBVA 3G1VA 4NQ1A 5HQEA 3RF9A 3W83A 4EOUA 3NPUA 3SZ8A 3BK0A 5FEXA 5H91A 3R13A 1RQHA 3IIPA 3LXAA 3PY2A 1L9WA 3RLVA 1F5ZA 3B0VC 1N7KA 2YYTA 4IMCA 4CQAA 1I2PA 3NQ2A 3HBLA 1EWEA 4LS0A 2NXIA 3P62A 1OX6A 2CZ5A 2VFDA 3HG2A 2VEMA 2V2CA 3O06A 3MHFA 1W37A 1ZAHA 3FJ6A 1C8VA 1KFEA 3GKAA 1ICPA 7TIMA 1AW5A 3W7CA 1J4EA 1TTIA 3G22A 4JTLA 1KFBA 3S8HA 1VR6A 4BWLC 5CSSA 3CT7A 1ZNNA 1VZWA 4AAJA 3QJAA 1K7FA 3HG4A 4H4IA 3QRHA 1Q6QA 4BFAA 4JX5A 3SIZA 5I3KA 2X1TA 4HPJA 4Z1AA 3NXFA 1Q6RA 1Q3NA 4Z1CA 1T8XA 4OU1A 4UTIA 4O0KA 1ML1A 5CSRA 1SW7A 1XCFA 3C8FA 8TIMA 1LBMA 4XWUA 1XI3A 4MYAA 1KFJA 1LLZA 2ATSA 2FPYA 3N3MA 1D3GA 3FLUA 4WX2A 3EKZA 3B06A 1LBLA 4PC8A 1JRCA 2CFFA 3UY7A 3UXDA 1G6CA 1BWKA 3LRKA 3S6DA 3EB2A 2GOUA 3PSWA 3PSVA 3L65A 2CLMA 5CZJA 1GOXA 1FWNA 3N2MA 4Y8FA 1W5MA 5D38A 3G0XA 4JTIA 1X6UA 4N6EA 3T44A 3U8GA 1KM1A 2FQIA 3MW7A 5FEZA 3UWYA 5LGZA 2RHGA 1R2TA 1KTNA 4ADSA 3U2OA 3QEZA 1YTKA 5DCEA 4NZJA 1W3TA 4JEQA 3W7MA 1S5VA 4QNWA 4UTUA 1VCVA 3TSMA 1H61A 2ZRUA 3G1XA 4IGHA 4FEZA 3V1PA 3I6RA 3EWWA 4MZ1A 3F4NA 3G0SA 4RZ6A 2B7QA 1G7VA 3S0CA 1PS9A 3ZWTA 3E0IA 5G2IA 1UB3A 5CPOA 3TA6A 2Y85A 3STFA 3NQGA 2ABBA 4FNTA 4UFLA 1FWTA 3UZJA 4MPQA 1QOQA 4IMGA 1DJNA 4WQ6A 3W1PA 1EWDA 3TQVA 4EF8A 5LNUA 3CEUA 4GFSA 3LM7A 1YDOA 2ISVA 1W3IA 2WSRA 3ELFA 4X9SA 1K8ZA 2Z1BA 5D2WA 1WYIA 1K8XA 3C0JA 2GQAA 5HR6A 1XL9A 2ZFAA 4O15A 4UTWA 2PRHA 2TMDA 3TFCA 3LERA 3TX9A 3G24A 1O94A 1PV8A 3QF0A 5EL1A 1VQTA 4CCEA 2QR6A 1R46A 4N4QA 4A21A 4GXMA 2QF7A 4HSNA 3P82A 6TIMA 4MYXA 4JTEA 3SECA 3QM3A 1RPXA 4O14A 5A5WA 1XUUA 1R47A 3C2VA 3W7DA 4U4MA 1EPXA 3R5EA 4TMCA 1G4PA 4A2RA 4RR4A 2R14A 5AOUA 2DORA 2V2HA 5AYXA 3NNTA 2VELA 3UNDA 2V82A 3NQ8A 2VFEA 1UUMA 1H50A 3QMRA 1M5WA 3B0PA 3TJLA 2RDWA 2WJZA 5AHLA 2ZDRA 3IVUA 4NUWA 3W7RA 1F7BA 1O5KA 3JS3A 3GX9A 3UPWA 4LVAA 4XUGA 4JYFA 3IEBA 3C6CA 1JCJA 2QEZA 4QJ1A 1SZEA 2VEPA 1NVMA 4LC6A 1OFPA 3PULA 5BOOA 3AJXA 4MLJA 4K36A 1LOLA 4XTIA 3IIZA 2XN0A 4HNNA 5C2XA 4NJIA 1WOBA 1TQJA 3WJZA 1GVRA 5I3FA 4WOQA 4YCOA 4NNAA 3FYPA 3QSRA 5D33A 3BARA 3EWYA 4AWSA 3R8RA 5E93A 3UQNA 1AK5A 3B4UA 3NDOA 1W5QA 1JCMP 4NJJA 2Z0IA 3BGJA 2A2IA 2B0MA 3T4CA 2HS8A 2VOMA 1VPXA 4ADUA 1T99A 4JS3A 5FEPA 3EX6A 1MSSA 1I2NA 1OYAA 2FFCA 3VE9A 1TPEA 1HFBA 5KTLA 4O28A 3YPIA 4LVDA 2E6DA 1SO3A 1LRNA 2A21A 2OCZA 1LOQA 3G1DA 3EWBX 3HG3A 4TMBA 1RZMA 1OK4A 1XBYA 3A22A 1KA9F 4EIVA 4O17A 5DY2A 1JJKA 1ZALA 4DEFA 5EBUA 1OF8A 4AHQA 4FNRA 1B57A 1LDCA 3HGSA 2J6XA 1UCWA 1SO4A 2W79A 3RFAA 3T40A 1ZY9A 1VYPX 3BV4A 3IIOA 4UIOA 3USBA 1TJPA 3I7SA 3UPBA 1GVFA 4GUGA 5DCDA 3W7GA 3L5LA 4NJHA 4DBDA 2NWSA 3LCWA 2JGYA 4NU7A 2ZA3A 5IBXC 1ME8A 3CTLA 4E0CA 1H1ZA 2GPTA 1IF2A 3BW2A 1SZGA 3VI2A 1ALDA 3DKLA 3M5YA 1XXXA 1YDNA 3SSJA 2HS6A 4MZYA 5CPLA 1EX5A 4PFMA 5HWMA 3HGJA 5C55A 4JTFA 3UYCA 5AHNA 3NAVA 3OG3A 1K03A 2CZFA 3W2LA 2YFOA 3BG9A 3MWAA 3ABQA 3NPVA 1MEHA 1TYGA 2W6RA 4Q33A 1C9DA 1SPQA 5E1QA 4UNLA 1QPQA 3C2EA 3M9YA 5D09A 2RH9A 3KFTA 1IGSA 4KFNA 3QYQA 2PE4A 5G1YA 3O16A 1SZFA 3TU9A 1O60A 4IPIA 3FFSA 2Y63A 2ISWA 3L0NA 3T55A 1SW3A 1QO2A 1JQVA 2C15A 2TSYA 5TBOA 3KAOA 1TO3A 5G4WA 3GDKA 3NM3A 2C3ZA 2HTMA 2YX0A 4RKAA 4S2BA 1PIIA 1K02A 5AB3A 1Z48A 3N2XA 5FF4A 5DCBA 4LRSA 1FUYA 4DO6A 1WX0A 2RDUA 3V75A 3NA8A 4MY1A 1OFEA 3RNDA 5LKYA 4UXDA 3LHVA 1H60A 3UD6A 3SJ3A 4W9TA 1A50A 5ABTA 2DU2A 4IPJA 5AHFA 1RR2A 2C16A 3W1QA 4OV9A 3FKKA 4Y9AA 3HPZA 3GXTA 4RV8A 5BMXA 5HUOA 3LXCA 2YW3A 2PRLA 4LWWA 4Z0JA 3C2OA 3GNDA 4I7VA 2CZDA 1KM3A 3MP4A 4AWTA 4N9CA 2BWGA 1FCVA 4PTNA 5D03A 3E9AA 3TR2A 4TX9A 2QCCA 1XM3A 1F74A 1Q45A 4O12A 1SSGA 5HJLA 4XKYB 3LTSA 3BG3A 1W5PA 1P1XA 2E5DA 5AC6A 4FX7A 3CWNA 3LHWA 1OHLA 3STGA 1FBAA 3GR8A 3LOTA 3QQ1A 5CZ0A 3JR2A 3TCEA 1GPWA 1RD5A 3GAKA 4J9JA 2VEKA 4UFKA 1B3OA 3GXNA 1THFD 5G2WA 2QCNA 1VYRA 4O18A 3LTPA 3CLMA 3CM4A 3NL6A 2YYUA 4RXFA 2NLIA 5LGXA 1P0NA 4IX0A 5EMUA 1S5TA 4OE7A 3A21A 3QW3A 2ZZ3A 3W84A 3P7YA 5F1VA 4JTGA 2CLOA 3C56A 4Z1DA 3ATYA 2ZA2A 3S5NA 3NGJA 4O50A 4L4MA 3TH6A 3WK3A 2R8WA 3NPXA 1CX9A 2BXVA 5AYZA 5A8GA 1R30A 2X1UA 1MZHA 1NFBA 3A9IA 4CNOA 3E49A 2C19A 3LI1A 4CCCA 4JTHA 4PEKA 1OG0A 4UFMA 3R12A 3W23A 3VNDA 3RMJA 2TYSA 2PC4A 1AG1O 1KFLA 4FIRA 1QPNA 3BG5A 1VLWA 1PCWA 4MOZA 1G4TA 3FA5A 4AEOA 1FY6A 2A85A 1SR9A 1ZENA 5BRBA 3BGGA 3PB2A 2EF9A 2Y7FA 1I2QA 1YPFA 1M6JA 3PWAA 4M6QA 3P74A 1F76A 4FNSA 1TPDA 4PODA 2O7QA 2FB2A 4UTJA 1LYXA 1TCDA 2GVLA 3G1SA 3I65A 4UCGA 3F03K 1X8FA 2C13A 4LC8A 3LXBA 1W5OA 4FF7A 1OYCA 4G1KA 4ORIA 4DF0A 3M47A 3PF3A 1GVOA 1BEUA 1KTBA 3G18A 3LB0A 4RCXA 1VCFA 4UTTA 4K37A 3EX4A 4QNEA 1K7EA 3L0KA 1GTEA 4LS2A 2G95A 3STEA 3TXVA 3TFXA 2OT0A 1VGAA 4M7SA 4MFDA 2ZCGA 2OMAA 3LRLA 3P84A 1OFDA 1B4EA 1FCUA 3G8RA 1W8SA 2UV8G 2A4AA 3G1AA 3HOJA 1JRBA 4Y90A 1Z44A 4HSOA 2OJPA 1OX4A 4RLIA 3STCA 1SO5A 3LLDA 4QAIA 5I3IA 3LV6A 4N02A 4XKYA 1FQ0A 1K7XA 1A5BA 3LBCA 1W3NA 1H7NA 4UTLA 1GJPA 3SW6A 1OFBA 4ADTA 4FNQA 3TAOA 2AQWA 4MZ8A 4UMBA 5EKYA 3Q37A 4Z08A 1H51A 3TROA 1W56A 3C4UA 1WDWA 1JULA 3D0CA 3LBMA 1NEYA 2E77A 2ZRYA 3EWZA 4S2CA 1WQ5A 1XBZA 4ALDA 4X2RA 5LNVA 1QO5A 4FX6M 1H7WA 2NWRA 4JD4A 1MXSA 4ZQRA 4WUIA 1HL2A 4R33A 2ZRZA 4LUIA 2VFHA 4NJKA 2C1HA 3E02A 3W87A 4PH6A 1WV2A 5K9DA 2HMCA 2NZLA 5DY3A 2ABAA 3GKFA 5IBXA 4O52A 1SW0A 2ZRWA 4CQ9A 4E2BA 3TC6A 4OHQA 2QCDA 1P0KA 4MIMA 3FYOA 2G96A 5AN7A 1A53A 1A5CA 4N9DA 3BLIA 2AGKA 3DENA 3PC0A 2J24A 2VXNA 3M43A 3QH2A 5T26A 1I2RA 3B04A 3MI3A 5EY5A 2BSLA 4IXHA 1UASA 2CLKA 2CLHA 2PURA 3RU6A 3NVTA 3MI2A 3VFLA 3BPWA 4C1LA 3P5YA 4AF0B 1F6KA 4K38A 4AHOA 3N9SA 1LM1A 4CQ8A 1LCOA 2OT1A 3W7NA 3UZ5A 2GJLA 1LP6A 5DLCA 3I7RA 3KXQA 1S3HA 4NNCA 2QUTA 3M7WA 1I2OA 2CLEA 3KVLA 4DPQA 5KINA 2Y7DA 3EKLA 3NL5A 1R2RA 4IMDA 3QPYA 1OX5A 1G4SA 1VH7A 1VS1A 1QMLA 3PVFA 3GLCA 4FX8A 3IGSA 1WAUA 4MKNA 3W1MA 1YTDA 2Z6IA 4A22A 1VYSX 4M6PA 4YLWA 5LHEA 2PCQA 1JVNA 3W74A 3ZFHA 1KTCA 3TXZA 3VKJA 4DXVA 1HTIA 2B7OA 4JXCA 1A5AA 3W71A 1KLZA 2F84A 4TO8A 1I8JA 1YXYA 4GNJA 3B0UX 3TW7A 4RZ5A 1YXDA 3OBKA 3LX9A 2WSQA 2DJXA 2I14A 2GQ9A 4BI5A 4NT0A 1GG0A 3O6CA 1UJPA 3L0GA 3DHFA 1Z42A 1G7UA 3LDVA 5HWJA 3M5XA 1DJQA 1YDVA 1PVNA 3W72A 4GC4A 2CW6A 2VFIA 1OJXA 1YLVA 3WK2A 1ZAIA 2R91A 3HQ1A 5EA9A 5LHFA 3F1QA 1JCXA 2ZTJA 3QPZA 3NQAA 1H63A 3WJSA 3E12A 1MEWA 3M0ZA 3GVGA 4YCPA 1GZGA 5CZTA 3AO0A 3MBFA 3MMTA 1TJRA 3W73A 4UTMA 1JUKA 6ALDA 1OVDA 5I3JA 1W1ZA 1H7RA 3PUEA 3SI9A 2DZXA 4K7VA 4N9EA 3TQ0A 2TRSA 4JX4A 3I7QA 3WJWA 4FXSA 2YFNA 3M1ZA 4NZFA 2B7PA 3PBUA 1ZAJA 2V0TA 4O16A 2Y7GA 3PG8A 3T78A 3C61A 4WXYA 3Q94A 2B7NA 3BW4A 4MVAA 1F2JA 1PHQA 4LVBA 4IQLA 4UMAA 1ME7A 3S5YA 4O53A 3KRSA 2VENA 2ZA1A 1FCQA 2QDHA 1W31A 1W0MA 4LVFA 4PL2A 1TPC1 4RZ4A 4CNPA 4FIQA 3W76A 2ZZ6A 3W1UA 3MI6A 2NXGA 3IGUA 3W70A 4DF2A 2JKPA 3NG3A 1TPFA 2Y7EA 4QM1A 1QWGA 3W2KA 2NX3A 4WY0F 4WXZA 4R53A 5BW6A 2ATMA 3S1UA 3CU2A 2IQTA 5KITA 3ABRA 1VLIA 2G97A 3LHTA 1SSDA 3O8AA 4FXRA 1NF7A 1SFJA 5DN1A 5FI8A 4XTDA 3G0UA 2V5LA 4UR8A 5L9FA 3G3DA 3PB0A 3N9RA 4JY8A 1JUEA 4PL1A 1QCWA 4JTKA 1BTMA 1EP3A 2H6RA 2Q3OA 5D04C 3L67A 2A6NA 2Z6JA 5C5YA 5FF7A 2V5BA 2QAFA 2FIQA 3E96A 2ZZ1A 2RKXA 2FTPA 3W3OA 5DXYA 1TTQA 3DH7A 1KM6A 3W7QA 3PS7A 4HNVA 2ZZ7A 4ML9A 3HMJG 1XKYA 2V2DA 3A5VA 2OZ0A 1FXQA 4TU1A 4ZZ9A 1KBIA 3H53A 1SU5A 1O5XA 1OFAA 3FKRA 2WOQA 3PBYA 4WZHA 3GNNA 1EP2A 3MP5A 3O15A 3QW4B 1RVGA 4X3ZA 4BI6A 2J9ZA 5F1UA 4ZQNA 3TQKA 3WFAA 3GB6A 4UR7A 3OA3A 4UTKA 4GJ1A 1TPVA 1TV5A 1LZOA 5G2HA 2NX9A 2Q3RA 2DZTA 4E2DA 2NUYA 1EB3A 4O8RA 3W2UA 1FCBA 2A0NA 4AH7A 5TIMA 1TTPA 3UWVA 2VEIA 2EGZA 2C0AA 4HKPA 5D30A 3W07A 3LCHA 5F2GA 2W0UA 5D2XA 4FO4A 3TE9A 3HJZA 1TPWA 2E6FA 3TSDA 1EA0A 4AXKA 5CPMA 1X1OA 3NL3A 5FEWA 1LOSA 1F05A 3L9CA 4UTTC 3TAKA 3UWUA 1J2WA 4JICA 3NL2A 1B9BA 1DBTA 4UMCA 3KVMA 5U4NA 4ORMA 1DV7A 3L66A 3W1RA 1AL7A 1GVQA 4O1DA 1JQXA 3HF3A 4UC5A 3FIGA 3M5VA 3O6YX 2H8ZA 2Q8LA 1GVSA 4ICNA 1AW2A 1FDZA 1PL9A 2YXGA 3IV3A 5AHIA 1SUXA 2WKJA 3WK1A 1KM4A 5BMWA 2QCFA 4MFEA 1VHCA 2FPTA 5LSMA 2YCEA 4DBEA 1KFCA 4Z1BA 1CI1A 2GVJA 1KV8A 3LI0A 3UY8A 4OV4A 1I45A 4FNUA 4YWIA 3QSTA 3TIMA 1B4KA 5HINA 4PCFA 5DBUA 2PRMA 1YXCA 2ZBTA 3THQA 3GDLA 4IMEA 2EKCA 3PUDA 3SR7A 2J9XA 4M7TA 3UWQA 3MYOA 5HULA 2JK2A 2JKAA 5F4XA 3HPXA 3WK0A 1WXJA 4JDBA 3DXIA 5AHEA 1KV5A 4KKXA 3C3NA 3W1NA 5K9CA 2XN2A 2QCMA 4AHPA 4JYDA 5AC7A 1VC4A 2QUVA 3TDFA 4IXXA 1H5YA 5K7JA 3NQCA 2ZRVA 3W7JA 1F6PA 3Q58A 4IMFA 1N55A 1N8FA 3M41A 4JGDA 3W7KA 3G3MA 4ZL1A 2ZRXA 4JNMA 3LLFA 2QAPA 3DU0A 2X16A 4IWWA 5LZLA 1W5NA 1F73A 5BNKA 2HSAA 3NQEA 2Z2UA 5EPDA 2R94A 2WNNA 1VJIA 2QJHA 3OEXA 5SWUA 3S1WA 2CWNA 3VCRA 2E09A 2H3BA 3KRUA 3P67A 2X1SA 1NAL1 1UUOA 3N19B 1HUVA 4B5NA 5F4WA 1NF0A 2YZRA 2A7RA 3C2RA 4LV4A 1J5TA 3Q2DA 3SY5A 3LCGA 4UFIA 1DL3A 1A5SA 4PA8A 5D32A 2FDSA 3LV5A 3LHUA 5HNRA 3NM1A 1R2SA 1OYBA 2C6QA 4Q32A 1LLWA 2Y61A 1OF6A 3IRDA 4I7UA 3GXPA 3CIWA 2QCHA 1DORA 3KRZA 4UTWC 1SQ7A 4A3UA 4TIMA 2J9YA 1AW1A 1ZCOA 2VFGA 3QZEA 1TPUA 2E68A 2LLEA 1H62A 2XFWA 4TR9A 5C54A 3PM6A 1IIGA 2CLFA 3EEGA 1QNVA 4O54A 4XQ6A 3UXAA 4LUJA 3GDRA 2A7NA 1GWJA 5E0KA 3LHYA 3H55A 1S5WA 3NEVA 1SO6A 3TNOA 3W88A 5C6MA 4M5PA 4IOTA 1TPH1 2DZSA 3G1FA 3M44A 4L4LA 5DXXA 3B8DA 1L2UA 1WOAA 5F2MA 1LBFA 2QCGA 4C1KA 4EWND 1SFLA 4FNPA 1GTHA 4K39A 5TQLA 4RK8A 4NJGA 5HMSA 2E5BA 1WA3A 1P4CA 5FESA 3H54A 1YADA 1Z41A 3W7OA 5DBTA 1H7PA 1DVJA 3R89A 1D9EA 1BKSA 1OK6A 1IXPA 1EUAA 1W54A 2FLIA 4EVZA 1TV8A 1QOPA 1TQXA 1VCGA 3L5MA 3MO7A 2JGQA 3EX3A 3G8EA 3THAA 3NQ6A 4KFPA 1H7OA 3W85A 3B05A 4NNBA 4ZMGA 4JYEA 3S1XA 1I4NA 2EHHA 4Z0SA 3BLEA 1QDSA 1KW1A 3QC3A 3PG9A 1L6WA 3JRKA 4DF1A 1OABA 3LCIA 5FF2A 3W7LA 1YYAA 3TK7A 1DQXA 1UBSA 1GG1A 4OBTA 1G67A 3LGEA 2C14A 3C52A 4UFJA 2YPIA 4QISA 3W1TA 1GEQA 4QIUA 1QPOA 3LCFA 1L6YA 1TREA 3LCLA 1AMKA 5K9XA 2O7SA 3L2IA 2ZZ5A 4WD0A 1TRIA 4WJEA 1FXPA 3R2GA 2ZYFA 2P10A 4DELA 3ZWSA 3N34A 4H3DA 2QJGA 4LVGA 4JTSA 3EWUA 3W22A 3W7EA 3A24A 5DELA 3W2JA 5H2ZA 4I7WA 5LNWA 1QPRA 1V5XA 3GIYA 4LRTA 4LY8A 1FWWA 3BLFA 3U6WA 4Y6GA 2Q8ZA 3CB8A 1WBJA 4CLMA 3DKJA 5J5RA 1KBJA 1DQWA 1SZNA 5AC8A 2H8XA 4NXKA 2DP3A 4JIPA 3F4WA 1TTJA 3NOEA 2NXHA 3W7PA 1JR1A 3OVQA 1ME9A 5CG7A 1TPB1 5KZEA 4R7JA 3P8JA 3GDTA 3DHDA 2C18A 4ZQPA 3VE7A 5CGQA 3O05A 4N6FA 4JTTA 5CZSA 4O0ZA 4LW7A 1KLYA 5G1TA 4UNKA 5U7SA 4DO4A 3CPRA 4AF0A 4GUJA 5HWNA 3MJYA 3A23A 2E6AA 1EEPA 2H90A 3MBDA 3IVTA 4O4VA 2V9DA 3GYEA 4GUIA 1JCLA 3EX1A 4YXGA 3W6YA 4D2JA 1O95A 2CLLA 1YTEA 4N4PA 4HT3A 3SGZA 4Q4KA 2A5HA 3ATZA 1ZFJA 3QQ0A 1U5JA 3M5ZA 2GUUA 5CPNA 1ZHAA 5LNRA 1XFBA 5IM51 4KWWA 2J88A 2Y89A 2XN1A 5D2TA 1TB3A 3WJXA 3QMSA 5I3HA 1HG3A 3NQDA 4X22A 1HO4A 2QKFA 2JKEA 1FWSA 1PE1A 4FHAA 4AVFA 4O11A 4P61A 3I68A 2X2GA 5G5IA 2WV8A 3RK8A 3NQVA 5CKSA 5AYYA 4UFHA 2BTMA 2NX1A 4UUIA 3A5FA 5HUPA 1BWLA 4M6VA 2ZTKA 4GE8A 3TJXA 3DI0A 4POCA
chains in the Genus database with same CATH superfamily
4OWGA 3K1DA 4L6OA 1VKFA 1M53A 4K7YA 2OWWA 2REQB 3UVIA 3GNXA 3BSGA 2PDUA 1MFUA 2IQDA 4C6FA 1D2KA 4OT7A 3GAYA 4KRZA 4A8RA 4IPPA 5D37A 3GU1A 5EYWA 1JNEA 4A3RA 2F2KA 1Q2SA 2NQ5A 3NYZA 1WDRA 4A29A 1ZP4A 3W0KA 2XIMA 3HGOA 1FWEC 1LROA 2J8GA 1V6XA 3EB4A 2D2HA 4ZENA 3GVRA 1IXQA 4Q8MA 3W82A 1OEPA 4YTTA 2V69A 3HG5A 4JHOA 1KRCC 4IIGA 4B90A 2PBGA 3T7VA 5BXTA 3O3RA 3WL0A 5KMYA 4XIMA 2H3DA 2OYKA 3LU2A 4R7OA 3GNOA 1PKMA 2Y6ZA 3DFQA 4GQRA 2BLEA 3QBUA 3WQVA 4GVIA 3K4WA 2VVNA 4BF9A 3EWXA 4C91A 1UR4A 3W1LA 2BMBA 1ZRQA 2VM8A 2X09A 1PKNA 4Z42C 4R88A 3KHDA 1JDAA 2PTYA 3PUGA 2QPSA 4UWMA 3PJUA 3WQWA 1ISWA 5L6UA 3EXRA 2X2YA 1UZ4A 4GBUA 4AY7A 1T96A 3ECQA 2P0OA 2XWDA 3FJ4A 4EE9A 1JCYA 2YSWA 2CLPA 3Q65A 2QMKA 3RLUA 1TV7A 1P43A 3ARSA 4P2VA 1Q6CA 3KS6A 4GKTA 2DJLA 5A2BA 1RV8A 3AZRA 1XLMA 4BK9A 5E09A 1PSCA 3AYTA 1X1ZA 3H22A 3CUJA 4YPJA 1JUBA 3KLLA 1YPIA 4ZQOA 2WPBA 3TW6A 4JTJA 1Q8AA 3IJ9A 3L2LA 3W6MA 3NZRA 4KFOA 3NO3A 2VT0A 4CNNA 3INPA 1TWZA 3TV8A 2GJNA 1ONRA 2Z1KA 1MWOA 4NVTA 5C9ZA 2PDBA 5CC3A 1TIWA 3EA2A 3K2GA 1IHIA 2P1FA 5LA1A 4D8LA 3T2OA 4G5DA 4XD4A 1OX4B 2FPVA 3AOFA 2J8FA 3E2RA 4W8BA 2GVGA 1ZTVA 1DTUA 1ZBWA 3AICA 3BQ5A 1VAHA 3A4XA 2JBMA 3AMCA 3J7HA 1V3JA 4MWAC 1JI1A 4HMCA 4UQDA 4C7GA 4M24A 1CB2A 2PWGA 2AKZA 4JN6A 4K6AA 1IYXA 4YN5A 3F2CA 4R7WA 2TPSA 5EGRA 2Z00A 2Y62A 3S2MA 3VD5A 5F7UA 4W86A 3C8NA 3L21A 3W81A 4HOWA 1RXOB 1XLDA 3GNRA 2FZBA 3B9OA 1F61A 3NXLA 5JVLA 2ACSA 2PEVA 3KP1A 3PZGA 4XBSA 4CD4A 1C92A 1DOSA 2NV1A 3DBPA 1CW2A 2Z1WA 1FA2A 4Z2HA 3L68A 2WQDA 2UWFA 4LU0A 1B54A 3UJEA 4ROPA 1F4AA 3WN6A 3RYSA 1XCWA 1R3TA 1BF6A 1KFKA 2E28A 3TMQA 4DO7A 4NAFA 4YYCA 1UKPA 1DHPA 1B31A 2JEQA 5HR7A 3UWZA 3FEMA 1VRDA 4JQ2A 5DX7A 1LT8A 1FRBA 1CCWB 1DTNA 4HIBA 1M68A 1UIPA 5FF0A 3WEZA 1WKEA 3HPSA 4S1FA 3NO5A 4DO5A 1XLBA 1E0VA 5K4XA 1DXFA 3P5ZA 4HU0A 2B4GA 1H11A 3WF4A 4ICCX 2QT3A 3T8LA 5EMJA 2YCLA 1VBUA 4XBKA 2VTFA 3LEPA 5AVHA 3VD7A 1FDJA 2BVDA 1VFFA 2YGYA 4GC3A 2DDXA 3FAXA 3F7JA 3FS2A 2OO0A 1M7OA 2RFGA 2V30A 3CK5A 1DE5A 3T09A 2FFIA 2Y24A 3FGCB 1QNOA 2BX7A 4DHGA 1E6PA 2AQVA 2I9EA 1M7PA 1NOWA 3GFZA 1EOMA 4ZXOA 3K30A 5FAJA 3IJ7A 1E51A 5FKYA 4JIIX 3KHJA 2WMHA 3UBPC 2G3JA 4ZO9A 1EUNA 3A13A 1KCKA 3A4WA 2IPFA 4FLRA 4AMCA 3G6LA 3N2BA 4G6CA 3W75A 5C8BB 5I06A 4G7EA 2X1RA 4O13A 2VUYA 5LNSA 4K8EA 1Z69A 4ZGYA 3HGRA 3IUDA 1CDGA 5MF5A 1BVNP 3PBVA 4GQQA 5HQEA 3NPUA 3SZ8A 3ZLFA 3CYVA 5H91A 4DLMA 1L9WA 1EDTA 1DIOA 5BOFA 1N7KA 3FK4A 1IEIA 1EWEA 3HBLA 2V3FA 1V8EA 4FALA 2NXIA 1MVYA 1OX6A 4WGHA 1EL3A 3IJQA 2ASHA 1MQQA 5AZ1A 4XAFA 1K8CA 3QGAC 1GORA 4PMUA 1A5OC 4WSHA 7REQB 4CNTA 3AC0A 3Q67A 4BWLC 3DBNA 5CSSA 4Q8OA 4F2UA 1BQCA 4LF1A 4IH3A 2D24A 3WNLA 3V36A 4GYPC 4JX5A 3KZSA 2X1TA 8CGTA 1NWTA 1Q3NA 1T8XA 4OU1A 4O0KA 1XCFA 3SY8A 1JZ5A 1AUSL 3CHCA 1KFJA 2ATSA 3N3MA 2HPIA 2WBKA 4PTVA 2NQLA 5LXXA 4WX2A 4MDOA 3K4DA 3P2VA 1CGWA 3EKZA 3AHZA 1JRCA 3LRKA 1O6IA 2FGLA 2CLMA 4RDVA 2PP1A 5D38A 3U2ZA 1X6UA 4KCVA 3KTXA 2FQIA 3MW7A 2YB4A 2GSEA 1R2TA 4ADSA 2AL2A 3QEZA 4NZJA 4QLJA 4JEQA 4DNMA 3W7MA 5I07A 1POKA 2FZNA 2IKIA 4QNWA 4OTKA 1VCVA 5A6TC 3TSMA 1H61A 3UCDA 3UR8A 1XH0A 2P8BA 2DQXA 3WMSA 4IGHA 1UZ1A 4GQ0A 3EWWA 3WLRA 3G0SA 4PCNA 1G7VA 3E0IA 2W63A 4QG6A 2PTWA 4QBXA 4W93A 4JTQA 4ML4A 2ABBA 1FWTA 4WQ6A 1YQ2A 4GFSA 2GJXB 4GPNA 3ELFA 3W25A 3MC5A 2R24A 1K8ZA 2Z1BA 1T6MA 3KDOA 2FYMA 3OHMB 1Q6DA 2PF8A 2INZA 5E0CA 4OKDA 5HR6A 1QNSA 4REQA 1GQKA 4HJWA 4CN1A 3TFCA 3WLKX 2GDQA 1XSKA 3LLXA 2YXXA 4AEEA 1A5LC 3AU2A 2PDHA 2QR6A 3S2JA 1R46A 1GQLA 4GXMA 2QF7A 2WBGA 3WH8A 3P82A 1E6NA 6TIMA 4DWSA 3GW3A 1XRFA 2EPKX 2V5CA 4NAEA 3QM3A 2HXTA 4O14A 1XUUA 3OYXA 5M03A 1VBHA 4Q3MA 1F8IA 4A2RA 5AOUA 2DORA 3ITVA 4F79A 1KKOA 2VFEA 1SR0A 3UXIA 1DJYA 4F9DA 2Y8UA 4XZLX 4YJ5A 3GX9A 1KXTA 4U31A 4JYFA 3RJXA 3HA1A 2QEZA 4QJ1A 3QV7A 3N17A 1IV8A 1I1XA 2OWXA 5D8ZA 4C6JA 1OFPA 4XISA 4MLJA 1E15A 3PWGA 1MW0A 4LYRA 1JDEA 3GTFA 3LSBA 1LT7A 5C2XA 4G7FA 4GACA 4NJIA 1WOBA 3UNTA 2CERA 2PDFA 1UQZA 3C5QA 3QSRA 5D33A 1NIUA 5E93A 4UR9A 2XWEA 1AK5A 3B40A 1JCMP 5HDRA 2AL2B 2Z0IA 3BGJA 2B0MA 3T4CA 2VGIA 3H4XA 3QOMA 4WKHA 1L8PA 1T99A 6REQB 3DFYA 3EX6A 1J11A 2UY4A 1HFBA 1FHLA 2DIJA 2OGJA 3FVMA 1B9ZA 4LVDA 3BC9A 4HN8A 2E6DA 1A0EA 3I4KA 1EPVA 3EWBX 1EEXA 2QNEA 1XBYA 3IAPA 4QDWA 1BGGA 3RILA 1XRTA 4DEFA 2XFYA 1OF8A 2WMJA 1H2JA 3GRIA 1Q85A 4S38A 2ISFA 1XIJA 2J6XA 5IDZA 4C6MA 3PZUA 1GW1A 1C91A 1REQA 1AH0A 4GUGA 2GDVA 4H00A 4K68A 3W7GA 4U5KA 1KCZA 2NWSA 4PBGA 5HQMA 5FJIA 4NU7A 3V35A 5IHRA 1F07A 1WZLA 3VIHA 1W6TA 4PB3A 1H1ZA 1VIWA 3VI2A 4E8DA 5IXEA 1AVAA 1EXBA 2OODA 3SSJA 4JL1A 4ZOAA 3FVDA 2HS6A 3TN4A 3A6OA 5CJMA 1XLLA 1DEDA 3KBWA 3HGJA 3NAVA 2YFOA 3WLTA 4BQ5A 3AJ7A 5A2AA 5E1QA 4IIDA 3O16A 4ES4A 1O60A 3FFSA 4IPIA 2Y63A 2ISWA 5ECUA 1VJSA 3M0LA 5JQ9A 3H7RA 4U2ZA 1J96A 3H8AA 2YX0A 3RCMA 1PIIA 4OUEA 5AB3A 5GJMA 5DCBA 1DIEA 1EDQA 1NH6A 2ZKMX 1H60A 3UD6A 3CMFA 2DIKA 1I0DA 3KDNA 4W9TA 1JD7A 1KR0A 2HXUA 4IPJA 1TZZA 2C16A 3SQLA 2VNCA 4CU7A 1DJHA 1TKKA 4Y9AA 4RV8A 3WLIA 5HUOA 3LXCA 2PRLA 4V27A 1KBBA 3AMGA 4QCEA 3C2OA 4PUKA 4AWTA 3QR1A 1UWSA 5JIPA 2BWGA 4PTNA 3MSGA 2X7WA 1WDPA 4AYSA 3VIKA 3MV01 4OOZA 3TR2A 4TX9A 4O12A 1Y5WA 3VMPA 5A6BD 3LTSA 2G37A 3QKEA 4DRSA 1E1EA 2JQXA 3LHWA 1FBAA 1ENUA 3R11A 3LOTA 3VKCA 4NI8A 1GPWA 1RA5A 3GAKA 4J9JA 2YBUA 4F66A 4Z1YA 2OZ3A 4MHBA 2D20A 3GXNA 5C2GA 3CAVA 2PB1A 1CIUA 3CQHA 4KMQA 4A6GA 3IANA 3R10A 2QCNA 1FOBA 3ITGA 1AMYA 3CLMA 3NL6A 2OTDA 2X8RA 4EP8C 2UY2A 3OQEA 4AXNA 5LGXA 4PSPA 3QW3A 3P7YA 4GVGA 4JFTA 4L4OA 2QIWA 3SUWA 3S5NA 3IV8A 3TH6A 5LIYX 3NPXA 3PFRA 2XTKA 2I57A 3RLHA 4Y9OA 3A9IA 4CNOA 4C5YA 3E49A 4PEEA 4JTHA 4PEKA 3W23A 3VNDA 2TYSA 3TWAA 3UESA 3VINA 4ZE4A 3COTA 7REQA 1KFLA 1W1YA 3EAUA 1ZGDA 1PCWA 2HNHA 4MOZA 2NQZA 2H9AA 4AEOA 3REQA 2YB1A 2PZ0A 2ZICA 3SN4A 4R27A 2VP8A 3L4VA 4M6QA 3JU2A 1TPDA 3O0FA 4M6UA 4UTJA 4DUWA 4J3TA 2GVLA 4IZGA 2VUNA 1F3EA 3I65A 3F03K 1Q65A 3CV6A 3MDWA 2C13A 3GZAA 3PNUA 1NOFA 4PUEA 4FF7A 1OYCA 2PGFA 4ERIA 4DF0A 2OG9A 3MKVA 3M47A 3PF3A 1OG6A 3G18A 3L4TA 4TX8A 4D6IA 4QNEA 1K7EA 4DWDA 2G95A 1ZU8A 3VMNA 2CIPA 3SB0A 2J13A 4GNVA 1A0DA 2OVLA 3BJTA 4IUGA 1OFDA 3RX3A 3GUGA 2UV8G 2BNJA 2Y1HA 1K77A 1Z44A 1TA3A 2PWHA 1SO5A 5I3IA 4N02A 1W3NA 4TVUA 5HMEA 3SW6A 4ADTA 4FNQA 4MZ8A 4Z08A 1R3RA 1H51A 1W56A 3FSUA 4AD5A 3V4BA 4N7QA 2PLKA 4H9UA 4S2CA 3GTNA 1XBZA 1VPQA 2F2HA 4Z2JA 3H12A 2NWRA 2VFHA 4NJKA 3WD4A 3W87A 2VGBA 3PFMA 4F3HA 3CUGA 4JKMA 5LA0A 5K9DA 3EDJA 2HMCA 2HVMA 2NZLA 4WF7A 3B0XA 3OO2A 4ZB5A 2G4FA 4HYVA 4LJ3A 1SW0A 1FWDC 2ZRWA 1VBJA 4O0QA 4U33A 4E2BA 4OHQA 3N04A 1H1NA 3LENA 4JFUA 1DWFM 3DG6A 3WD1A 4V33A 3DENA 3PC0A 4H6EA 3UZZA 4EWJA 4JQ1A 1PUDA 2BSLA 5AZ0A 2D23A 9XIAA 2PURA 3RU6A 3BURA 4J1OA 4UZUA 1LG2A 3KOXA 1DXIA 2J47A 4AHOA 1YE4A 2DGAA 3UZ5A 4E4UA 4NNCA 1I2OA 1CXHA 4L64A 2X0YA 3KVLA 1UR8A 3BWWA 2PLMA 2POZA 3QPYA 3VDGA 5I6SA 1DJWA 6TAAA 3VZZA 1I60A 1MUMA 1I1WA 3FA4A 3ARYA 1YTDA 4JKLA 1XLCA 2YKKA 1FWFC 3KTSA 2GZXA 1X98A 4OBSA 2WNWA 2V38A 1HTIA 1H41A 4MB1A 1YXDA 4CQCA 3IK4A 1XIGA 4NRRA 5DQPA 5D4YA 3ZO9A 2PUZA 5EMYA 3I10A 2QGYA 2J7BA 1JFXA 1VP5A 3W72A 4GC4A 3EMQA 2VI0A 1OC6A 1U5HA 5E0FA 3EOSA 3NQAA 3E12A 5J04A 1OCQA 3M0ZA 3GVGA 3F5JA 3SN0A 2FHBA 3H70A 3E0LA 3CV2A 1EO7A 1V08A 1GNXA 4MB3A 3W73A 1J0IA 1OVDA 1W1ZA 4IF2A 4K7VA 1QWKA 4JX4A 4PRTA 3CUIA 2YFNA 3FA3A 4B9YA 4NZFA 2B7PA 1UD2A 1K9TA 1V0LA 4TTUA 3PG8A 4WJXA 3S1GA 3T78A 1QI5A 3BJSA 1H0IA 3CZJA 2DEPA 1FCQA 1W0MA 3AU6A 3WQFA 1TPC1 2PGRA 4WSKA 2BS9A 1QT1A 3W76A 1BVZA 3URAA 4A3HA 3W1UA 1BXBA 3NG3A 1TUXA 2FZ9A 3W2KA 5FAGA 4ACZB 5KITA 3ABRA 2G97A 4FXRA 3VNIA 3W6LA 2IMRA 4CN4A 3BMXA 3QY7A 2V5LA 5L9FA 3G3DA 1JUEA 1BTMA 4DJFC 4JFWA 4PUMA 2H6RA 2Q3OA 2A6NA 1XISA 5C5YA 1OM0A 1ZBKA 3E96A 3L7RA 4X60A 3W3OA 5DXYA 3DH7A 9RUBA 1BWVA 3S2LA 2OZ0A 1FXQA 4XZWA 4RNHA 2PF0A 1O5XA 5C9XA 1OFAA 2WOQA 1UA7A 4AY8A 3FAWA 1T7LA 3PBYA 1EP2A 3MP5A 5M3WA 4HOXA 4BI6A 4BQ4A 5F1UA 2Q02A 1JZ8A 4X9YA 3B8WA 1PWLA 4UR7A 3CV1A 2CNCA 5HNUA 1TPVA 4FLQA 1LZOA 1Y5VA 1UJQA 2NX9A 4PMZA 2Q3RA 2DZTA 5ABFB 3QC0A 1EB3A 3PZMA 4HU4A 1JGIA 4AH7A 1NWSA 4HNCA 2VEIA 1QW8A 4LBRA 2EGZA 3VYLA 1XWYA 2C0AA 1TR1A 3QFWA 4JBRA 5D30A 2W0UA 4FO4A 4KWOA 1CXKA 2GSHA 1RK5A 3TSDA 4FR6A 1NDYA 5FEWA 3L9CA 3TAKA 4UTTC 3OIHA 4L80A 1ZBVA 3QR3A 5D9PA 4XSLA 2XDFA 4XO6A 4UMCA 4JAWA 3W1RA 1QI4A 2INEA 3GSMA 1GVQA 1O7AA 4UC5A 4H9ZA 3M5VA 3VD4A 3NUKA 1XGZA 2HK1A 1UR0A 2Q8LA 4B2DD 1GVSA 5BRQA 1AW2A 1FDZA 3GH7A 3PJWA 3WK1A 5BMWA 2QCFA 3U4FA 3S83A 4QG9A 3GC5A 1KV8A 4JPGA 3UY8A 4OV4A 1I45A 1RVKA 3GD6A 3PK7A 4YWIA 1XH1A 3FV9A 1E6RA 3OU8A 1L0PA 3H2NA 4XD5A 3ZM8A 1TE1A 5DBUA 2PRMA 1BG4A 3EDKA 4DIAA 1V3HA 3GIPA 4MWAB 3R43A 1M3UA 3MYOA 2VDGA 2XH2A 1OT1A 3WK0A 5BROA 2X1IA 2POTA 3C3NA 3W1NA 4HSHA 1ZJHA 5K9CA 1HKJA 2XN2A 2QCMA 1CBGA 5TNVA 1VC4A 2QUVA 1XR2A 3M0KA 3TDFA 3GXDA 1IZJA 5K7JA 3CL7A 3T9PA 1N55A 1E9IA 5HAOA 3W7KA 2IW0A 3WBXA 2ZRXA 3WNOA 3LLFA 2QAPA 3M64A 2GFTA 1W5NA 3ARXA 3QGVA 2Y5EA 1XPGA 3QV9A 3AS0A 3CHFA 2HSAA 4PTWA 4DJFD 4B4HA 2XIIA 2WNNA 4L6HA 2QJHA 1ZL1A 2VGGA 2VR2A 2CWNA 3KRUA 3UETA 5KETA 1KCLA 3N19B 4PTXA 5HPOA 1B5TA 1HUVA 1XYAA 2J74A 3MV11 3ZT7A 3GVWA 2RDXA 3SRHA 2G3IA 1R2SA 1OYBA 1EYEA 4Q32A 1LLWA 1OF6A 3IRDA 4OBRA 4UTWC 4H7ZA 9CGTA 4E3TA 4TIMA 1AW1A 2MNRA 3SCQA 2YL8A 1IZCA 2E68A 3DYPA 1W9PA 3PM6A 3GDRA 2A7NA 5E0KA 3TQPA 4W8AA 1V0MA 3UVAA 4P8WA 3K1GA 2YBTA 3W88A 5C6MA 3VVGA 1NWRA 1AQFA 4IOTA 1TPH1 2DZSA 1ECQA 4I5XA 4LFYA 3LMYA 4QQUA 1S46A 4J3UA 1RD6A 3IK2A 1SFLA 3VKKA 1EF3A 2E5BA 2E4TA 4Z2KA 3H21A 2BODX 3H54A 1Z41A 1E0XA 3R89A 1HT6A 4DUVA 4Q7BA 4DNHA 3L4WA 1IXPA 3I6EA 1QJWA 1XFCA 4B4FA 1OBAA 4H9MA 1VCGA 3L5MA 3KBMA 2JGQA 1E1CB 1W9VA 5FSDC 3NQ6A 4KFPA 4RE3A 3UT0A 4NNBA 4JYEA 4H6QA 1I4NA 1WDQA 3ZR6A 4DBUA 2CKRA 3QC3A 5A6KA 1GOQA 1VFMA 1OD0A 1OABA 1YYAA 1HX0A 1S1PA 3C52A 1JYWA 4UFJA 3UR2A 2YPIA 3QN3A 3T07A 4G1NA 3ZZ1A 1QPOA 1XYZA 1L6YA 1TREA 1O68A 5K9XA 3G1RA 5I00A 3FW6A 3SCSA 4YTSA 4PMRA 1YBQA 3R0KA 2GUBA 2P53A 3R2GA 4TTGA 1AZ2A 5DO8A 1A5NC 3UYIA 4H3DA 2QJGA 4JIEA 4LVGA 4JTSA 3PBMA 4C7FA 3LA4A 1R0MA 3W22A 3UZYA 3A24A 3W2JA 1MW3A 4FA3A 1V5XA 2WKGA 3GIYA 1LL6A 3SQSA 2V63A 1XINA 4J3ZA 1DXEA 3U6WA 4MNKA 3CB8A 3PZOA 3HFTA 4B3ZA 2X7VA 3I3EA 1E43A 1KRBC 3DKJA 1SZNA 3CAWA 1M7XA 2DSKA 2E8YA 2H8XA 3UR5A 4MKSA 4A3QA 1XDJA 2DP3A 4JIPA 3EA1A 1TTJA 3W7PA 5I7GA 4BJHA 3R1ZA 2BGSA 3RX2A 1ME9A 3N9KA 5KZEA 4HK6A 4R7JA 5A6AA 1PTAA 4ZQPA 4DWSB 5FA5A 3ES8A 4JTTA 4O0ZA 4M56A 5AYBA 1LJYA 4LW7A 1KLYA 2WMKA 4AG0A 1OWQA 4UNKA 3CIVA 1U30A 5U7SA 4GUJA 4GGBA 3WELA 3B9NA 2YCLB 3MJYA 2XSAA 3VK5A 2E6AA 3MBDA 3VIMA 2V5JA 3LS9A 4JNYA 3W6YA 2Y4SA 3CO4A 4D6CA 4PB5A 3RITA 2EBNA 4C6CA 1ZFJA 3L2MA 1KGUA 1UYQA 2GUUA 4QS6A 2DZAA 4NP7A 3UF9A 5CPNA 1ZHAA 4KWWA 2J88A 1LG1A 2XN1A 7TAAA 3WJXA 4X22A 5C7VA 4S3AA 2HRWA 4GI4A 3S6OA 4X61A 4DI8A 4EANA 2O9RA 2X2GA 5G5IA 5H8MA 4WVXA 3SJNA 5AYYA 2WB5A 3WSUA 2F6UA 3M6DA 1UOKA 3MWCA 1OZQA 3RCNA 1BWLA 1P6WA 2Z26A 2ZTKA 3S2CA 4B5VA 3U57A 2GQ8A 1TMHA 4BA0A 1KB3A 2BHZA 4WY0B 3CC1A 5BZAA 3MHGA 2F7FA 4MNLA 3ZMRA 1MXGA 2PDCA 3M0VA 1WB0A 5KZDA 1ICQA 2WNQA 4DY1A 3QMTA 1PTDA 2JE8A 1Q6OA 4CEUC 3VIGA 3LNMA 3ISIX 4KBXA 3PZQA 4US6A 4JIQA 1K3UA 2WHMA 3DCPA 3CJPA 1JPKA 4E8GA 3WH6A 3EKGA 3TYCA 3N6QA 4HU3A 3HB9A 4CCDA 3PZIA 2OLSA 1V51A 4AIEA 3O63A 3IIXA 1X6LA 4H6KA 4H9VA 2OSYA 3BLDA 2R1LA 3VX1A 4O1CA 1QXLA 3ALGA 1K9FA 3DFOA 3EGJA 1WBHA 2HISA 1VHNA 2HEJA 4QE5A 4AZ7A 1TX2A 4BZYA 3EYPA 5BXRA 4C1NB 3UZWA 3AS1A 1LTDA 4GWEA 3TYBA 1E4IA 4D1JA 4QXIA 5F2LA 2PU1A 2RUSA 1H1YA 3VIIA 2YOCA 3IVSA 3CWOX 1P1MA 2E1WA 4MY9A 4RJEA 4JY9A 1BXCA 1LWJA 1PCKA 3DZ1A 4I9AA 4EF9A 2O4MA 3GE7A 3GM8A 4JX6A 1YRRA 2W5FA 1GJWA 3KCLA 4W84A 3M16A 1D3HA 4E38A 2VCAA 1MW1A 2GL5A 4KS0A 1JCNA 3EWDA 5JIWA 2G4JA 4D72A 2BHUA 1M03A 1OFQA 2VWSA 3S9YA 4BEUA 1A5MC 3G1HA 4R34A 1V7AA 4BS0A 3IUIA 4BR1A 3KEHA 5JMUA 3QQWA 4S3JA 2XYLA 4FR1A 1AD1A 1EJRC 1PHWA 4O19A 3CIXA 4W4QA 1BYDA 3NQ7A 5FF3A 2EG8A 4ZEPA 1NDVA 2J8TA 4WJ8A 3APGA 3OOQA 2AAMA 5D05A 4W7VA 1V93A 4H04A 3APTA 2B31A 2YDAA 4QP0A 1S2TA 3MP3A 5K2ZA 5CJ5A 3BCJA 1X1NA 3DEQA 4N9BA 3HIJA 2WSYA 2CBUA 5IOBA 3MKKA 1TRDA 1OCNA 2ZQ0A 4HHPA 2PDXA 3EXTA 1NSJA 2X40A 3C2YA 3E74A 3ZS4A 3VX0A 2NV2A 1VFTA 1JXKA 4JQ3A 3MHUA 3N6HA 1IE7C 4JDYA 4DPPA 1UWTA 1WO2A 3EPMA 3UA4A 2NUWA 2WCGA 2NSOA 1D8WA 1EC9A 1ADDA 1XBXA 3CEPA 2R82A 5EMMA 3E5BA 1W3HA 1PAMA 1DKWA 1O1HA 3DFHA 5FOOA 3OB8A 3SFKA 1XDLA 4OGZA 2DT2A 4EPKA 1IXNA 3NR0A 3HZ3A 3DFSA 4GUFA 3P8IA 1QTWA 1DIKA 3BAWA 3RR4A 1RJQA 1XUZA 2A1YA 5AHMA 1S39A 4B9ZA 1QI0A 3MSYA 4CVUA 3OVRA 2CXEA 3RM4A 2OXNA 5G4EA 1S5NA 3PWIA 3S1VA 2DZVA 3W01A 1ADOA 2PDNA 1ISXA 1DWHM 1IIHA 2DUXA 2F61A 2QUUA 2DSZA 3TC7A 1H49A 4HZ7A 4XD6A 3G77A 3KOFA 3EWCA 3MSRA 4RNFA 2VFFA 3KOZA 1EFZA 4IIBA 2Y88A 4PCTA 4OUIA 4AZ6A 2A3HA 2PSNA 4LSBA 3T4WA 1OFOA 3KL3A 3KUMA 3OHIA 3CHVA 3VNYA 3WX7A 4LOCA 3ZR4A 2CZEA 5D02A 1QPKA 1DWGM 3GR4A 2OEMA 3K8LA 3VKAA 1C29A 1XDMA 3F4CA 4F0SA 2BG5A 5XIAA 3UXKA 3AI0A 1BD0A 1VEMA 1B1YA 2GJPA 1TIMA 1UQYA 1E6XM 4C6DA 4N42A 4HNTA 2PDIA 2E5CA 2V5DA 2VRJA 1XCXA 3ZVIA 3TA9A 2AMGA 4CGTA 4MUZA 3SADA 2BVYA 4I8YA 1X7FA 2VKZG 4HQVA 2QVHA 1R9YA 4DVOA 2YR1A 2EPHA 2OYLA 4DAFA 3C0QA 2HDJA 2IPJA 4ZVJA 3W2MA 3KTCA 1T41A 3TJ4A 5D2YA 3OIXA 3MKCA 1R87A 5C7HA 1HO1A 4FK9A 1VB9A 2PS2A 3W83A 4LYKA 3BK0A 4M51A 4ZXLA 1RQHA 3IIPA 3WUBA 2Q71A 2YYTA 3MT1A 2P50A 2G41A 2GK1A 3TJIA 2D2JA 3THCA 3WBAA 2VEMA 1EZ2A 4Q6XA 3O06A 3QKZA 1W37A 1ZAHA 1C8VA 4G2DA 3OBEA 1US2A 3FHAA 7TIMA 1HVXA 3MUZ1 2XM1A 3G22A 1R3SA 2EQDA 2VZTA 4H2HA 1VR6A 1ZNNA 4B16A 1VZWA 4AAJA 5C9UA 1Q6QA 3TLQA 3OLDA 2OZTA 4Z1AA 3FXGA 4I8DA 2ZUTA 4LUSA 3A4JA 3F2DA 1ML1A 3H4GA 5CSRA 1SW7A 5CPSA 8TIMA 4XWUA 1TWSA 3TYAA 4W7WA 2CFFA 1VEPA 1G6CA 3S6DA 4CKQA 2V67A 4GCXA 4P7OA 1W5MA 3BLOA 1YEYA 3U8GA 3ITXA 1HJWA 2RHGA 1KTNA 3FX4A 5DCEA 3DX5A 2R1NA 1QUMA 1E9ZB 5T9CE 3OQ8A 5JBFA 2YIHA 3G1XA 3MVTA 4Q8QA 3V1PA 1UKTA 1PZ0A 2VZOA 3F4NA 1W9XA 4IIHA 4RZ6A 3H26A 1JYVA 5CPOA 1EZWA 5HNNA 2OSWA 2Y85A 4MJ4A 3A3HA 3VCCA 1UPMB 4FNTA 1CPUA 1JL8A 4IMGA 1DJNA 4IHCA 5LNUA 3LM7A 1YDOA 2ZIDA 1W3IA 5A8PA 5DT7A 4ZTXA 5CC5A 1EO5A 5D2WA 1AQ0A 2DW7A 1K8XA 2O0TA 3TR9A 4Q7IA 3WG6A 4TQTA 1XL9A 2ZFAA 4O15A 1US3A 4UTWA 5BU6A 2TMDA 3TCSA 1PXGA 2ZUNA 3TX9A 1AODA 1KGWA 1BAGA 1UWUA 2Z4GA 4HTYA 1VQTA 4PMQA 5ECVA 2CITA 1XC6A 5B80A 1ZS2A 4JTEA 4TV5A 1CXFA 1BYCA 4J40A 1BRLA 4C5ZA 1E4LA 3LPOA 4JIHA 1EPXA 3R5EA 2VOTA 3NQBA 3CASA 3NNTA 3UNDA 1OADA 2YXOA 3NQ8A 3QMRA 3WUGA 2YCKX 1M5WA 3B0PA 4NUWA 3GXIA 3W7RA 1F7BA 3UFYA 1QHOA 3UPWA 4LVAA 3MUY1 1E6ZA 2QIIA 3TTSA 4XAGA 2OB3A 1JCJA 3DG7A 5FJUA 3R58A 4JFSA 3MDUA 2PTXA 1NVMA 2BB0A 4LC6A 2WLYA 3U2EA 2IPGA 4GOAA 2DIEA 4P7NA 2WHKA 4XTIA 3IIZA 1CECA 3CHDA 1KXHA 5EU9A 1U2YA 3JVAA 4KEUA 3WLNA 3ZJ6A 1B30A 4O1FA 3BARA 4D1IA 1ZBCA 6REQA 4AWSA 2CKSA 2W91A 3EMCA 4GVFA 1UMYA 1S2AA 1HQTA 2J62A 1WAWA 1QK0A 2A2IA 3TVAA 4MKVA 2DVXA 5FEPA 5CGTA 1OYAA 3VE9A 1TPEA 3T0CA 3VGGA 2PODA 5KTLA 2FVLA 4D8AA 5CPTA 1EQPA 2XVNA 2A3AA 1EKOA 3HG3A 4DI9A 3IUHA 1Q63A 3BLKA 3CZ8A 1RCQA 3A22A 1EJVC 5DY2A 5I02A 4QS5A 1B57A 1LDCA 1JAEA 1SO4A 3RFAA 2QMJA 3BL3A 4H8NA 4Y8EA 2O4QA 2JEPA 1TV3A 4UIOA 3WD0A 1FFQA 3E2SA 4PBFA 2QJNA 5DCDA 2DUAA 4NAFB 1Q6EA 2WMFA 3LCWA 2ZA3A 1ODUA 4GVHA 4E0CA 2GPTA 1ALDA 1AJZA 1YDNA 3F2BA 2B81A 4QR6A 4MZYA 4EPEC 3CV7A 1GVIA 2QDEA 1O1ZA 5HWMA 3TC3A 5C55A 3B8UA 5AHNA 3W2LA 1RLCL 3MWAA 1CLVA 1XLAA 3NPVA 2DW6A 4ASTA 1FWAC 4Q33A 5EMKA 4DXKA 4UNLA 3FN9A 5D09A 2ONEA 3KFTA 4GG9A 4RZBA 3VZXA 2PE4A 5G1YA 4N0RA 2WMIA 1WDDA 1SZFA 2FZDA 4L61A 2GWNA 3TU9A 5CAHA 5DMYA 2C15A 2TSYA 5TBOA 2OLHA 5CXPA 4IP4A 2PLCA 1KRAC 3H7UA 3CXOA 1OGGA 3CZLA 2VRQA 4LRSA 1WX0A 1KR1A 2WMGA 2RDUA 3NA8A 4HA1A 4FXFA 3RNDA 3UGRA 2GJXA 3PPFA 3SJ3A 3WYZA 3M0MA 4TV6A 2FKPA 3RPTA 3HN3A 5I78A 4LUYA 3S5SA 3FKKA 4GX9A 1PBGA 4PULA 4KCUA 4KRUA 3FGCA 1AD4A 3GNDA 3HV8A 4I7VA 4B5XA 2BV9A 1YIXA 7ENLA 3SRFA 3QOKA 5IDIA 3JZEA 2VURA 3E9AA 1OC5A 4WRHA 2GWGA 4WR3A 1SSGA 4FOJA 2DUZA 3RXZA 4BQ2A 4XKYB 1W5PA 3DN5A 4FX7A 2VD8A 1E56A 4F4RA 3STGA 4GINA 4M82A 3E6EA 6PTDA 5CZ0A 3TCEA 1RD5A 3ZSTA 1UD3A 4UFKA 3MANA 3LPGA 1WP6A 4AC1X 2WYSA 5IFTA 5G2WA 1GOKA 1VYRA 4O18A 2PI6A 4XVEA 4TX6A 2YYUA 3ARUA 4RXFA 3GHRA 2UZ9A 1P0NA 1Z9AA 3E3HA 1XLKA 3A21A 1L6GA 5F1VA 1GZJA 1PX8A 4Z1DA 3NYDA 4L4MA 4PUUA 3SURA 2X1UA 1SFSA 4M1RA 3HURA 1W32A 4JL2A 1PKYA 2PDMA 3R12A 1V02A 3RMJA 2A85A 2XZ7A 1E0TA 3BGGA 2WVSA 5BYWA 3BANA 4W5UA 5FJJA 1CXIA 1M6JA 3W26A 4FNSA 4Q8UA 1M04A 4PODA 4KEZA 2O7QA 2P3EA 1TCDA 1Q6FA 3LZ5A 3U7BA 3G1SA 3VOHA 3QHOA 7PTDA 1X8FA 2XIBA 4GI8A 4HB7A 1GVOA 2DT0A 2YL9A 4RCXA 4KGJA 4IQDA 2ZWYA 3STEA 3V0UA 2OT0A 4M7SA 4HVXA 1XYCA 2ZCGA 1V3LA 2OMAA 4CD6A 3BTNA 3P84A 3U7VA 4U2YA 1W8SA 2A4AA 2WZIA 1LWHA 3BGAA 2JIEA 2OJPA 1OX4A 4RLIA 3V7PA 4LEFA 3V3WA 4LNCA 4ZTYA 1FQ0A 1K7XA 3LBCA 3LGDA 1H7NA 4C6OA 1GJPA 4GISA 3OG2A 3IJ8A 4MTVA 2W61A 3Q37A 3TROA 3C4UA 3V1HA 4V1XA 1NEYA 2QQ6A 3EWZA 1U1JA 1WQ5A 5T9BG 1OT2A 4FX6M 4JD4A 2HNEA 1JFHA 1GKRA 3OYZA 1MUCA 2I17A 5D8WA 2ABAA 3GKFA 4QJ5B 4D6HA 3JZUA 2CESA 1WZAA 1HN1A 3TC6A 4GFIA 3ENLA 1PIFA 3VIJA 3ITCA 2AGKA 1WXYA 2PA6A 5JU6A 2J24A 5BXPA 2VXNA 3M43A 4Z2LA 1XP3A 3MI3A 5EY5A 1UASA 2CLKA 4YVPA 2CLHA 1W9DM 5PTDA 3VOIA 3V0SA 1V6UA 3MI2A 3VFLA 4C1LA 3WQCA 4K38A 3T2QA 1VRXA 3W7NA 5DLCA 3KXQA 1S3HA 2QUTA 3M7WA 2PFHA 5KINA 1HGWA 1R2RA 1G4SA 1VS1A 1QMLA 2J78A 3GLCA 3PVFA 4GA8A 4AZIA 5HNTA 4IFRA 1WAUA 4MKNA 3W1MA 2IS7A 1VYSX 4YLWA 2WVUA 2W3ZA 3BQ6A 1JVNA 5DMMA 3WFLA 3W74A 3ZFHA 1DE6A 1KTCA 2WXDM 3VKJA 1R38A 4TO8A 3AXHA 4DZAA 5EFFA 3LPFA 3OBKA 2WSQA 4BI5A 1EGZA 1U33A 1US0A 3O6CA 4UQBA 1NU5A 4GK8A 2QLYA 1UJPA 4S3CA 3DHFA 5REQB 5I77A 2PDQA 1G7UA 3LDVA 3CUXA 3M5XA 1YDVA 1PVNA 3WDIA 1CLKA 2R91A 4HZ6A 1XPYA 2ZTJA 1QW7A 3B3DA 1QI2A 2J66A 3DHPA 1MUWA 4J5NA 4ZOBA 2EKGA 5T91A 3MMTA 1AJ2A 3TOPA 1EC8A 4UTMA 1E71M 3SI9A 1H7RA 3TN3A 3EPOA 2UY3A 3WJWA 2J79A 3URNA 3AFBA 1AQHA 2TAAA 3M1ZA 3PBUA 1ZAJA 2BVWA 3L4YA 4IP7A 3WY1A 4LCSA 4MVAA 2B7NA 3Q94A 2BY1A 2DVUA 3KRSA 3OZYA 3LK6A 3AXIA 5H1WA 3G2GA 3W38A 4LVFA 3M0XA 1E5JA 1K6WA 3TZFA 1HL9A 4M8UA 3DDMA 4HPNA 4CEXC 2JKPA 3P6LA 4QM1A 2NX3A 3UU0A 3BUVA 3S1UA 4IGNA 5FL1A 3PTDA 3CU2A 1VLIA 3LHTA 3O8AA 8XIMA 1SFJA 3BCDA 5DN1A 1FWIC 1YPXA 2WC4A 1UOZA 1A3XA 3EA3A 1N82A 3SQMA 2E25A 4C65A 4HYWA 3PJXA 1EDGA 4UR8A 1L8NA 4PL1A 1QCWA 1TA3B 3AXXA 3B97A 3QGKC 1W1TA 5GJNA 2Z27A 1WCGA 4ML9A 2EPOA 1XKYA 4D6FA 3WH9A 4A35A 4U3AA 1KBIA 3ZT5A 1K6AA 3H6OA 4L1GA 1TCMA 3H53A 2FHCA 4ZBCA 3RR1A 3FKRA 2KX9A 4XB3A 3QLLA 2C79A 3GNNA 4GIYA 3QW4B 4ZQNA 4HTBA 4YIWA 1R3QA 3T1GA 4XZHA 4Y9PA 1HP4A 2FVMA 3EEZA 4DYEA 3FDKA 5BCAA 1KQZA 3A47A 3AALA 4E2DA 4O8RA 2VYOA 5TIMA 1TTPA 2YA2A 4HKPA 3CB3A 5F2GA 3HJZA 2DSVA 2VZSA 5CPMA 3Q45A 1MI3A 1LOSA 4OVXA 4AW7A 3QZAA 1J2WA 4JICA 3NL2A 3OZOA 4BQ3A 1DBTA 3KVMA 3H2MA 1UBPC 1CT5A 3L66A 3WLSA 1AL7A 4DYJA 5CLWA 3FIGA 4WIWA 3N12A 4DBSA 2H8ZA 3OZPA 2PLJA 1YNPA 1RUSA 2DT1A 2YXGA 3PTQA 1KM4A 4LY4A 1VHCA 2FPTA 3GU9A 4Z1BA 1VFSA 1OZMA 4M81A 3ID7A 4MMWA 3IJIA 5I0DA 3THDA 3QSTA 4ZCWA 4W8LA 5HINA 1XIBA 3VUPA 2XGIA 2ZBTA 4BF7A 1ECEA 3SR7A 4M7TA 2FTYA 2VEGA 5HULA 5F4XA 1SFTA 2Y2WA 2Z1XA 5CEWA 2VJXA 4NKCA 3OGRA 1KV5A 3VPLA 1BPLB 3A4AA 2G3MA 1MQPA 3UP8A 1H5YA 3NQCA 3IJDA 2ZRVA 1Q2RA 2J75A 3Q58A 3VOFA 3TP4A 3G3MA 4L6DA 1VEOA 3BV7A 2X16A 2PGEA 2DT3A 3NQEA 1JPDX 2R94A 1VJIA 1ZJAA 3VCRA 2GGEA 2E09A 2H3BA 3BAIA 1QHZA 4R9XA 1UUOA 4IPNB 5F4WA 1TWWA 2P76A 4HMDA 1K9EA 3AYVA 1C8XA 2XSBA 4LV4A 3Q2DA 3SY5A 1MXDA 4LAZA 1DL3A 5HQLA 1E73M 4PA8A 5D32A 3GG7A 3LHUA 5E70A 3T05A 1KGXA 3GXPA 3NO1A 3CIWA 3KRZA 3RJYA 3AIRA 3RAOA 3N2CA 3MU7A 3MPGA 4LBSA 3VDHA 3WDRA 3C86A 3NWRA 4WKFA 4RE2A 3WUEA 4A3UA 1CNVA 3MJMA 2J9YA 2A3LA 2PWEA 2EJ1A 4H8HA 1J12A 3TYUA 2WZHA 4ZA0A 4RE4A 1TPUA 2LLEA 2R1PA 1GEHA 4YTQA 2XFWA 1IIGA 3AZSA 2CLFA 3EEGA 3UXAA 3W27A 5H6HA 3U3HA 2W27A 1SO6A 4PMYA 3TW9A 4M5PA 4H9TA 3WQ5A 1HP5A 1F3XA 1LF1A 4L4LA 1GZ1A 3R0DA 1KO0A 1V6TA 4YTUA 2WSKA 4K39A 1GTHA 1XYBA 4F9JA 1P4CA 1H7PA 3A12A 4L4PA 3SCWA 1D9EA 4ZSTA 3KOYA 1MDLA 1EUAA 2X42A 1OC7A 1QOPA 4HK5A 1BRLB 3PZNA 3MO7A 3EX3A 3THAA 1H7OA 2EPMX 3W85A 3IS4A 2C1IA 2V68A 4ZMGA 4JQAA 4AIOA 5FL0A 3SCPA 1XQKA 1KW1A 3PG9A 3JRKA 4DF1A 5I23A 3GO2A 1ITXA 5FF2A 1XRSA 3ZYZA 3FEQA 4QISA 2OU4A 4I3GA 3W1TA 1R3YA 1GEQA 2D22A 4L9YA 1DIDA 3NSNA 3DYMA 3LCFA 3GVQA 3GBDA 4PCPA 4IGMA 2KAUC 1UWAA 2O7SA 3VDBA 4UQCA 3QY6A 4WD0A 4J27A 4FOUA 1OCJA 1YHTA 1FXPA 3I6TA 2ZYFA 2OLAA 3ZWSA 3N34A 2PP0A 3WF1A 4L1XA 4Y9NA 2XFFA 2OQLA 3W7EA 5DELA 5LNWA 4J28A 5H2ZA 4OFCA 3CQKA 4K3ZA 3SSZA 3RUBL 3PANA 4LRTA 1FWWA 2HBVA 1J10A 4Y6GA 4G9PA 4CLMA 2FH8A 4PN2A 4D6DA 1IGWA 3OW1A 2F8QA 3BAXA 2ANUA 5G1MA 3GDBA 3P0XA 4NAEB 3P8JA 3GDTA 1XIDA 2C18A 1LUCA 5EFDA 3WF2A 4YYFA 4I6KA 5CGQA 1D3CA 3WD3A 1E9LA 3TNBA 4EXBA 3BAJA 2P8CA 3NOYA 3CPRA 4AF0A 3VNKA 3VO0A 5HWNA 2FGBA 3A23A 1EEPA 3IVTA 3VCNA 2V9DA 3CAQA 1RAKA 2WWDA 1JCLA 1UKOA 4YXGA 1O95A 2IKGA 1YTEA 4N4PA 2HWGA 3AHTA 3GXMA 2HCVA 5HPCA 1IZKA 1PDYA 1DWIM 4LUTB 1BHGA 3BE7A 3GS6A 2EO7A 2DFAA 4CU6A 4LEQA 2ZVRA 1WNOA 3S4TA 4UQAA 4GZ7A 2NQ9A 1W91A 1XFBA 3VKDA 2OO6A 3DERA 4DWSC 4F0KA 5I3HA 1VFUA 3UR7A 3LSCA 1EJXC 3VD3A 1PE1A 3URQA 4HP5A 1P7TA 2AOSA 1YX1A 5CKSA 2CHNA 2QULA 4QX4A 3A5FA 3AIUA 5HUPA 3CLWA 4P7LA 4M6VA 4GE8A 4WDUA 4HA4A 2GSJA 8A3HA 4POCA 4E5TA 1PPIA 4ATLA 1QR7A 5CCZA 3BLPX 4G7EB 3NQMA 2MANA 4LF2A 3CQ0A 2FZMA 4O1BA 3GG8A 3GU2A 5KZMA 4W85A 1MO0A 5A8MA 4ERGA 2ZADA 4GXWA 4B5UA 2OFJA 1KRMA 3EX2A 4US5D 1ISVA 4KWVA 3KBVA 2BZNA 2PBOA 1R85A 3NPWA 4NXSA 2VR5A 1BYAA 4QSHA 3W1XA 4RW3A 3WDQA 3BLLA 3LYEA 2A3EA 2I1OA 4C6IA 4MJ2A 4EAMA 2WANA 1UR3M 4BKNA 4KRTA 3PBWA 1T0OA 4BWLA 3O7UA 3LZ3A 2VL4A 4LS1A 2VHLA 4B91A 4A2SA 3N14A 1NELA 4O1AA 4KCWA 1XH2A 2NT1A 2XH7A 2X30A 3P60A 3GTHA 5DRIA 1B3ZA 4KQNA 1Y5XA 2OOFA 3VOJA 4DQWA 4K8HA 3MQTA 5KSWA 1O4UA 1YW1A 1P5BA 2BGQA 4IQEA 4JTCA 2QPXA 3KL5A 1FX6A 1HJUA 2Y8VA 5J5DA 4MY8A 3VOCA 4B5SA 2BY0A 1UZHA 4M19A 1C7SA 2ZUVA 4QQ3A 1AL8A 4IX2A 3MYPA 2WMIB 1DJXA 1XG4A 1FWRA 1GGOA 3S42A 5BRPA 1R9XA 4MJZA 3P61A 2BY2A 1IWAA 1LQ2A 3BO9A 3ZIZA 2W62A 4BI7A 4CQDA 1PX3A 4F2TA 2ZX8A 3T6CA 3RM9A 4TVCA 3RHGA 4LAUA 8RUCA 1W3LA 2GVYA 3NDZA 4MJMA 2KZHA 4UCFA 4AWEA 4EACA 4GYPA 4RX0A 1G69A 4H7VA 1XSIA 2ISSA 4Y9MA 1EIXA 2CLIA 2QCEA 4DJDC 3O6DA 1JZ6A 3O2LA 4PMNA 3SGUA 2E1DA 3G6MA 4RXGA 3EDEA 2C71A 3ZLGA 5F2IA 4MDPA 4JCMA 3I4EA 1XF0A 4CD8A 3GK0A 2VX6A 3W7HA 2YCIX 1Q4WA 3BW3A 3PUOA 4HMNA 1Q4NX 3NZ1A 5DEZA 4LTSA 5C71A 3S3GA 1UIOA 4IUOA 5MHBA 3SBFA 4X2PA 4WY0A 1TSIA 4DJDA 3RDKA 4GIEA 3AXMA 1DWJM 1RBLA 2Y5JA 3BCFA 1EHAA 3ARVA 1V3KA 3DI1A 4GD0A 3WJYA 1XC4A 4YVXA 2C1GA 2FMNA 3POHA 2E6YA 2OOGA 5HOSA 1OB0A 1QAPA 3C2FA 3UCCA 1DHKA 1G5AA 2YA0A 1DJGA 1RA0A 1IEWA 1JZ2A 3ZSSA 3MUCA 1GPFA 3L5AA 2BXYA 2CC0A 2WO5A 3AISA 4U10A 1RQEA 4PUJA 4X0NA 1CGUA 3DECA 4XZBA 3O07A 2V8ZA 5AFDA 1ITCA 2FJKA 4P5UA 1H7XA 2J77A 1F3WA 1SMAA 2Z7GA 1U5VA 2Q01A 2YLLA 1P0DA 1IR2A 3KVKA 1W1A1 3QFEA 2A6LA 1AFSA 1U83A 1J2BA 4LV9A 3MUXA 1XBVA 2YDQA 3PTKA 3TMLA 1VD6A 3AWNA 3FOKA 3UG5A 1L6SA 4M0XA 1XIHA 2RDTA 3NQFA 2XINA 3LRMA 3MUAA 2AAAA 1XLFA 3LTYA 4A8LA 3GG1A 5CZKA 3KVJA 4H41A 3TTYA 4KH2A 1ZJIA 2WC7A 3U2CA 3D3AA 1Y7VA 3VKBA 2IQ0A 4GNKB 8XIAA 1CGYA 2V81A 4FB7A 1EP1A 4XIAA 1B3VA 1P0EA 1QATA 3V5FA 2WPGA 1JPHA 3AHXA 4AB4A 3KBNA 1V3MA 3Q4DA 2X41A 4IP5A 3GBEA 3SO7A 2Z29A 4FI4A 2Y70A 4Y96A 2CYGA 4NL1A 1K9DA 2XGZA 4I9TA 1LRQA 4JR5A 1UP3A 4LANA 4KF1A 3FJLA 4O8AA 4Q6JA 1E70M 3UCQA 3T0TA 1EBHA 3BZJA 3HV9A 3FXYA 4N2YA 2XG9A 4HNUA 2D3LA 1SGJA 3VIFA 3TLLA 4JTUA 3B9AA 1RQBA 4O57A 1Q66A 2D73A 2WVVA 3MMDA 4ONVA 3TSBA 4PUNA 2J7HA 4WHBA 5F4SA 4GRSA 2CBIA 2E7FA 3BSHA 3C0SA 4HN4A 3G1VA 4NQ1A 3RF9A 2VC9A 3GHSA 5FEXA 1HJQA 3R25A 3PY2A 3LXAA 1E5NA 1GOOA 1JNDA 3RLVA 4IFOA 1F5ZA 4AIBA 4CQAA 1I2PA 3VU2A 3NQ2A 1UWRA 4OOUA 2A3BA 3D46A 1EIBA 3K13A 4WLCA 2VFDA 3HG2A 1EGVA 2V2CA 4WGXA 2OSXA 3VNZA 3MHFA 3VGFA 2XSXA 1O12A 3FJ6A 4WCJA 5DT5A 4P8XA 1PYMA 1KFEA 3GKAA 1ICPA 1UA3A 4ECLA 2WWCA 3VNLA 1AW5A 3M46A 5CJNA 3W7CA 1J4EA 1TTIA 3S47A 3S8HA 3VZYA 3T8QA 4D6GA 5CH9A 1HJVA 4UQEA 1K7FA 3HG4A 4H4IA 3A9BA 3QRHA 4PUDA 2XM2A 3SIZA 5I3KA 4CD5A 3NXFA 1Q6RA 4Z1CA 2CCRA 4W87A 3WNNA 2ZWZA 3C8FA 1S2CA 4GYFA 4DJDD 1LBMA 1XI3A 2FPYA 2O9TA 1D3GA 2V6AA 3B06A 1V4YA 4PC8A 1CLXA 1MFVA 3UY7A 4HPHA 1BWKA 3EB2A 2GOUA 3PSWA 3IARA 1FFRA 2E9LA 3PSVA 4M29A 4WDWA 1ISZA 1UD5A 2VZVA 3N2MA 2WJDA 4ZE5A 2BASA 2XPKA 3G0XA 2NV9A 3ABXA 5LIUX 3T44A 4FP1A 1OSEA 2YDRA 6ENLA 4F40A 2QVNA 2D0GA 1XIMA 1W3TA 1CXEA 1GCYA 4UTUA 4AZ5A 3PPCA 2ZRUA 3GH5A 3I6RA 4GJIA 5CBIA 3SFWA 2O92A 4MZ1A 2OKOA 2VRKA 1A80A 3S0CA 4C6LA 3K8KA 3XIMA 1VPYA 1W2VA 1MQRA 3TA6A 3STFA 3UZJA 1GHRA 1QOQA 3W1PA 1UMLA 1V79A 3TQVA 1EQCA 2ISVA 2J7DA 2XZ9A 4NRSA 4NZCA 4R3UA 1Q7MA 3GH4A 1UR2A 3OGSA 2ISDA 1PZ1A 1X39A 1C3FA 4GQGA 1FH8A 1WUEA 3CUFA 4MWAA 3CTTA 1C8QA 1FHDA 3PJTA 2QJMA 3N15A 5GNZA 3LERA 4RPQA 2E0PA 1M01A 4I5RA 2QPUA 1O94A 3GC2A 4L56A 4CCEA 3MY9A 4HSNA 4YHEA 1M1BA 1DP0A 1UKQA 1VBRA 4IJRA 4PB4A 4MYXA 4ZO7A 3CAKA 3SCRA 2G3NA 2Q09A 3BDKA 1RPXA 3DGBA 3S9ZA 5CC7A 5A5WA 1R47A 4GH3A 1BXNA 4MG4A 4PUWA 3W7DA 4U4MA 4DWSD 4TMCA 1G4PA 1N8WA 1R86A 4DB7A 2V2HA 5M17A 4KEMA 4J3SA 4JHMA 4ACYA 3ARZA 1RJPA 1H50A 1UUMA 2P0IA 2ACQA 2R1KA 4L1WA 3TJLA 5AHLA 3VA8A 2ZDRA 3IVUA 4HHMA 4AISA 4S3BA 3JS3A 5A8NA 1LQAA 2EEXA 4I90A 5HJXA 5ABHA 4XUGA 3M07A 3IEBA 2XJ7A 1EGMA 4XO7A 2VEPA 3H2OA 1CENA 4KESA 5BOOA 3CMJA 3AJXA 3WIJA 4K36A 1IT0A 4C6EA 1LOLA 1NFGA 2XN0A 4HNNA 5AKQA 2AQOA 2RJHA 3ZOAA 1GVRA 1XIIA 4MNJA 1O66A 1HNYA 4YCOA 4NNAA 4C6QA 4F48A 3R8RA 2ON3A 3VDAA 5A6MA 4AC7C 3RO8A 1N2VA 1W5QA 1RY0A 4NJJA 1ONEA 2E9BA 4E2OA 1RSCA 4GZEA 2VOMA 2VZUA 1J0YA 4JS3A 1MSSA 2XUCA 1I2NA 3BZGA 1FH7A 1JCTA 2FFCA 4HJFA 1BLIA 3SCVA 2WC3A 5C9WA 1D7FA 3YPIA 2YA1A 1JZ3A 1SO3A 2OCZA 1LOQA 4AD4A 3G1DA 4EK7A 3W4RA 1ZUAX 1AQMA 1RZMA 3SEPA 1RP8A 4UOZA 1RK6A 1KA9F 4EIVA 4O17A 2D0HA 1JJKA 5D9NA 4YS1A 1QHPA 4AHQA 3POCA 4FNRA 3HGSA 1UCWA 1W9BM 1J79A 2W79A 3T40A 1ZY9A 4NYYA 5LIWX 2XISA 1VYPX 4WDXA 3IIOA 2GGJA 5GQBA 2GOKA 3UPBA 1GVFA 2YDSA 1X6NA 5A1AA 2Z1SA 1C8YA 4DBDA 1TV4A 3DIPA 4C6KA 1PKLA 3SRDA 3CTLA 1U1HA 1IF2A 5FD0A 5HATA 1F6YA 1SZGA 3M5YA 1ITQA 5CPLA 4PMDA 1YE6A 3LNPA 1V6WA 4XG1A 3UYCA 5K3VA 1ISYA 2CZFA 4H8UA 3RLGA 1HGYA 1XD0A 3BG9A 2XVPA 3ABQA 4MAZA 1C9DA 1SPQA 1QPQA 3BJFA 2YZ5A 1IGSA 2D69A 1UR9A 3QYQA 2DVTA 2E3ZA 3WEOA 2FJUB 1SW3A 1JQVA 1KNWA 4GXPA 3M0HA 1TO3A 2PDPA 4FXJA 3GDKA 3WQOA 3W29A 2HTMA 5BXSA 3ARRA 4S2BA 4E3VA 4NI3A 3N2XA 4GABA 3KZPA 3KW3A 2GVEA 3GC4A 4KT2A 3V75A 1OFEA 2IUZA 3WH5A 5LKYA 4UXDA 3T08A 1V77A 1TVLA 5I2UA 1E55A 1A50A 5ABTA 3CMGA 4J4KA 5AHFA 1VIZA 3WLMA 3W1QA 1KBLA 3N29A 3GXTA 5BMXA 2YW3A 4P7QA 4HCLA 1VFLA 4Z0JA 2WLZA 1IEXA 4N9CA 4P8UA 1FCVA 5D03A 3ITOA 1XLEA 3BICA 1F74A 4HCDA 2QW5A 3B8VA 4MWAD 1DQUA 1P1XA 5AC6A 2PU0A 3CWNA 1OHLA 3ZJ8A 4J3VA 2E8ZA 3NJ3A 5GPRA 3GR8A 5D9OA 4ZO6A 3T2PA</