1DMQA

Crystal structure of mutant enzyme y32f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
molecule keywords STEROID DELTA-ISOMERASE
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmqA00
3JUMA 2XSHB 3G0KA 1ZO2A 3DXOA 4WWUC 1NU3A 1OCVA 2GEYA 3EN8A 1GYBA 3T8UA 3KE7A 2W2CA 4WYKB 3B7CA 1SJWA 3MHEA 3OX9A 1O7WB 4K1VA 3SEDA 2XRXB 3EHCA 2CHCA 5KP4A 3FLJA 3BLZA 5IG3A 4WP5A 5IG4A 3MG3A 1QMAA 5IF6A 3EC9A 6STDA 1ZX2A 3GWRA 4XDWA 2B1XB 1JN5A 3FF2A 1E97A 1JKGB 4U13A 3EF8A 1OHOA 4L8PA 2IMJA 5EVHA 5KP3A 8CHOA 3SOAA 1JB2A 5CLKA 1GY6A 2R4IA 3NXJA 1ISKA 2QIYA 3RGAA 3H3HA 1EG9B 4STDA 5D83A 3LYGA 5AEUB 1NDOB 4R1KA 1K41A 2INXA 2HMLB 3VGNA 3UNLA 3HK4A 1OHPA 4HKVB 1OGZA 3GZRA 3FZWA 4I4KA 2HMJB 2XR8B 3K7CA 3B4OA 3G8ZA 4FCMA 4K1UA 2QGUA 1WQLB 3GZBA 3F40A 4X2OA 1C7HA 4HJLB 4OUQA 1O7GB 2HMOB 1Q40B 3MYTA 5HGRA 3DM8A 3KKGA 4J8TA 4XBTA 1JB4A 5CXOA 3Q90A 2XSOB 1OF5A 3GZXB 3NV0A 4IIAA 3MSOA 5AIIA 1JB5A 3B8LA 4XM4A 4L7KA 4HVNA 5DREA 4XDVA 5CF1A 5AEWB 1E3RA 1CQSA 3IPTA 4LGQA 3NHXA 3OWUA 5D81A 3GRDA 1GY7A 4XBYA 1W00A 3S5CA 4HM4B 4PEJA 3CPOA 2K54A 4N3VA 3NM2A 1AR0A 5TGNA 5IEPA 2F86B 3HX8A 1W6YA 3DUKA 2GEXA 3DZLA 4GB5A 5IERA 3JUPA 5JPUA 1OPYA 3EJVA 4KVHA 2F99A 3EN1B 1IDPA 2Z76A 3ER7A 2YFLB 3VSYA 1OUNA 4LMIA 2YFJB 1O7NB 3NBRA 2BNGA 4HM3B 4RZMA 5D82A 4J9AA 1ASKA 5DRVA 5IEOA 1S5AA 2Z77A 4FCJA 1HKXA 5G2GA 2UX0A 3F8HA 1W02A 1BUQA 1OF5B 1W01A 3ECFA 1U5OA 2RGQA 1O7PB 3NV0B 1DMMA 2BMRB 2STDA 4R9LA 1UUWB 4ORLA 3NUVA 3EBTA 3F9SA 3RGRA 1GS3A 2JQ5A 4H3UA 3JUQA 1OH0A 3STDA 3FGYA 3MG2A 4HM6B 1JKGA 2HMNB 3KZTA 3D9RA 4R9KA 1GY5A 1TUHA 2B24B 3T8NA 1E3VA 2HMKB 1JN5B 5CK6A 3GZYB 3F14A 1NWWA 3EX9A 3E99A 3F7SA 3OXAA 1DMQA 1QJGA 3FF0A 1STDA 5AIHA 3SOYA 4X2HA 2A15A 3M8CA 4XBXA 4HM2B 1TP6A 4OVMA 5BVBA 1A2KA 1O7HB 3OWSA 2GXFA 1VZZA 4HZ9B 2YFIB 3CNMA 2F98A 2Z7AA 2OWPA 3LZAA 3G16A 7STDA 4L8OA 2BMQB 1Q40A 2GBWB 2BMOB 5IENA 3JUOA 3F8XA 1Z1SA 5JPPA 4MJDA 4HM0B 5IG0A 1EA2A 1Q42A 2PZVA 4HM7B 3MG1A 2RFRA 4WYKA 3KSPA 3HZPA 1DMNA 3EBYA 1OGXA 4LEHA 3OWYA 3DMCA 3JUNA 3EQQB 5FW5A 2RCDA 5CF2A 3FSDA 3I0YA 5AI1A 3K0ZA 5KP1A 3OV4A 4HM5B 2HMMB 1O7MB 2I9WA 3CU3A 4XB5A 3CNXA 3WMDA 5IG5A 3ROBA 3BB9A 3FKAA 1ULJB 1ULIB 5AIFA 5AIGA 4HM8B 1UUVB 4HZBB 3A76A 2CKFB 5STDA 3UJMA 1OHSA 3FH1A 4HM1B 3B4PA 5BXQA 3F7XA 3H51A 4Q53A 2GBXB 4CDLA 3MKIA
chains in the Genus database with same CATH superfamily
3JUMA 4N6UA 1W5ZA 2CIUA 1MOLA 2GU1A 3UB1A 1TIJA 2W56B 2XSHB 2BO9B 4JF8A 2KF5A 1TRQA 3G0KA 4BL3A 1B21A 1ZO2A 3DXOA 1KC84 4WWUC 1B20A 3K9MC 4WHAA 1NU3A 1OCVA 4NPBA 2GEYA 1RHLA 3EN8A 3D4AA 4CCVA 1GYBA 2XGNA 3T8UA 3UL5A 4BTWA 3KE7A 2W2CA 4WYKB 2IUKA 2Z6BA 1MWTA 3ZG0A 3B7CA 1SJWA 3MHEA 3OX9A 1RTUA 1TU5A 1O7WB 4O8SA 4K1VA 2CFLA 1LQMB 2XRXB 3EHCA 3SEDA 2CHCA 4NHFA 1M1XB 2E2UA 3X42A 5KP4A 1KWIA 3CCJ3 2XGLA 2AADA 1UGIA 8RNTA 2CC3A 2WGQA 3WHOA 3FLJA 1RN7A 3BLZA 5IG3A 4EW5A 1Q9EA 4HBRA 1SIHA 4WP5A 2RNTA 3CCS3 5IG4A 1GOYA 1SARA 1QMAA 3MG3A 3EC9A 5IF6A 4J5KA 4KZ1A 1NB3I 6STDA 1RJOA 4N6LA 1I70A 1FA3A 1Q864 1VQ53 1W4NA 1GMPA 1VQQA 1FGTA 1UCKA 1LOWA 2BHMA 2F5WA 1BNRA 3PGBA 1ZX2A 4ZM8A 3CCM3 1UDII 1IK3A 1OACA 2MF7A 2LQVA 3LXUX 4FMBA 3V99A 3CCL3 2KF3A 1HZ1A 3GWRA 4XDWA 1RGCA 2D1WA 2B1XB 4AEQA 1JN5A 3PS8A 3DGOA 3IJEB 3X3YA 3RNTA 3FF2A 1YIJ3 1E97A 1JKGB 4U13A 1G0TA 2YX9A 1JRQA 2CK3H 1IVXA 4N6V0 1N8R4 3EF8A 1OHOA 4L8PA 2IMJA 4EC6A 5HOHA 5EVHA 5KP3A 8CHOA 1G96A 5LC6A 3SOAA 1JB2A 1RCLA 4AKZA 1YJN3 1F8NA 5CLKA 1M9GA 1GY6A 2R4IA 1YGEA 3NXJA 2QIYA 2RSXA 4GL6A 1YIT3 1ISKA 1SPUA 3KSED 3RGAA 4R80A 1VQ83 4TX4A 3H3HA 3AGNA 3WOEB 4J5GA 3U1WA 1EG9B 4STDA 5D83A 1US1A 3LYGA 1IV9A 1T5YA 5AEUB 1NDOB 4N6NB 3BNCA 1A2PA 3BU4A 1R4YA 1K41A 2INXA 2WO0A 1X1WA 2HMLB 3MPHA 4R1KA 3Q3FA 3FG3A 3VGNA 1LNHA 3UNLA 2OQEC 3HK4A 3X3ZA 1UCJA 1QALA 3X40A 1OHPA 1BNEA 2CX1A 1YNVX 3HIGA 4HKVB 1AVKA 4LYLB 2CWVA 1NNVA 1OGZA 3GZRA 3ALAA 1QVF2 4LZIA 1JJ22 1I0VA 4FR9A 3FZWA 1BAOA 3K63A 3KFQC 4I4KA 3V92A 2WOHA 2HMJB 2XR8B 5IW9A 2KF6A 1BSAA 3K7CA 3URPA 1LQGC 2CFKA 2CFDA 1BRIA 1FYSA 3B4OA 1UCIA 3FCSB 3WOFB 4DKIA 1FUWA 5G1LA 3HI7A 1BSBA 2IA7A 3G8ZA 2GU3A 4FCMA 1S723 1UUGB 1BSEA 5JBSA 4K1UA 2QGUA 2ZA4A 1WQLB 2W6JH 5EQLA 1BANA 3CCU3 1VQL3 3A5EA 3GZBA 1K9M4 3F40A 3LTCA 1Y4KA 4X2OA 2CG0A 1RLSA 1UGHI 3LTAA 3MKIA 2P05A 4O2HA 1C7HA 1D6UA 2P0MA 4FMAA 3CCQ3 2CWTA 4HJLB 4OUQA 3ZG5A 3SYUA 1O7GB 2HMOB 4I5QA 1Q40B 4EV5A 4EBGA 3MYTA 5FGOA 1PY3A 3DM8A 5HGRA 3KKGA 2IUJA 1WMNA 4KT3B 4OK0A 3KCHA 3V98A 1W2B2 3LTBA 4J8TA 4XBTA 2CG1A 1JB4A 2HOHA 4O02B 4CPKA 3AHSA 3D5IA 1LOVA 1FZUA 2H0HA 2MC8A 4O3VA 5CXOA 4BU4A 1ROAA 4BTXA 3Q90A 1RCKA 3CCE3 2XFSA 1I8VA 2XSOB 1U8CB 1LOYA 1OF5A 5M18A 1YHQ3 3GZXB 1IVWA 1J2BA 1UI8A 1I3IA 1YVSA 3NV0A 3Q2PA 4IIAA 3PCRA 1W7CA 4FMCA 4R4KA 3MSOA 3SLUA 5AIIA 1TFKA 1MNLA 1FW7A 1JB5A 1RRHA 2CH9A 1RMSA 3B8LA 1RDSA 4XM4A 1WMOA 4L7KA 3T0UA 1UI7A 3VF1A 1SIIA 1RRLA 1IT8A 4HVNA 5DREA 2P38A 4XDVA 1WTHA 4NREA 1CH0A 3PXMA 5AEWB 1E3RA 2M7OA 3DY5A 5CF1A 1IV7A 1CQSA 3IPTA 1M1K4 3LTDA 1BOXA 2XH9A 4LGQA 4RNYA 3ZFZA 1FGQA 3NHXA 1AVLA 3OWUA 5D81A 1IYYA 3QK9A 1WMPA 3GRDA 1GY7A 1V57A 3LMLA 3DH2A 1W6GA 4XBYA 1W00A 4HM4B 4RBNA 3S5CA 4PEJA 1DYUA 1RGAA 3CPOA 2K54A 4N3VA 2O9UX 3NM2A 1GD3A 1TFOA 3LT8A 1L5GB 3CME3 1AR0A 2F56A 4K90B 5TGNA 5IEPA 2F86B 4QWTA 1I2GA 3HX8A 1N8QA 1W6YA 2KCDA 3DUKA 2GEXA 3DZLA 4HAAA 4BIRA 4GB5A 5IERA 5LC7A 1JBSA 3JUPA 5JPUA 1MWSA 4JRFA 3JVCA 1OPYA 3S29A 3EJVA 4G1MB 2XEPA 4KVHA 1B2SA 1IQXA 3HIIA 1W2ZA 2F99A 3EN1B 1IDPA 2W03A 2Z76A 3DGYA 1RGHA 1YGWA 1STFI 2YFLB 4CJNA 1X1YA 3VSYA 1OUNA 4LMIA 1G02A 2KXGA 2YFJB 1O7NB 3NBRA 2BNGA 3AMOA 2Y74A 4KFDA 2WOFA 1B2ZA 3S27A 3BNBA 4HM3B 4RZMA 5D82A 4J9AA 1ASKA 2AAEA 2W9PA 5DRVA 1KQS2 1PFPA 5IEOA 5GSPA 1S5AA 3UL6A 1BNGA 4IT7A 1WNHA 2Z77A 7RNTA 1LOXA 4FCJA 1VQO3 1HKXA 3CCR3 1GMQA 5G2GA 2UX0A 2OOVC 1K8A4 3F8HA 6RNTA 4EXRA 1TRPA 3O8YA 3SVAA 4EYCA 1W02A 3TDGA 1IVUA 1UW1A 3NBJA 2BT3A 1BUQA 1EUIC 4KFEA 5M1AA 3N8BA 1A90A 1ROVA 4FMDA 1GSPA 3SXXA 1N9EA 1OF5B 3BIRA 1X1XA 1W01A 3ECFA 2OTL3 2WGOA 3G713 1YI23 1U5OA 2RGQA 1O7PB 3S28A 3GAXA 1AY7A 2F5MA 2SARA 3NV0B 1GMRA 1DMMA 1BGSA 1PYLA 1Q7HA 2BMRB 1B2UA 1AV4A 1K28A 2STDA 3PZWA 4R9LA 1UUWB 4ORLA 1I0XA 3NUVA 1JBTA 1LXEA 1T2IA 3EBTA 1LNIA 2P09A 4KFFA 3F9SA 1MGRA 1C54A 1QVG2 3RGRA 3J7Yd 2CX0A 3EE1A 1GS3A 1K734 1CYVA 2JQ5A 3CC23 2CFGA 4H3UA 5ELJA 3JUQA 1RKYA 1OH0A 3STDA 4LSOA 3FGYA 1AQZA 1B27A 3MG2A 5ELUA 4N6MA 1BUJA 4HM6B 1JKGA 2HMNB 1JZOA 2ML5A 1GOUA 3KZTA 1VQ63 3FG1A 3D9RA 4R9KA 1T3BA 2GSPA 3MWZA 2OQEA 1GY5A 2IY2A 1VQ73 1BVIA 2CFWA 1NJI4 2W9QA 3IMAB 1TUHA 2J8XB 3I563 1CEWI 1JNQA 2B24B 1B2XA 2D42A 4RNTA 3SX1A 3T8NA 5AYSC 1UCLA 1KSIA 1E3VA 2ZL8A 1Q814 3CMA3 1BRSA 2HMKB 1LRAA 1RNTA 3KIIA 3CCV3 1BNSA 1JN5B 5CK6A 3GZYB 3CC43 1BSCA 3DGLA 3F14A 1N9JA 4IPBA 1D6ZA 1KD14 1GOVA 1BNJA 1NWWA 1RGEA 3BNEA 2ZDJA 3E99A 3EX9A 1I3FA 1IQ8A 3F7SA 3OXAA 1QAKA 4N6OB 2FNQA 4GHOA 1DMQA 4MMYB 3CD63 1QJGA 1RGKA 3L0RA 3FF0A 1STDA 5AIHA 1V74A 1EEJA 1HU9A 3SOYA 4X2HA 2BU4A 1Q824 2A15A 2F4YA 3M8CA 4K61A 1IT7A 3HOHA 4XBXA 4HM2B 5RNTA 1LVNA 1BRGA 2XF3A 1NB5I 3CC73 2ZHXB 3AMOB 1CYUA 2C4BA 3AGOA 5A0OB 1EQKA 1TP6A 4RNZA 4OVMA 3Q1CA 3X3XA 3G6E3 1MWRA 2Q07A 2R41A 3U97A 2V1LA 1RN4A 1GD4A 5BVBA 3WDGB 1IVVA 1I2EA 1ZS7A 1Q7Y4 2K3DA 3EB8A 1A2KA 1BSDA 1O7HB 3OWSA 3LOYA 2GXFA 1YJW3 4HYZA 1BIRA 1VZZA 1TTOA 1VQN3 4HZ9B 3GSPA 1R4CA 2UUGC 3NM7A 3PCSA 2L4VA 4BTYA 2L1SA 2YFIB 1PU4A 3CNMA 3X41A 1RNBA 2KAAA 3NBBA 3RDEA 2KF4A 1VQ93 2F98A 1JZDA 2Z7AA 3KN4A 3LT9A 2KRTA 4HOHA 2W04A 4FCZA 1BNFA 1EKMA 2OWPA 1B3SA 3LZAA 1X1UA 1BRHA 4H61A 3G16A 1BRJA 7STDA 1B2MA 4L8OA 2UGIA 2BMQB 1Q40A 5BIRA 2GBWB 2XFTA 1MWUA 1YVBI 1FGOA 3D79A 2OTJ3 3S67A 2E2TA 4GSPA 2W56A 2H0IA 3WR2A 2BMOB 3D3LA 5IENA 1A67A 3K5TA 5BU4A 3JUOA 5G1KA 2ML6A 1Z1SA 3F8XA 4ILFA 5JPPA 4MMZB 1SQWA 4MJDA 4HM0B 1NO3A 1EA2A 1Q42A 1DETA 2JDIH 2OCTA 2PZVA 5AYRB 5IG0A 3CPW2 1ZGXA 3N54B 4HM7B 1MGWA 1RGFA 2CWUA 3MG1A 3NQYA 5M19A 2RFRA 3I553 3G4S3 1JV2B 2SBLA 4WYKA 2FXTA 3WA3A 3KSPA 3HZPA 1DMNA 3EBYA 1OGXA 4AKYA 1RGLA 3FG4A 3OWYA 3DMCA 3JUNA 4LEHA 3EQQB 6GSPA 5FW5A 2RCDA 5CF2A 3NX0A 4MEIA 3FSDA 3I0YA 1W6CA 2Y73A 5AI1A 1JBRA 3K0ZA 2RBIA 1TJDA 5KP1A 1RSNA 1FGMA 2BIRA 2CW9A 3OV4A 4HM5B 2E2VA 2PNCA 1T2HA 2HMMB 1O7MB 2I9WA 3CU3A 3AHWA 4XB5A 1I2FA 5I97A 1RN1A 3CNXA 3LH4A 2H0GA 1D6YA 1FGRA 3D5GA 1HYFA 2C11A 3WMDA 2QEX3 3WA2X 1VQ43 1FUSA 5IG5A 1IQYA 4BL2A 3DGNA 3ROBA 3BB9A 3BNDA 1BRKA 3FKAA 1ULJB 1ULIB 1V58A 3NQZA 3PYJA 5AIGA 5AIFA 4HM8B 4N6TA 4MMXB 1VQM3 1VQK3 1UUVB 4HZBB 3A76A 3DGMA 2CKFB 5STDA 4EV2A 1BRNL 2O3OA 1A2VA 7GSPA 3UJMA 1OHSA 3FH1A 1DVDA 1IU7A 2W0QA 2LYXA 4HM1B 5EEOA 2K0MA 4WFOA 2FGTA 1DVCA 2QA43 2OOVA 2IYJA 3QRDA 2P0XA 1VQP3 3B4PA 1FUTA 5BXQA 3N9HA 3CXC2 1BNIA 1M904 1YJ93 3F7XA 1DE3A 9RNTA 1QAFA 3H51A 4Q53A 2GBXB 1BU4A 3WODG 3OW22 4CDLA 1RGGA 1N5HA 2C10A 1N5PA 3ER7A
chains in the Genus database with same CATH topology
3JUMA 4N6UA 1W5ZA 2CIUA 1MOLA 2GU1A 3UB1A 1TIJA 2W56B 2XSHB 2BO9B 4JF8A 3G0KA 1ZO2A 3DXOA 1KC84 4WWUC 3K9MC 4WHAA 1NU3A 1OCVA 2GEYA 3EN8A 4CCVA 1GYBA 2XGNA 3T8UA 3UL5A 4BTWA 3KE7A 2W2CA 4WYKB 2IUKA 2Z6BA 3B7CA 1SJWA 3MHEA 3OX9A 1TU5A 1O7WB 4O8SA 4K1VA 2CFLA 2XRXB 3EHCA 3SEDA 3X42A 2CHCA 4NHFA 1M1XB 2E2UA 5KP4A 3CCJ3 1KWIA 2XGLA 2CC3A 2WGQA 3FLJA 1RN7A 3BLZA 5IG3A 4HBRA 1SIHA 4WP5A 3CCS3 5IG4A 3MG3A 1QMAA 5IF6A 3EC9A 4KZ1A 1NB3I 6STDA 1RJOA 4N6LA 1FA3A 1Q864 1VQ53 1W4NA 1FGTA 2BHMA 3PGBA 1ZX2A 4ZM8A 3CCM3 1IK3A 1OACA 2MF7A 2LQVA 3LXUX 4FMBA 3V99A 3CCL3 3GWRA 4XDWA 2D1WA 2B1XB 4AEQA 1JN5A 3PS8A 3DGOA 3IJEB 3X3YA 3FF2A 1YIJ3 1E97A 1JKGB 4U13A 2YX9A 1JRQA 2CK3H 1IVXA 4N6V0 1N8R4 3EF8A 1OHOA 4L8PA 2IMJA 4EC6A 5EVHA 5KP3A 8CHOA 1G96A 5LC6A 3SOAA 1JB2A 4AKZA 1YJN3 1F8NA 5CLKA 1M9GA 1GY6A 2R4IA 1YGEA 3NXJA 2QIYA 2RSXA 4GL6A 1YIT3 1ISKA 1SPUA 3KSED 3RGAA 4R80A 1VQ83 4TX4A 3H3HA 3WOEB 3U1WA 1EG9B 4STDA 5D83A 1US1A 3LYGA 1IV9A 1T5YA 5AEUB 1NDOB 4N6NB 3BNCA 3MPHA 1K41A 2INXA 2WO0A 2HMLB 4R1KA 3FG3A 3VGNA 1LNHA 3UNLA 2OQEC 3HK4A 3X3ZA 3X40A 1QALA 1OHPA 3HIGA 4HKVB 1AVKA 2CWVA 1OGZA 3GZRA 3ALAA 1QVF2 4LZIA 1JJ22 4FR9A 3FZWA 3K63A 3KFQC 4I4KA 3V92A 2WOHA 2HMJB 2XR8B 5IW9A 3K7CA 2CFKA 2CFDA 3B4OA 3FCSB 3WOFB 1FUWA 3HI7A 2IA7A 3G8ZA 2GU3A 4FCMA 1S723 5JBSA 4K1UA 2QGUA 1WQLB 2W6JH 5EQLA 3CCU3 1VQL3 1K9M4 3GZBA 3F40A 3LTCA 1Y4KA 4X2OA 2CG0A 3LTAA 3MKIA 4O2HA 2P05A 1C7HA 1D6UA 2P0MA 4FMAA 2CWTA 4HJLB 4OUQA 1O7GB 2HMOB 1Q40B 4EV5A 4EBGA 3MYTA 5FGOA 5HGRA 3DM8A 3KKGA 2IUJA 1WMNA 4OK0A 3V98A 1W2B2 3LTBA 4J8TA 4XBTA 2CG1A 1JB4A 4O02B 2MC8A 4O3VA 5CXOA 1ROAA 4BTXA 3Q90A 3CCE3 2XFSA 2XSOB 1U8CB 1OF5A 1YHQ3 3GZXB 1IVWA 1J2BA 1UI8A 3NV0A 3Q2PA 4IIAA 3PCRA 1W7CA 4FMCA 4R4KA 3MSOA 3SLUA 5AIIA 1MNLA 1TFKA 1JB5A 1RRHA 2CH9A 3B8LA 4XM4A 1WMOA 4L7KA 3T0UA 1UI7A 3VF1A 1SIIA 1RRLA 1IT8A 4HVNA 5DREA 2P38A 4XDVA 1WTHA 4NREA 3PXMA 5CF1A 5AEWB 1E3RA 2M7OA 3DY5A 1IV7A 1CQSA 3IPTA 1M1K4 3LTDA 2XH9A 4LGQA 4RNYA 1FGQA 3NHXA 1AVLA 3OWUA 5D81A 3QK9A 1WMPA 3GRDA 1GY7A 3LMLA 1W6GA 4XBYA 1W00A 4HM4B 4RBNA 3S5CA 4PEJA 1DYUA 3CPOA 2K54A 4N3VA 2O9UX 3NM2A 1GD3A 1TFOA 3LT8A 1L5GB 3CME3 1AR0A 4K90B 5TGNA 5IEPA 2F86B 4QWTA 3HX8A 1N8QA 2KCDA 1W6YA 3DUKA 2GEXA 3DZLA 4GB5A 5IERA 5LC7A 3JUPA 5JPUA 4JRFA 3JVCA 1OPYA 3S29A 3EJVA 4G1MB 2XEPA 4KVHA 1IQXA 3HIIA 1W2ZA 2F99A 3EN1B 1IDPA 2W03A 2Z76A 1STFI 2YFLB 3VSYA 1OUNA 4LMIA 2KXGA 2YFJB 1O7NB 3NBRA 2BNGA 3AMOA 2Y74A 4KFDA 2WOFA 3S27A 3BNBA 4HM3B 4RZMA 5D82A 4J9AA 1ASKA 2W9PA 5DRVA 1KQS2 1PFPA 5IEOA 1S5AA 3UL6A 4IT7A 1WNHA 2Z77A 1VQO3 1LOXA 4FCJA 1HKXA 3CCR3 5G2GA 2UX0A 2OOVC 1K8A4 3F8HA 4EXRA 3O8YA 3SVAA 4EYCA 1W02A 3TDGA 1IVUA 1UW1A 3NBJA 2BT3A 1BUQA 4KFEA 3N8BA 1A90A 1ROVA 4FMDA 3SXXA 1N9EA 1OF5B 1W01A 3ECFA 2OTL3 2WGOA 3G713 1YI23 1U5OA 2RGQA 1O7PB 3S28A 3GAXA 3NV0B 1DMMA 2BMRB 1AV4A 1K28A 2STDA 3PZWA 4R9LA 1UUWB 4ORLA 3NUVA 1LXEA 3EBTA 2P09A 4KFFA 3F9SA 1QVG2 3RGRA 3J7Yd 3EE1A 1GS3A 1K734 1CYVA 2JQ5A 3CC23 2CFGA 4H3UA 5ELJA 3JUQA 1RKYA 1OH0A 3STDA 4LSOA 3FGYA 3MG2A 5ELUA 4N6MA 4HM6B 1JKGA 2HMNB 2ML5A 3KZTA 1VQ63 3FG1A 3D9RA 4R9KA 3MWZA 2OQEA 1GY5A 1VQ73 1NJI4 2CFWA 2W9QA 3IMAB 1TUHA 3I563 1CEWI 1JNQA 2B24B 2D42A 3T8NA 3CCQ3 3SX1A 1Q814 5AYSC 1KSIA 1E3VA 2ZL8A 3CMA3 2HMKB 3KIIA 3CCV3 1JN5B 5CK6A 3GZYB 3CC43 3DGLA 3F14A 1N9JA 4IPBA 1D6ZA 1KD14 1NWWA 3EX9A 3BNEA 2ZDJA 3E99A 1IQ8A 3F7SA 3OXAA 1QAKA 4N6OB 2FNQA 1DMQA 4MMYB 3CD63 1QJGA 3L0RA 3FF0A 1STDA 5AIHA 1V74A 1HU9A 3SOYA 4X2HA 1Q824 2A15A 3M8CA 4K61A 1IT7A 4XBXA 4HM2B 1LVNA 1NB5I 2XF3A 1CYUA 3CC73 3AMOB 1EQKA 5A0OB 1TP6A 4RNZA 4OVMA 3Q1CA 3X3XA 3G6E3 2Q07A 3U97A 2V1LA 1GD4A 5BVBA 3WDGB 1IVVA 1Q7Y4 3EB8A 1A2KA 1O7HB 3OWSA 3LOYA 2GXFA 1YJW3 4HYZA 1VZZA 1VQN3 4HZ9B 1R4CA 3NM7A 3PCSA 2L4VA 4BTYA 2YFIB 1PU4A 3CNMA 3X41A 3NBBA 3RDEA 1VQ93 2F98A 2Z7AA 3KN4A 3LT9A 2KRTA 2W04A 4FCZA 1EKMA 2OWPA 3LZAA 4H61A 3G16A 7STDA 4L8OA 2BMQB 1Q40A 2GBWB 2XFTA 1YVBI 1FGOA 2OTJ3 3S67A 2E2TA 2W56A 2BMOB 3D3LA 5IENA 1A67A 3K5TA 3JUOA 2ML6A 1Z1SA 3F8XA 5JPPA 4MMZB 1SQWA 4MJDA 4HM0B 1NO3A 1EA2A 1Q42A 5IG0A 2JDIH 2OCTA 2PZVA 5AYRB 3CPW2 4HM7B 3N54B 2CWUA 3MG1A 3NQYA 2RFRA 3I553 3G4S3 1JV2B 2SBLA 4WYKA 2FXTA 3WA3A 3KSPA 3HZPA 1DMNA 3EBYA 1OGXA 4AKYA 4LEHA 3FG4A 3OWYA 3DMCA 3JUNA 3EQQB 5FW5A 2RCDA 5CF2A 3NX0A 4MEIA 3FSDA 3I0YA 1W6CA 2Y73A 5AI1A 3K0ZA 5KP1A 1FGMA 2CW9A 3OV4A 4HM5B 2E2VA 2PNCA 2HMMB 1O7MB 2I9WA 3CU3A 4XB5A 5I97A 3CNXA 3LH4A 1D6YA 1FGRA 2C11A 3WMDA 1VQ43 2QEX3 3WA2X 5IG5A 1IQYA 3DGNA 3ROBA 3BB9A 3BNDA 3FKAA 1ULJB 1ULIB 3PYJA 3NQZA 5AIFA 5AIGA 4HM8B 4N6TA 4MMXB 1VQM3 1VQK3 1UUVB 4HZBB 3A76A 3DGMA 2CKFB 5STDA 4EV2A 2O3OA 1A2VA 3UJMA 1OHSA 3FH1A 1DVDA 1IU7A 2W0QA 2LYXA 4HM1B 5EEOA 2K0MA 4WFOA 2FGTA 1DVCA 2QA43 2OOVA 3QRDA 2P0XA 1VQP3 3B4PA 5BXQA 3N9HA 3CXC2 1M904 1YJ93 3F7XA 1QAFA 3H51A 4Q53A 2GBXB 3WODG 3OW22 4CDLA 2C10A 1N5HA 1N5PA 3ER7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUM A;  2XSH B;  3G0K A;  1ZO2 A;  3DXO A;  4WWU C;  1NU3 A;  1OCV A;  2GEY A;  3EN8 A;  1GYB A;  3T8U A;  3KE7 A;  2W2C A;  4WYK B;  3B7C A;  1SJW A;  3MHE A;  3OX9 A;  1O7W B;  4K1V A;  3SED A;  2XRX B;  3EHC A;  2CHC A;  5KP4 A;  3FLJ A;  3BLZ A;  5IG3 A;  4WP5 A;  5IG4 A;  3MG3 A;  1QMA A;  5IF6 A;  3EC9 A;  6STD A;  1ZX2 A;  3GWR A;  4XDW A;  2B1X B;  1JN5 A;  3FF2 A;  1E97 A;  1JKG B;  4U13 A;  3EF8 A;  1OHO A;  4L8P A;  2IMJ A;  5EVH A;  5KP3 A;  8CHO A;  3SOA A;  1JB2 A;  5CLK A;  1GY6 A;  2R4I A;  3NXJ A;  1ISK A;  2QIY A;  3RGA A;  3H3H A;  1EG9 B;  4STD A;  5D83 A;  3LYG A;  5AEU B;  1NDO B;  4R1K A;  1K41 A;  2INX A;  2HML B;  3VGN A;  3UNL A;  3HK4 A;  1OHP A;  4HKV B;  1OGZ A;  3GZR A;  3FZW A;  4I4K A;  2HMJ B;  2XR8 B;  3K7C A;  3B4O A;  3G8Z A;  4FCM A;  4K1U A;  2QGU A;  1WQL B;  3GZB A;  3F40 A;  4X2O A;  1C7H A;  4HJL B;  4OUQ A;  1O7G B;  2HMO B;  1Q40 B;  3MYT A;  5HGR A;  3DM8 A;  3KKG A;  4J8T A;  4XBT A;  1JB4 A;  5CXO A;  3Q90 A;  2XSO B;  1OF5 A;  3GZX B;  3NV0 A;  4IIA A;  3MSO A;  5AII A;  1JB5 A;  3B8L A;  4XM4 A;  4L7K A;  4HVN A;  5DRE A;  4XDV A;  5CF1 A;  5AEW B;  1E3R A;  1CQS A;  3IPT A;  4LGQ A;  3NHX A;  3OWU A;  5D81 A;  3GRD A;  1GY7 A;  4XBY A;  1W00 A;  3S5C A;  4HM4 B;  4PEJ A;  3CPO A;  2K54 A;  4N3V A;  3NM2 A;  1AR0 A;  5TGN A;  5IEP A;  2F86 B;  3HX8 A;  1W6Y A;  3DUK A;  2GEX A;  3DZL A;  4GB5 A;  5IER A;  3JUP A;  5JPU A;  1OPY A;  3EJV A;  4KVH A;  2F99 A;  3EN1 B;  1IDP A;  2Z76 A;  3ER7 A;  2YFL B;  3VSY A;  1OUN A;  4LMI A;  2YFJ B;  1O7N B;  3NBR A;  2BNG A;  4HM3 B;  4RZM A;  5D82 A;  4J9A A;  1ASK A;  5DRV A;  5IEO A;  1S5A A;  2Z77 A;  4FCJ A;  1HKX A;  5G2G A;  2UX0 A;  3F8H A;  1W02 A;  1BUQ A;  1OF5 B;  1W01 A;  3ECF A;  1U5O A;  2RGQ A;  1O7P B;  3NV0 B;  1DMM A;  2BMR B;  2STD A;  4R9L A;  1UUW B;  4ORL A;  3NUV A;  3EBT A;  3F9S A;  3RGR A;  1GS3 A;  2JQ5 A;  4H3U A;  3JUQ A;  1OH0 A;  3STD A;  3FGY A;  3MG2 A;  4HM6 B;  1JKG A;  2HMN B;  3KZT A;  3D9R A;  4R9K A;  1GY5 A;  1TUH A;  2B24 B;  3T8N A;  1E3V A;  2HMK B;  1JN5 B;  5CK6 A;  3GZY B;  3F14 A;  1NWW A;  3EX9 A;  3E99 A;  3F7S A;  3OXA A;  1DMQ A;  1QJG A;  3FF0 A;  1STD A;  5AIH A;  3SOY A;  4X2H A;  2A15 A;  3M8C A;  4XBX A;  4HM2 B;  1TP6 A;  4OVM A;  5BVB A;  1A2K A;  1O7H B;  3OWS A;  2GXF A;  1VZZ A;  4HZ9 B;  2YFI B;  3CNM A;  2F98 A;  2Z7A A;  2OWP A;  3LZA A;  3G16 A;  7STD A;  4L8O A;  2BMQ B;  1Q40 A;  2GBW B;  2BMO B;  5IEN A;  3JUO A;  3F8X A;  1Z1S A;  5JPP A;  4MJD A;  4HM0 B;  5IG0 A;  1EA2 A;  1Q42 A;  2PZV A;  4HM7 B;  3MG1 A;  2RFR A;  4WYK A;  3KSP A;  3HZP A;  1DMN A;  3EBY A;  1OGX A;  4LEH A;  3OWY A;  3DMC A;  3JUN A;  3EQQ B;  5FW5 A;  2RCD A;  5CF2 A;  3FSD A;  3I0Y A;  5AI1 A;  3K0Z A;  5KP1 A;  3OV4 A;  4HM5 B;  2HMM B;  1O7M B;  2I9W A;  3CU3 A;  4XB5 A;  3CNX A;  3WMD A;  5IG5 A;  3ROB A;  3BB9 A;  3FKA A;  1ULJ B;  1ULI B;  5AIF A;  5AIG A;  4HM8 B;  1UUV B;  4HZB B;  3A76 A;  2CKF B;  5STD A;  3UJM A;  1OHS A;  3FH1 A;  4HM1 B;  3B4P A;  5BXQ A;  3F7X A;  3H51 A;  4Q53 A;  2GBX B;  4CDL A;  3MKI A; 
#chains in the Genus database with same CATH topology
 3JUM A;  4N6U A;  1W5Z A;  2CIU A;  1MOL A;  2GU1 A;  3UB1 A;  1TIJ A;  2W56 B;  2XSH B;  2BO9 B;  4JF8 A;  2KF5 A;  1TRQ A;  3G0K A;  4BL3 A;  1B21 A;  1ZO2 A;  3DXO A;  1KC8 4;  4WWU C;  1B20 A;  3K9M C;  4WHA A;  1NU3 A;  1OCV A;  4NPB A;  2GEY A;  1RHL A;  3EN8 A;  3D4A A;  4CCV A;  1GYB A;  2XGN A;  3T8U A;  3UL5 A;  4BTW A;  3KE7 A;  2W2C A;  4WYK B;  2IUK A;  2Z6B A;  1MWT A;  3ZG0 A;  3B7C A;  1SJW A;  3MHE A;  3OX9 A;  1RTU A;  1TU5 A;  1O7W B;  4O8S A;  4K1V A;  2CFL A;  1LQM B;  2XRX B;  3EHC A;  3SED A;  2CHC A;  4NHF A;  1M1X B;  2E2U A;  3X42 A;  5KP4 A;  1KWI A;  3CCJ 3;  2XGL A;  2AAD A;  1UGI A;  8RNT A;  2CC3 A;  2WGQ A;  3WHO A;  3FLJ A;  1RN7 A;  3BLZ A;  5IG3 A;  4EW5 A;  1Q9E A;  4HBR A;  1SIH A;  4WP5 A;  2RNT A;  3CCS 3;  5IG4 A;  1GOY A;  1SAR A;  1QMA A;  3MG3 A;  3EC9 A;  5IF6 A;  4J5K A;  4KZ1 A;  1NB3 I;  6STD A;  1RJO A;  4N6L A;  1I70 A;  1FA3 A;  1Q86 4;  1VQ5 3;  1W4N A;  1GMP A;  1VQQ A;  1FGT A;  1UCK A;  1LOW A;  2BHM A;  2F5W A;  1BNR A;  3PGB A;  1ZX2 A;  4ZM8 A;  3CCM 3;  1UDI I;  1IK3 A;  1OAC A;  2MF7 A;  2LQV A;  3LXU X;  4FMB A;  3V99 A;  3CCL 3;  2KF3 A;  1HZ1 A;  3GWR A;  4XDW A;  1RGC A;  2D1W A;  2B1X B;  4AEQ A;  1JN5 A;  3PS8 A;  3DGO A;  3IJE B;  3X3Y A;  3RNT A;  3FF2 A;  1YIJ 3;  1E97 A;  1JKG B;  4U13 A;  1G0T A;  2YX9 A;  1JRQ A;  2CK3 H;  1IVX A;  4N6V 0;  1N8R 4;  3EF8 A;  1OHO A;  4L8P A;  2IMJ A;  4EC6 A;  5HOH A;  5EVH A;  5KP3 A;  8CHO A;  1G96 A;  5LC6 A;  3SOA A;  1JB2 A;  1RCL A;  4AKZ A;  1YJN 3;  1F8N A;  5CLK A;  1M9G A;  1GY6 A;  2R4I A;  1YGE A;  3NXJ A;  2QIY A;  2RSX A;  4GL6 A;  1YIT 3;  1ISK A;  1SPU A;  3KSE D;  3RGA A;  4R80 A;  1VQ8 3;  4TX4 A;  3H3H A;  3AGN A;  3WOE B;  4J5G A;  3U1W A;  1EG9 B;  4STD A;  5D83 A;  1US1 A;  3LYG A;  1IV9 A;  1T5Y A;  5AEU B;  1NDO B;  4N6N B;  3BNC A;  1A2P A;  3BU4 A;  1R4Y A;  1K41 A;  2INX A;  2WO0 A;  1X1W A;  2HML B;  3MPH A;  4R1K A;  3Q3F A;  3FG3 A;  3VGN A;  1LNH A;  3UNL A;  2OQE C;  3HK4 A;  3X3Z A;  1UCJ A;  1QAL A;  3X40 A;  1OHP A;  1BNE A;  2CX1 A;  1YNV X;  3HIG A;  4HKV B;  1AVK A;  4LYL B;  2CWV A;  1NNV A;  1OGZ A;  3GZR A;  3ALA A;  1QVF 2;  4LZI A;  1JJ2 2;  1I0V A;  4FR9 A;  3FZW A;  1BAO A;  3K63 A;  3KFQ C;  4I4K A;  3V92 A;  2WOH A;  2HMJ B;  2XR8 B;  5IW9 A;  2KF6 A;  1BSA A;  3K7C A;  3URP A;  1LQG C;  2CFK A;  2CFD A;  1BRI A;  1FYS A;  3B4O A;  1UCI A;  3FCS B;  3WOF B;  4DKI A;  1FUW A;  5G1L A;  3HI7 A;  1BSB A;  2IA7 A;  3G8Z A;  2GU3 A;  4FCM A;  1S72 3;  1UUG B;  1BSE A;  5JBS A;  4K1U A;  2QGU A;  2ZA4 A;  1WQL B;  2W6J H;  5EQL A;  1BAN A;  3CCU 3;  1VQL 3;  3A5E A;  3GZB A;  1K9M 4;  3F40 A;  3LTC A;  1Y4K A;  4X2O A;  2CG0 A;  1RLS A;  1UGH I;  3LTA A;  3MKI A;  2P05 A;  4O2H A;  1C7H A;  1D6U A;  2P0M A;  4FMA A;  3CCQ 3;  2CWT A;  4HJL B;  4OUQ A;  3ZG5 A;  3SYU A;  1O7G B;  2HMO B;  4I5Q A;  1Q40 B;  4EV5 A;  4EBG A;  3MYT A;  5FGO A;  1PY3 A;  3DM8 A;  5HGR A;  3KKG A;  2IUJ A;  1WMN A;  4KT3 B;  4OK0 A;  3KCH A;  3V98 A;  1W2B 2;  3LTB A;  4J8T A;  4XBT A;  2CG1 A;  1JB4 A;  2HOH A;  4O02 B;  4CPK A;  3AHS A;  3D5I A;  1LOV A;  1FZU A;  2H0H A;  2MC8 A;  4O3V A;  5CXO A;  4BU4 A;  1ROA A;  4BTX A;  3Q90 A;  1RCK A;  3CCE 3;  2XFS A;  1I8V A;  2XSO B;  1U8C B;  1LOY A;  1OF5 A;  5M18 A;  1YHQ 3;  3GZX B;  1IVW A;  1J2B A;  1UI8 A;  1I3I A;  1YVS A;  3NV0 A;  3Q2P A;  4IIA A;  3PCR A;  1W7C A;  4FMC A;  4R4K A;  3MSO A;  3SLU A;  5AII A;  1TFK A;  1MNL A;  1FW7 A;  1JB5 A;  1RRH A;  2CH9 A;  1RMS A;  3B8L A;  1RDS A;  4XM4 A;  1WMO A;  4L7K A;  3T0U A;  1UI7 A;  3VF1 A;  1SII A;  1RRL A;  1IT8 A;  4HVN A;  5DRE A;  2P38 A;  4XDV A;  1WTH A;  4NRE A;  1CH0 A;  3PXM A;  5AEW B;  1E3R A;  2M7O A;  3DY5 A;  5CF1 A;  1IV7 A;  1CQS A;  3IPT A;  1M1K 4;  3LTD A;  1BOX A;  2XH9 A;  4LGQ A;  4RNY A;  3ZFZ A;  1FGQ A;  3NHX A;  1AVL A;  3OWU A;  5D81 A;  1IYY A;  3QK9 A;  1WMP A;  3GRD A;  1GY7 A;  1V57 A;  3LML A;  3DH2 A;  1W6G A;  4XBY A;  1W00 A;  4HM4 B;  4RBN A;  3S5C A;  4PEJ A;  1DYU A;  1RGA A;  3CPO A;  2K54 A;  4N3V A;  2O9U X;  3NM2 A;  1GD3 A;  1TFO A;  3LT8 A;  1L5G B;  3CME 3;  1AR0 A;  2F56 A;  4K90 B;  5TGN A;  5IEP A;  2F86 B;  4QWT A;  1I2G A;  3HX8 A;  1N8Q A;  1W6Y A;  2KCD A;  3DUK A;  2GEX A;  3DZL A;  4HAA A;  4BIR A;  4GB5 A;  5IER A;  5LC7 A;  1JBS A;  3JUP A;  5JPU A;  1MWS A;  4JRF A;  3JVC A;  1OPY A;  3S29 A;  3EJV A;  4G1M B;  2XEP A;  4KVH A;  1B2S A;  1IQX A;  3HII A;  1W2Z A;  2F99 A;  3EN1 B;  1IDP A;  2W03 A;  2Z76 A;  3DGY A;  1RGH A;  1YGW A;  1STF I;  2YFL B;  4CJN A;  1X1Y A;  3VSY A;  1OUN A;  4LMI A;  1G02 A;  2KXG A;  2YFJ B;  1O7N B;  3NBR A;  2BNG A;  3AMO A;  2Y74 A;  4KFD A;  2WOF A;  1B2Z A;  3S27 A;  3BNB A;  4HM3 B;  4RZM A;  5D82 A;  4J9A A;  1ASK A;  2AAE A;  2W9P A;  5DRV A;  1KQS 2;  1PFP A;  5IEO A;  5GSP A;  1S5A A;  3UL6 A;  1BNG A;  4IT7 A;  1WNH A;  2Z77 A;  7RNT A;  1LOX A;  4FCJ A;  1VQO 3;  1HKX A;  3CCR 3;  1GMQ A;  5G2G A;  2UX0 A;  2OOV C;  1K8A 4;  3F8H A;  6RNT A;  4EXR A;  1TRP A;  3O8Y A;  3SVA A;  4EYC A;  1W02 A;  3TDG A;  1IVU A;  1UW1 A;  3NBJ A;  2BT3 A;  1BUQ A;  1EUI C;  4KFE A;  5M1A A;  3N8B A;  1A90 A;  1ROV A;  4FMD A;  1GSP A;  3SXX A;  1N9E A;  1OF5 B;  3BIR A;  1X1X A;  1W01 A;  3ECF A;  2OTL 3;  2WGO A;  3G71 3;  1YI2 3;  1U5O A;  2RGQ A;  1O7P B;  3S28 A;  3GAX A;  1AY7 A;  2F5M A;  2SAR A;  3NV0 B;  1GMR A;  1DMM A;  1BGS A;  1PYL A;  1Q7H A;  2BMR B;  1B2U A;  1AV4 A;  1K28 A;  2STD A;  3PZW A;  4R9L A;  1UUW B;  4ORL A;  1I0X A;  3NUV A;  1JBT A;  1LXE A;  1T2I A;  3EBT A;  1LNI A;  2P09 A;  4KFF A;  3F9S A;  1MGR A;  1C54 A;  1QVG 2;  3RGR A;  3J7Y d;  2CX0 A;  3EE1 A;  1GS3 A;  1K73 4;  1CYV A;  2JQ5 A;  3CC2 3;  2CFG A;  4H3U A;  5ELJ A;  3JUQ A;  1RKY A;  1OH0 A;  3STD A;  4LSO A;  3FGY A;  1AQZ A;  1B27 A;  3MG2 A;  5ELU A;  4N6M A;  1BUJ A;  4HM6 B;  1JKG A;  2HMN B;  1JZO A;  2ML5 A;  1GOU A;  3KZT A;  1VQ6 3;  3FG1 A;  3D9R A;  4R9K A;  1T3B A;  2GSP A;  3MWZ A;  2OQE A;  1GY5 A;  2IY2 A;  1VQ7 3;  1BVI A;  2CFW A;  1NJI 4;  2W9Q A;  3IMA B;  1TUH A;  2J8X B;  3I56 3;  1CEW I;  1JNQ A;  2B24 B;  1B2X A;  2D42 A;  4RNT A;  3SX1 A;  3T8N A;  5AYS C;  1UCL A;  1KSI A;  1E3V A;  2ZL8 A;  1Q81 4;  3CMA 3;  1BRS A;  2HMK B;  1LRA A;  1RNT A;  3KII A;  3CCV 3;  1BNS A;  1JN5 B;  5CK6 A;  3GZY B;  3CC4 3;  1BSC A;  3DGL A;  3F14 A;  1N9J A;  4IPB A;  1D6Z A;  1KD1 4;  1GOV A;  1BNJ A;  1NWW A;  1RGE A;  3BNE A;  2ZDJ A;  3E99 A;  3EX9 A;  1I3F A;  1IQ8 A;  3F7S A;  3OXA A;  1QAK A;  4N6O B;  2FNQ A;  4GHO A;  1DMQ A;  4MMY B;  3CD6 3;  1QJG A;  1RGK A;  3L0R A;  3FF0 A;  1STD A;  5AIH A;  1V74 A;  1EEJ A;  1HU9 A;  3SOY A;  4X2H A;  2BU4 A;  1Q82 4;  2A15 A;  2F4Y A;  3M8C A;  4K61 A;  1IT7 A;  3HOH A;  4XBX A;  4HM2 B;  5RNT A;  1LVN A;  1BRG A;  2XF3 A;  1NB5 I;  3CC7 3;  2ZHX B;  3AMO B;  1CYU A;  2C4B A;  3AGO A;  5A0O B;  1EQK A;  1TP6 A;  4RNZ A;  4OVM A;  3Q1C A;  3X3X A;  3G6E 3;  1MWR A;  2Q07 A;  2R41 A;  3U97 A;  2V1L A;  1RN4 A;  1GD4 A;  5BVB A;  3WDG B;  1IVV A;  1I2E A;  1ZS7 A;  1Q7Y 4;  2K3D A;  3EB8 A;  1A2K A;  1BSD A;  1O7H B;  3OWS A;  3LOY A;  2GXF A;  1YJW 3;  4HYZ A;  1BIR A;  1VZZ A;  1TTO A;  1VQN 3;  4HZ9 B;  3GSP A;  1R4C A;  2UUG C;  3NM7 A;  3PCS A;  2L4V A;  4BTY A;  2L1S A;  2YFI B;  1PU4 A;  3CNM A;  3X41 A;  1RNB A;  2KAA A;  3NBB A;  3RDE A;  2KF4 A;  1VQ9 3;  2F98 A;  1JZD A;  2Z7A A;  3KN4 A;  3LT9 A;  2KRT A;  4HOH A;  2W04 A;  4FCZ A;  1BNF A;  1EKM A;  2OWP A;  1B3S A;  3LZA A;  1X1U A;  1BRH A;  4H61 A;  3G16 A;  1BRJ A;  7STD A;  1B2M A;  4L8O A;  2UGI A;  2BMQ B;  1Q40 A;  5BIR A;  2GBW B;  2XFT A;  1MWU A;  1YVB I;  1FGO A;  3D79 A;  2OTJ 3;  3S67 A;  2E2T A;  4GSP A;  2W56 A;  2H0I A;  3WR2 A;  2BMO B;  3D3L A;  5IEN A;  1A67 A;  3K5T A;  5BU4 A;  3JUO A;  5G1K A;  2ML6 A;  1Z1S A;  3F8X A;  4ILF A;  5JPP A;  4MMZ B;  1SQW A;  4MJD A;  4HM0 B;  1NO3 A;  1EA2 A;  1Q42 A;  1DET A;  2JDI H;  2OCT A;  2PZV A;  5AYR B;  5IG0 A;  3CPW 2;  1ZGX A;  3N54 B;  4HM7 B;  1MGW A;  1RGF A;  2CWU A;  3MG1 A;  3NQY A;  5M19 A;  2RFR A;  3I55 3;  3G4S 3;  1JV2 B;  2SBL A;  4WYK A;  2FXT A;  3WA3 A;  3KSP A;  3HZP A;  1DMN A;  3EBY A;  1OGX A;  4AKY A;  1RGL A;  3FG4 A;  3OWY A;  3DMC A;  3JUN A;  4LEH A;  3EQQ B;  6GSP A;  5FW5 A;  2RCD A;  5CF2 A;  3NX0 A;  4MEI A;  3FSD A;  3I0Y A;  1W6C A;  2Y73 A;  5AI1 A;  1JBR A;  3K0Z A;  2RBI A;  1TJD A;  5KP1 A;  1RSN A;  1FGM A;  2BIR A;  2CW9 A;  3OV4 A;  4HM5 B;  2E2V A;  2PNC A;  1T2H A;  2HMM B;  1O7M B;  2I9W A;  3CU3 A;  3AHW A;  4XB5 A;  1I2F A;  5I97 A;  1RN1 A;  3CNX A;  3LH4 A;  2H0G A;  1D6Y A;  1FGR A;  3D5G A;  1HYF A;  2C11 A;  3WMD A;  2QEX 3;  3WA2 X;  1VQ4 3;  1FUS A;  5IG5 A;  1IQY A;  4BL2 A;  3DGN A;  3ROB A;  3BB9 A;  3BND A;  1BRK A;  3FKA A;  1ULJ B;  1ULI B;  1V58 A;  3NQZ A;  3PYJ A;  5AIG A;  5AIF A;  4HM8 B;  4N6T A;  4MMX B;  1VQM 3;  1VQK 3;  1UUV B;  4HZB B;  3A76 A;  3DGM A;  2CKF B;  5STD A;  4EV2 A;  1BRN L;  2O3O A;  1A2V A;  7GSP A;  3UJM A;  1OHS A;  3FH1 A;  1DVD A;  1IU7 A;  2W0Q A;  2LYX A;  4HM1 B;  5EEO A;  2K0M A;  4WFO A;  2FGT A;  1DVC A;  2QA4 3;  2OOV A;  2IYJ A;  3QRD A;  2P0X A;  1VQP 3;  3B4P A;  1FUT A;  5BXQ A;  3N9H A;  3CXC 2;  1BNI A;  1M90 4;  1YJ9 3;  3F7X A;  1DE3 A;  9RNT A;  1QAF A;  3H51 A;  4Q53 A;  2GBX B;  1BU4 A;  3WOD G;  3OW2 2;  4CDL A;  1RGG A;  1N5H A;  2C10 A;  1N5P A;  3ER7 A; 
#chains in the Genus database with same CATH homology
 3JUM A;  4N6U A;  1W5Z A;  2CIU A;  1MOL A;  2GU1 A;  3UB1 A;  1TIJ A;  2W56 B;  2XSH B;  2BO9 B;  4JF8 A;  3G0K A;  1ZO2 A;  3DXO A;  1KC8 4;  4WWU C;  3K9M C;  4WHA A;  1NU3 A;  1OCV A;  2GEY A;  3EN8 A;  4CCV A;  1GYB A;  2XGN A;  3T8U A;  3UL5 A;  4BTW A;  3KE7 A;  2W2C A;  4WYK B;  2IUK A;  2Z6B A;  3B7C A;  1SJW A;  3MHE A;  3OX9 A;  1TU5 A;  1O7W B;  4O8S A;  4K1V A;  2CFL A;  2XRX B;  3EHC A;  3SED A;  3X42 A;  2CHC A;  4NHF A;  1M1X B;  2E2U A;  5KP4 A;  3CCJ 3;  1KWI A;  2XGL A;  2CC3 A;  2WGQ A;  3FLJ A;  1RN7 A;  3BLZ A;  5IG3 A;  4HBR A;  1SIH A;  4WP5 A;  3CCS 3;  5IG4 A;  3MG3 A;  1QMA A;  5IF6 A;  3EC9 A;  4KZ1 A;  1NB3 I;  6STD A;  1RJO A;  4N6L A;  1FA3 A;  1Q86 4;  1VQ5 3;  1W4N A;  1FGT A;  2BHM A;  3PGB A;  1ZX2 A;  4ZM8 A;  3CCM 3;  1IK3 A;  1OAC A;  2MF7 A;  2LQV A;  3LXU X;  4FMB A;  3V99 A;  3CCL 3;  3GWR A;  4XDW A;  2D1W A;  2B1X B;  4AEQ A;  1JN5 A;  3PS8 A;  3DGO A;  3IJE B;  3X3Y A;  3FF2 A;  1YIJ 3;  1E97 A;  1JKG B;  4U13 A;  2YX9 A;  1JRQ A;  2CK3 H;  1IVX A;  4N6V 0;  1N8R 4;  3EF8 A;  1OHO A;  4L8P A;  2IMJ A;  4EC6 A;  5EVH A;  5KP3 A;  8CHO A;  1G96 A;  5LC6 A;  3SOA A;  1JB2 A;  4AKZ A;  1YJN 3;  1F8N A;  5CLK A;  1M9G A;  1GY6 A;  2R4I A;  1YGE A;  3NXJ A;  2QIY A;  2RSX A;  4GL6 A;  1YIT 3;  1ISK A;  1SPU A;  3KSE D;  3RGA A;  4R80 A;  1VQ8 3;  4TX4 A;  3H3H A;  3WOE B;  3U1W A;  1EG9 B;  4STD A;  5D83 A;  1US1 A;  3LYG A;  1IV9 A;  1T5Y A;  5AEU B;  1NDO B;  4N6N B;  3BNC A;  3MPH A;  1K41 A;  2INX A;  2WO0 A;  2HML B;  4R1K A;  3FG3 A;  3VGN A;  1LNH A;  3UNL A;  2OQE C;  3HK4 A;  3X3Z A;  3X40 A;  1QAL A;  1OHP A;  3HIG A;  4HKV B;  1AVK A;  2CWV A;  1OGZ A;  3GZR A;  3ALA A;  1QVF 2;  4LZI A;  1JJ2 2;  4FR9 A;  3FZW A;  3K63 A;  3KFQ C;  4I4K A;  3V92 A;  2WOH A;  2HMJ B;  2XR8 B;  5IW9 A;  3K7C A;  2CFK A;  2CFD A;  3B4O A;  3FCS B;  3WOF B;  1FUW A;  3HI7 A;  2IA7 A;  3G8Z A;  2GU3 A;  4FCM A;  1S72 3;  5JBS A;  4K1U A;  2QGU A;  1WQL B;  2W6J H;  5EQL A;  3CCU 3;  1VQL 3;  1K9M 4;  3GZB A;  3F40 A;  3LTC A;  1Y4K A;  4X2O A;  2CG0 A;  3LTA A;  3MKI A;  4O2H A;  2P05 A;  1C7H A;  1D6U A;  2P0M A;  4FMA A;  2CWT A;  4HJL B;  4OUQ A;  1O7G B;  2HMO B;  1Q40 B;  4EV5 A;  4EBG A;  3MYT A;  5FGO A;  5HGR A;  3DM8 A;  3KKG A;  2IUJ A;  1WMN A;  4OK0 A;  3V98 A;  1W2B 2;  3LTB A;  4J8T A;  4XBT A;  2CG1 A;  1JB4 A;  4O02 B;  2MC8 A;  4O3V A;  5CXO A;  1ROA A;  4BTX A;  3Q90 A;  3CCE 3;  2XFS A;  2XSO B;  1U8C B;  1OF5 A;  1YHQ 3;  3GZX B;  1IVW A;  1J2B A;  1UI8 A;  3NV0 A;  3Q2P A;  4IIA A;  3PCR A;  1W7C A;  4FMC A;  4R4K A;  3MSO A;  3SLU A;  5AII A;  1MNL A;  1TFK A;  1JB5 A;  1RRH A;  2CH9 A;  3B8L A;  4XM4 A;  1WMO A;  4L7K A;  3T0U A;  1UI7 A;  3VF1 A;  1SII A;  1RRL A;  1IT8 A;  4HVN A;  5DRE A;  2P38 A;  4XDV A;  1WTH A;  4NRE A;  3PXM A;  5CF1 A;  5AEW B;  1E3R A;  2M7O A;  3DY5 A;  1IV7 A;  1CQS A;  3IPT A;  1M1K 4;  3LTD A;  2XH9 A;  4LGQ A;  4RNY A;  1FGQ A;  3NHX A;  1AVL A;  3OWU A;  5D81 A;  3QK9 A;  1WMP A;  3GRD A;  1GY7 A;  3LML A;  1W6G A;  4XBY A;  1W00 A;  4HM4 B;  4RBN A;  3S5C A;  4PEJ A;  1DYU A;  3CPO A;  2K54 A;  4N3V A;  2O9U X;  3NM2 A;  1GD3 A;  1TFO A;  3LT8 A;  1L5G B;  3CME 3;  1AR0 A;  4K90 B;  5TGN A;  5IEP A;  2F86 B;  4QWT A;  3HX8 A;  1N8Q A;  2KCD A;  1W6Y A;  3DUK A;  2GEX A;  3DZL A;  4GB5 A;  5IER A;  5LC7 A;  3JUP A;  5JPU A;  4JRF A;  3JVC A;  1OPY A;  3S29 A;  3EJV A;  4G1M B;  2XEP A;  4KVH A;  1IQX A;  3HII A;  1W2Z A;  2F99 A;  3EN1 B;  1IDP A;  2W03 A;  2Z76 A;  1STF I;  2YFL B;  3VSY A;  1OUN A;  4LMI A;  2KXG A;  2YFJ B;  1O7N B;  3NBR A;  2BNG A;  3AMO A;  2Y74 A;  4KFD A;  2WOF A;  3S27 A;  3BNB A;  4HM3 B;  4RZM A;  5D82 A;  4J9A A;  1ASK A;  2W9P A;  5DRV A;  1KQS 2;  1PFP A;  5IEO A;  1S5A A;  3UL6 A;  4IT7 A;  1WNH A;  2Z77 A;  1VQO 3;  1LOX A;  4FCJ A;  1HKX A;  3CCR 3;  5G2G A;  2UX0 A;  2OOV C;  1K8A 4;  3F8H A;  4EXR A;  3O8Y A;  3SVA A;  4EYC A;  1W02 A;  3TDG A;  1IVU A;  1UW1 A;  3NBJ A;  2BT3 A;  1BUQ A;  4KFE A;  3N8B A;  1A90 A;  1ROV A;  4FMD A;  3SXX A;  1N9E A;  1OF5 B;  1W01 A;  3ECF A;  2OTL 3;  2WGO A;  3G71 3;  1YI2 3;  1U5O A;  2RGQ A;  1O7P B;  3S28 A;  3GAX A;  3NV0 B;  1DMM A;  2BMR B;  1AV4 A;  1K28 A;  2STD A;  3PZW A;  4R9L A;  1UUW B;  4ORL A;  3NUV A;  1LXE A;  3EBT A;  2P09 A;  4KFF A;  3F9S A;  1QVG 2;  3RGR A;  3J7Y d;  3EE1 A;  1GS3 A;  1K73 4;  1CYV A;  2JQ5 A;  3CC2 3;  2CFG A;  4H3U A;  5ELJ A;  3JUQ A;  1RKY A;  1OH0 A;  3STD A;  4LSO A;  3FGY A;  3MG2 A;  5ELU A;  4N6M A;  4HM6 B;  1JKG A;  2HMN B;  2ML5 A;  3KZT A;  1VQ6 3;  3FG1 A;  3D9R A;  4R9K A;  3MWZ A;  2OQE A;  1GY5 A;  1VQ7 3;  1NJI 4;  2CFW A;  2W9Q A;  3IMA B;  1TUH A;  3I56 3;  1CEW I;  1JNQ A;  2B24 B;  2D42 A;  3T8N A;  3CCQ 3;  3SX1 A;  1Q81 4;  5AYS C;  1KSI A;  1E3V A;  2ZL8 A;  3CMA 3;  2HMK B;  3KII A;  3CCV 3;  1JN5 B;  5CK6 A;  3GZY B;  3CC4 3;  3DGL A;  3F14 A;  1N9J A;  4IPB A;  1D6Z A;  1KD1 4;  1NWW A;  3EX9 A;  3BNE A;  2ZDJ A;  3E99 A;  1IQ8 A;  3F7S A;  3OXA A;  1QAK A;  4N6O B;  2FNQ A;  1DMQ A;  4MMY B;  3CD6 3;  1QJG A;  3L0R A;  3FF0 A;  1STD A;  5AIH A;  1V74 A;  1HU9 A;  3SOY A;  4X2H A;  1Q82 4;  2A15 A;  3M8C A;  4K61 A;  1IT7 A;  4XBX A;  4HM2 B;  1LVN A;  1NB5 I;  2XF3 A;  1CYU A;  3CC7 3;  3AMO B;  1EQK A;  5A0O B;  1TP6 A;  4RNZ A;  4OVM A;  3Q1C A;  3X3X A;  3G6E 3;  2Q07 A;  3U97 A;  2V1L A;  1GD4 A;  5BVB A;  3WDG B;  1IVV A;  1Q7Y 4;  3EB8 A;  1A2K A;  1O7H B;  3OWS A;  3LOY A;  2GXF A;  1YJW 3;  4HYZ A;  1VZZ A;  1VQN 3;  4HZ9 B;  1R4C A;  3NM7 A;  3PCS A;  2L4V A;  4BTY A;  2YFI B;  1PU4 A;  3CNM A;  3X41 A;  3NBB A;  3RDE A;  1VQ9 3;  2F98 A;  2Z7A A;  3KN4 A;  3LT9 A;  2KRT A;  2W04 A;  4FCZ A;  1EKM A;  2OWP A;  3LZA A;  4H61 A;  3G16 A;  7STD A;  4L8O A;  2BMQ B;  1Q40 A;  2GBW B;  2XFT A;  1YVB I;  1FGO A;  2OTJ 3;  3S67 A;  2E2T A;  2W56 A;  2BMO B;  3D3L A;  5IEN A;  1A67 A;  3K5T A;  3JUO A;  2ML6 A;  1Z1S A;  3F8X A;  5JPP A;  4MMZ B;  1SQW A;  4MJD A;  4HM0 B;  1NO3 A;  1EA2 A;  1Q42 A;  5IG0 A;  2JDI H;  2OCT A;  2PZV A;  5AYR B;  3CPW 2;  4HM7 B;  3N54 B;  2CWU A;  3MG1 A;  3NQY A;  2RFR A;  3I55 3;  3G4S 3;  1JV2 B;  2SBL A;  4WYK A;  2FXT A;  3WA3 A;  3KSP A;  3HZP A;  1DMN A;  3EBY A;  1OGX A;  4AKY A;  4LEH A;  3FG4 A;  3OWY A;  3DMC A;  3JUN A;  3EQQ B;  5FW5 A;  2RCD A;  5CF2 A;  3NX0 A;  4MEI A;  3FSD A;  3I0Y A;  1W6C A;  2Y73 A;  5AI1 A;  3K0Z A;  5KP1 A;  1FGM A;  2CW9 A;  3OV4 A;  4HM5 B;  2E2V A;  2PNC A;  2HMM B;  1O7M B;  2I9W A;  3CU3 A;  4XB5 A;  5I97 A;  3CNX A;  3LH4 A;  1D6Y A;  1FGR A;  2C11 A;  3WMD A;  1VQ4 3;  2QEX 3;  3WA2 X;  5IG5 A;  1IQY A;  3DGN A;  3ROB A;  3BB9 A;  3BND A;  3FKA A;  1ULJ B;  1ULI B;  3PYJ A;  3NQZ A;  5AIF A;  5AIG A;  4HM8 B;  4N6T A;  4MMX B;  1VQM 3;  1VQK 3;  1UUV B;  4HZB B;  3A76 A;  3DGM A;  2CKF B;  5STD A;  4EV2 A;  2O3O A;  1A2V A;  3UJM A;  1OHS A;  3FH1 A;  1DVD A;  1IU7 A;  2W0Q A;  2LYX A;  4HM1 B;  5EEO A;  2K0M A;  4WFO A;  2FGT A;  1DVC A;  2QA4 3;  2OOV A;  3QRD A;  2P0X A;  1VQP 3;  3B4P A;  5BXQ A;  3N9H A;  3CXC 2;  1M90 4;  1YJ9 3;  3F7X A;  1QAF A;  3H51 A;  4Q53 A;  2GBX B;  3WOD G;  3OW2 2;  4CDL A;  2C10 A;  1N5H A;  1N5P A;  3ER7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...