1DLHB

Crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
188
Chain Sequence
b'TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS II HISTOCOMPATIBILITY ANTIGEN (HLA-DR1) (ALPHA CHAIN)
publication title Crystal structure of the human class II MHC protein HLA-DR1 complexed with an influenza virus peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility antigen
total genus 36
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 1994-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dlhB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1dlhB01
4FZ8L 3W0WD 4NNXA 1A14L 1U95A 1FVCB 3OKNA 4PR5A 4PJFE 1NGXA 4X5WB 2J1KA 4L8SA 4YBLC 5FO7A 1ZGLP 2XACC 1MCSA 1QYGH 5FYLH 3ARFC 1X7QB 3BMVA 4R4NC 3LOWA 4LVNB 4TSCL 3E8UH 3GJFB 2R4RL 2XTLA 1U8PB 4ZG1A 2IPUK 3WKNA 4HC1L 2HFGH 2OJEB 1AY1L 5CZVL 4TULL 4YR6A 1NGWA 3TO4C 2DM7A 4ESKA 1WVZA 3SDXE 4OZIB 2AXFA 1CFQB 2CR3A 2VLME 3FL7A 1JGLL 2XZQL 1ZHNB 5J3HD 1YY9D 4LLVA 4BK5A 1GGCL 4HCRA 4GXVH 1KJ3L 2ZG1A 4U33A 1VGKB 3OSKA 2EDDA 3HA0A 1DBMH 3DVNA 2FECL 5E6IC 4FN0A 5DFVD 3H7LA 5DD0L 5HI4D 3SEPA 1YN7B 1U2HA 2J5LB 3SDAB 5FA3B 4E9LA 2R8SL 1F3JA 5JA8B 2GJZB 3QDMA 4MQXD 2ARJB 2D0HA 1U91A 3QIBA 3VRJB 1AQKL 4R4BB 3HG1A 3LH2H 1O5DT 3S3PA 1MY5A 3RDTC 4GAJH 5CZXD 5DD6A 4PJ9C 5FIEA 1BZ9B 2IC2A 4PJXA 4QTHB 3UPAA 2YR3A 1KLUB 3V4VL 2PETA 3CXDH 3EGSA 1XCQA 5D7KE 2CLRB 4EI6B 1KN4H 1JWUA 2FIKB 5FF6B 5MP6H 4P9HL 4PJCE 2CIKA 1Y18A 5D93C 3ULVF 3QEGH 3DI3B 4JREB 5JOFA 2EYSB 1QQDB 4Q6IA 5TFSL 1N5AB 3MBXH 3O3EB 2NY3C 3ARGA 4AH2A 4KTYA 1T20B 5DJ2A 1KV3A 5MEQB 4PRNA 3DPBA 3QIWD 3SPVA 2JIXD 2AV1B 3P0GB 3AREB 1UB5B 1K8DB 4JDVA 3U4BH 1H8NA 3JSSA 5FKPA 1OAXH 3RWEB 2EXWC 4JM2D 4WHDA 2V5RA 1BVZA 5CMAB 2OP4H 4P2RB 4X80L 3GO1L 2EDYA 3SE3A 1XF3A 4DKFL 3V8CA 4OFPA 1I1FA 2OYPA 2ZCHL 1DBAH 4P2YA 1QVOB 2L7JA 3C5SB 4Q9BA 4HCRH 4TN9A 1AFVH 2APFA 3RGVB 4JFDB 1U9KA 1ZE3C 5F7LB 2I9LB 2X4PA 3AMKA 1CL7L 1DEEA 3BHBA 3BZ4A 2I07B 2HJLB 3OXRA 4XAKD 4NRXA 1SM3L 1Z5LA 4LDOB 3HI1A 4XPGL 4CN6A 5GJTH 4ZS7L 4AEEA 3CFKA 4JRWA 5IMOA 4Z78B 4ODVH 2X70A 3EJZC 4BELD 2IG2H 3ZDZE 3D39A 1C5CH 4OT1H 3ROLB 3UBXG 1VACA 5GGVH 3UPRB 4GW4B 3MFFA 2VXTH 3MLXH 4DCQB 3DVIA 3O4LE 4CBPA 5I15H 2ITDA 1Q9WB 3V2AR 1MELA 5C0JB 4MXWH 3OG4B 4H1LB 4X6DB 4C55A 5C09B 5IROA 1F4WL 3IF1B 3HNTL 1FFNA 4KTEL 2BDNL 4M48H 1MCDA 2R56L 3DYOA 4EOWL 4JREC 4E41D 3H0TB 5C0AD 5FUZH 3TM6A 2NX5A 1ETZB 4UUJA 3VW3L 4ZYKB 4M1CC 5HYQB 4UINL 1IVLA 1J8HE 2XPGB 4RFEA 1RJYA 35C8H 2J12B 3CFBB 1C7TA 5I19H 1NDGA 1I9JL 4MB5A 5CJBA 2IH3B 4Q0XH 4HLZG 1HSAA 3MV9B 2HT3C 2FO4A 1X4ZA 4U1NB 1F4XL 3ET9F 3LEXA 3AAZB 3IDGA 4Z7NF 4E0RB 3U82B 1E28B 1GOFA 2EECA 4Z7WB 4RRPA 1CGVA 1C5BH 3BGAA 3U4EB 3LEVL 3VGAB 1XF5A 5DQ9B 5T1DL 2BNRE 3MOQA 4C56D 3V0AC 3RNKB 1IEHA 4WHYH 5IHBA 4JFFB 2NY4D 4KJQC 3H9SB 3I02A 5H2BA 1C12B 3IKCA 5D9SA 2GK0B 1UA6L 3RWDB 4PBWD 1MEXL 3BP7B 2IPTL 1MH5B 1CFTB 1EO8H 3BD5A 2XRAL 3LMJH 5F9WB 1T7YA 4D3CL 4X99A 1JK8B 1M7IB 2AEPH 4LVHB 4M00A 1HCVA 2UWEB 5LGHH 1A7NL 5HPMA 4GQ9L 1A22B 4OSUL 3SDCA 3GSRA 2EDNA 4HQQH 1MI5B 2PYED 1XGYH 1E4WH 1MHPH 2V2TA 5IMLB 4F7MA 1QLFA 1HH6A 4MS8D 4GS7B 2NW2B 4E42A 3PQYA 4HD9A 1Q72H 3DMMB 4U7KA 4LEXL 3ZKNC 5ENWB 1CF8L 5ANMA 4DUVA 4MNQA 3LRHA 2Q20A 3RBSA 3ZTNH 4U1SB 4QOKD 1Q38A 3M07A 3N1MC 1FCCA 2X9WA 4XAWH 2EKSB 12E8H 3S3JA 5L2KE 4R3SA 4XWOC 1A0QH 4I9WD 4JFQB 4OZGE 5CBEB 3B3IB 2M2DA 5D5ME 1TETH 5JQHC 1JI2A 5E8DH 2ADGB 4NSKA 3GGWA 3GM8A 3B9VA 2QQLL 3I6GB 3THML 3X11B 3L3GA 4BK4A 3DX8B 5DC4B 2Q86A 5MEND 3OKDA 3EO1B 1OQXA 1HHGB 2VXVL 1JMZA 4X4ZA 2JB6A 2EYTB 5F7KC 3DETD 3FRPA 5DO2D 3VDBA 2X4NA 1DFBL 1T89A 4P2QB 4QCIB 3U0PA 4PJ5E 1Q94A 1T7ZA 5IV2A 2IEPA 1VFBB 4JQIH 4G7YH 3C60D 3QQ3B 3LKRA 5LXGL 3CMGA 4LVHC 3FO9A 1T1YA 4TVPL 4JPKL 1PG7W 2WLZA 1G7LB 1CN4A 4NQCB 1Y6MR 4XNMB 4LCWE 4WI6A 4RZCB 3VI3F 4QXTB 1JGUH 3KPMA 3QQ9C 2IAMD 2DQCH 1IEAA 3I85A 3SKOB 2NY7L 2QSQA 4GRMA 1UXWB 1U3HB 5KSUB 4GS7C 3LKPA 4F57H 2C3VB 3B2VH 3B6SB 2APBA 3DV6A 5I1LA 5FYJL 1KIRA 3WS6A 1IAOA 1R0AH 1BHGA 5ICXB 3S35L 2BY3A 3QQ4B 5D2LA 4ZODA 1CFNB 1CFSB 4Z0BL 1E6JL 4QXGH 4J23A 1CD8A 2DBLH 2ICCA 1IQDB 2BFVL 4JFZL 1KB5H 2Q1EA 3TBTA 1D3CA 5E94A 3SE9H 2AXHA 2X4QB 3WFCH 2ILLA 1NCCL 3TIEB 3E6HA 2VNCA 2GUOB 3BXNA 4LDLB 3K4AA 3KPRD 4KAQH 2O5YH 1OGAE 3Q3GA 3VWJB 2OJZL 2AK4A 1K4DA 3H3PL 1I85A 1QSFD 3KLHC 2ICWB 2WWMC 1KG0A 1T3FA 3F58L 3PWPB 2AJUL 1KT2B 2OTWA 3RVWC 1LVEA 1BEYH 3GIZL 1YNKL 2BSSB 2XA8L 2BY2A 3BJLA 4Y2DB 4NQDE 4HHAB 4EI5D 4HXBL 2DWDB 1OAUH 4HX1B 2VITA 1R6VA 3QDGB 1JZ5A 1BVKB 4RGMC 3JWOH 4EDXA 4L5FL 5CGMA 1R5VB 1XIWA 1IGIH 4FFVC 4YBHA 5JPMB 4P4KD 1DJSA 2X89A 3LZFL 1OB1A 2D2OA 1FVDB 5JMRA 4OUUB 4I4WB 5TJWK 1X44A 3QO1B 5CKGA 3WE6A 3TA3A 3MYZA 4J8RB 2BSTB 5CHNA 1WBYB 1IC4H 2MMXA 3MLYL 5K9JL 4MMZC 4PGDA 4XNZB 4LSSH 1BJ1J 4NRZA 2ICES 1CICA 4YDKH 4Y7MA 5HI5D 3SDXF 3UJIH 2FZ3A 3VFMA 2QV2A 4HUXB 1DVFD 2EEDA 2FX8L 4IMKA 4OLUL 2ICEA 3X13A 3ZKXB 3RWGB 5JDSB 2HMID 1BM3L 3WIIH 3LHPH 2F15A 3X17A 4FQCH 4CRPA 1FIEA 4D2NA 2VLRD 4NOFA 4KJWD 1BREA 4DTGH 1ZANH 2NR6D 4ZUWA 4JRYE 3B8SA 3ARDD 4JKLA 4Z0XB 5CUSH 1CT8B 4O4YH 4JZJA 3T2OA 1FVEB 43C9B 4JFHE 3O9WD 4P3CL 1E4KA 4Z5RA 2Z8WC 5CJOL 5FCUH 2Z35A 4YHLH 5A3IC 3G9AB 4Y2DC 3JV5A 4OLEA 4QRTA 2XG4A 5IFHH 4LSTL 2GCYB 2DLIA 1F8TH 4F9PC 3ZHLA 1A4KA 4UILL 3LQAH 4L9LB 4LQFL 2DWEB 4GRLC 3B9AA 1R3JB 5IBUB 3T0EA 3UC0H 2PXYC 2CH8A 3AMLA 2R0ZH 4P99A 4PJIE 1EEYB 3T65A 1QRND 4NPYA 4JRXB 3ARFA 1L0XA 4MA7H 4NN7B 1I9EA 2HLAA 2VDOL 3G6DH 4WW1A 3CPLA 4G8GA 3KPOA 3PHQA 4TUKH 3IU3A 2VDKH 4ZUVB 1KTKE 4J7RA 4M7JL 2R2HA 2JJTC 3TYGL 1KJ2B 2I27N 1D6VH 1P2CA 3VGFA 1PG7X 2DKMA 5DC9B 3GSVB 5AAWA 4PJ8C 3MUJA 4JLRA 3MR9B 2CUMA 3FN0L 5F9AC 1KCSH 3Q0HA 4JKMA 3D0VA 3O81A 4XZUA 1OPGH 1UWGH 4QRSA 1GJIA 4Y4KB 3DSNA 3K8LA 2R15A 5C0BB 4DKEL 4WTZG 1TXKA 2DM2A 3UTSE 4OZHA 4PYGA 3HZYA 5H37H 3FT4B 1A3QA 3W0WE 3FONB 2GJJA 3BESR 3QIUB 7FABH 1G7PB 3BIBX 3OKYA 2P44B 4GUPB 1NFDA 3CH1A 3Q5YA 3WO4B 1BVLA 3FO0L 4OGYH 2X4SB 4KHXH 3O0RL 2DKSA 5F7DA 4PRID 3QHFH 2A0LC 3NGBB 4J3VA 4HJJL 3RDTA 5BRZB 3MBED 1QEWA 3O3BA 3ZDZF 1Z9SA 1NBYB 9CGTA 4UBDD 1H8SA 3E1F1 4K7FB 3HC0B 4K2UH 1JF5A 5CWSB 5SV3A 3QFJB 5H35A 3BZEB 4S1RH 4XCFH 4UOJA 3QAZB 1RIUL 3N85L 1YJDH 8CGTA 1MWAH 4GMTH 3BEWB 1JYNA 5KANI 1FPTH 4PRHB 5CS7A 1BQUA 5M94B 1NFIA 4NIKB 1ZK9A 4JZOB 4GOSA 2MPAL 4DQOH 3GMRA 4HIIB 2I60H 1FG2A 5B39A 5T1KD 3GRWA 3B2UC 4S0TD 3QUYD 1JNLH 4Y88A 2DF3A 3P4MB 1INQB 1LQSR 5BXFB 3PGFL 4EN3D 4N8VG 3QRFM 4RNRA 2XNAB 3ZL4H 1TTGA 1Q9KB 1HSBA 4GW1B 3AXLB 1MCRA 3ZKSD 4S2SA 4Y4KC 1MPAL 3KYNB 1CQYA 1I8MA 4EUPB 3O2WH 4PTTB 3ULSA 2MCPH 5IG7B 4X7TA 5EU6B 1KJVA 2CXKA 3ZTJH 1AXSA 3SKJL 1L6ZA 2EZ0C 1B0GA 1Q0YL 1JV5B 4HZAA 1BD2A 1X5IA 2P24A 1N8ZB 5GJSL 1RJLB 3WO4C 1A7OL 4OM1L 4U1JB 3ULUD 5C9KA 4HUVB 4BH7A 1QZ1A 4XXDA 5AG8A 3SGEH 2EH7H 3QPQD 2VIRB 1IL1A 5DK0A 3CUPB 1SBSL 1S5IH 3UYRH 3G5YA 3DTXB 4A2MA 2OXGA 4Z95H 3LKNA 4LSVH 4XBEL 2AJSH 4N90D 5IVXE 5J13B 3CDGA 3T0AA 5GZOD 3QUZC 1I8IB 1N64L 4NQVB 1R3KB 2ORBH 1G7IB 1F58H 4FFWC 3NAAL 2VDPH 2ADFH 3GNMH 1FGVL 1WK0A 2AQ3A 3BP6A 2R4SH 3PDOB 1XR8B 2O26U 1IZJA 4GAGL 4XCNB 4S1DD 2VDLL 1CIDA 1G1YA 4NN6B 3SQOH 1C7SA 4HGWA 3OMZA 4K7PY 3W5MA 5BQ7A 2P46B 2A6DA 4GLRH 1IGTB 1EJOL 3GRWH 3QDJB 2HP4A 2WBKA 2PN5A 5E24E 2VB5A 3P3YA 3V8OA 4OZGF 5E08H 1JL8A 3MNVB 4V1DE 4HWZA 3ZZ1A 5D5MF 1NJ9A 1MUJB 2NLJA 4NO0A 4RWYL 3ZYJA 2E7LC 3BKJL 3U1SL 3GSWB 4HKBB 5IB5B 1OTUC 3GJEA 1FCGA 1N0LA 2C4XA 4K7PH 3KWWB 2Q7YA 3BIKB 4FABH 3JUZA 3HNVL 1PX3A 5IWLA 4HT1H 4HV8B 4X6FB 5KSAA 5IEKB 4N8CH 3V6ZB 1ZLVH 1U36A 4LNVA 4PGJA 4IRSB 3QEHA 3HAEB 2ESVB 3RZWA 3G6AB 5C0AE 2DQHL 3SCMB 2CJUL 3DX6A 3T0XA 1CXIA 5D7LD 4U31A 4XP5H 4YUEL 1A5FL 2VH5H 2J8HA 1V3KA 3U7AA 1LEGB 3ECBB 3FFCA 3WNMA 3CC5A 1CDCA 2BVPB 2PUQT 3KNBA 1HZHL 4N0CC 3WBDA 3U46A 4JM4L 3GKWH 5GSVB 1U8NB 5EULV 3CX5K 3NCJL 1T1XA 3KPPB 4X5LA 4NC2B 4NHCL 4XGZA 2V6HA 5DT1L 4JR9H 3KLAB 1N3NA 2H32H 4WENB 5EBLB 4G9FB 3V7MA 5E1AA 4ZNEA 5JHDD 4RMVA 3NIGE 4PTUA 1N4XL 3NCFB 1LEIB 1FNEB 4OF6A 3FOLA 1IGCL 3B5GA 3VH8A 4IJ3B 4PJFB 1K4CB 2W91A 2IPKA 4CMHC 4WI2A 1QOKA 3H9YA 5ID0A 5IW6A 3LKQB 5T5FH 3CGTA 5E70A 2VL4A 2ED7A 1KBGL 4KGJA 2UVEA 5T3XH 5JTWA 4CGTA 4NKIL 1B4JH 3H42L 2PYEE 4EDWH 1EK3A 4ZOCA 1DQLL 1IAMA 3M17B 3NFSH 5EU5A 1AR1D 3X3FH 3VFWB 3VGGA 5E95B 3BW9B 2UUDK 5E2TH 4I0PB 3Q6GL 5JNYB 1T0PB 4NQUA 3BDBA 4IOFD 1EFXB 4GRWE 5DS8A 4OQTL 2DQEL 1IGFL 4R97C 5KVFH 1IGJA 3P9MB 4DGYL 4NZRL 3NZHL 5JA9A 4K94H 5F3BB 1P69B 3TPUA 2VXSL 2F5BL 1LILA 1JYWA 4P23B 4EIZC 4NZUL 1L7IH 4I9WE 2P8MA 2CLVA 4TTDD 3QHZH 1CDJA 3VWKD 4WIQA 1I7UB 1PG7L 2EDJA 1I9RL 3OG6B 2IANE 1OD9A 4FQHA 5F1SA 5AWNL 4LFHG 3JV0A 5MENE 1KB9K 2VXQH 3PL6B 2FATL 3MREB 4MXVE 3MLSH 3QNZB 3FQUA 3W9EA 5JORA 2EC8A 1F2XK 3MGOB 4GW5B 4MJIE 1FZKA 2P8LA 3QCUH 3WFBL 4M8QA 1W72A 1I3GL 4ODUA 2BVQB 3S88L 3WEXB 5HI3D 3EYVA 4X4MA 3GSOA 2BVOA 4AEFA 3MLWH 4PUBL 4FFYH 1YYMH 3K80A 4NNYB 4XVJL 4PJCB 1GIGH 3MGTB 5ISZA 1UM6H 5J0BA 1CXEA 1QG3A 5KSBA 2AI0H 4JDTH 5I1DA 1FNGA 2DYPB 4WY7H 1DQTA 4CVZA 1TJIL 4YEFA 1A6ZA 4MSWA 5JW4R 4WEBL 1DBKL 3NA9L 4JQXA 1XGTB 3F5WB 1KLGA 3A0OA 4LSQH 1J0KA 1BQHG 4Q74A 3V9FA 4YHOL 4I0PC 3OKLA 1JPFA 4JGUA 4ODHH 1AD9A 4JKKA 1QSZA 5TDOB 4EQ2A 3PWLB 4NT6A 3DRTA 3RIFK 4F33B 5LBSL 1RIHH 1BECA 4JG0H 3OKOB 3ZKMC 1OAZH 3PE9A 2LTQB 1IGMH 3QDMD 1A3RL 4Q58C 1FYTA 4QWWC 3UTPD 3QIBD 4P23C 1K6QH 2IFFL 4QRQB 4PJIF 3HG1D 2ATPA 4MYWB 3IVKA 2IMNA 3AC0A 1EHLL 2AJZA 5EO1B 3RVTC 3C8HA 1DDHB 1EBAA 3TH3T 5AYUH 1FDLL 4DVBB 4FMFA 4N1CA 3WCYA 2NPLX 4Y4FA 1FO0B 2OK0L 1QFWH 1Z3GL 5IJKC 3KPRE 5GS0H 1NKOA 3EHBD 4LU5L 1QSFE 1UJTA 3WIFB 4RAUA 4H1LG 2BZDA 3MRCA 4LF3A 3O4LB 4TSAH 3TO2B 4AG4L 1W72H 4M5YL 1F3RB 4PREB 3VU2A 3ARGD 4S1QH 4BZ1L 3G5VA 4NBZB 1J10A 2Q7NA 2H26B 5A16B 4AEIL 3KS0J 1RUKH 3VXME 4YHPB 3I2CH 3MSPA 2VXUL 1IRAY 5J6GA 5C0NC 3OR7B 2WP3T 1J8HB 2EDHA 1MIML 3IDIA 1S9KC 3VD7A 5DMJB 3MMEA 5I1IH 3W39A 2FB4L 1U8QB 3EO9L 3GI9L 4PGCB 4CL7A 3IXTA 4KRPC 3I50H 1YEIH 4H0GA 3HRZA 4F9PA 1AI1H 2IBBA 1DLHA 2HG5B 1GZPA 2LTQC 4GRLA 1TZIA 4M7ZB 1CFBA 2PXYA 4EBQL 2BNRB 3ARUA 4TNWK 3H9HA 4F7PB 1DN2A 4L29B 2YXFA 1B0RA 3L5WA 3GJFK 1DE4B 3TJHC 2VLJE 3ETBF 4UT7L 4HKJA 4OLYH 4UV7H 4Q6YA 3QWOB 4OLVL 1MREH 4LCYA 2VLRE 4LLUB 4N5EC 3T1FA 1NDMB 1R5IA 3BPLB 3FO2B 3S37X 5IHZA 4HUKB 3NACL 2FHFA 4PJ8A 4ZFFB 5ICYB 5D2NA 3VCLA 3DURB 4NDMB 4RGNC 4AEHL 5GPRA 4DVRL 4Y89A 1OF2A 3OX8B 5I1JL 4LPYA 3QXWA 1QBML 2H9GB 2OTPA 2KQMA 4CVXA 3QXDB 3UTZA 3ALPA 3VFRA 3K2MC 1AJ7L 3WXWL 4OF0A 4UV4L 1GL4B 1DQML 3T1WA 2HH0H 1SY6L 3B9KB 2ADIB 1YEKL 4M62H 5D7JA 4XX1E 2LU3A 2P43B 4KK5D 4UB0H 1QRNE 3F8UB 2W9LA 2EXYD 4DK6A 4LL9A 1U8JA 3LN4B 1S9YB 3VGDA 3WXVL 2N4IA 5H94A 5L2KB 3MC0A 3A6BL 1JZ7A 4OZGB 2DDQH 5D5MB 1NCUA 2B4CH 5TF1H 1BAFH 2V9RA 4TOYL 5IVXF 1GHFL 3UTTA 1MF2L 2F54D 5LJYH 2X9YA 3SKMB 2JJSC 1RUPL 1WCBA 3DX7A 1IM3A 1LO3L 2DQTH 3B9DA 5DJAB 1PYWA 1A9EA 5CLWA 2P7TB 5EA0L 1YUHB 1KTDA 5I1KL 4W4OC 3LSOA 3GKZA 4PJ5B 1C1EL 3SDCD 3ZSSA 4P0DA 1K85A 3FB5B 2W0FB 5DMKA 1INEL 2G9HA 1ND0B 4PJ7F 2EDKA 3BPLC 3QH3B 4G8EA 2OSLB 1B6DA 2DLTA 4QHNA 2DD8H 4KRNA 4LCWB 2VAJA 5LAXB 3T77A 5DUBA 5I66A 1Z2KA 1D5MA 2C1PA 2YEZB 4Q9RH 4MNQD 3QXAB 4HXAL 4Y8DC 2YXMA 1G9NC 1LP9F 2H45A 1F5WA 4YBQC 3STLA 1DBBL 1P6AB 4M8VA 1WT5C 3UTQB 2A6IA 5GQBA 5JHLL 5GHWH 1S7TA 5HVGB 3VJ6A 5J7CC 5GSRB 5C7XH 3EYOB 3MRDB 1CK0H 2NMSA 4XNYH 1T5XB 2CRZA 2LVCA 5SX5K 5DJXA 2F53A 4ZDHA 3IFOB 3QG7H 5FDWB 2FWOB 2VQ1A 3BQUB 3OKKA 1EVTC 3EYQC 2VC2L 1I7RA 4OCSH 4Y2OA 1I1YB 4OTXH 1DCLA 1HDMA 4K71B 3QUZA 1SYVA 5E9DD 3VRIB 4NWUL 1DP0A 1KJMB 2GTWA 1OGAB 4NHUB 5ADPH 2A9MH 2LFGA 3CFCH 4OGXH 3BH8A 4APQC 4HLJA 4LHUB 2YKLH 4HLZH 1QFOA 2YSSA 1CVRA 3C6SB 4QRPD 4R96B 3CVIL 3VFGH 4MA1C 4DZ8A 4NQDB 3NIGF 4YHNB 3ULUE 1EJ6A 3L6FA 5KS9A 1T2QL 3CCHB 1NC2B 5ILTL 1QLEL 2Z8VC 3PXJA 4PP1D 3Q6FA 5JW5A 4WV1C 2RQ8A 1F11B 1ZGLA 4G9DB 2OZ4A 2GT9B 1IQWH 1JE6A 3U7YH 2E7LA 2GY5A 2R23A 2UZIL 4OGAD 3DLQR 1P4LA 2F8OA 5EOQH 1YEJH 3P0VL 3REVB 4N90E 4NGHL 1VPOH 1HILA 3VFOA 1HCFX 3VXQA 5DD1H 1TJGH 1FO0L 1MCHA 2VTFA 3T4AA 4R8WH 5SWSA 3IAGC 1II4E 1CDBA 2BVYA 2PW1B 4U0QB 1FZOA 4G6FD 3QEUA 2WBJB 4L4TA 4EVNA 1MHHB 4LK4A 4G6JH 1D5IH 1FFPB 1YPZE 3BQUC 1E4XH 2VLLB 4OCRL 4AT6B 2A74B 1U93B 3IS1X 5DGRA 2E7MA 4YPGA 4QO1A 4KDWA 2AK4D 5AAMA 5BV7C 5IGXH 4LPXA 5F3HA 1F02I 1KB9J 4NKDA 5F9JA 2BY1A 1IC7H 4JRYB 2LVEA 3O2VL 5J12B 1S5HA 5INDA 4WJ5B 1BJMA 2VABA 5DLML 3ARBD 2W9DL 1UWEH 2O61B 3QUMB 1DQQB 1UH2A 3WL9A 1XIWD 2Q76A 3LRSB 4KROD 2X89D 5KTEL 5IBUG 1EUUA 4O9HL 1MCCA 4HFWB 5EO0B 1CDGA 3RKPA 3TA3D 1U58B 3D1MC 5I1GH 1NLBH 3VD3A 3SQBA 3V5KA 4I1NB 4PJIB 3SY0B 3QNXB 5D7LE 1A6WH 3E6FA 5TGBA 2OZ4H 2R69L 3A6CH 3FFDB 1JZ4A 1B0WA 4ZPVB 3SGKC 5J6HA 4U0RB 1Q9OA 3OJ2C 3QI9A 5BVJB 4MD5A 4NN5B 4YXLH 2VDMH 1JZ6A 4YDVB 4ZD3H 3TNNB 4FMKA 4G43A 1AGBA 1HNGA 2NY0D 2G5BB 2NY5C 4JDZB 3QWQB 4DUXA 1YC8A 5A2KH 1I1AB 4ZAKA 1Q0XL 2FX9H 4KFZC 1U8KB 3RBGA 4N1EA 5JHDE 1QNZH 2ZSWA 3P9LB 4G3YL 1CLZH 2Z31D 3UTSB 3KS0H 4NJAH 1Z0MA 3MRMB 1G9NL 5IESL 5AZ2H 4LGPB 3OPZH 1BBDH 4YWGL 5T1MB 4ODXA 3W0WB 1MIEL 4BQBA 3CSYA 3IFLH 4BYHA 1SY6A 5IK3A 3BP5A 1CBVL 1A8JH 1LGVA 4E5XA 1YEDA 2J8UA 3T0ED 1WBXB 4M6ML 2QHRL 4JY4A 2ERJB 5D6CA 1FN4B 5EG6C 1QSEE 4O2CA 2EDOA 2J6EL 3FT3B 1RZIB 4KI5C 4JFEA 4R4ND 1I8KA 1NMCB 1FL3A 4G8GD 1DUYB 5GGRA 2MSPA 2B2XL 1W8OA 3ZSTA 4MXQD 5KVEL 1E27A 2V7HA 3EOTH 1XGQA 3S98A 4OLXL 1DR9A 4G6KH 1IAKA 1MCKA 1RZJC 5D1QB 1ORQA 1REIA 4OIIH 4NN5C 1FIGH 1WBZB 3OTTA 4ERSL 2IALA 2AGJH 2IGFH 2WIIA 2PYFB 3WLWD 2X4OA 3VFUB 5HDQL 4PJAE 4EUPG 1I9IL 1QLRB 2CO6B 3VXOA 4F9LC 3U7WH 5MERB 3LQZB 4QYOA 2QR0A 3DO3A 1KOAA 1JPGA 3L3OB 1JIBA 1S7WA 1WF5A 4IHOB 1HXMA 1GGIL 4EEEA 5JR1H 3HZVA 5FOBA 3BYTA 1U8HB 3PWVB 4XMKH 5CSZA 1UG9A 2E6QA 2KUTA 4ZQKA 2ADJB 3V95A 2A6KB 4P57A 4PS4H 1YMHB 4PJEA 3CMOL 5GGRY 1ZTXL 4GSDH 2Z9TA 2HFFA 2ERJC 5DYOB 1AHWB 5IJKA 4AENA 1OL0A 1ZS8A 2R9HD 4LCCB 4PBVC 2OL3A 3NZ8B 4K3DL 3HUJA 3WN5B 5IVNA 4WWKB 1IGYA 1AGCA 5AG9A 5FYKU 3REWB 3W2DH 2IBGA 5IVXB 5AZEH 4JM2B 5FHBL 1CCZA 2GJ6A 2CUHA 2DLFL 5DXWA 1YY9C 2CK0H 5J3HC 5HGGS 3VFSB 3FRUA 5BV7L 5C71A 1I4FB 1Q8MA 4HAGA 4JFYB 2VE6B 3QDME 3KGRA 1RZFL 5HI4C 3UTPE 3WLBA 3HG1E 2W38A 4J3WA 4FZ8H 1NMBH 3BE1H 1JWSA 4MJ6A 2EC9T 3B83A 4OCYL 1KIPA 4MQXC 4LASL 5EC1B 3TT1H 5HJ3B 5EUOA 3ROOB 4V1DB 4I5BB 1U42A 5CZXC 5L9DL 4HS3A 4JY5L 4HC1H 2B7DT 4QHMB 3KR3L 3ARXA 3UXFA 3SDYL 3QNYB 3WJJC 1N5YH 3FQWB 3DI2B 5KW9L 4PG9A 3D85A 5HHVH 2WANA 3EJZD 5MEOA 3SJVD 1OAQH 4N0YL 3MCKA 4YO0B 4ELMA 2XKUA 3R8BB 3IU4L 3HAEG 5ALBH 5KJRL 4YIQA 3DX9A 5D7SL 2WUCL 5BS0D 5I17B 2Z4QA 1J12A 2NY5L 4UNUA 5C0AB 4UIMA 3GSNH 3SE4A 3NOIA 3DBXA 3QIWC 2MQCA 4LIQH 3I75B 1T83A 2P5WA 1OP3K 1B2WL 4JM2C 3F65A 4O2FA 5CSGA 1J5OL 2NNAA 1JGVL 1KCVL 1L6XA 3STZA 4JKPH 3OQ3B 2VDNH 1W0YT 4AL8H 2R0LH 3DRQB 1RFDH 2R1WA 3FJTA 3JWDH 3DV4B 4EQ3A 3F7VA 5T33L 1T21B 1HYRC 3MNZB 3MRRA 4OZFB 3GI8L 2HT3D 3OAUH 1X5FA 2NY4B 3TWCL 4U1KA 2FJFB 3CLEH 3QUML 5FO8A 1MNUL 3D39E 2XTJD 1LWRA 1MJUL 2WSKA 1RHHB 5EC2A 4OZ4A 2HJFA 1KC5L 4F2MB 2QKIB 5BZDB 1CXHA 5HHPA 5KSAD 3MV8A 2HVJB 1P1ZA 2JJSA 3GBML 4G8FA 2PYEB 2IBZX 1NSNL 4HIHA 2DMCA 3C2AL 1CGYA 1JVKA 3BT2L 1MQKL 1RZJL 1KN2L 4LKCA 4RAVA 4DN3L 2BHUA 1YN6B 2NX5E 2KZ1B 4DKFH 4W4OA 3TN0D 5CEZE 1YMMD 1BOGB 1QKZL 5I76A 4YK4B 2VZUA 1X6NA 4HFUH 3FFCD 4QF1B 3MRBB 4GRWB 4YGAB 3RWJB 3ULUF 1J0IA 2W9EH 3BKCL 4ODTL 1YDPA 4NRYA 5E8EA 5IEHB 3L3IB 1A1MA 1WFTA 3X3GH 1OP5K 5I8EB 1IFHL 2OXHA 1D9KB 5CINL 4ZS7H 3K1DA 4X0KB 4X4XB 1WIPA 4HIEA 4BSVB 4HPYH 1JYVA 1WT5A 2IANB 4YDJB 3KPLB 3TJEL 4MWFA 2GYSA 4XT1C 1VDGA 2ZG2A 5MENB 3LKSA 4XWOD 4RA3A 5DJ8B 1KNOA 1A6VL 2NY4C 4KUZL 4C83B 3PNWB 1HH9A 2MJWA 3GMOB 2J7LA 3OHXB 4MJIB 4LHJB 1F4WH 3HNTH 3G5ZA 4HWBH 1D6EB 1RZ8A 4HUNB 2E7BA 4EOWH 5DUMH 3C60B 1YPZF 3CVHB 2NYYC 3UPCA 5I16A 4OAWA 4FQ2H 4IDJL 3FT2A 3X14B 2DJSA 3QP3A 3BMWA 3CSGA 4UINH 1BJ8A 4FRWA 3PQYE 1I9JH 5L7XL 5IMKA 3IDJA 1FVCA 2YPLA 2QQKH 4LARL 4MNQE 5INCB 5I18H 4D0DB 4MS8C 1O0VA 3RHWF 3EDJA 3Q1SL 4YNYB 4YK4C 2PO6D 1X7QA 3FMGL 5IOPB 3R06A 4CVUA 1HIMH 4OB5L 5T1DH 2E9IA 3P0YL 2OJEA 4I0CC 1LHZA 3NIFE 5F9OH 4HK0A 5CCKL 4WI9A 3CFJB 2V17L 2P8PB 3PG2A 5DSCA 3RWCB 1UA6H 1H3PH 3MRQB 1BFOB 1HHIA 2VKWA 4AQ1B 4WV1A 4OKVB 4GKSB 4XBPB 4RGOL 2XRAH 3SO3C 3GSUA 5E2UH 2Q3ZA 1ZVYA 3S3SA 4YFEA 5FUOH 1LNUB 2C1OB 5E4EB 1SJEB 1PAMA 4M7KL 3SGEI 4ISVB 5KVDL 4GG8A 3DETC 4ONFH 5DO2C 4K3GA 3KPRB 1DL7L 3CFEB 3V0VB 3SDAA 4QXWA 4UDUB 4G5ZH 2GJZA 1QSFB 5AUMA 2EO1A 2K9UA 3C60C 2PKDA 5GZND 3OXSA 4NM8L 3S97C 3R1GL 4WFFD 4LEXH 3BH9A 1SEQL 1CE6A 5HTSA 4JAMB 4LLDB 4EI5B 4J4PA 3KYOA 3BN3B 4U2YA 2D7QA 4U6XA 5J9PA 4Y0GA 3CJJA 1KLUA 2IAMC 3RPIB 3VXMB 1GGBH 5HGBA 3O3UN 1CQKA 1K9TA 3MRPA 1NC4A 5C70A 5TDPB 3SBWA 1J7VR 4OIBA 1AO7A 4GLRI 1SEBB 3GBLA 3OKEA 5D2LE 3THMH 2QQLH 1JHKH 4LLWB 3UYPA 1FYTD 4UU9B 3DGGA 1Y0LA 3CFDB 3O3EA 1NLDH 3GJFH 3DUSB 1FORH 2OTUB 4H88L 1HHKB 1G7HB 2Z91B 5GS2D 5DMIL 2AV1A 5CAYB 4RIRB 1K8DA 1DVFB 4XNUL 2AJ3A 4U6HB 4M61B 4WFGD 4P2RA 4Y4FD 2ICWJ 1D5ZB 5TE4H 2EEBA 2VLJB 1JN6A 2X1XR 4MZ2A 3N9GL 4XXCA 3RAJH 1X5GA 5I73B 2VLRB 1C5DA 3PWNB 2VR4A 3JVGC 3V4UL 2CIIA 3FN9A 1H15B 2BNUB 1CGUA 4IOSD 4K9EC 2NY7H 2YOCA 2PTTA 2XFXB 4KMTH 2AJVL 1M71B 3U9UB 2QHLA 5DK3A 1H3GA 2IMMA 4OQ1A 4DGVH 2C3XA 4G6AD 4QT5B 4PJAF 5DJYA 5CJQL 1X5XA 5C8JA 1RY7B 1EGJH 2E7CA 2FX7L 4JPWH 4Z78A 4EI5C 3FB7B 5DI8B 1NCNA 3MRNB 3S35H 1RK0B 1A2YB 4KK6D 3ROLA 2IADB 5ITBL 4L4VD 4CVWA 1S7UB 5D70L 3UPRA 2BFVH 3RU8H 3S36L 4JFZH 4P4KC 1RJZA 3MV11 5IB4B 3EDEA 3FQXB 4IRZL 1QRNB 4JFPA 3ZLQC 4ONHB 1A6UL 4XPTH 2NXZD 3T4YB 2HTKD 5IFAH 1WFUA 1TDQA 1NCCH 2DQJH 5D6DC 2ZUQC 1IEBA 3EOAA 3H0TA 3TV3L 3HR5A 2IQAA 1CDUA 3GHBH 3W5NA 5DJ6A 4ZSOA 1DBJL 5E2JA 2D03L 5HI5C 1ZVSB 1R24B 1GAFL 1KCLA 3BKML 1JCKA 5IB2B 1DVFC 4ZXBB 2GKIA 4WO4D 3F58H 2AJUH 4HWEL 3HI6L 2OBGA 4U1NA 2HMIC 3MXVH 1VGEL 1MCBA 1QR4A 4QNPE 5HGHA 4I48A 4PJ8D 5I73C 4KJWC 4YHZL 2I26N 3MJGX 5D8JL 4P5MB 2NR6C 3ARDC 4L8DA 1K2DB 3LZFH 2AQ1A 4ZTPH 3H9SA 1GXEA 5KG9B 2VZ1A 5E7FA 3BN9D 1I7TA 1FG9C 2XIDA 3O9WC 5DZNA 3RWDA 4P59L 3U36B 1XGRA 3T0EE 2EIEA 3AFLA 3T0DA 3MBEB 5C3LD 1CE1H 1JNHB 4XPFH 1UB6B 5K9JH 1LO0H 2MHAA 5D7JD 4PG2C 1MLBB 1C16B 5SX5H 5CP3A 1EA9C 1XF2B 1CU4H 5F6IC 5F72S 4XPAH 4D94A 2LQRA 1J0YA 4B7LA 4G8GE 3WS3B 2FX8H 1ZHLA 5DJCA 5IMLA 3TIDB 4I18B 4WHTB 1V05A 1NCWL 3MRGA 1BM3H 4H1LH 3QJHA 1N0XL 3DMMA 1MLCA 5GGQL 3UTTD 3LQMA 1MAMH 4K8RD 1KPVB 5ENWA 2XZCH 5ESAA 3C5JB 3FB8B 1RU9H 1RMFH 3F62A 1V7NL 2RB8A 3MLUH 5C0DB 4U1SA 2C7UB 1T66D 1ODAA 2BOBA 4BSWA 4K55A 4EN3B 4P3CH 3GZKA 3VXTA 4OZHE 1ZHKB 3PV6A 1OCWL 4O5LL 4JFQA 5CBEA 1I3RB 5EU7C 3TZVA 4LHUG 1ORSB 2ADGA 4AIOA 1NFDE 3GUTB 4XNXH 1YNLL 4U1GB 5LCVL 1BZQK 5HYSB 4XC3L 1IKNC 1F6AA 2VN4A 1HHGA 1UKQA 4FXKB 4P5KA 4BFIB 1FZMB 3MJ9L 1JF6A 3SE8L 4RQQA 3TGXA 5FO9B 1GSMA 4R90L 3MRIA 5EO9B 3FO1B 4H5SA 1JPST 4M93B 1YQVL 3LS4H 2DAVA 3MBEC 3K81A 1BBJB 3QQ3A 3T2NL 4UBDC 5EU3A 4OGZA 1BLNA 2EDTA 2VR5A 1RZGB 2YZ8A 4M7JH 1HHJA 1LO5A 2F53D 2YA1A 1J88A 1AXTL 5C0CE 1RURH 4NQSA 4J1UB 5C86A 3SKOA 1TZGL 3O2DA 4L8BB 3GIVA 5F1IA 4K9EL 4PY7B 4TVPE 4P3DA 1MFDH 2FHBA 3B6SA 3JTTB 1YPZB 5CEXB 4IIQB 1VFUA 2JIXA 4W6WB 1JGDB 1YECH 5ICXA 3QUYC 1JNNL 1CFNA 1G0YR 1TITA 5EBMB 1ADQH 4OM0H 1I7ZB 4JB9H 4EN3C 3O0RH 4M6OL 4CMMA 4I3RH 4JN1L 2N7AA 1VB9A 2F74B 1KIQA 5CILH 1KYOJ 2APVA 1X5HA 1ZSDB 3P4OB 4ZUUB 4NO2A 3VFVA 3IGAA 5HYJD 1BD2E 1ZA3A 2FSEB 1KXTB 2E8YA 5FYJE 5JQ6H 5IFJA 1VFAA 4FZEH 4PJHA 2ZWLT 5DUPH 4KY1L 3N85H 1KULA 1TZHB 5C9JA 5CEYB 3MRJB 1X4YA 3ULUC 4ZMAT 2EC9U 4PRPA 1HINL 4M93C 3L5HA 4LMQE 3QHTC 2R1XA 1KT2A 3QPQC 4TSBL 4D0CA 1A7RL 1R3LB 4N9OB 4NO5B 2H2PD 4JY6B 4MCZB 2MPAH 1R5WA 2BMKB 3UTOA 4UQ3A 1LD9A 1QSVA 5D7LB 3WD5L 3OL2A 4HHAA 1G9EA 1P7HL 3RX7A 1U8OB 2N1KA 4NKMA 4Z8FH 5SWSD 4J3TA 5GZOC 3QDGA 2FBOJ 1QRKA 2KZWA 4KJPD 1XCTA 2UZYB 1FL6A 4RMTA 1FVDA 2ZSVB 1JGEA 4S1DC 5LGJA 2FGWL 1TVHA 2BSTA 5EZJB 3FTGA 3GMMB 4MB3A 3EYUL 3NIFF 3SKJH 1DANT 4JQVC 5ACZB 4KKLD 3KPSD 5JHDB 3MNWB 3UEZA 4XPBL 1T5WB 2CGRH 2Y9RT 4OM1H 1OGTA 2GSIA 1NBZB 1KUMA 4UDTB 3V5HA 2WQ8A 4UTAH 4OV5A 4HBQA 1NAKL 1NEZA 2MFNA 4Q7DA 4H26B 1HYSD 1HEZB 5I8OL 5TQ2L 5MEPA 3N06B 4MA3A 1SBSH 1P7KB 1K5NB 3WIHL 1OVZA 2R0KL 5CFHA 4HJGB 4AYFA 3OJMB 4NC1E 4LPTA 3SKNB 5I8CA 4XBEH 5KSVA 2OR9L 3L7EB 1G9MC 2AV7A 3NAAH 1QSEB 1CT8A 1UJ3C 2FJHA 3SGJC 3PHSA 2GAZB 3RTQA 2K1MA 4GAGH 3WO3B 1CR9H 3FFCE 3O6LL 3QI9D 4OD3H 3TBYA 3SDDA 2GCYA 1UM5L 1BZ7A 5K9KB 2ID5A 2YPKB 4L9LA 4MA8L 3VD4A 4LNRA 2OQJA 5J1AB 4ZAKD 1V3JA 3EW3B 4JKWA 3TVMB 3VWKB 3UMTA 2Y06H 4AMKL 2OI9C 5D2LF 3SKUD 2EDEA 3IJSA 3P9WB 4HMDA 4M5ZL 4GAYA 4Y16A 4KVCH 4N68A 3EBAA 5I75B 1RUMH 1JUFB 4R0LB 3VMPA 1ZT4A 4PJAB 3D2UD 2DQUL 3O6FB 5IVZB 4QOKA 1U95B 2DI8A 4NKQB 4PR5B 4O2EA 1NGXB 3HNSL 4L8SB 5FO7B 4X7CC 1XT5A 4I3GA 4P46A 2W60A 3CZFA 2DQHH 1N59A 4L3ED 4QXUL 1NGWB 3UBXI 3PDGA 4PRBA 1A5FH 1UACH 4FTVD 1FLRH 2YRLA 2PNDA 4O02L 3MLZL 1PKQA 1UCBL 1LO4H 1PKOA 3QULA 4DUWA 1PJ9A 3FT4A 1XZ0A 2GTZA 2UY7A 3QIUA 5FM5M 2CKBL 1G7PA 3HFMH 1AR1C 2BXYA 4LLVB 3ULVH 4OV6F 3DUUA 5FKAA 5C6WH 3I6LE 2MKLC 2YN3A 4KPHH 1EERB 1IILE 4NHCH 3BI9X 4ETQB 5BMFH 1EX0A 3GMLA 5DT1H 3O41B 3DVNB 4IOFC 4G6MH 3PP3H 1G0XA 1S3KH 2K7PA 4U1IA 3MLVL 3MRFA 4ZPTA 4N0FA 4X6BA 4K7FA 3HC0A 1Z6JT 1F3JB 4X6CF 3KYMA 3QDMB 2ARJQ 3I3DA 1A9BA 1U91B 3NTCL 4AM0A 1S7VA 3QIBB 4J2XA 2IBZY 2V9TA 3HG1B 4PBXA 4TTDC 3HB3C 1RHFA 1IGCH 5I1EL 3NH7H 4MJ2A 1FE8L 1FH5L 5DD6B 1M05A 3B5TA 3K46A 5I75C 1FQ9C 3ULUL 4DAGL 4R0LC 1KBGH 3MJ6A 4KH2A 5T1LB 3HMWL 1GPOH 1KELH 5GGTA 2X2YA 4OFYA 2DJ4A 4DEPB 4L8SC 4DOHE 3GHEL 4ZFOA 1OTTD 1JWUB 1XFPA 5IKCA 4IS6B 5F7EL 2CIKB 1KJ2H 1Y18B 3GBNH 2D7TH 2VYRE 1INQA 5KSBE 5BXFA 5ISZE 4WFFE 5HI3C 5JOFB 4I0KA 1Q9LA 4Q6IB 3SHSA 3WHXA 4GW1A 2XN9A 25C8L 2HKHL 3ARGB 1UEMA 4QNPF 4AH2B 1J11A 5DJ2B 2H6PB 4PRNB 3SPVB 3QUKA 5EU6A 1YC7A 1MCWM 5D71L 4JDVB 3UP1A 3ZHKA 2X7LB 3JVGA 5FKPB 3VA2C 2VXSH 2F5BH 1CFVH 2GJ6D 4NZUH 1E4XI 4TQEH 4C59B 2HKFL 1YEHL 6FABH 1XF3B 2Q8AL 1EEZA 1I1FB 2DTML 1I9RH 1I1RA 1FYTE 3ARPA 2QTEA 1SQ2N 2VERN 4LPWA 1S7XA 4OZFG 1K8IA 2VAAA 1KEML 3HLAA 3OJVC 1DEEB 3BHBB 3BZ4B 2GSGA 4MX7A 3PGCA 4NRXB 1Z5LB 2QEJA 3QIBC 4ALAL 2BOCA 1HXYA 4P4KA 3RL2A 3HI5L 4WFGE 5K33A 2APWA 3CFKB 3S88H 4KHTL 2WUBL 5IMOB 1P6FA 2ZUUA 3LRGA 1G7IA 2X70B 3D39B 2F19L 2OR8A 3BUTA 3UO1L 4JHAH 1G9ML 1VACB 5D6DA 3C08L 2OR7A 3F7RA 1BX2A 4K3JH 4YQXL 5DRWA 3MFFB 1OQOA 4XMLH 2YA2A 5DHVB 2ITDB 4WEBH 3MXWL 3NA9H 4LRNH 4XP1L 4DEPC 5T3ZH 2CUIA 3LN5A 5D1XD 2EIZA 1FFNB 5I30H 4HG4K 4PGZA 4OKDA 2H1PL 4Y5XC 4DGIH 3KYAA 4OZHF 4TPRL 4NCC1 4Q6IC 5DTFA 3ARGC 2QSVA 2NX5B 4OIAA 1H0DA 4UUJB 43CAA 2BX5A 5HY9A 2E27L 4UT6H 5A1AA 1EMTL 2RCSL 1OP5H 1RJYB 4LBEA 2AP2A 1A3RH 2P5WD 3HZMB 3QQNA 1NDGB 2RR3A 4NQEA 3BIKA 3ARDA 4XC1L 1HSAB 4ACPA 5DRZA 2FO4B 3LEXB 1G6RA 1KXVC 1QYGL 3A67L 4POUB 3V6ZA 5K9QG 3E8UL 4WEMB 3PWUA 1YEGL 4IRSA 5HHXH 1WICA 1XF5B 2HFGL 5GRZA 4TNWF 5C07D 2D7NA 4X9GA 4XH2B 2OK0H 1Z3GH 3J7HA 3KHQA 4GBXA 1VEPA 1EHXA 5H2BB 4N0UA 3IKCB 5D9SB 4IDLA 1QUNA 2BVPA 2DQIH 3LV3A 1MJJA 4X99B 1QBAA 5F7WC 5GSVA 5SWZE 4GXVL 4MVBD 5KN5A 5HPMB 3SDCB 4DJMA 3L5IA 3LKOB 3MV8D 3VE0A 2B20A 3CDYA 2R1YA 2ED8A 3GSRB 5D2NE 1DBML 3DVGA 4AEIH 3HCVB 4QRRD 3PIQA 3QUXA 2X1PA 4PLOB 2YPVL 4U1HA 2Z93A 2PTVA 5IROC 2V2TB 4IRJA 4F7MB 1QLFB 3NABL 5I6XB 1HH6B 5I1HH 1MIMH 4E42B 3PQYB 3BPOC 1LEIA 1FNEA 3LH2L 4WI8A 4M3JA 3GI9H 4FHBD 4CAGA 1XGUA 4MNQB 1U92B 2CDGA 2K3TA 4CU8A 2D31A 1XR9B 3FQNA 3N1QC 1BF8A 3OBAA 1VESA 3BZFA 3CXDL 5B8CA 4R3SB 4Y5YA 1MFCH 5F93C 4KK5C 2O5ZH 1NMAL 1J9CT 2EXYC 1KN4L 4NSKB 4NQXA 3GGWB 4U6TA 5MP6L 5J06A 3SDXA 1A6TA 3L3GB 1P7QA 4JANA 2Q86B 3OKDB 2X4UA 4B0MM 3MBXL 3IDNA 2VISB 3HPLA 1JJUA 2JB6B 1J87A 3RPKA 2ZCKH 5DA0B 3HAEH 4G8IB 5ACMA 2X4NB 1SYSA 3NACH 3QXVA 3U0PB 3ZDYE 1Q94B 1OARH 3U4BL 1OAXL 3BSZL 4D0BA 5F3BA 5IV2B 2G75A 4DVRH 3L5XH 3LKRB 3ZYZA 3FO9B 1T1YB 1NAMA 1QBMH 3CSBA 5HDBE 5DHYA 3SDCC 1AJ7H 2CKBA 3O6MH 2ZKHH 3LY6A 4HCRL 2AAVA 4ZFZA 1C08A 3ES6A 3KPMB 1AFVL 4KVNH 3WUWA 1IEAB 3QNZA 1YEKH 4EIGB 3QUYA 4GRMB 2FLRT 2YPLD 3MGOA 5I6XC 4RX4D 3S34H 3LKPB 3TF7C 5FECA 5GJTL 3WNOA 5I1LB 2A77H 4YH6A 5C0GA 1H8OA 1CXLA 1S7RA 1WZ1L 1KIRB 3WEXA 4ODVL 2BC4A 3PABA 2EICA 4CUCA 2IG2L 2NY6B 1IAOB 1C5CL 5C08A 5JIHA 4OT1L 5D2LB 2EDXA 5HGAA 2F53E 2X9XA 4TNVF 1DUZA 4X8XA 2PW2B 4D8PB 4URTB 4A6YA 1QTYT 3MLXL 5I15L 5EOCH 4MXWL 3MRLA 1KPRA 3L7FA 3KLSA 5EIQA 3TBTB 5JDJA 3NIDE 5E94B 2WZPD 4OCNC 4M48L 5I1KH 4WI4A 5E8OB 4F7TA 4G6FB 1C1EH 2B39A 5FUZL 5TDOA 1PX4A 3Q3GB 2DQDH 3SDAD 2XWBA 1KTLA 35C8L 1K4DB 4FQQA 1KG0B 4XHJD 1T3FB 1MHCA 2OTWB 5J11B 2I5YH 4Q0XL 3IJYA 2B5IB 3GB7A 5HHME 4LFHD 3ZYIA 4HXAH 3TPKA 2KKQA 4J4PD 3JWOC 5KS9E 3K3QA 1NAMH 4GKNA 3BPNB 1C5BL 2AEWA 1KCRH 2KBGA 1EEQA 5BW7A 4EDXB 3CFIC 1XIWB 2EDLA 3HC3L 3INUH 1OB1B 2CR6A 3PGDA 4PP1C 3TA3B 3EJJX 2UV3A 3G04B 1EO8L 4XX1G 4NP4L 5CHNB 3DSFL 5I9QB 3WIFA 3LMJL 1L0QA 3O4LA 5C0EA 3WS6C 4YC2B 1PQZB 5BCAA 4OGAC 2EYRB 3E2HC 1OSZA 4NRZB 4ZUTA 1CICB 2VC2H 2AEQH 2FZ3B 5SWSE 2BK8A 2X4TA 2HWZH 4HQQL 1P5VA 5D1ZA 5C0RH 3BJ91 4L4TE 2ICEB 2QADD 4YHPA 4P2RD 3UZQA 1E4WL 1QFPA 4NOBA 1MHPL 1UJ3A 3SGJA 3OB8A 2NY0B 3X13B 3BRGC 2VZVA 1Q72L 5EBGA 2FL5A 5EOTA 1U8QA 1IMHC 1MFBH 3LIZH 1TCMA 3CVIH 4CADA 1VEMA 4JFDD 4XVTL 4ZUWB 4PJBE 3ZTNL 1V7MH 4JZJB 3VXRA 1I85C 1T2QH 4FQPA 2LU7A 5ILTH 3P4NA 1U3YA 1S8DA 1TENA 1EFQA 4Z5RB 4XAWL 4CN4A 2BNRA 2Z35B 1ITBB 1A0QL 4L29A 1TETL 4QRTB 5E8DL 4P2OA 5DURB 3NFNA 4HS8H 5J89A 4KWUA 1A4KB 1FL5A 3ARBC 2SEBA 2ZG3A 3T0EB 5EZOH 1XIWC 3PP4H 1GOHA 1DANU 4HUUA 4KROC 4RA0C 4Z7VA 2E9WA 3F6IA 1VSCA 4YBLB 3T65B 4JGMA 4QHKI 1CGSH 1DQDH 5C09D 3R8QA 1FO0H 3ARFB 5KSBF 3SGDI 4Z77A 5I9QC 2HLAB 4NDMA 3CPLB 4JQIL 4G8GB 3KPOB 3PHQB 3OX8A 3IU3B 3DNKA 5I0ZA 3DUHA 4I77H 4OCRH 1ZWIA 2R2HB 3IXAB 4G42B 1NCBH 1P2CB 4LRIC 5DEGA 4HIXH 3BAEH 2QSCH 4OJFH 1H3VA 4JLRB 1ZVHA 3HRPA 1A6AA 3MV9D 3D0VB 4XZUB 2Y07L 2NY0C 3P73A 4X9FA 5D72H 4QRSB 4JO3H 5DLMH 2VUOA 4Y19A 4OZHB 3HZYB 3P77A 3F7PC 3RY6A 5IF0A 3ZO0A 5F88A 1L7TL 1R0AL 1NFDB 3CH1B 2Z31C 5HYSG 5TQ0L 5KTEH 3H9SD 2ITCA 1BVLB 1SMOA 5JO5A 4HKZA 4O9HH 2DBLL 5F7DB 1FRGH 1UZ8A 2J8UE 2YUZA 3SKMA 1FZJA 3RDTB 1QEWB 4LLAA 4I2XA 3PHOB 1MCEA 3OF6A 1NFKA 1BOYA 5H35B 3T0EC 2ZJSH 4JFEE 4U49A 4HGKC 2O5XH 1MI5D 1MCIA 4KAQL 2O5YL 1JPTH 3IETA 3QWRA 3CAFA 1S9VA 1NFIB 3MA7A 5D93B 5LAXA 1EAJA 1RIVL 1BEYL 4PP2B 4UNVA 3DMMD 3V52H 5C0CB 1AIFA 1F4YH 2NY3B 3GMRB 4K7PX 1FNLA 1UWXK 4MXQC 1FG2B 4WDIA 5B39B 5JOPD 2CRIA 4MHHG 4G3YH 1OAUL 3OB0K 5DVLA 3CZJA 4EXPX 4N1HB 3JWOL 4QY8B 4RNRB 3U0WL 1NBVH 3VRLE 5EB9A 3MACH 1A4JA 1HSBB 3L3DA 3TT3H 2BRRH 3BPCB 4S2SB 3TZVD 4YHIA 3TBVA 1I8MB 4AIZB 1NGQL 3ULSB 2V2XA 4X7TB 1RZKH 3IFOA 4FQXA 3VG0H 3IFNH 5FEBA 1KJVB 3WLWC 2FWOA 1IC4L 1AXSB 1OLZA 3CK0L 4M6MH 1UYWH 3ARWA 1B0GB 1BD2B 4LSSL 4K23L 2P24B 1H5BC 4YDKL 1Y6NR 2Y5TA 2J6EH 1A1NB 1PSKH 4MCYA 4P2QD 4BH7B 4PJEE 4XXDB 4QTIL 5JPNB 3VG9B 1IL1B 2JLLA 5DK0B 1OGAA 3G5YB 3HUJE 3WIIL 3LHPL 5KVEH 4FQCL 5DRNA 4LGSB 3LKNB 4KQ4H 3CDGB 2R9HC 2GJ6E 1ZANL 4NQDA 5CUSL 4O4YL 1U3HD 4F7EA 3CCHA 4ERSH 2QQQA 4Y5XA 1UVQA 5F7HA 1WITA 1MHEA 3HC4L 5FCUL 4YHLL 3LEYH 2APXA 4M43L 5HDQH 2H3NA 4HGWB 3MV7E 1I9IH 1M6OA 1UXSA 5F89A 1F8TL 5BQ7B 1BPVA 2A6DB 1BQHB 4PY8I 2AXJA 4UOW1 5EUOE 1PLGH 3BGFB 3JV6A 1IAII 1I8LA 2RFXA 4NO0B 2NLJB 4P9ML 3MJ7A 3MA9L 2D4FA 2YD8A 5GRVK 3OZ9H 4J12A 3C2SA 4YFLI 1WIOA 5DEFA 5DD5H 1ZGLM 2AW2A 1P4BH 3GJEB 2CLZA 4LCIL 5GGVY 2Q7YB 1ZTXH 4TUKL 5DJDA 1TCRA 4U1LA 4AT6A 4ELME 1D6VL 5KSAB 1U93A 4KZDH 4HPOH 1FBIL 4PRPD 3VD5A 3ZDYF 3VWJD 4NFBA 4KUCF 3PWPD 3QEHB 3VG9C 4YHKH 4ORGA 4XRCA 3DX6B 2G5RA 5HDBF 4M4PA 1OPGL 1QBBA 3WFEH 3VDAA 2IH1B 5BVPH 3BGMA 4RGNE 3FFCB 2KQNA 2P5WE 1T1WA 3CC5B 3KNBB 1RZFH 3QDGD 4HZLA 3U46B 4PJDA 4U05A 3RUGE 3LRSA 5FM5O 4I8DA 3BO8A 3NPSC 4P4RA 5GGUA 3ZT7A 1T1XB 4OGYL 4KHXL 3RQ3A 5FGBA 1NGPH 3QHFL 1RV6X 1J1OH 2VL5A 1N3NB 4YAQB 4WUKH 1AE6H 1BIHA 4G7VH 5E1AB 4JY5H 3KR3H 4K2UL 4GG6A 4PTUB 5CKAA 3W11D 1W8NA 3L3JB 1G84A 3BGFC 4LPUA 1VFMA 3ESUF 3FOLB 4LPCA 1WJ3A 3UJJL 4CNIB 2YD7A 3NIDF 5GS1A 1N2RA 3VH8B 2V5MA 1FPTL 2XTJC 2IPKB 5ID0B 4PRDA 2Q8BL 4JO1H 1FFQA 5FB8B 5IBLD 2VLKE 2WUCH 5E03A 5B38A 1U8KA 1UGNA 2I60L 3R0NA 2F58L 5IWLC 3ULVD 1CD1A 4C57C 5KSAC 1M7XA 2AQ2A 3DIFA 3H7BA 5EU5B 2X44D 4JZNA 2GK2A 2F54A 2JELL 4NC1C 4UT9H 3RTQD 3VD9A 5EZLA 2NYYD 1JPSL 4ZFGH 1T4KA 5DS8B 5IMMA 3TBSA 3SDDD 3TN0C 4K94C 5KS9F 1BMGA 3B43A 2BNQA 5D96B 3T0VA 1IGJB 4LSPL 1WBXA 3TPUB 2A1WL 4HEME 5CGYD 2Z0BA 1QO3A 2P8MB 3KDMA 3TWCH 2P45B 2Y72A 2YD9A 2QLVB 3FT3A 4Y16D 3VI4F 4NO3A 5FYKD 3QZWA 4FA8A 2EH7L 5EZIL 3RHWK 2AJXH 1SMAA 1ZMYA 2VQTA 3FQUB 3W9EB 5JORB 1NUDA 1KB5A 1NANI 2GFBA 5FHAH 1FZKB 2P8LB 1SJXA 4Z95L 5E6ZA 4M8QB 3AVEA 3G6JA 1W72B 4LSVL 2AJSL 4YXKH 4ODUB 4P46D 1NSNH 4W70A 3CD4A 1J05A 3RL1A 3BT2H 2FEEI 1MCOL 1N6QL 1MQKH 3EYVB 1KN2H 1RZJH 4OLZH 4DN3H 4DOHB 3CX2A 2BVOB 3GNML 1FSKC 2R4SL 1HQRA 5C0BD 1OWWA 5KSBB 5ISZB 15C8L 1FC2D 4WFEE 1FNGB 5I2IA 2E7HA 4MSWB 1QLRA 4PJBF 3LPGA 1KLGB 3QIUD 3BDXA 5JIKA 2YPLE 5SV4A 3ZHDA 5E9DA 1VCAA 3GRWL 2AERT 3OKLB 3HE7C 1JPFB 3ARYA 4OUOA 2JTDA 1AD9B 3W9DA 5E08L 4YE4H 5CINH 1V3LA 3DRTB 4NT6B 1X5ZA 5D96C 1FLTX 3DWTA 2PO6C 2YD4A 4HWNA 4QRPA 2XWJA 1PZ5A 4K7PL 2D3VA 1OW0C 4RGMB 1FYTB 4FABL 2XT1B 2ATPB 1A6VH 4KUZH 3BFOA 4HT1L 3IVKB 4LCCA 3GM0A 3WN5A 2LV4A 5SX4H 2XKSA 4N8CL 5F7FA 3REWA 1JHTA 2ZOKA 3P11L 1FNSH 3MLRL 2VOTA 4NNPH 2AK1H 4ELKA 5K9OA 5T3ZD 4Y4FB 2VUYA 4XP5L 1T7XA 4Z76A 2VH5L 4OFYD 4WGWB 4KGLA 2VE6A 4FQ1L 4EZMA 3GK8L 4D9LL 4RAUB 3C8KA 2YD3A 1ZA6A 1Q1JH 1WZMA 3MRCB 1FJ1A 4LF3B 5FM8A 2VQUA 2ENYA 4LLMB 5E6YA 2XZAH 4PJ7A 2Y7QA 4BZ2L 2XN9D 1XAUA 2OS7A 3BWAA 2Z8RA 3G5VB 5EPMA 5EC1A 5GZNC 5EU6D 3TCLA 3C5ZA 3FMGH 2MQ3A 4JR9L 4JG1H 4V1DA 1NCDL 4JQXC 1XF1A 3RY5A 4OB5H 4QHMA 4NZTH 1U8MA 5J6GB 5JUEL 3UJTH 5CCKH 5HBBA 2AKRA 1AO7E 1LP9A 5IQ9B 3IDIB 3MMEB 1TPXB 1VHPA 3W39B 3QO0A 4HH9A 4ONGH 1GOGA 2NXYD 3HRZB 5T5FL 3ARBA 2NXZB 1DLHB 3CU1A 1GZPB 4U3CA 2ZUTA 2FIRT 3O45B 4GRLB 1TZIB 4KZEL 4M7KH 2PXYB 1LO2H 4PJFF 4OCXH 4EDWL 1AQDA 4F8TA 3G5XA 3H9HB 5KVDH 5DJ0B 1B0RB 3L5WB 5DGQA 3X3FL 2X41A 3MROA 5F7NC 4HKJB 5IBTH 4RMRA 1MCQA 4ZOAA 4MQ7A 1NKRA 1GGTA 4Y4FC 2E8ZA 4LCYB 5DK2A 1CGXA 5SWZB 1R5IB 2N7BA 3JTSA 5IHZB 3K2UH 1ONQB 5KVFL 4LRIA 4KRMB 1HI6A 1LEKA 3VFPB 3MRHA 3K74B 5L88L 4PJ8B 1IT9H 1HE7A 4K94L 5D2NB 1A7QH 1DQJA 1E0OB 1WEJL 4BFGA 5BJTA 1L7IL 2DQFA 3QHZL 2BSED 5F96H 4CVXB 3UTZB 4YHYB 1J1XL 3NBNA 1WAAA 1ERNA 4R7DB 2IF7A 4G6AC 3RI5K 4WU7A 5GIRA 2VXQL 2PCPA 1OSPH 5E5MB 3MLSL 2L4OA 4NQED 5FUCE 3VXNA 2Z31A 5D7JB 2JB5L 2Y6SC 5KAQF 4KK6C 5DD3L 1DZBA 3RWHA 5IQ7L 5HHOA 2HVJA 1U8JB 1TPXC 4KKBD 2B4CC 5H94B 4IRSD 1EXUB 3MLTA 4FOMA 3DROA 2NXZC 2HTKC 3FKUS 1AC6A 4ZSOE 3RKDD 3HMXA 4FFYL 4GBXD 5IP4A 1CTOA 1MWAA 1YYML 2FRGP 2WK2A 3N9GH 4KI5E 1GIGL 4AJ0A 1UM6L 2AI0L 4JDTL 3OJDA 4YDIH 4WY7L 1WCBB 4Z7OE 3DX7B 4NUGH 4WW2C 1PYWB 1A9EB 4PJCF 4UOW0 1XH3A 1LK3L 4YFDB 3WSQH 3UAJD 1KGCD 3KPTA 3LSOB 4WO4C 2MOVA 2D4DA 2Z8SA 4ODHL 5I8EA 3U48A 5DMKB 1D9KA 1J1PL 2G9HB 3VXUA 4X4XA 5CJQH 3LD8C 3QUXD 4G8EB 2FX7H 4BSVA 4JG0L 4G9FD 1OAZL 4PB9H 4QHNB 4IRJD 4BQ9A 4NZDA 1IGML 5D2NC 5EUOF 4AK1A 3GMNA 3T77B 2BJMH 1K6QL 4JJHA 4NBYB 5D70H 5DUBB 5I66B 1OLLA 1D5MB 3S36H 4LGRB 2LE9A 5JZ7C 1Z0NA 4OZFH 2C1PB 4TRPL 3WFDL 2XZZA 3OHXA 4YHYC 3IRPX 3BN9C 4D9QD 1RI8A 3GSXA 1A6UH 3STLB 1NL0H 4F58L 5AYUL 2A6IB 1S7TB 3OR6A 4KDVA 4KI1A 5D7JC 5B4MD 3A6OA 1H5BA 4ELMF 4XP6H 2VZSA 1DBJH 3TNMA 1GAFH 5DJXB 2F53B 3F6LA 4ZDHB 1Z9LA 1P7QD 2VQ1B 2VLMD 4HWEH 1W72L 5TH2A 3HI6H 4GKZA 1JBJA 2E6PA 5INCA 3OKKB 4NM4H 4S1QL 4XVSL 2JJUA 2HTLD 1I7RB 4IOIA 2R2BA 2HT4D 2YK1H 1WWAX 2DL2A 3O11A 4JO2H 4K8RC 3HMXH 1HDMB 3QUZB 1SYVB 4X9BA 1RUKL 3RUGF 1UQSA 2WAHA 3HHRB 2P1YA 3I2CL 2GTWB 3BDYL 4PV8A 4HBCH 1T66C 3CFJA 5IT2H 2HFEA 4LAQL 2YSSB 3MO1A 2B1AH 4XBPA 1YEEH 3PL6D 5HHMB 4ZTOH 1YEIL 4DZ8B 3S96A 4HULB 3L6FB 5KS9B 5JXEA 3JV4A 2YBRA 3BKYH 4NYLA 3Q6FB 4F3FA 5JW5B 1I75A 5C3TA 4ISVA 1ZGLB 3V5DA 5ADOL 2DQGL 3RZCA 2R23B 5HYEA 5C08D 2J88H 1P4LB 4OLYL 3C9NA 3ZE0E 2VR9A 1N0XH 2V7NB 1MREL 1HILB 2C3WA 3NN8A 2DYPD 1HKLH 1P4IH 3LAFA 3VXQB 4MDJA 5A2JH 4ODWB 5E8PB 1FGNH 3CVHH 3T4AB 5SWSB 3T0WA 1G7JA 3IAPA 1FZOB 4TUJA 4GMSH 1OAYL 3SJVA 4L4TB 4EVNB 1OCWH 4OD1L 4NCC2 1FNHA 3S4SA 1IAIM 3VXPA 1P5UA 2NCMA 2KDGA 5BS0A 4CW1A 1CLYL 4YPGB 3DYMA 4MAUH 1YNLH 2HH0L 5F3HB 4XC3H 2ZCLH 3CFDA 4NKDB 1A1OA 1JTPA 5F9JB 2V5SA 4PRAA 5KZCB 3GMPA 1P84J 1JFQH 4PJBB 5FA4A 1S5HB 4NWTH 5INDB 2H32A 4R90H 4C58B 5ERWA 2VABB 1NGZA 1T04A 5IB3A 3LB6D 4JHWH 1UFUA 4PJHE 2FLBT 3WL9B 2DDQL 4XCCH 2B4CL 2Q76B 1Z9MA 2XKNA 1BAFL 4XAKE 2JCCE 4PRPE 3CDFA 5F1OB 1KENL 1AXTH 5IIEA 2DQTL 4XCYA 4CMHB 3O4LD 1F97A 3E6FB 1TZGH 5TGBB 2XFXA 1ACYH 2ZOLB 1M71A 2M1KA 1L4IA 3U9UA 3N1FC 4J3OC 4JN2A 2H2PC 5J6HB 1Q9OB 5GISH 3QI9B 5D1ZD 4KMLB 4ZS6D 1S7QA 5JXAH 1AGBB 2JK5A 4E41E 2VRAA 3DJ9A 3EOBA 4ZAKB 3QPXL 3TLRA 5TE7H 2XQBL 1RUAH 4OF7A 4KJPC 3HE6A 3TN0A 1X6LA 1YMMA 5C6PB 4Q9RL 4R97B 2GQHA 2ZSWB 4LLQB 4W4NA 3T4YA 2J3SA 3KJ4C 3IAQA 4XP4L 4ZUSA 3VXRD 32C2A 5GHWL 4G80A 5C7XL 3IDXH 2EE2A 1PDKA 1CK0L 4KKLC 4P2CG 4JCMA 2BNRD 2P49B 4KY1H 4ODXB 4XNYL 3U2SA 4N9GA 4WEUD 3CSYB 3KPNA 3NFPB 5IK3B 4P2OD 1LE9A 3HZKA 4NFCA 1BIIB 2R2EA 2XV6B 1AGDA 5ESVA 4E5XB 3LVEA 1F4HA 4ZXBA 2J8UB 1BFVL 5J57B 4C56E 1A7RH 1HYSC 4JY4B 4FQIH 5FYLD 5D6CB 2A83B 1X3DA 2CXGA 3X12A 1GCFA 3S5LA 4O2CB 1NCTA 1UM4H 4JFEB 3L3KA 5CP7A 1I8KB 4R26L 4P48A 1FL3B 1NGYB 1UWXH 5GGRB 4K8RL 5ADPL 2A9ML 4OGXL 1E27B 2V7HB 4MNHA 1XGQB 2YKLL 4PLNC 3QBTB 3WJLA 1IAKB 2FGWH 5K59E 5B39G 3QI9C 2J4WL 1BJ1H 5DFTA 4Y5VC 3VFGL 2G60H 2HLFD 4XNQA 5I8KH 4Y4HA 2VDQH 2AEIT 3ZKQD 4XPBH 5E5RB 3HE7A 4TUOB 4H25A 4ZAKC 5FYKE 3STBA 4HDIA 2WIIB 3UX9B 4Y19D 1FAIH 2Z92A 4OFDA 1IQWL 3U7YL 3VXOB 4QOKE 5TQ2H 2PO6A 2QR0B 2GHWB 2XQYG 1YEJL 3WIHH 1OW0A 4JHZA 1S7WB 5E0QA 1S7SA 4PV9A 5C6TH 4B7IA 3C6LA 1HXMB 3EDKA 1V3MA 3FQTA 3HB3D 3HZVB 2A9NH 3C5JA 5DD1L 3FB8A 5IR1A 1IARB 5CSZB 3OF6D 4R8WL 4ZQKB 4DN4H 4P57B 4PJ5D 4PLJD 4PJEB 3M1BA 1PKQE 3QA3A 3O6LH 4PFEA 5SWQA 1NBQA 1E4XL 1ZS8B 3ZDXE 2OL3B 3HUJB 1TQBB 3QWRD 1UM5H 1IGYB 1ZT1A 1AGCB 1ZT7A 4FS0A 3EAKA 5IGXL 2FD6H 1AGFA 2FDBP 4MD0A 5TDNA 4LSRH 2X1WL 1BP3B 2GJ6B 2OCFD 3IDMA 5L8KB 1IC7L 2HJKA 2WWKO 4F80A 3FRUB 1GYAA 1A3LL 2DS4A 4Z7NE 4FQLL 3EZJB 4M5ZH 2WNGA 4TTGA 4LP5A 4PGEB 2WINA 1A7PH 1SJHB 5BO1H 3WLBB 1VERA 4DWHA 3MV7B 1J86A 4H8WC 2DQUH 4MJ6B 2ZPKH 5KBNC 1KIPB 4NUJA 4O51A 4FQXD 4KTDH 5EUOB 5I1GL 1NLBL 5ECJE 5IM7A 1OOAA 4PYHA 4KRPB 2EIDA 3IDUA 4HS3B 5EU4A 4H20L 3M8OL 4KI5F 2OZ4L 3A6CL 3L9RA 1G7MA 2FYYA 5E2WH 4Z7OF 4PG9B 3D85B 2V5YA 2VDML 4WNQA 1DSFH 1MJ7L 3I9GH 1OTTC 2NZ9D 2OLDA 4ELMB 1OGAD 3MCKB 2XXMB 2PTUA 3T0BA 1I7ZA 4YIQB 5E00B 3DX9B 2FX9L 1MSPA 5IHUH 2Z4QB 2F74A 5A2IH 3EYFB 4XB7A 5AD0A 4UIMB 2BERA 4HIJA 2CDEA 3P4OA 5IJVA 3DBXB 4H0HB 1QNZL 3L1OH 1TQBC 4NQDD 1CLZL 3D25A 1AKJA 1CLOL 1NC2D 4RGNB 1ED3A 4NJAL 2P5WB 5AZ2L 4O2FB 3L3HA 3OPZL 1TLKA 2NNAB 3JWDC 3RUGB 3IFLL 3STZB 5E99L 2WW8A 5I1EH 4F7CA 2R1WB 3VFTB 4GKOA 4MDIA 3F7VB 3ORJA 3ULUH 3MRRB 4DAGH 2HT2D 1O7SA 5FGRA 4Y1AA 1R3LA 2DLGA 1WFNA 4MAYC 4FXGA 4WTXA 1AD0A 3JUYA 4WFHD 5FO8B 4L4VA 4KMQA 5F1NA 3FCTA 1WC7B 5EC2B 1CDIA 5F7EH 4X7DC 3VH8G 4OZ4B 1GZQA 2WBJD 2HJFB 2C3HA 2VZ3A 3MGAA 5L6YL 5HHPB 3EOTL 1S9XA 4G6KL 1P1ZB 1SBBA 3L5JA 4MQTB 2VLKB 1LK2B 1WTLA 5D71H 4OIIL 4U1MA 4G8FB 3L95A 1OM3H 4HIHB 4WW2A 4MLIA 3VI3E 4LSUH 3GSQA 1FIGL 4RAVB 1KCKA 4FQJH 5D1XC 2HKFH 4Z6AT 4WO4A 6CGTA 1NBZA 1HQ4A 2AGJL 4DFIA 5I76B 3PJSB 1A6PA 5C0IA 3QEQA 4KQ3L 5HGDA 3SE4C 5ID1A 4DKAA 4NQEE 4X5XA 4H26A 3U7WL 4N0RA 4PLKD 1YDPB 4NRYB 5ALCH 5E8EB 4ZO9A 3T2QA 3O8XA 1KEMH 1P7KA 1HWHB 1K5NA 2OMBA 1T83C 4YGVA 1A02N 1A1MB 3MCLH 3SKNA 4FP8H 4LEOB 2CO7B 4M6NH 5JR1L 2BSRA 3L7EA 4HIEB 4KHTH 4XMKL 4OBRA 3BP4A 3OWEA 2BCKA 2XQYK 4KU1A 4N0UE 4X9HA 4MWFB 4PS4L 3UO1H 3UBXA 4GSDL 5IW1A 4YQXH 2R0WL 1KNOB 2ED9A 3KJ6L 3LDBC 1JF1A 3QG6A 1W2KT 4RISH 5I74C 4NCDA 5F6HI 3G5ZB 1D5XA 4LLYA 1RZ8B 1I1AD 3VXSA 5DR5L 2CK0L 5B3NA 5CD5D 2CDFA 4MVBC 1EIBA 5I16B 4OAWB 1CXKA 3F7YB 1T0MB 3FT2B 4XI5D 2E27H 2YRZA 4JM2F 3T8XA 4XBGA 4D9RD 5EORH 2FJGA 1A64A 1JUFA 1TMCB 4BQ6A 4ETYA 1FNAA 4PJAA 1QFUH 1NMBL 3BE1L 3O3DB 4XC1H 5EU7E 5TPWH 3O6FA 5IVZA 5IMKB 4RMQA 1RAMA 3IDJB 2YPLB 1V8HA 1LE5A 4D9QE 2B1HH 3DXAA 4APQB 1MVUA 1KACB 2BNQD 3A67H 4H8WL 5CSBA 3TT1L 4PJHF 1KFAH 3R06B 1YEGH 4MA1B 4M7LH 3QXUA 2JCCF 4HK0B 5ICZA 4KK8D 3KPQA 1JZ2A 2L7UA 2P42B 4PRIE 4QKXB 5DSCB 1N5YL 4HKXB 1HHIB 5HHVL 4WV1B 1JHLL 5FM4A 3GMQA 3GSUB 4HS6A 1OAQL 1QBLL 2EE6A 3G08B 1ZLUK 5DVOA 5ALBL 1TQCB 1BF2A 2FBJL 3S35X 2JF1A 5D1QD 4ETQA 3DYPA 3O41A 3MV01 3GSNL 4GG8B 2X4RA 3WNNA 3U0TA 1EAPA 2DKUA 2YPVH 2EH8L 4TNVK 4LIQL 3MODH 1BGXL 4LAJH 3NABH 3CXHK 2OL3L 4XCEA 5AUMB 4W6XB 3OXSB 1JWMA 1M7DA 5DQDH 3BH9B 4JKPL 2VDNL 1CE6B 4AL8L 2R0LL 4UIKH 1RFDL 3KYOB 3JWDL 1U8IA 1F90L 4U6XB 5J9PB 5BV7B 2PR4L 1TVBB 1E6OH 3VA6A 5T1LA 3AGVA 2DM4A 3OAUL 3BUYB 5HGBB 4MB4A 3MRPB 1GC1H 1NC4B 3ILQD 3MLPA 3ABZA 2DTSA 3CLEL 1NMAH 5IB1A 1AO7B 3K1KC 5C08E 1U2CA 4L3CA 3OKEB 4IS6A 4LVNC 3EDDA 5HYJA 4JJ5A 3DGGB 1F2QA 1Y0LB 1FP5A 4S1SH 5CJXA 5E8NA 4P5TA 2H6PA 4WWKD 1T22A 1W0WA 3AU1B 5DFWH 1WTGT 1CG9A 2X7LA 2AJ3B 3BSZH 1OAKL 3RX5A 2QADB 4S0SD 5EWIL 2CRYA 5EH1A 1HHHA 1XF4B 4X7SH 4PPTA 1JN6B 1JI1A 2P5EA 1TQCC 4JO4H 5HPOA 5K59F 1MRCH 4X98A 4HFUL 3WHE1 3KXFA 1MQ8A 1C5DB 3PWJA 2J5LC 2CIIB 2W9EL 1AGEA 3SDAC 2G2RA 4R7NA 5FK9A 2HN7A 2PTTB 2F8XC 4XHJC 3MTRA 3X3GL 2QQNH 4GRWF 3ZE2E 2H2SD 3C5ZD 1UC6A 2EEAA 3ZYOA 5DJYB 5GRJH 4NFDA 5DJZB 1CZ8H 1KCUH 4V1DD 5C8JB 1WZ1H 3QJFA 4HPYL 4J4PC 4XMPL 3EUUA 1KXQE 3BEVA 2BRQA 4HUWA 3KPSA 1FYHB 3RNQA 2C4FT 4CU7A 2X1QA 1RJZB 2VJXA 5DHVA 3SBWC 4JFPB 4JFXA 2R29L 2AXGB 2NQCA 5EN2A 4HWBL 2W59A 4MXVF 3E0GA 1FV1A 2BVEA 3O3AA 5DUML 1IEBB 3EOAB 3ZDXF 3OGOE 1BFSA 3HR5B 2IQAB 2DI7A 1OHQA 5DHXB 5DJ6B 4ENED 4FQ2L 4ZSOB 1X9QA 3TH4T 4F8QA 5CBAA 1I3VA 1WLHA 5C1MB 3AREC 4JPIA 2VDRH 1JMXA 1YNTA 3HZMA 2QADC 2EDFA 2QQKL 4MZ3A 1JRHL 5I18L 2OMNA 4XXCC 4OD2A 3FHQA 3VXRE 5HGHB 4I48B 5EFIA 5CJ5A 4Y5VA 3EFDH 3RWFA 1HIML 4YX2H 4LP4A 3WKMH 2FH8A 3RGVC 5F9OL 2D7PA 2X40A 3AUVA 5HHNA 4L8DB 4XH2A 1KPUA 3HC3H 4F37F 3QT2A 5ESQA 8FABA 2F5AH 2WLYA 1I7TB 2H8PA 1H3PL 1BQSA 3U9PL 1XGRB 4NP4H 3DSFH 4WU5A 1IKFH 1R3IH 5E2UL 5FYLE 1SHMA 2MHAB 4Z7VE 5FUOL 4R4FL 5DQJA 2WIMA 1S9WA 4OF3A 4KJYA 3LKOA 2V2WB 4X83A 5HHOD 1H3TA 3S37L 1S78D 1YYLH 3D2UA 1MRDL 5FUCC 4Q9QH 3HCVA 4NC0B 5CIPB 1RULH 3SOBH 4ONFL 1ZHLB 1ZXQA 4PGBA 3DGCR 5DJCB 2X09A 2LABA 4G5ZL 5DRXA 5DHVH 1BWMA 3Q2CA 3MRGB 5KVGH 3QJHB 1YY8A 1MLCB 2HRLA 4QRUA 5TE6H 4L3EA 3WMSA 2A73A 5ESAB 4FTVA 3BISA 1AP2A 1U92A 4XVTH 4PJGE 1XR9A 1W0VA 5C0FA 4M3KB 4UTBH 2BOBB 4BSWB 5CEZH 3RVVD 4ODSH 5ITFA 3VXTB 4Y19E 1GGBL 1D9KD 4U7MA 3PV6B 4WGVB 3VXUD 1X5AA 1ZEAH 3TZVB 3FQRA 1IJ9A 4IMLA 5EBWA 1T1ZA 2IAND 1OWRM 1R3HA 3ARTA 1JHKL 2YMXL 1B4RA 3VGAC 5I1CL 3EFFA 3FOMA 1KEGH 1F6AB 3F12A 4RBPK 1NLDL 2VISA 1FORL 4P5KB 4RQQB 3RVXD 4G8IA 4I2XE 4MJ5A 3MRIB 4M1GH 4MJID 4H5SB 4HC1A 4HF5H 1HOCA 1PGRB 5F9WC 5EU3B 1YEFH 1BLNB 5TE4L 3U30B 1B9ZA 4QHUA 1YA5A 5SX4I 1HHJB 1LO5B 1MRFH 4YXHH 4KKCD 3RAJL 4I3SH 4QEGA 4XWGL 4HMEA 3WNPA 4NQSB 4FFZH 4BUGA 2Y07H 1VADA 3GSNA 4K3EH 4KMTL 1K3ZA 3GIVB 4X6EA 5F1IB 1T03L 3PV7A 3DMMC 4DGVL 1F45A 4WTZA 4P3DB 2XA3A 4NKOA 3P4LA 1IAIL 1EGJL 4JPWL 3QIWB 2JIXB 1QR1A 1KF9B 1L7TH 4MQSB 1EV2E 3V7AE 5TQ0H 1MOEA 2W0KA 3WYRA 1DN0A 5LWYL 4CMMB 2PW2A 2GI7A 3RU8L 4D8PA 1KIQB 4OI9A 3TZVC 4NO2B 1L9NA 3AY4C 3IGAB 3VFVB 1ZA3B 3MUGA 4XPTL 4XTRD 5IFAL 5JXED 5DC0A 5BZWA 5IFJB 5E8OA 4HUMB 1VFAB 2DQJL 3ARVA 2I9TA 4PJHB 4Q2ZA 1CTNA 4MAYA 3MX0A 1A14H 5C9JB 4BH8A 3GHBL 2JCCB 4M02A 4PRPB 3RZCD 4Z7QE 4LKXB 4PJXE 2Q6WA 4AIXA 4TSCH 2R1XB 1T6WA 2R4RH 4B50A 1RIVH 4D0CB 1AY1H 4W68A 5CZVH 3OGCA 1R5WB 4TULH 3EO0A 1LD9B 4UQ3B 3U30C 3MXVL 1UZ6E 4LHQB 5EIIA 2AABL 3T3ME 1A7BA 4NKMB 3MRKA 3AS1A 1JGLH 2XZQH 3ILPA 2UYLA 3TFKD 3AROA 2GITA 3U0WH 4N8VA 5D1XA 3VXMD 5JLZA 1GGCH 5HYFA 1XCTB 1U3HC 4OFVA 5GRYA 4ZTPL 1QA9A 1FL6B 1T7VA 4L8CA 1KJ3H 1JGEB 3D6GA 4E41B 1NGQH 5LGJB 5IHLB 1TVHB 4X6CA 1LDPL 3M45A 3G04A 5I1AA 2WMPA 3U6RB 3FTGB 2HVKA 2NTFB 5DD0H 1CE1L 3CK0H 4XPFL 2XWTA 1LO0L 1PQZA 1IC5L 2EYRA 4CJ1A 2R8SH 4K23H 3S8WA 4WFHE 3D0LA 1OGTB 1J0JA 2GSIB 4OLWL 1CU4L 3V5HB 3QFDA 4NBXB 3DO7A 1AQKH 2NY1D 4XPAL 4OV5B 3MUY1 1AR2A 1NEZB 4QTIH 4WUUA 1T0NA 4B5EA 4MNGA 3TYFA 5MEPB 5HSFA 3I6KA 4MA3B 2VLJD 1IM9A 3CXHJ 4WI7A 1RK1A 3V4VH 4C56B 5C07A 5I8CB 5DMGD 5F44A 1MAML 5CJ8A 5GGSA 4HWBA 2XZCL 5KSVB 5T3XD 2DIAA 1RU9L 2ATKA 1RMFL 2AV7B 4X4YA 2FH6A 3MLUL 3VWJC 4GO6B 4P9HH 2FJHB 3RTQB 4JEGB 1L0YA 3IFPA 5TFSH 3HC4H 1V5JA 1U6AL 4M43H 3TBYB 3SDDB 1U8LB 1WV7T 2UUDH 4LCUA 4PJDE 1XGPB 5DWUL 3D3VA 5KOVC 4XNXL 1BZ7B 1IC1A 4Z7UA 4QRRA 1ZHBA 4LNRB 2OQJB 4FNLL 4X80H 2A6JB 4LPVA 3GO1H 5F7YC 1K3IA 3I84A 3HE6D 1ZLSL 2ZCHH 4P9MH 4W81A 3KYKL 3MA9H 3IJSB 4GG6E 2FEDD 3NCYS 4GAYB 4Y16B 3LS4L 4U6YA 3OKMB 4LCIH 4DZBA 1ZT4B 4QHLA 2FEEL 4XNZC 5DZOA 4QOKB 3WHE0 3TO4A 1CL7H 3IXAA 4G42A 4O2EB 3W11C 1EEUA 1SM3H