1DL3A

Crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
191
Chain Sequence
MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVERVGVFVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVRPFAVDVSSGVEAFPGKKDHDSIKMFIKNAKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
publication title Structure and function of mutationally generated monomers of dimeric phosphoribosylanthranilate isomerase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Isomerase
total genus 65
structure length 191
sequence length 203
chains with identical sequence B
ec nomenclature ec 5.3.1.24: Phosphoribosylanthranilate isomerase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dl3A00
3RNDA 4BK9A 3ABRA 3OHIA 3UWUA 1BEUA 3BLEA 2PCQA 5F2IA 5FF7A 1SW3A 1PCWA 4JY8A 4HPJA 2GQ8A 3BPWA 2CLOA 3C3NA 5LGXA 1KFEA 2YPIA 1ME7A 4WD0A 2QUTA 3WK1A 5K2ZA 3KVJA 3PUEA 1K03A 2QDGA 2A21A 2Z6JA 4EF8A 1GTHA 3A22A 4LY8A 4PL1A 5E1QA 3W1RA 1OX6A 4KWVA 5EBUA 2W79A 2BX7A 3FIGA 3TCEA 3ABQA 4LS0A 2E6AA 4FX6M 4RV8A 2JBMA 3P5ZA 4FXSA 4UMBA 3FS2A 2OT1A 1NVMA 2QJGA 3CQ0A 1JCYA 3N34A 4UMCA 3GDLA 5HR6A 1OFEA 1N8FA 5LZLA 3KVLA 2HS8A 1KM0A 3NQ8A 4MZ8A 3UWVA 1YXDA 1JUKA 1W31A 2YSWA 1GJPA 5HR7A 1H7OA 3MBFA 4HNNA 1I8JA 3B03A 3O63A 1VYRA 1W3NA 3N9RA 4I7VA 3TAKA 1VHCA 2DU2A 3PUOA 3A21A 2X2GA 1QPNA 1KLZA 1F74A 4JD4A 4LNYA 4ZQMA 4OV4A 1EWEA 4UTWC 1F7BA 4YMZA 4DBDA 3HGOA 1S5TA 3A24A 4W9TA 5D02A 5BMXA 2B4GA 3BG9A 1KTNA 1IF2A 1VC4A 2E09A 5I3HA 3KHJA 4YWIA 2V8ZA 1CI1A 1J2WA 2DJXA 4LVDA 3M6YA 3W1AA 1SUXA 1LYXA 1SSGA 3G1AA 4QISA 4RK8A 5K9CA 3I7QA 1JCNA 5E93A 1S5VA 3BW2A 1WOAA 4XBSA 2EHHA 3TIMA 2NUWA 3LV6A 1TPEA 1LTDA 3UZ5A 7TIMA 4LRSA 4ZVJA 3PS7A 1RR2A 1IGSA 1A53A 2I9EA 2G96A 1QO2A 3W2NA 1H60A 4JTSA 4I7WA 2C6QA 1I2RA 1WV2A 3U2OA 1SO4A 4MUZA 4N6FA 4RXFA 1W1ZA 3P7YA 5HJLA 3DHDA 4OGZA 4LVAA 4TMCA 1K8XA 1T99A 1ICSA 3P67A 2Q8ZA 2YW4A 5LNVA 2RHGA 3W7MA 4BF9A 3EX6A 3IVSA 4JGDA 3G1DA 3QFEA 3E49A 5DXYA 4FNRA 1KFKA 1TPC1 3GKFA 1TJRA 4IMGA 1SR9A 4CNPA 5J5DA 4Y6GA 2FIQA 1QFEA 1Z48A 5HUOA 4O13A 4IJBA 3UXAA 1TMHA 4A21A 3IGXA 1RQBA 3TR2A 1GTEA 1VCVA 4YCOA 4YXGA 1NSJA 4Z0JA 3EX4A 2Y7DA 3INPA 3G1SA 1XXXA 5BRBA 3G1VA 4N02A 4S2BA 1O5XA 4JTKA 3CEUA 1ZCOA 3MYPA 3CIWA 3NNTA 3S1UA 3NM3A 3MYOA 4WZHA 1BKSA 3C6CA 3PULA 1PV8A 1OFQA 2C13A 1MEWA 4Z1DA 5F1UA 5L9FA 1TTJA 1YADA 4I7UA 1YLVA 3LCIA 5DY3A 4LVGA 1A5SA 3P61A 3I65A 3LHYA 1SO5A 5CGQA 3B0VC 1EIXA 3QSTA 3OIXA 4K8EA 3TFCA 1I2PA 3E12A 5FEXA 1W8SA 3FOKA 1SFJA 3UWQA 2YYUA 1T96A 4TIMA 2DZSA 3DI0A 4PCFA 3PBYA 3WK3A 4AF0A 3QW4B 4EWND 4TR9A 2HSAA 1T8XA 1DHPA 1MSSA 3F4NA 5K9XA 3IRDA 3PBWA 3QQ0A 4O8RA 5G2WA 1ALDA 1SZFA 5DXXA 5F2LA 1TPFA 2ZRWA 1JQXA 1M6JA 4Q32A 3T44A 1F6PA 2ZDRA 4NJHA 3UWYA 3MWAA 1ONRA 2YR1A 5F4WA 1ME8A 4UTWA 3TDFA 3V75A 3OEXA 1YTKA 4TU1A 1J4EA 4ZQCA 2I1OA 3NAVA 4NT0A 2CU0A 5D03A 4BFAA 1QPQA 5CPOA 2B7NA 2RDUA 1F73A 3O8AA 4C1LA 3LBMA 4HSOA 1LP6A 1W5PA 3M9YA 2CLHA 3DI1A 3P60A 4BI6A 4E2BA 1TRIA 1EPXA 4FNQA 3NQCA 1OFBA 3PBUA 1FQ0A 1AK5A 2WQPA 2QCDA 2X1RA 2Y85A 4A2SA 5LSMA 1D3HA 2LLEA 1JUBA 1I4NA 3EXSA 2AAMA 1D9EA 1YTDA 2ZRYA 1JCMP 1KA9F 1HTIA 4LWWA 5EYWA 4UTKA 3HPZA 2ATMA 5C5YA 1MZHA 1L6YA 3QYQA 3W87A 3EKLA 4HT3A 1H51A 3ZR4A 1TSIA 3NL2A 4UNLA 3W86A 4NUWA 1KM2A 2ZFAA 3FJ6A 4A2RA 4X22A 3NA8A 1QAPA 4N9CA 5BW6A 4LTSA 5HULA 3Q2DA 1P1XA 3RLUA 2PE4A 4XQ6A 5DLCA 2E5DA 2ZA1A 2QAFA 4KWWA 4M6PA 4ZZ9A 1PVNA 1KLYA 2OZ0A 3C61A 3HGSA 4RCXA 4FEZA 4AAJA 4XBKA 3W1QA 3GXNA 3TXZA 3BK0A 3LI1A 4PA8A 3UD6A 2PURA 1QNVA 3A23A 3G18A 1VCGA 2QAPA 3QF0A 2A2IA 4Y9AA 3PVFA 5G1TA 4Z1AA 3S9YA 2J88A 3BVJA 1OVDA 3W07A 3FYPA 1PS9A 2VFDA 2J9XA 2Z1BA 3HMJG 2V0TA 5D2VA 4TMBA 1JRBA 3QMRA 1YDOA 4JX5A 5LNUA 3BARA 3SJ3A 5I3FA 3DU0A 3UY8A 5D30A 3U6WA 2DZUA 1JULA 4DF2A 1XBZA 1X6UA 2QF7A 4DQWA 2QUVA 4UCGA 3R12A 4NU7A 4DO5A 3KRSA 3CU2A 3KXQA 3NM1A 5HWJA 1VQTA 3W73A 4TX9A 2QJIA 3NPWA 2JGYA 3KVKA 6ALDA 1OFDA 3GX9A 1YPFA 3EX3A 3SR7A 2P0OA 1H1ZA 1XUUA 3GR8A 4JYFA 4QQ3A 3B4UA 3L5MA 3TSDA 4IOTA 3P8IA 2RDTA 1FX6A 4HNVA 1TTIA 3W74A 3P82A 1YYAA 5DELA 3W3OA 3IVTA 1CW2A 3LGEA 1B3OA 3B8DA 2RDWA 3MHFA 3BLIA 1IIHA 2J9ZA 1Y0EA 3CB8A 4TO8A 4ALDA 3I6RA 3W7JA 1LDCA 4ADUA 1FCBA 1TB3A 1U83A 1W5MA 3DFTA 1PCKA 2CLIA 1GVRA 3P62A 1WBJA 2A85A 4IMDA 4KFPA 5CG7A 1G4EA 2E5BA 2HS6A 3FKRA 3TSMA 4DBEA 3HG3A 5K4XA 1UCWA 2GOUA 2UV8G 2H3BA 2XN0A 4NJGA 3L0KA 3PUDA 1X7FA 1NEYA 4NX0A 2A7PA 1GQNA 3LI0A 3HG5A 4NZFA 3KFTA 3E96A 1KFLA 3NL6A 4UXDA 3RK8A 4EIVA 3EWUA 1H7RA 1P0NA 4MFDA 3S5NA 3LCXA 1X8FA 3L21A 3UXDA 5KSWA 2V30A 1IXNA 1Z42A 2ZTJA 3W7QA 3GVGA 3N2XA 4FO4A 1I45A 1DV7A 2OCZA 1ZFJA 1H7NA 3TKFA 3W83A 4FNTA 2QCGA 5FF2A 3GAKA 4UTUA 1L9WA 4MLJA 3SGZA 4K38A 1H7XA 2FJKA 1NAL1 4DPPA 2O7SA 5MHBA 5LHEA 3PSVA 5D05A 3TQVA 3S42A 2C0AA 1DBTA 3HB9A 4CCEA 4LC8A 1FDZA 1Q45A 3CTLA 3M5VA 5CZTA 1XCFA 1VJIA 4S2CA 2ATSA 3B04A 3T78A 4O54A 1V5XA 4UR7A 1W0MA 5I3JA 1ZAJA 3GDTA 4EF9A 3O6YX 1ML1A 1G7VA 3GNNA 4CCDA 8TIMA 1PHWA 3DHFA 3TQ0A 5KINA 4N9DA 3NGJA 5G2HA 3KX6A 1SU5A 3H53A 1TRDA 3MBDA 2Y61A 4WOQA 4LW7A 4H4IA 3DFNA 3LCWA 3NQVA 3SI9A 3UNDA 3QRHA 3LCHA 4FNSA 1H5YA 4O28A 4EVZA 5J5RA 1XBYA 5F4SA 1AW1A 2VFFA 1QWGA 2B0MA 3GYEA 4WY0B 4X2RA 1TPUA 1VLIA 5TIMA 1WOBA 3T55A 3L65A 5C2XA 4KFOA 2ZZ2A 2X1UA 3N3MA 1NF0A 2QCHA 5D33A 3OA3A 2TMDA 3NQEA 4R34A 5DBTA 3GDMA 3WJSA 4IXHA 5H2ZA 3PG8A 3UY7A 4LVBA 4Y90A 4R33A 3LOTA 4K7VA 3S8HA 1JCXA 3EWBX 1ZJIA 4MOZA 4A29A 4M6QA 1S5WA 2VFIA 3LHUA 5CPNA 5AFDA 2ABAA 2QDHA 1AW5A 1B9BA 4FX7A 3PB2A 2NWSA 4GJ1A 2H8ZA 2VC6A 3IV3A 5DBUA 5EPDA 4U28A 2VENA 4GWEA 4CNNA 4QSHA 1KBJA 3C8FA 1I2OA 4UFHA 1JRCA 1LRNA 1L6WA 4BWLC 2R94A 2JGQA 5AHLA 1JCLA 1XBXA 1H62A 5I3GA 2C19A 3W7NA 3SY5A 1JR1A 3M5XA 1G67A 1M5WA 4LT9A 5C6MA 1TV7A 1SQ7A 4JYEA 3M5YA 3EWXA 3F1QA 2DORA 3IGUA 3W1TA 1H7WA 3EB2A 1KV5A 4N9EA 3MI6A 3SSJA 3OG3A 1XM3A 1KV8A 1SZGA 3FKKA 1P4CA 4OV9A 5HWNA 4JTHA 4ADTA 4LRTA 3G1HA 2JKPA 3OBKA 1QPOA 1QMLA 1KM5A 4Z0SA 4XTIA 5F2MA 1SPQA 2DZXA 2Y63A 3QW3A 4AB4A 3M1ZA 4HPXA 1TQXA 5AYZA 3UQNA 1WDWA 4PC8A 4WJEA 1WBHA 1ICPA 2FTPA 4Z1BA 3UPWA 2YFNA 4N4QA 3W7IA 1D3GA 3SW6A 2E6FA 2WV8A 3H54A 4O17A 1R47A 2QCFA 4S1FA 3KRUA 4JYDA 1ZENA 1FUYA 5CKSA 1SW0A 1XI3A 4AHOA 3QQ1A 5C54A 1O60A 3STCA 1VH7A 3QM3A 3RFAA 3W1NA 4WUIA 3DENA 2CLMA 2ZZ4A 3C52A 4EOUA 1VCFA 2NV1A 1LBFA 3R89A 1OFRA 5EA9A 2H3DA 5G5IA 3M44A 4KKXA 5AYXA 3FFSA 3GZ3A 3R2GA 3LTPA 4IUOA 4JIQA 1HO1A 3L66A 4IMEA 3GR7A 1K7XA 2Y6ZA 3BG5A 4LS2A 1LLZA 1EP3A 4E2DA 1YDVA 4NNCA 1K7EA 1H63A 1A5AA 3TNOA 1TPH1 1Q6QA 2V5BA 2ZZ3A 1FCQA 2C15A 4MYAA 4AEOA 4CQ8A 3PC0A 1DJQA 2E6DA 1B4KA 4O57A 3LBCA 2W6RA 1OHLA 1X1ZA 3EWYA 3KAOA 5I3KA 3CT7A 6TIMA 1GPWA 3UZJA 1XDLA 2E6YA 4O52A 3W2MA 3LLDA 3GNDA 3W9ZA 5FF0A 3EWZA 3G1FA 3AO0A 3NPVA 1Q6OA 3UWWA 1KM6A 1WYIA 3LERA 2RKXA 1XFBA 4L4LA 5HMSA 3HIJA 3LX9A 1RQEA 1UUOA 2QCCA 1KM3A 2R91A 2YW3A 4QNWA 4DPQA 4BWLA 2A7RA 4HKPA 5U4NA 1FCVA 2NZLA 3LXCA 2QEZA 2OT0A 4K7YA 1RVGA 1TJPA 2DJLA 3M16A 2NX1A 2H90A 4JXCA 3NR0A 4RX0A 5CZ0A 4ZMGA 1HUVA 1NF7A 5G4WA 1AL7A 4UFLA 2BZNA 3VE9A 2F7FA 1P0KA 3C2FA 4GE8A 4ZL1A 1TTPA 4IMCA 2V2HA 2OJPA 3RLVA 1E51A 4HN4A 5AHMA 1FDYA 1DOSA 3LCGA 1TCDA 2NV2A 1GT8A 1UASA 3O07A 4AH7A 4OHQA 1HG3A 3W7DA 3NZRA 3HPSA 4QNEA 3TV8A 2TPSA 3NQAA 3TAOA 3HG2A 3W7GA 2V2CA 2XFWA 3QPYA 4BI7A 3BV4A 4O1CA 3MP3A 2GUUA 3CPRA 2ZRVA 4WY0F 4ORMA 1VYPX 4JS3A 4YL2A 3L5AA 5SWUA 2WSRA 2QUUA 2YX0A 5D2YA 3STEA 2J27A 1I2QA 1XC4A 5D2WA 2NUXA 2A6LA 3DXIA 2GVLA 3NQ2A 4O10A 4PH6A 1THFD 3WJZA 4UC5A 3E9AA 4LS1A 5F2GA 4LVFA 4JY9A 3EWWA 3NXFA 3JR2A 3WJXA 4OQVA 1DJNA 3HJZA 3VKJA 5D2TA 5CPMA 3W75A 3G8RA 3TFXA 3P5YA 2Q3RA 4UTLA 2CLEA 3G0XA 1R2SA 1SSDA 3DGRA 1FXPA 3DFPA 1FY6A 4IGHA 4FF7A 1OYBA 4AHQA 5K9DA 2BSLA 3HQ1A 3GLCA 3DFSA 3GKAA 3DFQA 4UNKA 3KOFA 1TPWA 1H50A 3GK0A 4JEQA 5K4ZA 3NQ6A 1VGAA 1LCOA 1GG1A 2ZTKA 5EL1A 4DEFA 3W1UA 2FB2A 1GVOA 3E02A 4M6VA 4JDYA 3EX1A 1WX0A 4FXRA 3F4WA 1W5NA 2J24A 3LHTA 1J5TA 3CM4A 4RLIA 1Q6LA 3ABOA 1M7PA 1EA0A 4DO4A 2WSYA 2OMAA 4O19A 3S6DA 1KFCA 5IBXC 2ZA3A 3USBA 4RXGA 3BGGA 4WXZA 3G8EA 3W1MA 2WJZA 3LLFA 1GEQA 1F2JA 2ZA2A 2VFGA 3PWAA 4A3UA 5KZMA 5I3IA 4IPJA 2YDAA 3MUXA 4LUIA 4HHPA 1O94A 3P81A 5CZJA 1OFPA 1QDSA 3SZ8A 2C18A 4H3DA 1TV5A 4N4PA 3BO9A 1LBLA 1LOLA 1HFBA 1RV8A 2V5LA 3W6YA 4RJEA 4QIUA 5FEZA 2CZEA 2RH9A 3ELFA 4WY0A 2GQAA 3PY2A 4Q33A 3S5ZA 1TPB1 1UBSA 2P1FA 4IX2A 1OYAA 3QMSA 1LROA 4DF0A 4QITA 3CLMA 5D32A 2AQWA 1IXOA 1YXYA 3PAJA 5HUPA 2FPTA 1L6SA 2CLKA 3NVTA 4E0CA 1Q6RA 2J6XA 3MMTA 4WOZA 1U5JA 5K3VA 4AMAA 3HPXA 4UIOA 2C3ZA 3LRMA 4LV9A 4DF1A 4PODA 1LZOA 1IXQA 4O15A 3C2RA 3A9IA 1SO6A 3H55A 1R30A 1G4SA 3NQ7A 1ICQA 1S3HA 1BWLA 1GZGA 3TROA 3WJYA 2FPYA 3NQMA 1QOQA 1B4EA 3IIPA 1OFOA 2A7NA 3W1XA 3NDOA 3F03K 1VZWA 2WKJA 4R7JA 4WX2A 3N9SA 5G1YA 1G6CA 4D2JA 3B06A 2V82A 5HINA 1WQ5A 3DKLA 1QR7A 1DKWA 2AGKA 2A5HA 5BMWA 3P74A 4WXYA 4IMFA 3G1YA 3DFOA 1W54A 4GRSA 4JTFA 3W2UA 2YYTA 5LGZA 2CZFA 3EX2A 3GB6A 1OFAA 2B7PA 1DVJA 3L0GA 5AYYA 3G3DA 3L0NA 4UTTA 1VPXA 3MP4A 1SZEA 4NXSA 3CC1A 4Y8FA 3W1PA 5BOOA 1TQJA 2PC4A 2YZRA 1WA3A 5D38A 3G0UA 4KFNA 4XKYB 4OWGA 3MJYA 3M0ZA 3PM6A 2V81A 3QSRA 4GC4A 1EX5A 1GG0A 1EP1A 3VE7A 1SFLA 1ME9A 4JICA 1ZNNA 2CZDA 1GYNA 4UMAA 5IBXA 2EKCA 2FLIA 4N9BA 1IXPA 1MO0A 3NPUA 4PL2A 4NNAA 3TU9A 4AHPA 4AXKA 3S1XA 1IIGA 4O50A 4UTJA 3W7LA 1W3IA 3TX9A 1ADOA 1GVQA 1NFBA 2VEKA 1YPIA 3STFA 5KITA 4YCPA 2P10A 3OVPA 4O0ZA 2A4AA 5AHNA 3LTSA 3VNDA 3L9CA 1G69A 3M5ZA 5GVJA 1KM1A 3RF9A 3W71A 3S5OA 3M43A 3W2LA 1ZAIA 3LM7A 2C16A 2YCEA 3W7OA 3WK2A 2J9YA 2F84A 1EUNA 3EKZA 4E38A 5TQLA 4O4VA 3ZWTA 3W76A 1EUAA 3VCRA 3R13A 1AG1O 1AMKA 1JQVA 3LTYA 2WSQA 3G3MA 3UYCA 3UWZA 4UUIA 4ZQOA 2PRHA 1XBVA 1BTMA 1X1OA 1V7YA 1KW1A 4QJ1A 3HG4A 4GUJA 1DL3A 2GQ9A 3LB0A 3STGA 2Y7EA 3EXRA 2CLLA 1T0OA 1TPDA 1K3UA 5LKYA 4G1KA 1G4PA 4JTUA 5HNRA 3TW7A 3W22A 3NQDA 4NQ1A 3C0JA 3NQFA 3P8JA 1JUEA 1M7OA 3WJWA 1MEHA 2ZRZA 1YTEA 3MI3A 1C9DA 4IWWA 2QCNA 4CLMA 1OK6A 5TBOA 2Y70A 4MKNA 4NZJA 3O16A 4O16A 4MLRA 4Z08A 1W56A 2XN2A 2VEPA 3AJXA 4FIRA 3BW4A 2V9DA 2RFGA 3V1PA 4UTMA 1RD5A 3GIYA 3W23A 3TA6A 3N14A 1QCWA 2ZZ7A 4GFSA 2CWNA 1W5QA 4J9JA 4M7TA 3FJLA 4HNTA 1RPXA 4MY8A 4YLWA 1N55A 3KVMA 4NVTA 4GUHA 3FYOA 1OG0A 3GAYA 1W3TA 1UJPA 5LNRA 4GXMA 5IM51 4UFMA 2EAWA 2WNZA 3BLFA 3DAQA 4ONVA 3B05A 3PBVA 4LUJA 4M5PA 5DY2A 4U4MA 3HO8A 4ADSA 1MXSA 4MIMA 3L5LA 1AW2A 2H8XA 3T7VA 5G2IA 3OVQA 4MPQA 2BWGA 1L2UA 3NL5A 4IQLA 3PG9A 3NEVA 2DZTA 3VFLA 5F1VA 2EF9A 3S1VA 4R53A 3CWNA 3TW6A 4ORIA 4NNBA 2FFCA 2GPTA 5C55A 1FCUA 2EPHA 3B0UX 2Q3OA 2D73A 1FWWA 4JTTA 3W84A 2BTMA 4M19A 3LHZA 4K37A 4Z1CA 4Y96A 4GNJA 4UFKA 5AOUA 3MI2A 4O18A 5AC7A 5AC6A 4MZYA 4PFMA 1F05A 4FNUA 3DBPA 3D0CA 1O5KA 5A8GA 3HGRA 2G97A 4CCCA 1OX4B 5D37A 4ZQRA 3EXTA 2W0UA 1WXJA 2E5CA 3A5FA 5KMYA 4RZ6A 1XDMA 4P61A 4O11A 3P80A 3W70A 3R5EA 2E77A 2Y88A 1JVNA 3I7RA 5K7JA 4JTLA 3IGSA 3W1LA 1HO4A 1A5CA 4MJMA 3U8GA 3DH7A 3PSWA 3CWOX 4JTGA 2VKZG 4NJKA 1KM4A 2HTMA 2X1SA 4RKAA 4K8HA 5BNKA 1OYCA 1TYGA 2ZZ5A 4OU1A 1K7FA 1O95A 3LHVA 3O6DA 4H6KA 4HIBA 4P2VA 4N2YA 3W2JA 3G24A 3BW3A 3W7HA 3M41A 3G22A 3TJXA 1FDJA 2FDSA 1HL2A 2C1HA 4JN6A 3NO5A 4DO6A 1A5BA 3BGJA 3GXTA 4C1KA 3VI2A 4X3ZA 2GVGA 1TO3A 4O1AA 1LOQA 1EB3A 5CPLA 3SIZA 1SO3A 1TIMA 1MEIA 1PIIA 4NJIA 3FEMA 3IEBA 3IIXA 4O4WA 1FWRA 3TK7A 5AC8A 2NLIA 1K8YA 2ALDA 2X16A 5ABTA 1SZNA 2H6RA 3W7PA 4QAIA 1DQWA 1QPRA 3W2KA 5LNSA 2WO5A 3NPXA 3QH2A 4PEKA 5KTLA 5CSRA 2FB3A 2NX3A 4POCA 2Q8LA 4FHAA 2E1DA 2YGYA 4O1DA 1KTCA 2PRLA 1N7KA 3L2IA 3GDRA 2I14A 5AHEA 1R2RA 1XUZA 5DCBA 4UTIA 2WNNA 5FF4A 1RQHA 3IIVA 1EWDA 1FWSA 1PL9A 4XWUA 1LORA 3PR2A 4JNMA 4GUFA 4LC6A 4GUGA 4FB7A 1H7PA 3O6CA 4JR5A 2JK2A 1Q3NA 1G4TA 3QEZA 2DZPA 3W88A 3C56A 1F6KA 3N19B 3THQA 2C14A 4HSNA 2JKEA 1G7UA 3UPBA 1EP2A 4FX8A 2EGZA 5FI8A 3Q94A 3PB0A 1OX5A 3N73A 5DCEA 3IIZA 2NXIA 3C2OA 3P84A 1QO5A 4L4MA 3W7KA 3JRKA 4OE7A 1DQXA 2WPBA 5T26A 1RZMA 4IX0A 5AHIA 3NL3A 4MZ1A 4JX6A 4O14A 3JS3A 2Z0IA 4ICNA 4XUGA 2NX9A 5D09A 2CZ5A 3HBLA 3ZWSA 5EY5A 5FF3A 3ATZA 2QCMA 4O1BA 3SGUA 2ZZ1A 3TC7A 3WK0A 3FLUA 2G5WA 5DN1A 3QMTA 3T4CA 3G0SA 3NQGA 2B7QA 4O0KA 3EEGA 3W7EA 2NWRA 3TMLA 2A0NA 3THAA 5CZSA 2DZWA 4K39A 3MP5A 4UFIA 3LXAA 4JX4A 2QCLA 3B0PA 3LDVA 2O7QA 4M7SA 5AN7A 1SW7A 3LRLA 1CX9A 1TPVA 1K02A 2NXHA 2VELA 2VXNA 3C2VA 3YPIA 4XKYA 4UTTC 4FNPA 3LRKA 1OK4A 4DELA 5HWMA 3QJAA 2TSYA 1GYLA 1F5ZA 1YXCA 2GJNA 4ZQNA 5A5WA 2IQTA 3CHVA 3G1XA 1FBAA 4IXXA 2Y89A 2ISSA 5FEPA 2Z2UA 3O06A 4GBUA 4HNUA 1YDNA 3MW7A 5EKYA 4IPIA 3DZ1A 4K6AA 2ZYFA 3ANYA 1PE1A 1GOXA 4XTDA 4UFJA 1XL9A 5EMUA 2GJLA 3T40A 3I7SA 3L68A 3R8RA 3OVRA 2X30A 3NZ1A 4JIPA 4O53A 1Z44A 4Q4KA 3K30A 2VFEA 3O05A 2ISWA 3QPZA 2ZZ6A 1KBIA 4K36A 2YXGA 2HMCA 2OX1A 1ZY9A 3TSBA 3CEPA 2VOMA 1UB3A 1OJXA 5L6UA 1H1YA 3MHUA 1ZAHA 4NX5A 1OF8A 5AB3A 2KZHA 3ABSA 3QZEA 4N6EA 1H61A 4PTNA 4OBTA 4QM1A 3W7CA 5FESA 4GUIA 5CSSA 3LHWA 2DP3A 4AWSA 3W72A 5KZDA 4MJZA 2CFFA 5D04C 3QC3A 3N2MA 3ZS4A 3O15A 3TQKA 1R2TA 3FA5A 5LHFA 3WFAA 2G95A 1LRQA 4AF0B 3CIXA 1I2NA 1K8ZA 4BI5A 4AWUA 5FEWA 2XN1A 2R14A 3IVUA 1XKYA 2TRSA 1LLWA 1TREA 5F4XA 3SFKA 3PF3A 1Z41A 1DORA 1A50A 1GWJA 3ZFHA 2X1TA 3M7WA 2FPVA 3E0IA 5DCDA 2Z6IA 4OT7A 4A22A 4JTEA 4JTIA 3W7RA 3DKJA 4ZQPA 2Y7GA 2QR6A 1C8VA 3Q58A 1AL8A 1JCJA 3I68A 4I9AA 1JJKA 2V2DA 2WNQA 1TTQA 1QOPA 1B57A 3LXBA 5LNWA 4NXKA 4DXVA 1BWKA 3S1WA 3TJLA 4RR4A 1GVFA 4LV4A 4MVAA 5U7SA 2QCEA 5AHFA 2A1YA 2ZRXA 4MFEA 4XZ9A 5HQEA 2NUYA 3W85A 3LV5A 4BR1A 3Q37A 2CW6A 3LCFA 1LOSA 2CLFA 2BXVA 2A6NA 1OABA 2ZCGA 2BLEA 2VFHA 5KZEA 3GXPA 2QCDB 3GDKA 1EEPA 3C4UA 4MYXA 4JDBA 2VEMA 2GVJA 4B5NA 3TUUA 2YFOA 4FIQA 5H91A 2ABBA 2ISVA 1VS1A 2TYSA 4O12A 2DZVA 3MHGA 2R8WA 2VEIA 3L67A 3TC6A 1FWNA 1FWTA 3HF3A 3A5VA 2NXGA 2ZQ0A 3HGJA 4LOCA 5D2XA 3TXVA 3BG3A 1WAUA 3S0CA 1ZHAA 3LCLA 4NJJA 1UUMA 3HOJA 1P5BA 3KRZA 3S5YA 1KFBA 4AVFA 3RMJA 4CNOA 1LRTA 3C2EA 4MY9A 3TH6A 3SECA 4MY1A 3M47A 4RZ5A 2WOQA 1OX4A 1F76A 4X9SA 3IIOA 1LM1A 1ZALA 4AWTA 1LBMA 4CQ9A 1VHNA 1C29A 2FQIA 1FXQA 3NYZA 1PHQA 1OF6A 1VYSX 1VR6A 2JKAA 2ZBTA 3ATYA 1GVSA 1O4UA 1W5OA 3RU6A 3NOEA 2Y62A 2E68A 4LU0A 3TMQA 2PRMA 1R46A 1KFJA 1KTBA 3O1NA 2Y7FA 4UTHA 4JTJA 1TV8A 2QJHA 4RZ4A 1VLWA 1VRDA 2ZRUA 4UR8A 1W37A 5G4EA 3TE9A 2B7OA 4WQ6A 4CQAA 2QKFA 4ML9A 3NG3A 3MO7A 5E0KA
chains in the Genus database with same CATH superfamily
4BK9A 3UA3A 3BLEA 4H00A 1AH4A 1R85A 5FF7A 1KXQA 3B3DA 4TVDA 2P3EA 3I6EA 1E56A 3C3NA 5LGXA 3HM7A 4J1OA 2YPIA 3SN1A 5K2ZA 2I5GA 3PUEA 5LIXX 2QDGA 3DBNA 2A21A 4I8YA 3RIKA 5B7ZA 1JG9A 1VFOA 5AYBA 4KWVA 2R82A 4BF5A 2INZA 2POZA 1NU5A 7REQB 3VXGA 1Q6DA 3WF1A 4BEQA 1US0A 1FH7A 2E6AA 1CZ1A 4LUTB 3FN9A 6REQB 3FS2A 4NYUA 2OT1A 1NVMA 1JCYA 5HR6A 3GDLA 2OWCA 4AW7A 3VNJA 3V35A 1AMYA 3RM4A 5LZLA 3N15A 4A3HA 3KVLA 2VD8A 2VD9A 1YXDA 1UR1A 5BYWA 1W31A 2GGHA 3CAQA 4B3LA 2PA6A 4XG1A 2B81A 3TTQA 4PMXA 2PUZA 3E2VA 2X2GA 4JD4A 3OZPA 2BY2A 1FWAC 3UJ2A 3PZTA 1DXIA 4OV4A 4YMZA 1J01A 3C0LA 4W9TA 5D02A 1CGUA 2B4GA 4I8DA 4CNTA 2WHLA 4JBRA 4Y2WA 2QPUA 3KHJA 2V8ZA 1CI1A 2DJXA 3W1AA 1SSGA 3GFYA 2WLYA 1PSCA 1JCNA 1EGVA 1JZ2A 1S5VA 1H1NA 4RL3A 4GX9A 2CHRA 4XBSA 2NUWA 4H9TA 3LV6A 1IQ8A 1TPEA 4LRSA 4ZVJA 4F0MA 1A53A 2G96A 1EJWC 3W2NA 2C6QA 1CT5A 3ME3A 1UR4A 1I2RA 3U2OA 4HCHA 3AI0A 3FCPA 3GG8A 4CD5A 4GZEA 4LVAA 1L8PA 1T99A 1RA5A 3CUXA 1FHVA 1NIUA 2YW4A 4J28A 3E38A 1TUXA 1XSJA 4BF9A 3EX6A 3AXKA 3TYCA 3G1DA 3QFEA 4FNRA 3GKFA 2HV5A 5FJTA 1B3VA 4Y6GA 4GZJA 1QFEA 4O13A 5A2CA 1YKWA 1M01A 3IGXA 1GQLA 4GKLA 4JIEA 4KEZA 2YKKA 1WZLA 3V4BA 2PDHA 2OG9A 3INPA 4AZ5A 1XXXA 4PBGA 3TC3A 3M7SA 1V51A 4KERA 3TYAA 3HQNA 3CEUA 4JTKA 9CGTA 3MYPA 3T0AA 3NM3A 3N4AA 1BKSA 1PV8A 2EPKX 1VIZA 4HJFA 1MEWA 4C5YA 4HZ6A 4M51A 2XHYA 1YLVA 3QQWA 1MXGA 2FFIA 1T8QA 1Q5MA 3AIEA 2FGBA 4K8EA 3UETA 3TFCA 3E12A 2VEFA 5FEXA 3S3GA 3FOKA 3AHXA 4FF5A 3KBNA 3CWHA 2HISA 3GBEA 4P8UA 3DG3A 3VNMA 1EC9A 1HGWA 1E0VA 1C7SA 1WPCA 3UEQA 1Q65A 3PBYA 3WK3A 4AF0A 5A6BD 4JKKA 3SIMA 4TR9A 4DHGA 1DHPA 1MSSA 5A8OA 3AHVA 2EKGA 3NFUA 5E09A 5HAOA 1XLEA 5DMMA 1E1CB 4C91A 3M0HA 1U1HA 5DXXA 1QI0A 5F2LA 2IPGA 4ZB5A 2ZDRA 4NJHA 5GQBA 3UWYA 3MWAA 4LUSB 4ZEPA 1ME8A 1WP6A 3E2SA 1MMFA 1S5MA 2J7HA 1YTKA 1EGMA 2IKJA 3NAVA 2CU0A 4NT0A 5CPOA 1CNVA 5CSYA 4CD8A 3LBMA 2E8YA 3ID7A 4ZO7A 1C8XA 1WXZA 2X1IA 1GNXA 3CV1A 1NM9A 3DI1A 4Q4QA 3W82A 4BI6A 4W84A 4Z2GA 1TRIA 3WY1A 1E6NA 3NQCA 3MPGA 4AY1A 5LA1A 1AQFA 2J8FA 3UGRA 1FQ0A 4XSMA 1K6AA 3VGDA 3QTPA 2WVVB 3WH8A 5B80A 1X6LA 2NQZA 2G3JA 1YTDA 1KA9F 2PLMA 1UA7A 4LWWA 5EYWA 3HPZA 2ATMA 3BH4A 4DJDA 3H22A 4DJFA 4QEEA 4DWDA 4ECLA 3EKLA 3HV9A 2O9PA 2Z7GA 2XYLA 3NL2A 3TZNA 1KM2A 2PP3A 4M82A 7PTDA 3NA8A 1XLHA 1KRCC 5HULA 3AISA 1ODZA 3Q2DA 2JEPA 2PE4A 3UR5A 4M6PA 4ZZ9A 3OGRA 1KLYA 1BD0A 2OZ0A 4UZUA 4CN4A 4DYJA 1JDCA 2WMHA 4KRTA 3LI1A 1XGEA 3AU6A 3HQOA 3WQ5A 2PF0A 1LL4A 2A2IA 1XH0A 3PVFA 1PKYA 1PZ2A 3OLIA 2VCBA 2J88A 7ODCA 1YMYA 2XM1A 1PS9A 2J9XA 2Z1BA 3HMJG 3H2NA 1JRBA 5CCZA 3MQTA 4AX7A 4QE4A 5D30A 3U6WA 2DZUA 1F6YA 1JULA 3SCPA 3EPNA 3WLLA 3T9PA 4EXQA 1QVBA 1EBHA 5HWJA 3AXIA 3OU8A 3W01A 1D7KA 1FP9A 4R7WA 3UESA 3SR7A 2P0OA 4QQ3A 3PBGA 3TSDA 1EA9C 3IRSA 1FX6A 4B2DD 5ENLA 1TTIA 3P82A 2BP1A 2PBGA 1KGUA 3U2EA 3PNZA 2VVNA 2A3AA 2KX9A 3LGEA 3TWAA 3TJ4A 2J8GA 4B4FA 3H4XA 1LDCA 5I79A 2Z1VA 1TB3A 4KCUA 1PCKA 3QYSA 4AD3A 7REQA 3NXLA 1VB9A 4IMDA 2Z24A 1ADSA 1W1PA 1G4EA 2E5BA 2HS6A 3TYEA 3HG3A 5K4XA 1UCWA 1GHRA 2GOUA 4QDPA 4LUTA 3EA1A 2H3BA 3EA2A 1UUQA 2ZXDA 3L0KA 3G6LA 3PUDA 1GHSA 1QXLA 1EJVC 3LI0A 2D2GA 1UA3A 1Q2SA 3EWUA 2EJAA 3N25A 4EXAA 3L4YA 5AVHA 1IXNA 1Z42A 2ZTJA 4JNYA 1ZFJA 1V6WA 3BC9A 1GQKA 2QCGA 5FF2A 3QPEA 3UJEA 1ECQA 4UTUA 2BVDA 1L9WA 2E9MA 1QHPA 1V08A 4K38A 4MNKA 2FJKA 3R8GA 2BS9A 4DPPA 1POJA 5LHEA 2I57A 3WIJA 1IEWA 3HB9A 1K9TA 4RNHA 4LC8A 5BOFA 2GVYA 1FDZA 3CTLA 5CZTA 1XCFA 1GEHA 1IEIA 3AS3A 3B04A 2SFPA 4O54A 1V5XA 4MKVA 2QT3A 3RJXA 1VENA 3NDYA 3DHFA 2W61A 3TQ0A 4N9DA 3NGJA 1V4YA 3H53A 3MY9A 3BAWA 1YNPA 2VMFA 2CYGA 3LCWA 1Q7ZA 3NIYA 3UNDA 1XX1A 3RUBL 2WKLA 1MQRA 1OG6A 1XBYA 4WSHA 3EOOA 4AXNA 2ZC1A 4GCAA 3UA4A 1JNEA 3L65A 4KFOA 2G3MA 2X1UA 1C93A 3IJIA 4GXPA 2HWGA 1GJWA 5D33A 3NQEA 3GDMA 3WZ0E 4IXHA 3UY7A 4R33A 4J3TA 4PTDA 3S8HA 3LHUA 5CPNA 3B9NA 2D22A 1R3QA 2VGIA 1LL7A 1W9VA 2QDHA 3OODA 1XIEA 1AW5A 4H2CA 3OVGA 1B9BA 4FX7A 3PB2A 3PPHA 2NWSA 1BQGA 3WEOA 2Y8UA 3TOPA 3IV3A 2I7GA 5REQB 6CGTA 1NQ6A 1QPKA 1OQFA 2YB1A 1D3CA 2PP0A 4QSHA 2Z26A 1PB0A 1HP5A 5DANA 2PS2A 3NGFA 4REQA 3HMCA 1JYXA 5G4HC 1A3WA 1RY0A 4AZCB 4BWLC 3T42A 2EEXA 5CJNA 1XBXA 4GINA 3W7NA 3SY5A 4AFYA 3ORWA 1EC7A 5A6AA 1EKOA 1FFRA 4QG6A 1SQ7A 3F1QA 3WDRA 4H01A 2PDKA 1KV5A 4Z17A 2OZ8A 4Y9NA 1XM3A 1KV8A 2FVKA 5E9AA 1J93A 1SZGA 3GDBA 4HSHA 4OZOA 3UJRA 3AZRA 1GORA 2EPNA 2GDVA 3OBKA 4H83A 3URAA 4Z0SA 3LSBA 2AQVA 2DZXA 1OCNA 3QW3A 1NDZA 1UD6A 4HPXA 3H21A 4MADA 3UG3A 3QV7A 3LSCA 1O1ZA 1WDWA 1UWUA 5A6KA 1ICPA 4Z1BA 2BASA 3OB8A 5D9OA 2KAUC 3B8SA 4N4QA 3W7IA 1KRAC 1V3JA 1XDJA 2WVSA 2WVVA 2E6FA 4LAMA 3E5PA 3OHMB 5A6LA 3BL3A 1UD3A 1KXTA 4IPNB 3THDA 3KRUA 1ZENA 1YQ2A 2ZX6A 3D6NA 5CKSA 5LA2A 4E5TA 1QNOA 3RCMA 3MMWA 3BV7A 5C54A 3STCA 4H6QA 4I9JA 2FZBA 5FJIA 3W1NA 3ZMRA 2CBIA 3C52A 2ZZ4A 3DENA 4EOUA 5FAJA 4UQAA 4TX6A 1JF5A 5EA9A 4OBRA 3FFSA 4Q4SA 4PUJA 4RE2A 4PUMA 1HO1A 5E70A 5AZ0A 3I4EA 3BSGA 1K7XA 2Q09A 1G5AA 4FR6A 4OOZA 4W88A 1J11A 1R9ZA 4IQDA 4PGLA 3WF3A 4Y8EA 4GHRA 2IQ0A 4MYAA 4GVGA 4A8IA 3WNPA 3BANA 3CHEA 3ZT6A 2GYIA 4CQ8A 3PC0A 3IJQA 2E6DA 2ZKMX 3ARXA 3EWYA 5I3KA 1GPWA 4HD5A 1XDLA 3N1AA 3W2MA 3WYZA 1O12A 3OA5A 2QF8A 5EBAA 5IOBA 1LQ2A 2GDQA 3CQJA 3GTHA 3WD2A 4L4LA 3LX9A 3RHGA 2V3EA 2QCCA 2O92A 3W6MA 2YW3A 5M17A 3VIOA 3WFZA 4HKPA 4WKAA 5U4NA 2NZLA 1PKLA 2OT0A 4ZOBA 3MJMA 3C86A 2NX1A 2XVNA 2WNWA 4JXCA 3B40A 4MB4A 4PUKA 1NF7A 4XZHA 3JZEA 3CH0A 4GE8A 3VKKA 4ZL1A 1TTPA 2YL5A 1MZRA 4I9MA 4MKSA 1UASA 4AH7A 3IJ9A 3W7DA 2TPSA 3GVQA 1MW2A 1UWQA 3TAOA 3W7GA 1CYGA 2V2CA 3QPYA 4B4HA 4K2SA 1IZJA 3CPRA 1MRAA 2VR2A 2ZRVA 4LYPA 4JS3A 1MXDA 1Q8JA 6ENLA 2YX0A 5T8GA 3ZR5A 2J27A 3OZMA 1K77A 3B8WA 4WDWA 3GXMA 3WMBA 2DVXA 4LJ3A 3JR2A 3TYUA 4GA8A 1DJNA 3VKJA 1H0IA 3W75A 3TFXA 3QY6A 3P5YA 1BXNA 3WLJA 3WF4A 1R2SA 2W62A 1S2WA 2OX4A 3F2BA 4RDVA 1FY6A 3MSDA 2GGJA 4AHQA 5K9DA 2BGNE 4MB1A 3HQ1A 3VOFA 3DFQA 4UNKA 3KOFA 1TPWA 2OR2A 1H50A 4WIWA 3KBMA 1TKKA 4DEFA 3WQPA 1QK2A 3W1UA 2FB2A 1ZJHA 4R9OA 1O5RA 3B8VA 2WZTA 1X1NA 4JDYA 3EX1A 5BZAA 4FXRA 3A47A 9RUBA 1W9PA 1W1YA 2NVCA 4LX4A 3ABOA 3IUIA 4DO4A 4HYRA 1W9BM 2DH2A 3ARZA 3USBA 4C6CA 1BQCA 3SADA 3BQ6A 3BGGA 2R1LA 3CZKA 1E15A 3W1MA 4I6KA 4FOUA 5JIPA 3QBUA 4TV5A 1TWSA 3PP7A 3CZ8A 5I3IA 4IPJA 2EJ1A 4F4RA 3AMGA 4V1YA 3H7RA 5CZJA 3SZ8A 2Y5SA 2C18A 1XF0A 3GVWA 3SCQA 1I0BA 1HFBA 2V5LA 4GKTA 1M04A 1XYLA 4QIUA 5FEZA 3ELFA 3BMXA 5CC3A 2GQAA 1UBSA 2NLYA 2PDWA 4Q4RA 4OKDA 1LROA 2AL2B 3CLMA 4WJXA 5D32A 3PAJA 5HUPA 1XIHA 4L1GA 2CLKA 2OYKA 1JD9A 1Q6RA 2J6XA 4WOZA 1U5JA 4AMAA 2G3FA 1YNQA 3B9OA 1UZ4A 2RDXA 3FHAA 1QRQA 3GNPA 4DF1A 4QSFA 2NVAA 3ARQA 3GWQA 1LZOA 2XGBA 4E3VA 1CB7B 3L4ZA 3WQDA 5KETA 1B9ZA 4A8NA 2WCGA 1E0UA 3H55A 5REQA 1G4SA 4XVEA 1KKOA 1S3HA 2BHUA 4EX4A 1UQZA 5I6SA 1XQKA 3CO8A 4QX4A 1CLXA 3CNYA 3B06A 1CXKA 2V82A 1XIMA 1WQ5A 3ITGA 3GM8A 2W66A 2A5HA 4A05A 2WM0A 3P74A 2X09A 2YA0A 4IMFA 3EWCA 3G1YA 1W54A 2EG7A 2V3GA 5LGZA 2YYTA 4S3EA 3C2YA 4IP5A 3GB6A 4QJ3B 3CGTA 3TCSA 1DVJA 4V1XA 4EAMA 2OLAA 3G3DA 1OCJA 3DYOA 2FTYA 3CC1A 1ONWA 1CXIA 3DGBA 1Y65A 2RGMA 2V38A 3A3XA 1EP1A 3DESA 1GQIA 2DT0A 4NAEB 4N9BA 2VRKA 4YU1A 1IXPA 3PTQA 1GW9A 3TU9A 1E9ZB 1J10A 3GHTA 1Y5VA 2PSNA 3TX9A 3LM3A 4MDPA 3H7VA 1ADOA 4Y9OA 4KH2A 1NFBA 5KITA 1YPIA 4Z2HA 4YCPA 3RR1A 3OVPA 1TA3B 1CIUA 1XINA 3LTSA 1XHGA 2D2JA 3OTRA 1FRBA 2ZX7A 2DT1A 1KB3A 1UD5A 3M5ZA 1C7TA 1RK5A 3A4WA 3W29A 1RSCA 1DWFM 3W2LA 2WC7A 3LM7A 1YBQB 7ENLA 3WK2A 4HU4A 4QJ4B 4XAPA 4E38A 4LYKA 4F9JA 3KBVA 1JZ4A 3W76A 2PTDA 4LAKA 3D47A 3UWZA 4UUIA 4IJRA 4MAZA 4PMJA 1BTMA 4AD0A 3CH9A 4AWEA 3OLEA 2FZNA 1DL3A 1JAEA 3R8HA 3STGA 3K13A 3EXRA 1T0OA 1TPDA 3ALFA 4D8ZA 5HNRA 1RLDA 3DDMA 3TLLA 3PUGA 3NQDA 3N11A 1A0DA 4L1WA 4XZIA 3AHZA 3SQLA 2ZRZA 2PAJA 5BXTA 1A5KC 4CLMA 1OK6A 1B90A 4FZIA 4PCPA 1TWWA 4MTVA 2PPGA 3R11A 3AJXA 1OC5A 3T2PA 4J3WA 5CC5A 3WQ4A 1P48A 2RFGA 3V1PA 1KC7A 3GIYA 2IXVA 4K8GA 2CBVA 3TA6A 4NHVA 5PTDA 4WLCA 4F9DA 4GD0A 4JFUA 3KWXA 1ECEA 2XZ7A 1AJ2A 4O1EA 5D4YA 3BLKA 3RX3A 3HPAA 1OG0A 5BXSA 1TZ9A 2XU2A 5LNRA 3EDDA 4GXMA 4DY1A 4M5PA 3HO8A 4MIMA 3T7VA 3NL5A 1ZBCA 1EZ2A 1ZTVA 2PDNA 3KCLA 3VFLA 5FJPA 5F1VA 2EF9A 3E2QA 3TW6A 1OIFA 5C55A 1Q4WA 3BLLA 4ZA0A 2EPHA 4GBDA 1J2BA 1UIOA 2Q3OA 2D73A 1FWWA 4H1ZA 3F7JA 4MWAC 3M0MA 4Z1CA 2YXOA 3T0DA 4GNJA 1A4MA 1OD8A 5AC7A 2XPKA 4XIMA 4MZYA 4PFMA 4IJCA 4HA3A 3HGRA 8XIMA 4CCCA 3BOFA 1DEDA 1RUSA 2FZ8A 1Z9AA 1F61A 3P80A 3R5EA 3SRDA 3VX0A 3I7RA 1TMQA 5K7JA 3IGSA 3MSYA 3C8NA 1HO4A 4GABA 2NQJA 1A5CA 4MJMA 4AG0A 3U8GA 3PSWA 4R27A 2QZRA 2NQ9A 4JTGA 3VPLA 2HTMA 1T5AA 5FKYA 2QPXA 2OELA 2J62A 4Y9PA 1Q6FA 2OTDA 3W7HA 3TJXA 1MQPA 3BWWA 1EOKA 2G41A 3GXTA 4C1KA 3KCOA 1GGOA 1W91A 3H4GA 5C2GA 1EC8A 2A79A 5HK4A 3RLGA 2GSEA 4EAYA 1PIIA 3FEMA 1ZPTA 4YIWA 3IEBA 2D1ZA 3IIXA 3KP1A 1FWRA 1EO7A 3SCSA 2ALDA 3SURA 1MW1A 1GKPA 1NP2A 1SZNA 4Q8OA 1WXYA 2PB1A 3BQ5A 1JGIA 1Y5XA 3NPXA 4OUEA 1GVYA 5KTLA 3HTWA 1J79A 3S83A 2FB3A 4S3BA 3VABA 4KGJA 2Q8LA 4FHAA 4KETA 2E1DA 2DUXA 4JKLA 2AL2A 2W63A 1R2RA 4J3VA 1XUZA 3UR2A 1Q85A 4D1IA 1FWSA 2W91A 1P6WA 1PL9A 4JNMA 3RO8A 4GUGA 4FB7A 5DX7A 1S39A 4JR5A 1BVWA 1GOOA 1V0KA 3AUOA 2JK2A 4GG9A 4D6HA 3QEZA 4QROA 3C56A 2CHNA 1XSIA 4AU0A 3THQA 5I3DA 1HKMA 1TJ2A 4FX8A 1EP2A 2EGZA 3VD9A 3Q94A 3PB0A 5DCEA 2NXIA 1BXCA 1REQB 1QO5A 3F5KA 2WPBA 4GQ0A 3TN4A 4IX0A 1TR1A 4GJJA 3AYTA 3CPUA 4C6LA 4A6GA 3OIHA 1LT8A 4O14A 4BA0A 2Z0IA 4ICNA 1DJXA 1K70A 2NX9A 5D09A 2CZ5A 3ZWSA 1XYBA 3SGUA 1NARA 2GJXB 2EG6A 3D3AA 2OU4A 3EPOA 1FKXA 2ONEA 2QGYA 2G5WA 2GL5A 5DN1A 3QMTA 3T4CA 1EDQA 2B7QA 2Q8XA 3ES7A 3VNYA 4TTGA 1ZSXA 1PXGA 3GW3A 3LXAA 1DTUA 2OQYA 2QV5A 1A0EA 2POTA 3QN3A 3AIQA 3STPA 4M7SA 1BYBA 1CX9A 4AD1A 2NXHA 1DJWA 3YPIA 1QNPA 4FNPA 1OK4A 4FALA 3ITOA 3QJAA 1L2QA 1RJQA 1SMAA 4L7ZA 3ARYA 1GYLA 3NSMA 1YXCA 3EMZA 3CHVA 4GVIA 4QCEA 4GQRA 4NAEA 5A95A 3ITLA 5DT5A 4GBUA 3SCWA 2UY2A 1BG9A 1M03A 3ANYA 4UFJA 1DIEA 1XD0A 1UMLA 3SN4A 4O53A 4QG8A 1E6PA 3T08A 2R9RA 5HJYA 4PEEA 3O05A 2RAGA 4K36A 1UR0A 4F0KA 1E6XM 2Z28A 3ABZA 1UB3A 1A5LC 1GOIA 5L6UA 1GVEA 1H1YA 3CLWA 4RV3A 3VGFA 1AD1A 3U4AA 2E9BA 5AB3A 3ABSA 4PTNA 1MNSA 2VRJA 5EFFA 2JIEA 1YHTA 1ZU8A 5FL0A 1LRQA 1I2NA 4GIEA 1E73M 3IVUA 2TRSA 1W1VA 2J77A 4GO9A 5F4XA 3SFKA 4N42A 3WN6A 4PMNA 3QOMA 3RM8A 4B9YA 5DCDA 2Z6IA 4KEVA 2QJMA 1LUCB 3W7RA 3DKJA 1C8VA 2WNQA 1TTQA 5LNWA 5A94A 3K5XA 1FWCC 2J7FA 2C1GA 4MUPA 4DXVA 2O9OA 1WUFA 3DFHA 4RR4A 1V93A 4JN7A 1B3YA 2NT1A 2QCEA 3K8LA 5AHFA 3SM0A 1P1MA 2ISDA 3FHQA 1UKSA 1LT7A 1LOSA 5I7GA 3KZSA 2ZCGA 1A49A 2VFHA 3TZFA 2CKRA 2AKMA 3GG0A 3MV01 3GXPA 4HU3A 3D3FA 2GVJA 4C7DA 3P3BA 3MKVA 2YFOA 1AH0A 4F0SA 3CXOA 4F3HA 4O12A 4HK5A 4JFVA 3D5HA 3SBFA 5E0FA 3UF9A 1O66A 3W38A 3TC6A 5HQLA 1JF6A 4B5VA 3UBPC 4LOCA 5JBDA 5A2BA 1EFZA 1P5BA 3S5YA 1O68A 3WLHA 2XIJA 3THCA 1QK0A 4RZ5A 4CQ9A 2QW5A 3HZ3A 1GOKA 3PNUA 4BQ5A 1VYSX 3JUGA 1A47A 2JKAA 2ZBTA 4CQDA 3KL0A 4GYPA 3SAZA 1W5OA 3RU6A 4LU0A 5D9PA 4E4FA 4MAVA 1KTBA 2Y7FA 4WF7A 4HHLA 1VLWA 2CCRA 3BJTA 4Q8TA 4YTSA 4UR8A 1C3FA 2R24A 2UY3A 5CG0A 2B7OA 4WQ6A 4DNHA 4CQAA 3WD1A 3U0HA 5B7YA 2G0WA 1PX4A 4ML9A 4W8AA 4HU8A 5E0KA 3ABRA 3OHIA 2PCQA 2BGSA 4R9XA 5F2IA 2V63A 1SW3A 2ZOXA 3OLDA 1ZRQA 4HPJA 3BPWA 4JY8A 3KTXA 4WD0A 4HCDA 3WQCA 4X63A 2XSBA 3O0FA 3GFZA 2Z6JA 1GTHA 1M1BA 2IKGA 3N29A 1VBHA 5ABGA 1UR9A 4AZBA 3AQUA 4HNCA 1RJPA 4MB5A 3PJXA 3FIGA 1HF6A 3TCEA 2QUMA 1JL8A 4NP7A 3KCJA 5BRQA 1UHVA 3WUEA 4RV8A 1UPMB 3M0JA 2XFYA 3P5ZA 3W00A 1V3KA 4W86A 2ZC8A 2EPLX 1IWPA 4DNMA 5AY7A 2FHBA 1OFEA 3M0KA 4F0HA 4PUWA 1GKRA 4AC7C 3WLIA 4GLEA 4MZ8A 1JZ7A 2YSWA 1GJPA 4Z42C 4Q22A 2DVUA 1LG1A 3N9RA 3O9NA 3PUOA 1QPNA 2OEKA 4A8LA 1F74A 3W6LA 4EPDC 4NASA 3LPFA 4LUYA 4B5SA 1Q66A 1EWEA 3PZGA 5XIMA 3HGOA 3P0WA 3H4WA 2GJXA 5I3HA 2IPWA 2CETA 1J2WA 2YB4A 4NIRA 3M6YA 3H12A 1XV8A 3IK4A 3G1AA 4JTDA 4QISA 5K9CA 4LAOA 3I7QA 3N2OA 2XFFA 2XZ9A 3BW2A 1EQCA 3ZSTA 4IPLA 7TIMA 1ZQ5A 1IGSA 2ZUNA 4P8XA 4XO6A 4WEVX 5HPCA 1EYEA 3HJEA 4MUZA 4RXFA 3VILA 2WVUA 3P7YA 3DHDA 4GH1A 4TMCA 1ICSA 3WBYA 2FZ9A 4M1BA 2Q8ZA 2RHGA 4L64A 3IVSA 4DJDC 3CV2A 4DJFC 1YE6A 5DXYA 4IMGA 4W7VA 1RY8A 1SR9A 4CNPA 3DC8A 3IUHA 5J5DA 2FIQA 4A21A 4Q4MA 2V5KA 1GTEA 4RE4A 4YCOA 3G5EA 5A8PA 2CPUA 5DMYA 1FH9A 4G9PA 3G1SA 1KWGA 6XIMA 3I3DA 3NUKA 3U5UA 1XIJA 3BAJA 3CIWA 1LL6A 3MYOA 3PULA 3WENA 4Z1DA 5L9FA 5F1UA 5HNUA 3WKZA 4I7UA 4LVGA 3TP4A 3P61A 3I65A 4ZOAA 5T91A 5CGQA 3B0VC 1KO0A 3QSTA 4LY4A 4XK2A 5CPTA 1C92A 3UWQA 4UZSA 4YYCA 2YYUA 4IL0A 3H70A 2ZX9A 4HP5A 2YL9A 4TIMA 4FA3A 3WL1A 3VGBA 5I0DA 2HSAA 1T8XA 3GO2A 3F4NA 5K9XA 2YBTA 1OCQA 3PBWA 2C79A 3IWPA 2IKHA 3GC4A 1ALDA 3WNMA 4A3YA 2FJUB 3MCNA 4I5RA 1JQXA 1F6PA 3WH5A 1ONRA 1LUCA 3PZMA 1WKDA 2GOKA 3N17A 1BG4A 3WG6A 5D03A 2B7NA 1K9FA 1SFTA 5RUBA 5TF0A 2PP1A 2OODA 2Q01A 1FA2A 5MKGB 4BZYA 1L6FA 2IQDA 1US2A 1ZGDA 4OBSA 4NZ1A 3P60A 4E2BA 3AS2A 1EPXA 4FNQA 4Q7BA 5C9UA 3U7BA 1OFBA 2O9TA 3VGGA 2BY3A 1AK5A 2AGTA 4ZSTA 5GNYA 3TYZA 2X1RA 4GACA 2Y85A 4A2SA 3W24A 3IUDA 1QI2A 1DJYA 1MWOA 2F61A 3EA3A 4DX3A 5LA0A 3EXSA 2XFRA 3LN3A 4PMUA 3CUHA 1J0IA 5BU6A 4CD6A 1CWYA 1MZHA 3QYQA 2H9AB 4Z2KA 4YTTA 3ZR4A 1UQYA 3SRFA 3ZT7A 4QBXA 2PU0A 4D8AA 5CGTA 4X22A 5LXEA 3LA4A 1RBAA 1P1XA 3QV8A 3RLUA 4XQ6A 2X7WA 2ZA1A 3CL7A 1OB0A 1RH9A 3N2TA 3LY0A 4RCXA 4FEZA 4B5TA 4XBKA 3NO3A 1LLOA 1XYMA 2PWFA 3BK0A 2PURA 4C6DA 3A23A 4E3TA 2QAPA 1ISWA 1OBAA 4DVOA 3S9YA 2Z25A 4BJHA 3BVJA 3W07A 3FYPA 4WDUA 1WAWA 4IFRA 5D2VA 4TMBA 2DVTA 4J40A 4NI3A 3BARA 5CLWA 5I3FA 3UY8A 3PZIA 4HK7A 1XRSA 2D23A 4HK6A 4DQWA 1IWAA 2CEQA 4GJIA 2AKZA 4NU7A 2QULA 3CU2A 3KXQA 3NM1A 3NPWA 2JGYA 4XD6A 3S47A 4Q8VA 2F6KA 3UZZA 4JYFA 3QR0A 1EF2A 3W26A 5BCAA 3L5MA 1J0ZA 1QASA 2RDTA 4HNVA 1E70M 4US5A 2DZBA 1S2UA 5EMKA 3W3OA 1CBGA 1CW2A 1B3OA 3B8DA 2Z27A 4GH3A 1OC6A 4Q7NA 1IIHA 4BQ2A 3A12A 4TO8A 4ALDA 3I6RA 3EMQA 5I77A 1MUCA 2A3LA 4ADUA 4J7RA 1U83A 3DFTA 1X7IA 3RILA 3P62A 2ACQA 1RJRA 2NSXA 5CG7A 3WD0A 2ZUSA 1HW6A 4MWAB 3AIVA 2XN0A 4DUVA 4I6VA 5LYRA 2A7PA 4H7CA 4NZFA 1ZP3A 1PBGA 3UXLA 3NL6A 3LGDA 4D72A 3POCA 2VURA 4MFDA 2HE8A 4PUNA 1XIBA 4NF7A 3ZVHB 1SJDA 3R4IA 4L65A 3LNMA 4FO4A 2C91A 1DV7A 4QRNA 3ZJ7A 2E3ZA 2OCZA 3B9DA 1QTWA 1H7NA 4HOXA 3EOLA 1WZMA 1PTDA 2DV0A 1B3XA 3H8AA 1F8IA 4JOMA 3WD4A 3FK4A 3WMSA 3KTSA 1ITUA 1FHDA 1XLKA 5D05A 3TQVA 1B1YA 2INEA 3BXWA 3N12A 4DLFA 3N6HA 2HQAA 5AC4A 1Q45A 1H0GA 1B2YA 5GJPA 2ATSA 3T78A 3E0LA 1ZAJA 3GDTA 4EF9A 1ML1A 1DPMA 1G7VA 8TIMA 1A4LA 2PWGA 3REQB 3DC0A 5BROA 1SU5A 1ENUA 1U1UA 2Y61A 1UKQA 4WOQA 1OY0A 1LWJA 4H4IA 2GLKA 3SI9A 3VZXA 3V18A 1TUFA 3LCHA 4FNSA 4O28A 4EVZA 2E9LA 2VFFA 1QWGA 3OYZA 4D6GA 1TJ0A 2VCAA 4WY0B 2OO6A 5TIMA 3T55A 2PLCA 1LQAA 4RZBA 3N3MA 1NF0A 1PTGA 3MANA 2DIKA 1GOQA 4R34A 3LMZA 2QVHA 3PG8A 4B16A 2FMNA 4K7VA 1W9UA 4GO8A 3MB9A 1JCXA 3TONA 4A29A 5CAHA 1M41A 5AFDA 4LF2A 2VDIA 3GY1A 4RE3A 4AY8A 2WB5A 3WUFA 2WSPA 4GZIA 4TUFA 3TOYA 3CBWA 1VFLA 4UFHA 4XZNX 2WHMA 1K9EA 2R94A 3PFMA 2JGQA 4P7NA 4AVOA 1JCLA 1E6SM 1H62A 5I3GA 1JR1A 5ECVA 1TV7A 4JYEA 3M5YA 3EWXA 3GNXA 2REQB 3W1TA 1H7WA 4D8LA 3MI6A 1NWTA 3OG3A 3LPOA 1X39A 2QJNA 2PMQA 4UOJA 3ITTA 2VEGA 5HWNA 3BZGA 1B30A 4RNJA 3N2BA 3VNLA 5MKGA 3SUVA 4LRTA 1KM5A 4XTIA 2Y63A 1TFVA 3F4DA 4U5IA 4PC8A 3O2LA 1WBHA 4ES4A 3CYVA 2PU1A 3P14A 4JFWA 3SW6A 4JPGA 2D3NA 1NH6A 4HBKA 2UY4A 3H54A 3I10A 3GVVA 2E25A 3NQBA 2GQ3A 2QCFA 1E40A 2V3DA 4S1FA 4JYDA 2HBXA 3OGVA 1EX1A 2A3HA 1SW0A 5TNVA 4O8AA 3MCMA 2H9AA 4U3AA 2AOSA 3AWOA 9XIAA 3IAPA 3DFYA 2BOGX 2PWHA 1LBFA 3LZ3A 3M0IA 2CHOA 5T9BG 3M44A 4KKXA 3ZR6A 3GZ3A 2OZ3A 1DJZA 3WCZA 3L66A 2F9RA 2DPEA 1YDVA 4NNCA 2VM8A 1H63A 5HPOA 1HVXA 3RAOA 1TPH1 1Q6QA 2ZZ3A 2WAGA 2ZUVA 5AVNA 1CEOA 4IIHA 4EP8C 1XYZA 3SGGA 4LSBA 3IANA 3PJUA 2I9UA 2PD5A 3LBCA 3OLGA 5EU9A 1BYCA 3CT7A 1IZKA 2E6YA 2A3CA 3EWZA 2HCVA 3OJGA 4E8CA 3W27A 1TELA 2FTWA 1XFBA 5FIPA 1UWAA 1J96A 3HIJA 2VGBA 1RQEA 2Y8VA 2R91A 3CMGA 1X97A 2OLHA 5CH9A 2A7RA 1NWSA 1AJZA 3S9IA 1TJPA 3M16A 3NR0A 4RX0A 5CZ0A 4AY7A 4ZMGA 1HUVA 4GPNA 1KQYA 5G4WA 1TIWA 4UFLA 4X60A 2I5IA 3C2FA 3EWDA 1ISZA 4IMCA 4LB3A 1G01A 5FJRA 4HHHA 3RLVA 2WMKA 4HN4A 1VF8A 4F66A 4U5KA 3S4TA 4OHQA 1HG3A 1B5TA 1XCWA 4G7FA 4IL2A 2HNEA 3NZRA 4QNEA 1O7AA 3OGSA 3TV8A 4NYYA 3EOEA 3PJTA 3HG2A 4MWAA 2V5DA 1E9LA 3I3BA 3BV4A 4O1CA 4ZBCA 4H9MA 2GUUA 2PGEA 4YL2A 3SSZA 1EJSC 3KRBA 2QUUA 3STEA 4B5XA 3UZXA 1I2QA 1XC4A 5IXEA 5D2WA 2A6LA 4PH6A 4LS1A 5F2GA 5JUVA 2F8QA 3EWWA 1SYTA 3ZVHA 3NWRA 1HKJA 2QMKA 1E9IA 3G8RA 2FVMA 2GDUA 3G0XA 3L12A 4ZB0A 3DGRA 1XIIA 4MGGA 5CPQA 4UQ9A 4GI6A 4IGHA 5CC7A 1OYBA 1FWDC 5HNTA 2BSLA 3BSHA 2WLZA 2PF8A 4JEQA 8XIAA 5K4ZA 3RPMA 1CLVA 4G2DA 2GUYA 1VGAA 2ZTKA 1RP8A 5H8UA 4A3RA 4M6VA 3OW1A 3KL3A 1V02A 1RCOB 3IJ7A 1W5NA 2J24A 1J5TA 4XKMA 3O0KA 1ZBVA 1Q6LA 3N04A 5KEZA 3BLPX 1EA0A 4BKNA 2WSKA 3S6DA 2ZA3A 1AZ1A 4QE1A 3RCNA 1PDYA 2WJZA 3BJSA 3REQA 1YE4A 1F2JA 3PWAA 4J2PA 4A3UA 5KZMA 3MDWA 5I03A 2WCSA 4UNIA 3UCDA 3SCTA 4HHPA 2DT2A 1O94A 1RALA 1V8EA 3P81A 4H3DA 1TV5A 4MNLA 2BODX 1JEZA 3BO9A 1LBLA 5CPSA 3PANA 5LIWX 3W6YA 4RJEA 2MANA 2CZEA 2RH9A 4TX8A 5AECA 4HA0A 4WY0A 3PWGA 4US5D 3S5ZA 2VO5A 1UR3M 7XIMA 2EO7A 2P1FA 4IX2A 3QMSA 3MT1A 4DF0A 1US3A 2OZTA 1YXYA 3VKBA 2VQTA 3NVTA 3MMTA 1JPIA 1WE5A 1JXJA 1I6NA 2QLYA 3VD3A 2DH3A 8RUCA 4HGXA 4UIOA 3QHNA 1QI5A 3LRMA 4G56A 4EE9A 4YN5A 1IXQA 1PKNA 5IFPA 3FVMA 3KS6A 4H7VA 3NQ7A 3NQMA 4CNUA 1XP3A 4GCXA 4AUBA 4MNJA 3W1XA 3RPTA 3NDOA 1VZWA 2WKJA 4R7JA 3T6CA 3N9SA 1G6CA 1Y8BA 4D2JA 3DKLA 3QR3A 1DKWA 4WXYA 2PBOA 1B3WA 3DFOA 4LEFA 2WZMA 2CZFA 3EX2A 4Y9MA 2REQA 1IEVA 4LFYA 3SCOA 4XD5A 3TNBA 3L0GA 2IXUA 5AYYA 1QATA 3MP4A 3NURA 3FEQA 4MPKA 3W1PA 5BOOA 1TQJA 3WH7A 4I5UA 1MUMA 2PC4A 2YZRA 3MO4A 3VK5A 3AFBA 3G0UA 4XKYB 4OWGA 1F3WA 2PDMA 2CC0A 3PM6A 1EX5A 5TD4A 2WJFA 4DBUA 2V69A 2CZDA 4DYKA 1GYNA 4UMAA 4YJ5A 5IBXA 4YHEA 1MO0A 3NPUA 3FDKA 3CZJA 5HXMA 2ZIDA 4DIAA 4QCFA 1IE7C 2RJGA 1W3IA 5FJOA 1TVNA 3BAIA 1GVQA 2VEKA 2P10A 3KE0A 2Q6ZA 2A4AA 2HK0A 5AHNA 1HJSA 1Q6CA 2HZGA 3L9CA 5HJXA 4KESA 1WZKA 3D46A 4S39A 4L9XA 1QWKA 4CKQA 2YCEA 3W7OA 3ZIZA 3GXDA 5TQLA 1HQTA 4FP1A 3NYDA 3ZWTA 4HA1A 4TVCA 3JVAA 4QS6A 3G3MA 3UYCA 4ZQOA 2PRHA 1XBVA 1BAGA 3E0FA 4IUGA 1B31A 1S1RA 2GSHA 4CQCA 2PDCA 3LB0A 2ZICA 1D7FA 2Y7EA 2CLLA 3S2JA 5LKYA 4ZSUA 4G1KA 3QKEA 1G4PA 3W22A 8A3HA 4J2MA 2CZVA 5A6TC 4LYQA 3C0JA 4H9ZA 1KCXA 3P8JA 3KDOA 4HNOA 3ZVIA 1M7OA 3DHUA 3MI3A 5CBIA 1AJ0A 2J7BA 1V0NA 4IWWA 4NAFB 3CMJA 2Y70A 5M1TA 3XINA 4NZJA 1XJBA 3O16A 4O16A 4Z08A 2AMXA 5GNXA 5AYIA 3Q67A 1W56A 1BSLA 5M2FX 4UTMA 1ELSA 1RD5A 4L5ZA 2VZUA 5BWAA 2ZZ7A 4M7TA 1W5QA 1E5NA 2BXZA 4HNTA 2QYGA 4XBJA 2Y24A 3AYRA 3FYOA 2Y0FA 2OOGA 1W3TA 3V16A 1R3SA 1UKPA 5A6JA 4UQDA 4FK9A 2EAWA 2WNZA 1RCXB 2ANUA 5DY2A 1MXSA 3FSTA 1EBGA 2GWGA 5GNZA 3OVQA 4LGXA 2BWGA 1OD0A 4S3CA 1X38A 3NEVA 2DZTA 2J74A 2L5HA 4UCFA 3WLNA 3ITYA 3S1VA 4H9XA 3VVGA 3UNTA 3CWNA 4ORIA 4NNBA 4RW3A 3SB0A 2VZVA 4AIOA 1E4LA 1UMYA 2Z2AA 4JTTA 4S38A 3ERPA 4M19A 1DJHA 3E5BA 4UFKA 5AOUA 3MI2A 4O18A 3WQ8A 5AC6A 1GYMA 3P6LA 1UWSA 2G37A 4DJEA 4FNUA 3D0CA 3WBXA 5JXQA 3UG5A 1XLGA 1IT0A 1A5OC 5IHSA 4PMOA 1OX4B 5D37A 4ZQRA 3M4HA 2F2HA 4KWUA 3EXTA 1WXJA 1M9HA 4KCTA 2ICSA 2HJPA 4S3DA 1JVNA 3VUPA 4JTLA 3O7UA 3MCOA 3LMYA 3K8MA 4DXXA 3O3RA 2WC4A 2O4MA 3DH7A 3VOJA 4EANA 2P3ZA 2PGFA 4GZ7A 4JTCA 3WQGA 4NJKA 3KM8A 2JEQA 3URNA 4L1XA 5BNKA 3MUCA 1IWBA 1MQQA 3O6DA 3KOWA 4HIBA 3NVDA 5C2CA 3M41A 5CJMA 3G22A 1EXPA 3WLKX 1NY1A 1E71M 2C1HA 4HZ7A 4DO6A 3VI2A 4IICA 4X3ZA 2GVGA 4O1AA 2VOTA 3HA1A 3KW3A 4PTXA 1XLJA 1TIMA 4NJIA 3VIHA 4O4WA 3GD6A 1DYSA 3TK7A 1K8YA 3LEPA 1CDGA 2EXOA 4XISA 3KEHA 2PDQA 1JD7A 2V5JA 4QAIA 4R5EA 2NVDA 3WSUA 4PEKA 1JCTA 2NX3A 3A3HA 3T2OA 3C5QA 4O1DA 5DMLA 1KTCA 3GUGA 1VBRA 3MZNA 2BVTA 2I14A 2WNNA 4GYJA 1O1HA 2WKGA 2PCEA 3FSUA 2ZE0A 3RG6A 1C8YA 1NELA 1SZRA 2XH2A 4REQB 3O6CA 1OINA 4RDYA 2DT3A 1F9CA 1BSIA 1F6KA 1XPYA 2FH6A 1XISA 3ARPA 2JKEA 4HSNA 4Q8NA 1POKA 3UPBA 3ALGA 1OX5A 1E6QM 1E0XA 2XIMA 1DQXA 4UQCA 4W93A 4QDWA 5T26A 1RZMA 5AHIA 1UPPA 1LG2A 4FOJA 4JX6A 4BCEA 3HBLA 1PX3A 2D0HA 3A4JA 4ZODA 3G2GA 4C6QA 1CTNA 3L4VA 3WNOA 5BU9A 3NQGA 1A5MC 4ERGA 1KCLA 1EDTA 1UR8A 4K39A 1EHAA 4C6MA 3GH5A 3CIVA 3GTIA 3LDVA 1HX0A 4FLRA 4OVXA 3LRLA 1K02A 2VXNA 4XKYA 5IDZA 4UTTC 1TV4A 3WLOA 2O9RA 2V5CA 3LRKA 2Z4GA 3BAYA 4KMQA 3WLRA 4ZQNA 5A5WA 3TTOA 3BMVA 3VD5A 3VIJA 2Y89A 2ISSA 4Q4OA 5FEPA 1E5JA 3O06A 3VDHA 1YDNA 4MSSA 5EKYA 4IPIA 4K6AA 2ZYFA 1GOXA 3M0XA 4LQ1A 4XB3A 3VNKA 2HXTA 3R8RA 3OVRA 4ZB2A 3GRIA 3NZ1A 4JIPA 5HNNA 4KWOA 4TOQA 3BSMA 3T0BA 2VFEA 4FXJA 1V6TA 1W9DM 1UWRA 2X40A 1E4NA 1ZAHA 4NX5A 4E4UA 1KKRA 1TV3A 5HOSA 4JEJA 1XGDA 3QZEA 3GHRA 4GYPC 4QR6A 4IZGA 2VT0A 4P5UA 5CSSA 1VP5A 3LHWA 4S3KA 2PWDA 3W72A 1UH2A 3BCFA 2CFFA 3CT2A 3QC3A 1A3XA 5EGRA 3ZS4A 1R2TA 2VJXA 2UY5A 2OYLA 4S3GA 3CIXA 4AWUA 1SJBA 1R8LA 3TN6A 5I24A 1LLWA 3CUZA 4E2OA 1R3RA 1LJYA 3PF3A 1VBUA 3K4AA 1MI3A 3VFCA 3TQPA 4NAFA 3MMUA 4KIRA 3GHUA 3APTA 1YRRA 4JTIA 3VA8A 1QNQA 2UBPC 1W1IE 2Y7GA 1QHOA 4CD4A 4RNFA 1AL8A 3T81A 1DQUA 1DWHM 1QNRA 4PZVA 1DE5A 2V2DA 1QOPA 1B57A 3LXBA 4DI9A 3ARTA 3MTWA 1AZ2A 2WBGA 3S1WA 4LV4A 4MVAA 5U7SA 4AZ7A 2ZRXA 2WANA 1E9YB 4XZ9A 3F4CA 4BR1A 2YA2A 2E28A 2BVYA 2CKSA 1KGWA 5KZEA 1FP8A 2PC8A 1Z32X 5HA7A 2I16A 1YDYA 1NQKA 6PTDA 2VEMA 3SUSA 4MJ2A 1GOWA 4C60A 4FIQA 2ABBA 2FGLA 4B90A 2TYSA 4C6BA 1Q63A 3K4WA 3WQEA 3AYVA 1A5NC 3HF3A 3TYBA 2J8TA 3BG3A 3S0CA 1U30A 3V0UA 3HOJA 3KOYA 4UBPC 4E4PA 1M68A 4PMDA 2XIOA 4M24A 1PX8A 3MC5A 4MY9A 3TH6A 3SECA 3QKZA 4QLJA 2WOQA 1OX4A 3WMCA 4X9SA 2QV4A 3II1A 3IIOA 1LM1A 1FXQA 4RE0A 2Y8KA 1KRBC 1OF6A 4M0XA 1VR6A 3XISA 2ZUMA 2FYMA 2AAAA 3NOEA 2JF6A 3TMQA 3N9KA 5FCZA 3O1NA 2G3NA 4RZ4A 3WFLA 1UYQA 3SEPA 1W37A 5G4EA 3KOZA 3LBOA 2WC3A 2QKFA 2HVNA 4QAWA 4OECA 3RNDA 2CXGA 3UWUA 1WDQA 1BEUA 5DFAA 4JIRA 4QE5A 1VRXA 3CUFA 2VX7A 3WL0A 2CLOA 1KFEA 4IFKB 4UTFA 1NP0A 1K03A 4EF8A 3CPGA 4W7WA 1ISXA 4LY8A 4PL1A 5E1QA 1OX6A 5A8NA 3B8TA 4DZHA 4GY7A 5KZ6A 2C71A 3VIFA 1D8WA 2BX7A 2XTKA 3TTEA 3N3TA 4PFHA 3GU1A 4TTUA 2DGAA 4IQJA 4FX6M 4B3KA 3CHFA 3CZEA 1UD4A 2JBMA 4FXSA 4UMBA 1ITCA 5TAOA 4PRRA 2A3BA 4YPJA 3KBJA 1V3LA 3N34A 3ZOAA 3BLOA 3GG1A 3FYYA 1N8FA 2V6AA 4IISA 4BEUA 1KM0A 3UXIA 4X0VA 3W81A 3UWVA 3NZGA 2XIIA 1H49A 1JUKA 5HR7A 4HTYA 2DSWA 4HNNA 3FDGA 3EB3A 2ZX5A 3O63A 4I7VA 3TAKA 1IEQA 2D0GA 3A21A 4LNYA 2CIPA 4KEUA 1XQLA 1N8WA 1E6ZA 4JQAA 4C6KA 3A24A 3F2CA 2D24A 3HU7A 4QLLA 5BMXA 3KTCA 1KTNA 1PIFA 1IF2A 1JDFA 4LVDA 3L2LA 1LYXA 3MSGA 1V77A 4F8XA 4H41A 4JQ4A 1WOAA 2EHHA 3TIMA 1DWAM 4H8UA 1RR2A 2DIEA 3XIMA 2WWCA 2XSXA 1QO2A 5IHRA 4PN2A 4G5DA 2HROA 4JTSA 4I7WA 2YBUA 2VZOA 2BFGA 4U2ZA 1OIMA 3U57A 4N6FA 3K46A 5C71A 1HXJA 4C6FA 1W1ZA 1MW3A 1QW8A 3JZUA 1K8XA 5A6SA 4I5XA 5LNVA 3W7MA 3E49A 4QS5A 2ZXQA 1JPKA 1U2YA 3N2CA 1Z48A 3EAUA 3FY1A 4DM1A 4IJBA 4P7RA 3UXAA 1TMHA 1TG7A 2D69A 5BXRA 1F3XA 3ANVA 3BURA 4P7QA 4YYFA 3EX4A 1B3ZA 3S6OA 3G1VA 5AZ1A 4S2BA 1UP2A 1XYCA 3R58A 3NNTA 4A3QA 3S1UA 3C6CA 1OFQA 4KRZA 2PDUA 4H8HA 4AIEA 1XG3A 4H7ZA 5DY3A 5J8LA 1EZWA 1JZ3A 5I02A 4D1JA 3FXYA 3OIXA 5C8BB 3PN8A 1WCGA 4FAMA 1I2PA 1JIBA 4D71A 1W8SA 1VFMA 3TVAA 1VEPA 1RBOB 3SFWA 1NDYA 3KLLA 2DZSA 4DAIA 3DI0A 4PCFA 2VX4A 1KFWA 1ZB5A 4LANA 2Z7KA 4EWND 5A6BA 2VUNA 5DRCA 5EMMA 1V3IA 3QQ0A 3Q65A 3RRXA 1R5YA 4O8RA 5G2WA 2GGEA 3AYSA 4AD2A 2Z1KA 5I00A 1TPFA 1M6JA 2B31A 4Q32A 3T44A 4FR1A 3EPMA 2OWWA 3U2ZA 4BS0A 4UTWA 3ZJ8A 3R7MA 3BOLA 2PDJA 4GISA 1WZAA 4ZQCA 2VR5A 4BFAA 3VOIA 1QPQA 3G1RA 4PE8A 3O8AA 4C1LA 1H2JA 2Q02A 3W28A 3VD7A 4J35A 3M9YA 3BTNA 4GGHA 2I56A 5C0QA 2FHFA 5IFTA 4WK9A 4AISA 3RM9A 3PZOA 3PZNA 3WLQA 5LSMA 1XLIA 2FZMA 2LLEA 1JUBA 3HN3A 1I4NA 3R6IA 4DJDD 1TWIA 4DJFD 1D9EA 2ZRYA 3RJYA 1JCMP 1HTIA 1L6YA 3W87A 4AZIA 2NQLA 1H51A 3FAWA 3W86A 4NUWA 3JW7A 2ZFAA 3EB4A 3FJ6A 4A2RA 1M7JA 3GH4A 1QAPA 5D8WA 4ICCX 1G94A 2CESA 1UP0A 4GYKA 4LTSA 4FSAA 2PDBA 3CTTA 4U2YA 5DLCA 4GI8A 2E5DA 3U4FA 2QAFA 1V3MA 1PVNA 2G3IA 2ASHA 3C61A 3HGSA 3BGAA 1WNOA 2WW5A 3TXZA 4GC3A 3WNLA 4JNZA 1QJWA 3G18A 1T41A 2YOCA 4Q3MA 3GYCA 2D3LA 1OVDA 4H04A 3QR1A 3IJDA 3VAVA 1UKOA 2J4GA 4TVUA 2V0TA 3WUGA 3FGCB 1NDVA 4A35A 1HJXA 3QMRA 4JX5A 1L8NA 3DU0A 4D6IA 4Q4PA 2J13A 3E0WA 1XBZA 1X6UA 2QIWA 1MVYA 4PSRA 4DO5A 2V68A 3LQGA 1W1TA 2OLSA 4L6DA 3W73A 2QJIA 3AXMA 1YPFA 3EX3A 3GR8A 1H1ZA 1XUUA 1A80A 4IOTA 3P8IA 3RXZA 2J6VA 3W74A 1YYAA 3APYA 4M6UA 3AIRA 1EIBA 4IFKA 4TV6A 3IVTA 4B2DA 3VDBA 2WZHA 4HCLA 3PJWA 2J9ZA 1RD6A 2Q71A 1Y0EA 3CB8A 3W7JA 3UZYA 5CSUA 2DQXA 3PTKA 1S38A 1FCBA 2VX5A 6A3HA 2CLIA 4N7QA 2A85A 3GQYA 1V0LA 3WDQA 4KFPA 2GSJA 4DBEA 2J7DA 3BE7A 1UD2A 1WDDA 2O4QA 4NJGA 1X7FA 3WO8A 3IPWA 1GQNA 4B92A 1OEPA 4I3GA 3E96A 1KFLA 4JL1A 4UXDA 3RK8A 4EIVA 5M5DA 1G0CA 1P0NA 4KQNA 3S5NA 3LCXA 1X8FA 3WNKA 5KSWA 4K1GA 1YIXA 1AQ0A 1UBPC 1AQMA 2WMIB 1BKHA 1UKTA 4ZE5A 3GVGA 7TAAA 1I45A 4MNMA 2X0SA 1BRLB 3DERA 3GU9A 1Q2RA 1W3LA 4FNTA 2BXYA 2WQDA 4IQEA 3S6TA 4C6EA 3ITVA 4ZTXA 5EMYA 2IPFA 3SUTA 2Y1HA 1OC7A 3N4EA 3VDGA 2GFTA 2YCJA 2Y4SA 2BG5A 3NSXA 3R79A 1UC5A 3M6DA 3LS9A 4CEXC 1V6VA 5MHBA 2FZDA 3S42A 4ZENA 3ICJA 1DBTA 1DHKA 4YWSA 4CCEA 3EOSA 5JU6A 2PDGA 1XRTA 4GY1A 4LEQA 3S2CA 5HMEA 1VJIA 1EJXC 3IK2A 3NOYA 3QY7A 3DEQA 4UR7A 4F48A 1W0MA 5I3JA 1ZL1A 2PLKA 3T0CA 3O6YX 1J9YA 1PYMA 6TAAA 4CCDA 1XRFA 4C7FA 5KINA 4OFCA 1UIPA 5G2HA 1JDEA 1KRMA 3KX6A 1TRDA 3OP2A 4PULA 4L80A 3NO1A 4J4KA 3E2RA 1GPFA 1Y7VA 1UH3A 5CQ1A 3QZAA 1V6XA 1H5YA 5J5RA 2XDFA 5H8PA 2YBVA 3GYEA 2GJPA 1W3HA 2PLJA 1IV8A 3ARWA 4X2RA 3W0KA 1VLIA 4AC1X 3FAXA 3UR7A 3DN5A 2ZZ2A 2VDGA 4UOQA 2QCHA 1P6BA 3AC0A 3WJSA 5H2ZA 4LVBA 3LOTA 3QGAC 5ECUA 3DG7A 4IM4A 3DIPA 3EWBX 1ZJIA 4M6QA 1S5WA 2E8ZA 2QVNA 3WLMA 2VFIA 5CBJA 2QS8A 1B54A 1IR2A 2W67A 4G6CA 4CN1A 4CD7A 2XH4A 2DSKA 2OB3A 5M3WA 5ABHA 1JZ6A 2CBUA 1L0PA 4WKFA 1IGWA 4LCQA 1J8VA 4GY0A 1PAMA 2DUZA 3J7HA 1N8IA 3WMLA 2NSOA 4ML4A 2R6OA 5DBUA 4U28A 2VENA 2W9MA 1CGVA 4CNNA 5T9CE 2DUAA 1EL3A 3R0UA 2AMGA 2FVLA 1DWIM 3L4UA 3S46A 5EMJA 2F6UA 4X61A 3H2EA 1LRNA 3A9BA 5F7UA 4XO7A 3WUBA 2C19A 2ACSA 4B91A 3M5XA 3GZAA 1G67A 4LT9A 5C6MA 3H6OA 1V0MA 2HRWA 2DORA 3VOHA 3IGUA 3VU2A 2VWTA 3B8IA 2Z00A 1AFSA 4LNCA 3SSJA 4HMEA 1VFTA 3FKKA 2XISA 2X8RA 5GJNA 3K8KA 3VMPA 4JTHA 1UOZA 3B97A 4HQVA 3U9IA 4ADTA 3EDFA 5DO8A 3VO0A 5F2MA 1SPQA 3M1ZA 5AYZA 4K68A 1GK8A 2IUZA 4MF4A 1E72M 4WJEA 3VYLA 2NV9A 2PEVA 2WYSA 1AVAA 2XWEA 1HKIA 5C9XA 3UPWA 2YFNA 1UOKA 2GK1B 1HT6A 4C6JA 3EOUA 4DUOA 1EGZA 2R1MA 3CO4A 4O17A 5C9ZA 3CJPA 4PTVA 1JFHA 3EEZA 4AHOA 1XWYA 3WF2A 3OBEA 1TE6A 5JIWA 1VH7A 3RFAA 4WUIA 1VCFA 1XLCA 5DMNA 4NG3A 3QOKA 1GZ1A 2H3DA 5G5IA 4HMNA 1XLLA 3BICA 2RJHA 5AYXA 3R2GA 3LTPA 3G77A 1K8CA 4IUOA 4JIQA 3UXKA 5HMFA 4HU0A 3GR7A 3BG5A 1F4AA 1K7EA 3H24A 4DO7A 1A5AA 4ICMA 3TNOA 2V5BA 1V6UA 4CUCA 3K1DA 4AEOA 3T09A 1W17A 3DOPA 1D8CA 1DJQA 1B4KA 4DRSA 1BTCA 1OHLA 1X1ZA 3KAOA 6TIMA 1JDDA 3BLDA 3UZJA 3FGCA 3BZJA 1M53A 3LLDA 3WLTA 3GNDA 3W9ZA 1V3HA 3PZUA 3AO0A 3CV7A 2E40A 3LERA 2P50A 2RKXA 1S1PA