1DO5A

Human copper chaperone for superoxide dismutase domain ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
QNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN COPPER CHAPERONE FOR SUPEROXIDE DISMUTASE DOMAIN II
publication title Crystal structure of the second domain of the human copper chaperone for superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 35
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1do5A00
3L9EA 1YSOA 1E9PB 1L3NA 2Z7UA 1SXSA 1E9QB 1MFMA 2LU5A 3QQDA 1XSOA 2C9VA 1F1GA 2C9UA 1JCVA 3T5WA 3KBFA 5KBKA 4A7GA 3F7KA 1SXAA 2ZKXA 1QUPA 1IBDA 1N18A 2AEOA 3CE1A 3K91A 3KH3A 1SXCA 3F7LA 3ECVA 4U4IA 3HFFA 2R27A 1SDAB 2AQRA 2AQSA 5CU9A 2WYTA 2Z7ZA 3S0PA 1TO4A 1OAJA 1IB5A 3KH4A 2VR8A 3HOGA 1JK9A 2APSA 1FUNA 4FF9A 5KBMA 1IBBA 2ZOWA 4A7SA 1DSWA 1UXMA 1YAZA 2GBUA 1RK7A 2C9SA 2Z7YA 2WKOA 1SDYA 2NNXA 3GTTA 4OJAA 1UXLA 1EJ8A 2ZKWA 1P1VA 1SRDA 2WYZA 3CQQA 3H2QA 1BZOA 1SXNA 1E9OA 1HL5A 3MKGA 1TO5A 2AQTA 1DO5A 1U3NA 1PTZA 1SXZA 1AZVA 1F18A 3GTVA 4L05A 1B4TA 1KMGA 3L9YA 3QQDB 5KBLA 1HL4A 1Z9PA 2SODB 4B3EA 3CQPA 1XTLA 3GZOA 3SODB 1S4IA 1OALA 1CBJA 3ECWA 1Z9NA 2WZ5A 3PU7A 1E9QA 1F1DA 1E9OB 1SOSA 2Q2LA 4A7GF 2WKOF 3GQFA 4A7VA 3KM1A 1XTMA 2VR7A 2E46A 1IBHA 1COBA 1IBFA 2WZ0A 4BD4A 1OEZW 4N3TA 2JLPA 2XJLA 2WWOA 1JK9B 3LTVA 3ECUA 2ZKYA 1EQWA 1F1AA 1Q0EA 3HW7A 1ESOA 4A7UA 2VR6A 2Z7WA 3MNDA 2JCWA 2AQNA 1OZTG 4BCZA 1SPDA 3GZQA 1BA9A 2GBTA 4A7TA 1E9PA 4BCYA 2WWNA 3RE0A 2E47A 3KBEA 4A7QA 4OH2A 3GZPA 1OZUA 2XJKA 2V0AA 4N3UA 1SXBA 2WZ6A 2AQQA 2AF2A 3H2PA 2AQPA 2K4WA 1PU0A 2GBVA 1YAIA 1PZSA 1CB4A 4MCMA 1N19A 4MCNA 1B4LA 3KM2A
chains in the Genus database with same CATH superfamily
1E9PB 3U2SA 1JG9A 3TVMD 4GRLD 3DPBA 3WIFB 4HZAA 1CLVA 2DD8H 3L4YA 1NCUA 3I9GL 3DBXB 1P5UC 5JORA 1PKOA 2XOTA 5KANI 1LO4L 1XGRB 3MN8A 1IFHH 3RURA 1JHLL 2P5WD 1SXCA 1M53A 3BUQA 2P24A 5I1GL 1H5BB 3BD3A 4WUKL 3QHZL 4TQEL 3WFZA 4KKBC 2F53B 5T3XL 1ZAGA 2YC1B 2VR9A 3CZUB 4M7LL 5LLIC 5JOFA 1OK8A 2VDOL 4FRWA 1A4KB 2WJ5A 3BGFB 5EIIB 3M8OL 4XMKL 4AIEA 5DS1A 2X9XA 3TPKA 2VH5H 3QUZB 4MCZB 4Y16A 1DUZB 5IHZB 3BP5A 5IQ7L 1WBYB 4KVCH 2ATKA 2XV2A 3KEDA 3T04D 1SDYA 4JK0D 4LARL 3ARQA 2OSWA 43CAB 1W0VA 1I7TA 2FT6A 3MDJA 3P77B 5EUKA 3S4SG 4BJLA 3LZOA 2E3VA 4OU3A 4HUNB 3KYOB 3ERXA 5F7WC 5T3XD 3CFDB 4W6YB 2Z35A 3K74B 3I50L 2XFXB 3BIKB 4MNGB 1HCZA 2R23B 3GSRA 3M17A 3MNZA 4K94H 3VMOA 4LRNL 3T08A 2FSEB 2H6PA 4NKDA 1G9MC 5I8EA 3VXUE 4M6OL 1ZT4A 4ONHB 4NUQA 4FL4B 4FAAB 5DJ8B 2Z31D 2ZAHA 3MA9H 3QZWB 4HGMA 2UZIL 4HIEA 3U7YH 4FTVA 4AJYV 3D6GA 4Y19A 2DDQL 1NA8A 1T03L 1CGSL 4QLRA 5BCAA 3EFFB 5FYKD 3H3KA 3QJVB 5SWSD 2Y4SA 4M1DH 4CGTA 5CIPB 1PJWA 3HS8A 2MPAL 3PQYB 1AC0A 4YE0A 1MEXH 1YDPA 4E68A 2FWUA 4MHHG 1HCFX 1FJ1A 3F58H 4W4OC 2FO4A 4N90D 4PG9B 5TE6H 3CPLA 3OKOA 1TKWA 4OCLC 3MGTB 1ZHBA 4M5SA 1KPVB 1DANU 5A2KH 5EOTB 1A4JB 3CN2A 4DH2A 5ECGA 3NJXA 4OW6A 3THML 2WXFA 4LCIL 4PS4H 2E8ZA 2V0AA 1VFUA 1GZHC 2IGTA 1AGEB 3HI5H 2H45A 1D3CA 2BRRL 2HRHA 3FUEA 4X4YB 3BSGA 2I60H 3FH8A 2JI2A 1MCPH 5CS7A 2F08A 4OZFH 1JCVA 2NY4D 3QNYA 4ONGL 1J0YA 1QSFA 1I7RB 4JG5A 4L29A 3TZVA 2JKIS 2X1XR 5FO9B 1HDMB 4QRQB 3V5DA 2WD0A 4YXHL 2NY5C 4GRWF 4EDWL 3PDDA 4Z7WE 2WYTA 3RY6C 4GW5B 1I3UA 4EI6A 3LZPA 3DX7B 2LLLA 2NSQA 4A2FA 1S9XB 3DIVA 2WQWA 1PY9A 3QXTA 4OD1L 5AVWB 4A7SA 5HI5C 1FA4A 4QTFA 1RSFA 5F9WB 1DVSA 1BFVH 4I1NB 4UT7L 4U1JB 3H4HA 4I18B 2F5AH 2ID5A 1EHAA 3MBWA 1Y07A 3GRWH 3MX0B 4K55A 3L3IA 3S97C 2Y0SA 4Z3FA 2B5IB 2CDEB 5IFHL 4JO3L 5KWYC 4N2AA 4MAUL 4F9PA 4KRPC 5EDSA 2AJYL 2WQRA 1L9TA 1U3NA 4K5PA 2GSIA 3RWIB 4B50A 5D96B 4ZFOA 1TOXA 1A0QH 3GDBA 3HZVB 3IDNA 1IC4L 3N42F 5AOKA 3Q1EA 5CNHA 4U1IB 4W70A 4G8FA 4OFKA 3UTZB 1TQCC 2DLGA 4L3FA 2R69A 4IK6A 5DVOA 3UTSE 4JQIL 4JRXA 2F15A 2CHNA 2VUKA 2ZSWB 4H20L 4WEBH 3EO0B 1GJIA 1ZK5A 1ACZA 3SJVE 1LE9A 1DDHB 4QHLA 1KCLA 2E9IA 2EUXA 2F8IA 3LS4L 4R2GD 2OMZB 3HR6A 4A2HA 4X6FB 5HDBB 4U49A 2PW2A 4OM1L 1G6VK 2Z93B 3FU6A 5EC1A 3T2NH 2FEDC 3GMLA 4QUOA 4KAQH 5K33A 1CE6B 5E2TL 4KKAD 4R7XA 4YDIL 3CCHA 3GI9H 4XODA 1YG9A 2V33A 4HKJA 2QSTA 1T83C 2F5BH 3KYKL 2AXWA 1G7LB 2CLVB 4I85A 3TFBA 1DBKH 2R0KL 2W81C 1GZPA 2XRAH 1FNFA 4HH9B 2FCBA 3RA7L 2B1HH 3ZYIA 1JYVA 2G4GA 3D51A 1O6SA 5KSVB 3NCFB 1FN4A 2A74A 5T1KB 1ZLSH 1YJDH 2YKKA 3GLDA 4LOFA 4G9DA 2XZCH 2P43B 4L37A 2C1PB 2E74C 5JZ7D 1E7UA 4GT0A 3ECBB 3O4LD 4B9GA 4YC2C 3ELQA 4XMLH 1SNRA 3LZFH 3MBXH 3T77A 2VW4A 3KAAA 3WL9B 1GC1C 2VC2B 3G6JB 3D4YA 4OLZH 5DMYA 1G7IB 1X5GA 3TLRA 4ALAC 1WIUA 5LG1A 4C47A 1GGYA 5LVEA 3HS9A 4HUKB 2QTVA 1PZ5B 2X70B 3MRNB 1ADQA 4HXAH 2AV1B 3VI3B 2WLLA 1KUMA 1DYZA 1F0LA 1DUYB 5TH2A 3KW8A 4O00A 3W3BA 3KJ4B 4AC2A 1IBBA 4EQ3A 1MIMH 1EAPA 4KZ0A 1TJIH 3MV8D 4JJOA 4LASH 2QV4A 1EAJA 4BCXA 3GSOA 5AYUH 3E0GA 5CR8A 4O02H 4HIPA 4F5CA 2E86A 3MV7D 4LHQB 2Q2EB 4RDQG 2X4PA 2CIKB 3QUKA 5FYLE 2VKXA 3Q44A 1BLNA 1SHMA 5EO0A 4AL8C 1PAZA 3MO1B 4XB3A 3WJMA 3QZPA 3QDGE 4P5TA 4M7KL 1OTUD 4B53A 3IMBA 1OANA 2HN7B 1PKQB 2V5YA 1Y6KR 4NLHA 3DA0A 2DQUH 3DJTA 2VQ4A 2GG1A 1YUHB 3FQNB 4UQ3B 2AJXH 1Z2KA 1NSNL 5F1OB 4HJ1A 3KPMA 4L4VD 3VXQB 1OXYA 2HFGL 4EIUA 5KS9E 4XBMA 1TUPA 4OQTH 2WZPA 2W65B 3VWKA 3ARWA 1T04A 3GSXA 2F68X 2ICWA 4IOIB 4Y9CA 1E40A 3L3HA 2WCPA 3EHBB 3PV7A 3EF7A 4B95C 5CKGA 4S0HA 4ZJ9A 1KN4L 4NZUH 2JXMA 3AM8A 5SV4A 3DHPA 3FFCB 3H4FA 1BA9A 1KIPB 3VVWA 3I9IA 3IDMB 1I8KA 1KXTB 2CLZB 3NCCB 4J4PD 3TU6A 4YSSA 3EF4A 4BV1A 2DQCL 5AW0B 4DKEH 2XWJA 4LP5A 1K8IA 2W80C 3SSGA 3GMMB 4DGIH 4NP9A 3HA0A 5DHXB 2HFFB 3WEBA 5EO1B 2NYYD 4QRUA 3SKUD 1E5CA 1NMCC 3AG3B 1I1FB 3ARBB 4JKNA 5JHDB 4Y88A 4YL4A 2OM5A 4GXVH 5FM4A 5KSUB 5IJKC 1EAOA 3AREB 1D6EB 3QNXB 4LKCA 2C9UA 4XAKE 1LDPL 4PV9B 2YSTA 3ESPA 1X9UA 4M93B 5D2NA 5FB8A 2OMBA 4MXVE 1N18A 3OKDB 3EFOB 2E9WA 3CSFA 1RP8A 1O7SA 1V3MA 1A6WH 3GMNA 2PR4L 3H3BC 3VD9A 3Q9QA 4C59B 4HMEA 2AITA 2WNXA 1EERB 3NTCH 1AZZC 1FYTD 3EFDL 4PSRA 3PAYA 3DSFL 3QUYB 3HE6D 2XWBA 3QR1A 5DSCA 1N5YL 5DO2C 5EIIG 2CRIA 4NPKA 5F7EH 5C07D 3SOBL 3UBFA 4BM7A 4HETA 3MUY1 5C0CB 3S34L 1S5HB 1BD2E 4P2OA 4UF7C 5DQJB 3ILQD 3VG0H 5LAXB 2Q86A 3BWZA 4WW2F 4N1HB 3GPSA 5C0IA 4WV1C 5J11C 1QFWI 2HJKB 5LNDA 4Z77B 3W9DA 4WUUA 2QVFB 1A02N 1U8JA 4MYPA 4P5KB 1ZWIA 3MJ8A 4KO5A 1D5MB 4PRPD 1MWAH 5J12C 4GSQA 5EO9A 5HHNA 1BZ7A 4A55A 1LP9E 4QJ5B 1F18A 1OO2A 1MFUA 1GMEA 2JJWA 2VO8A 2FR4A 2X4SA 4OZIF 4H8QA 1RI8A 3UOAB 2RALA 3ISRA 1JZ6A 2CXGA 5KSAD 3VFOA 1VFOA 1LHZA 1KYAA 4L3CB 3QZWG 4K5MA 1I9RL 4KXBA 4U1NB 1USZA 4GEIA 2R0ZL 1DJIA 1E9OB 5AVXB 2K9FB 3EH4B 2HX7A 4OZGB 3CC1A 3HMWH 1UENA 4MBRA 4N0CC 4P59H 1Q0YL 2F18A 1INDH 3SKOA 3QO0A 3RY4A 2AJVL 3C5SA 4NRZA 4GMTL 1AJ7H 2E6PA 3GJFB 4A6YL 5IB3A 4XPHL 1KB5A 4I5BA 1HHHB 2KZBA 4Z7NE 4XCYA 4UM9D 1ZT7B 2Z4QA 1IKNA 4JM2C 5F71A 4XN1A 3R7RA 1R3JB 5EC2B 4ZODA 4FC3E 3AWFA 5ESQA 1U92B 5HHOD 4K3HA 3WY1A 4UI2A 3CFJB 3QBTB 3VRJA 2I26N 5TPWL 3HG2A 1A6AA 5BZXA 3RAJL 4URTB 1F4XH 5HHVH 4UT9A 5J3HC 5C6TL 3QZNA 1L9PA 1RFDH 2AXHA 4LSSH 4CSSA 1FHGA 1RIHL 4M6AA 2B1OA 2DWXA 4Q2ZA 3ZSSA 1RHHA 3O2DA 4BELD 4UT6H 1O7DC 2Y72A 3BP6B 2DYSB 4J3UA 2Z7UA 5IZ7A 4GNKB 4NFBA 2VLME 1DJWA 2VAAB 1FORL 3IGKA 5GRWA 3WV0A 2LTQC 4Y1TA 1NM9A 3NJJA 3QG6B 4IOSA 4MASA 3DK2A 4NUJA 3VD0A 4LQ1A 1GJWA 2H3XC 2GB2A 4PPTA 4OCRH 1M71A 4UINH 4CVUA 2AXGA 3NJKA 3L9BA 5FCSH 4XPFH 1BP3B 2H2SC 1S78C 2H32A 2UUDK 3WFHA 2WBJD 5F44A 3B2VH 1N59A 2NPLX 2WANA 3OHXA 2VSKB 1GGBH 1P7QA 3LIZA 2DTSA 4BKLB 1BBJA 5HGBB 4RZCA 1ET7A 2ITCA 5C0BE 3BGMA 5ELIA 5H8DA 5JO5A 5G4MA 1HAWA 1R33A 2BNRE 4FE9A 3L3DB 4EN3C 2ZNWA 5DA4A 4ELMA 3C6LA 2BZCA 5E8PA 4HHAB 3VAEA 4GIAA 2QSVA 2UY6A 4MD5A 1S7QA 4JKMA 4R8WH 2H6OA 1KNOB 3LKNA 4N87A 1F3JA 3RBGA 3UG5A 2JCCB 3ILDA 2P8LA 4Y5VC 4RNRB 5I82A 3CH8A 3UCQA 1PYWB 3TYFB 3RDTC 2HT2D 1DO5A 2EIMB 2A1WL 5HD8C 2FUTA 4GP8B 2IANE 5BRZA 4MAYA 1YCSA 3LHAA 5I1LA 3Q7JA 4ZFZB 5SX4H 2X89D 1BGXL 3QCVL 2CXKA 3BW9B 3RNKB 2YD7A 4EIGB 1URIA 3QIBD 4JO2L 3UG3A 3ZRFC 4FTDA 4KRPB 1A47A 3V4PL 1ZSDA 3AUVA 3B3BA 5JQ6H 1WO2A 3BKJL 5DQDH 1YPZB 5I1JL 4ZMNA 1KFAL 3KL0A 2O5NA 3WE6A 2A9NL 1XSIA 4BH8B 5KAQF 1U8OB 1J5OH 1BHGA 1X5ZA 3C8DA 3MRCA 1TQCB 2ERJC 4NQDA 4P5TC 3PXLA 4PJGA 1RZJL 5EZIL 3RLSA 3CVCA 2X4NA 5KEZA 1KLFA 4HF5H 5DWUL 1NDGA 3FRUA 4PYHA 3NZ8A 5GGUA 4EUPA 1H6UA 2BVTA 3UO1L 3KWUA 3ARGA 3SDCD 5DHVB 5ITBH 1UQSB 1MNNA 4BCZA 3SQBA 3C8HA 4A2LA 4NGHH 3BCFA 1EBPA 3LRGA 5E6IC 3P0VH 4RIRA 4ZUSB 3TX4A 1LM8V 1U3ZA 2X0WA 3B5HA 3REVB 2PTVA 1SMOA 4I0PA 4DK5A 2CR3A 1UZ6F 5EU6E 2WLIB 3EUDA 2P5ED 1ZHKA 4V1DA 1CT8B 1CE1H 12E8L 1Q72H 2CO6A 1T89C 2VABB 4TLUA 5IESH 1NGPH 1PZSA 4IDJL 2WXHA 3V0HA 3GBNH 4OLUL 1UM5L 4HUXB 2HMID 2CU9A 4L8SA 3E8UH 4H4NA 3CSTA 1QHOA 1CBVH 2ZG2A 4JREB 3PWPB 1T2QH 3AM8C 4YZFE 5JA9A 4HBCL 3F2LA 1NBQA 3A3YB 1IQDA 4DW2L 2HLFD 3QP3A 3AQDA 3EJCA 4X4KA 3RL2A 4IKIA 5LDSA 4UOQA 2X41A 4PJ5D 3ZUCA 1WWWX 1F8TH 5EEXA 3R18A 4PJDA 35C8L 4P4RB 3LRKA 1QW9A 4E5XB 4KI5E 2APFA 1ZRUA 2FJFB 4YC2B 3KYMB 3ZL4H 2H41A 3RFZA 3STBA 2WMPA 5D7KE 1HILB 4KFMA 4M8UA 3E6HA 3GIZH 4KV5F 3QB7C 3ZGIA 5HHQB 5JHLA 1TITA 4IIZA 3QCUH 4P2RD 2J8OA 2JB6A 3WKQA 1Q1JL 3ABGA 3D39A 4U4BA 2WN3A 1WFJA 2V37A 2ZWKA 3B6SA 4BSVA 1RULL 1S7SB 3NAAH 1Q94A 5HBBA 3ARVA 5B3JE 3ZW3A 4DP1X 4ORGB 2DQJL 3DSNA 1GGTA 4GI8A 1U3HD 4NJ9L 3U0WH 4FQLH 5EN2A 5FUOL 2NY3D 1WAEA 5JORB 4IKNA 1ACCA 4P2OC 5ID1A 4LOUC 4DO5A 2AJZB 2XKNA 3GM8A 3KBHE 3OX8B 3SDAD 5ACZB 4LEBA 4CW1B 4O5LH 2ODIA 1CICA 1OB1A 4JLRA 2GKIA 1SDDB 1R3KA 3QQ3B 4QI3A 3CVHL 5FYJH 5F7HA 4Y2DC 2D0GA 1KC5L 4JY5H 1BOGA 2HJLB 2VOTA 3N9GL 1JZFA 4AIZB 3DJ9A 3QK0A 3VXMB 1MY5A 1TZGH 2JKNA 4G6JH 3SIKA 2ATKB 3GHBL 2EVJA 2V8MA 4N2BA 1SFHA 5B1BB 1QHPA 3C9NA 3WEAA 3DV4B 1KZYA 4CU7A 1QWNA 2J72A 1LO5A 3E3QE 4WI6A 5GJTH 1ZTXH 2UYLA 3ETBF 4PY7B 4ZQKA 3GUTB 4TYUA 3CDZB 3V10A 2XKSA 4Z7OF 4WGVB 1OL0A 1QSEE 4Z7QB 1GRWA 2C3WA 2VN4A 3LEYL 5DFTA 4IM8A 4NO2B 1F90H 3EYOB 1G4RA 2FD6H 4PREB 2G9HA 4JRWA 3GSRB 3JWDH 3MNZB 4Z7UB 2E9JA 2H6PB 4NKDB 3TWCL 5I8EB 2PCFB 4FQQB 1HQ4A 1IGFL 3QRBA 4H13C 3V6OE 1IKNC 3VRIA 4AVKA 3UEZA 2DJUA 4U6YA 4HIEB 4JM0A 5AYQA 5D2LB 4Y19B 1UC6A 3IB4A 4MS6A 3AXLB 3F6LA 3QYCA 4KMTH 2EECA 1OGTA 4MZRA 1G9NH 5LWYH 5DHMC 3SN6N 2W0FA 2FQGA 4N2CA 3E6FB 4UWQB 1NMCB 4MJJA 3LQAL 5HVHC 1YDPB 3GWJA 4APQC 2XIDA 1WD9A 1ZS8A 4IBYA 5SX5H 1CXEA 1TKWB 2H6UA 1ZHBB 4U0QB 4PJFE 3K8LA 3LY6A 5FHAH 4K15A 1BEYH 1T5XA 4PH8A 3ZE2F 4G6KL 3ZU8A 1QLEB 1VGKA 2XN0A 1E4WL 1TQVA 1Z7JA 3GBEA 2VN6A 3DTDA 1I7ZA 1LO4H 2OJZH 3TIDA 3X12A 1LXMA 5IWLC 1QPXA 1AO7A 1V7NL 3JWOH 5IQLA 5BV7C 4YHOH 5I1GH 5EEVA 4XN4A 2VLRE 1QBMH 4TQEH 3RWGB 4JG0L 4WV1B 5J11B 5T3XH 3QNYB 3BI9X 4HXBL 2OL3A 2TSAA 4S0TD 1OD9A 3PNWB 4L29B 5DU7A 2NDFA 2YPLA 3HE7A 4XCEA 3ZZLA 5F6HI 3M8OH 4XMKH 5EU3A 2VUOA 4MNQD 5J12B 2YD4A 2HWZL 4WI3A 1WLHA 3DYMA 3ULSA 4BINA 4KHXL 1RHFA 4LARH 3OMZA 2VR7A 5HI4D 4YAQA 1AHWA 2YGQA 2FWOA 4LFHG 2YQ2A 2XVLA 4PG2A 4EI6B 4CJ1A 3OKNA 3EOBB 3DYOA 1ZLDA 5FYKH 4BFNA 3HCVB 3FTXA 4F80A 1UA3A 2RFXB 5HI3D 5DK0A 2VR3A 1F1AA 1OT4A 1WBXA 2JELH 4FKEA 1F6LL 3L3IB 3GS7A 5HYJB 3GZQA 4JFXA 4M6OH 2TSBA 4HJ0C 2VJ8A 4HT1L 3NFPB 1AR1D 4DERA 2QPSA 1XIWD 2DDQH 1T03H 4PV8A 3UX9B 3VGDA 3CFCH 3VJ6B 4L0YA 1X5HA 3GSNH 4P23C 5D1ZA 3IDNB 5E70A 3BUDA 5L8JB 1ZGLB 3NA9L 5TK4A 2YPVH 1TQBC 2IFGA 3LS5L 4KRLB 3JQOB 4ZTPL 3TJPA 3IMVA 2GTWB 3MCG1 3D85D 1ZCRA 4JRXB 1JRHL 4PWEA 2E4TA 2W88A 4BBWA 4PP1D 4B9CA 2VXTL 4WQOA 2HRPL 4XNMA 1LE9B 4RMTA 1Z66A 5C0AB 3QAQA 2EEDA 4QHLB 3QEQD 1FL6B 1JTTA 1YEIL 4XVJL 4XNDA 3W2DH 2HP4A 4UDUA 5AZ2L 4I0PC 6TAAA 3NCYS 4P4KD 3LRSA 1J5CA 1ZS2A 2R59A 4OUUB 4XPAL 5CU9A 3BXNB 4NKQB 4ZOCA 1OAJA 3MJ7B 2LTQB 4GUPB 4D9QD 2R0WL 2AEWA 4JZJA 2BRRH 1BZ9A 5I5MA 2VSDA 4L8SC 4Z7WB 3NMEA 1J1OH 2W07B 2BO0A 4KGJA 2B14A 1PFCA 3ILPB 4OFQA 2NY1C 4LL9A 2D31A 2PN5A 3B9AA 5DJZB 4TNGA 3BRDA 5FWRA 4M3KB 2QFRA 1MCJA 1O6SB 5IJVB 1FN4B 1B0WA 1N0XH 2FUQA 2FHCA 4EDWH 4OI7A 2QR0A 4G9DB 5F0JB 5AB2A 3KYNB 1JGUL 4L37B 5I0ZA 4RETB 4EN3B 4HUUA 4R4NC 2B1AH 1A2YA 4PSPA 4TUUA 5C2BH 1W72B 4M5YH 2EQDA 4Z1PA 4DNLA 3GT6A 1YEFH 4ZW6A 3T77B 4Q0XH 1BMZA 2DTMH 2V3EA 3IT8D 4PTUB 3GBDA 4LHJB 4Y5VB 2E7CA 4G6AD 3WS6C 4P3DA 4L1HA 4UT7H 5FM5M 4B60A 3RDTB 5GGVY 4ELKB 2E56A 2G3NA 3PLYA 3MJ9A 1YY9C 3FT4B 3JYBA 3VRLF 4JFDA 5HHMB 1KYDA 2WLLB 4DEUA 3VFUA 4JO3H 3UTSB 4G1MA 4ABUA 2ZKYA 3FRPB 3SJVB 1HWWA 1HWGB 3AW5A 4AVIA 3JWNC 1EAPB 1HHIA 1EK3A 2DBJA 3FUDA 3HFML 2HCZX 4BZ2H 4N6QA 3HI1B 4PRHA 5EEWA 5CZVL 4EI5D 3KPTA 1LL1A 3GI8H 2Y24A 3B56A 4G83A 3C5ZD 6FABH 4JFQB 3QSKB 3QUKB 3IJSB 2TRYA 4JQIH 5EO0B 4H20H 1M9WA 4ZFQA 4BSWB 1CXFA 3TH2T 2ERJB 3WJMB 4P5TB 1H3PH 3N41B 1PLAA 5LCVA 1KCBA 2W38A 4B9YA 1A4CA 3K6OA 4Z0BH 4NQCE 2O5XL 1DQKA 3LS4H 1FL5A 3BUBA 3NT0A 2I27N 3X1GA 2D7PA 1QFWH 2X4TA 3D33A 4MMZC 3S5LB 5E6IB 3QYMA 5MHSE 2XQ0A 5E03A 1OCWL 5GGRY 5C9JA 1MAKA 2P42B 4FQJL 5GRJH 1LVEA 2YRZA 3HC0B 2MMXA 4GINA 1G9EA 2D4DA 1MJ7L 3GM0A 3GSXB 1NCHA 3KYKH 2NRDA 4E5XG 5IR1B 3L3HB 3RIAF 5D4QA 5DDHA 5A3IC 2R0KH 3QHFL 3KZ8A 3H9ZA 2JXMB 3WTUA 4ZNEE 3D69B 5CMAB 3NIDB 2Y7SA 3LZNA 4Q6YA 3KPQB 3RTQC 3FUFA 1OP4A 5DGRA 1I8KB 4I1RA 3SD5A 1QYGL 2VZ3A 1JZ4A 3N1GC 4U2ZA 4WI4A 5IB1A 4C58B 5MENA 4KX9A 1WBZA 2X28A 3CU7A 4WGWB 4HIQA 5I5RA 1HEHC 3N85L 4XNXL 3DJRA 3QULB 4MXQD 4FMVA 2R83A 5KVMC 3UZVA 2BOBB 3EO9H 4X80H 2Q9OA 5EA0L 4KJPD 1DFBH 1HL5A 2DZEA 4ZOEA 2CR0A 2JKRM 4M6ML 3EGXA 2BCKB 2YZ8A 1RZPA 2ZTBA 3L9YA 1QO3A 3SKMA 2EEFA 2HTLD 3SY0A 3KXFA 3O4OC 4PJXB 1J0JA 3FPXA 5D2NB 3AAZA 5IV2A 2YD0A 3QDGB 3DXAD 5LQBL 4ZMVA 1RD6A 3GMNB 2IDUA 3UBXA 4FG6D 5GGSA 3MLZH 1EFXA 1KCSL 4UMGA 1KIUA 4JKPL 5DSCB 3EH2A 4QT5A 5MP6L 2XWBB 3WTXA 1HEJC 4HOZA 4HD5A 3BH8A 3BKMH 3VGGA 3WIHA 4P99A 4ZO7A 2DM7A 1V8HA 4NLAA 4P2OB 1ETA1 4MYWB 3DVGA 1JN6B 4M7KH 4N22A 2Q86B 1FSKC 4IHBA 3HG0A 3LZQA 3MPCA 4FKKA 3H7BA 4GUCA 4KJQC 1NCDH 3E3QC 3FHEA 4G59C 5CBAA 4JHAL 3CVBA 1RH8A 3BP4B 2CD0A 3A6OA 4OFVA 2M83A 4WUUB 3HE7C 4LCWA 2NX5E 1CDUA 3MJ8B 2PF6A 2EE9A 4Y2DB 5DZJA 2WWNA 2ZUVA 4TNWF 5ISZD 1ETJA 2EC8A 3HN3A 4ZXBD 1I1RA 4AKQA 3MJWA 3W11D 2QDVA 3ULUC 4H8HA 3V0EA 1X9LA 5IG7A 3MXVH 3WNJA 2X4SB 3RU8L 3C60C 4HJGA 3LXUX 1QFPA 4NKOA 3VFOB 1NFIA 2EDEA 2FYVA 3MAWA 3X3GL 4J3SA 1IAKA 1KJ2B 4G1EA 3UJTH 4MBOA 5I6OA 3FB5A 1KN4H 3VG9C 2XCMC 1I8MB 1HFUA 5AUMA 5K93A 1WFNA 2MKLC 1EJ6A 3SKOB 4JGJA 5AFAA 2DQCH 1CFSB 4KBPA 4S1SH 5IB3B 3C5XA 3NFSH 3N1MC 4AG4L 3HC3L 4HIIA 4XCYB 2Q20A 4FD0A 4WI5A 2F54B 4JFEA 4WAFA 5C71A 5E6ZA 1PZDA 2DI7A 3DUSA 5E6SB 3S7GA 4R5TA 3GEWB 3IFPA 3EGDA 4EXKA 4AXWB 4ERSH 2OA9A 2OKMA 2YOCA 3IFOB 1OHZA 3VRJB 4W9GC 3SEPA 3KPRD 1A6AB 1RY7B 4MD0B 1JHKL 2G2NA 4LEOB 5EULV 1LDPH 1V7ML 5HVHB 3TBYA 1BD2B 4Z0XB 4ODVH 1Q8MA 1B0RB 1RHHB 4O2CA 3SPCA 5CHNA 3S9DB 5I23A 2PR4H 4K3EL 3H2QA 4IBQA 4QRPA 5F7DB 4N8VA 1NGXA 2DEWX 3P2DA 3EFDH 4WJ5A 3MRQB 3P4OA 3QUZD 4MZIA 5E1AB 3KDPB 2A6IB 4PJCF 2JKTM 4WHTB 3TFKD 3KYAA 1ZE3H 5E95B 3S34H 4HJTA 1K6QL 1LP9B 1UUNA 1RPUA 3P73A 1H0DB 1M71B 1R3IH 2GTZB 1DQDL 2J3SA 4PGDB 2FYYA 4XMPL 1D5IL 1NC4A 5TDOA 3WFHB 3NACH 1N59B 5BV7B 5KZCD 3OHXB 2YD1A 4UZSA 5CZXC 1E2VA 1HZKA 4YHML 2AQ1A 3GMRB 2PXYD 4YBLC 5K1NA 4PN6A 4RZCB 7CGTA 1X5AA 3BGMB 5JO5B 1YYCA 2XBTA 4ADIA 5CEXA 4R4FH 1C5CH 5JYMA 4K0OA 3MREA 4E41D 2YD9A 5L9DL 2UY6B 5J6GA 4MD5B 4PJIF 4RFEB 1CXIA 3NCBB 1QABA 2EDHA 2OMYA 1I9RH 5IROD 4HOWA 5ACLA 3AXHA 4FQIH 2P8LB 3FT2B 2RTTA 5JXAH 3WLWD 2I5YL 2ITFA 2ED9A 2LLGA 2H0EA 3M1OA 1AKPA 5DJXB 1R5WA 2AJVH 2AK4E 4K7PY 4LMQI 4XO5A 4QY8A 5GS3A 3BMVA 1N19A 4XPHH 1K3ZA 2NOYA 4LCUA 3T0BA 5IB5B 1UJ3A 1SLUA 2N7BA 4JFFE 5FOBA 4BGLA 5CJXA 1ZSDB 3T6WA 3TOPA 4A67A 2CBQA 3DGGA 5ADPL 4DKFH 5EF1A 2BP0A 4JN1L 1Q9KB 5IF0B 1X4ZA 2CKBB 4P23B 1RJLA 4U6VL 5AZUA 4D8OA 2WGXA 4RAUA 1JGEB 5TPWH 2MKWA 2AEOA 3NIFE 2UVFA 4KO7A 5D7JC 3RAJH 1JWUA 1TXKA 3S3JA 1TQBB 2QKIC 3VWJD 3MOAL 5C6TH 3MRCB 4Q8BA 2MCMA 4FQPA 1OGAE 2X4NB 3S5ZA 3CMGA 1NDGB 2W0PA 3FRUB 2YGVA 3NZ8B 5FFLA 1TJGL 3ARGB 2NY0D 4R4BB 1MFEH 4ODWA 2Y6SD 4X98A 3PUUA 3ME0A 2JQAA 4RIRB 5DA0B 1TJMA 5C70A 1FORH 2N56A 3QFDA 4F37F 2XX0A 4I0PB 1LEKB 4K7PL 4Y4KA 5C0BB 4J2QA 5IK3A 5CP3A 5EOCH 3MODH 3KPSA 1RERA 1WICA 1YJDC 2A9ML 1JVKA 2BNRB 2KQNA 2YBRA 3CX5K 3H54A 4OFDA 4RMVA 5DRZA 2D9CA 2Y69B 4YHKL 3FB8B 5D7EA 1T4KA 2F1BA 1QBAA 2X3CA 3TO2B 4L8SB 3LN9A 3NSDA 2XV0A 4H8PA 1OTSD 4FXKC 4C83A 2NY1B 3GJFK 3RNQB 3BDBA 1SY6H 3V4UL 1TJHL 5MEQB 2K9UA 1RK1A 1L9OA 3BZ4A 5H37H 3T0ED 1T3FA 3BVVA 5AENA 4NM8L 4N86A 2ZP0T 4PJ9D 1AFVL 3S48A 4FA6A 4LPXA 4DVBA 2OK0L 1E6OL 4L3EB 3FRPG 3RFZB 2AEPL 3NESA 3FUHA 2O5ZL 3IXAA 1E8YA 4OKVA 3V0AC 3WY2A 1OPGL 1OT1A 4Q4IA 3SGJA 4WY7L 4ZSOE 4D0BA 3OF6A 2R1WB 1RPKA 4WW2A 2X6VA 3B6SB 1DVFD 4J3OD 3RVTD 3JVGA 3HEIB 1BGXH 2FBRA 2J55A 3QCVH 2AI0L 4BSVB 1Q94B 4YNYA 4JO2H 1I8UA 2ZCKL 5LBSA 2HB0A 1ZT1A 4TM9A 1OPOA 1KT2A 3W57A 4ZBJA 5E8OA 1Z5HA 4K23L 5I1JH 2YXVA 1KFAH 4MDJA 1GTFA 5EN2B 2YSSB 3S5LG 2ZWNA 3V4LA 1I8LC 2GBVA 3WFEH 4AJVA 3PHQA 4HLZH 5ID1B 4N28A 5EU6B 2Y6TE 5IEKA 2XKNB 3FOMA 3N40F 1OP3K 5TE4H 1QI5A 2CAKA 3D18A 1I1YA 3IMUA 1TNNA 2VC2L 1TTRA 1UT9A 3C2AL 3MLSH 4AWJC 1CICB 3UO1H 4B5ZA 4P46D 1WFTA 3L7FA 1LWHA 1T20A 3ZUNC 5I28A 4PP2B 4G9FE 4CA4A 1NBZA 5FYJE 2HVKA 2OMTA 3AMKA 4I88A 5IOKA 3ARSA 5BOPA 3O0RH 4XGZA 4PLJD 5T1KD 2MNWA 3PWUA 5EFIA 1NANI 2VMJA 4L4TA 1AMYA 4MMZB 3DMMD 3DJZA 4K5NA 2IEPA 2BFGA 2DLHA 2I24N 4CVXB 5IHUL 12E8H 4K3DL 4IDJH 5I8KL 3OKKA 5TFSH 3UPRA 1XQ4A 3WJJA 1UM5H 2G9KA 3FUNA 1DVTA 5LGYA 4FF9A 3T3PF 1MJ8L 4R6UA 2GABA 4ZQKB 3BT2L 3V6FA 1ZTXE 4HBCH 3P02A 1S3KL 2C4FT 2EH8H 1XL4A 5K9QG 2KT6A 4M43L 3U4BH 3RTQB 3V0JA 1J11A 1Y0LA 4KUCF 4KXAA 3UP1A 35C8H 5BS0A 2P8PA 3VRIB 1BREA 1K4CB 4CGUB 5BZWA 1Z9PA 3PWJA 1YNKH 3MNWA 1OGTB 1KCUH 1KGCD 3O6KL 2COQA 1K2DB 1F1DA 1FH2A 1Q1JH 1ZS8B 3HBQA 5HJ3A 3FTUA 4ANUA 1RULH 3NJMA 3O4OB 4N2HA 4N68A 3ZRCC 2FEEI 3QR0A 2CIIB 2VXUL 2Z1PA 5FDWA 2WWOA 1K3IA 2YMOA 3K8KA 3ZBMA 4NRXA 1MFVA 3S6CA 4AUYA 4NJ9H 1KGIA 2NY6D 4BH7A 2X05A 1X7SA 4MMXA 5HDWA 4PJ8A 4UDTA 1BMWA 3PL6A 3BSZL 2ODHA 3M07A 1NEUA 4BFFA 2AK1L 1DCLA 4FEMA 4DTGH 4OJDH 1IBYA 3RKDD 3T3ME 4MCYA 2I85A 1AO7B 1J48A 1YNTA 2BS71 2JTYA 3TA3C 1UM4L 5F7LB 1FSKB 2ZQKA 3EHBD 1LK2A 3IXTA 1TEGA 5MEPA 2VMCA 3MR9A 3H6AA 5T3XE 2WLNA 2OL3B 4ZMWA 1BYOA 1JPFB 1DLFH 3HE7B 1E5YA 5DVMA 5EU3B 2XTLA 1GYVA 2C9XA 3NGBC 3IDXH 5BVJB 3ULSB 1C1EL 3O2VL 4R5XA 1DVXA 5KBPA 2ZIDA 3GHBH 4FQHA 4F33A 1D7DA 2FZ3A 3ZX1A 2C4XA 3AQXA 2FWLB 2FWOB 4OI8A 1PEWA 2GJ6A 5GS0L 3S8WA 2RR3A 4XC1L 4XNUH 2XC8A 3DO7A 5AW7B 5FYKE 1XB6A 5DK0B 5SWSE 4M29A 1JK8A 3VG9B 4ZFFA 4PJ7E 2V4LA 4ZT1A 4H0LC 3V4VA 5JMRA 2KC0A 4GG6E 4N90E 2DKUA 4HDIB 5FYJU 1P5VA 1JGDA 1QOKA 2PTTB 1IGFH 3CLFH 1CGWA 2B39A 4NRYA 3KLHC 5F89A 4Y2OA 1UD4A 2XICA 1AIFA 1M7IB 3LXBA 4PJFB 4Y9BA 1PZUB 4PV8B 3VD7A 3QUXA 3BKYL 2MHAA 1AYRA 5D1ZB 3BQUA 4GKNA 3VTTA 2G2RA 3QUYD 2ZKWA 3HHMA 2A9AA 2RAMA 3VXOB 1QLRB 2D0FA 2KL6A 4UTBA 1ASQA 4TSBL 5T3ZD 1FGNL 2CRZA 1K5WA 1P4UA 4NZTH 1UG9A 2OSYA 5DMIH 4G80B 2QVMA 1OCCB 3SY6A 1CDIA 2IQ9L 2FGWL 4I9XA 2XV6B 4QDGA 2SODB 3KWXA 1RL1A 2O26U 3L4XA 4XNMB 4F2EA 3MRDA 5AW6B 1N2RA 2L8AA 1JZDC 1ROCA 4G6KH 2IAMD 2VLRB 5E5RB 2UUDH 4P3CL 1E4WH 3SYAA 1MSPA 2WBKA 1TG8A 5AOIA 5JNYA 4X5RA 5FV1L 1M05A 3L4VA 3AXIA 1VFMA 3LRSB 4JN2A 5INDB 5TQ0H 3SE9H 4NAMA 2IWKA 1HS6A 5FWQA 2XWDA 3M86A 3UPCA 1IM3A 1G9ML 2EDOA 3QXDA 5HGHA 1SGKA 4Y4HC 5DT1L 4MDRA 3ABZA 4FLOA 5BZZA 4XBEL 1N7ML 3CFQA 2LU7A 2Z7WA 2APXA 2CK0H 4EVNB 1AXSA 4YBLB 3ZTJG 3IK2A 2IALB 2WQ8A 2HWZH 4OLYL 2G30A 1ROWA 1W0WA 2QR0B 1CPUA 3QPKA 3SPJA 5C09A 5I1HL 1JGVH 2CO7B 5LUMA 4LFHD 4NQEA 4HUUB 4KHXH 1A2YB 3EZ8A 2YRPA 3PDOA 4XOCA 3P4MA 1J1PL 4OR1A 3MBED 4HKBB 2Q8AH 3OAZH 3HMXH 9PCYA 1WZ1L 3MXWL 2JJUA 1HWHB 1L3NA 2F7OA 4P3DB 1SXSA 3Q8BA 5D1QE 4HJSA 2V9TA 5EORL 4WW2C 3ZKMD 4MRCA 4FYTA 3RYMA 2BPBA 4JFDB 1XCTB 1YEHL 4PCSA 3VFUB 1VHPA 2E7HA 4HT1H 4W1TA 3CGTA 2DY2A 5DD1L 1FVDA 4G1MB 5AOJA 3S2AA 1HHIB 2X4UA 4NENB 4F8PA 5IKCA 4PRHB 2JIXA 3H7LA 2X9ZA 2G5UA 5J9PB 4WENB 3V0FA 2WINB 2F61A 2NY5L 4XP6H 1FNLA 4NKIL 5E0QA 1MLCA 4FI6A 2XN9B 4J8RA 5D7JB 3STZA 5FYKU 2QKIB 3VU2A 1HH6A 5D6DA 1LEIA 2HRPH 1JNNL 4JKWA 5AOMA 3K5SA 4UIKH 5J6SA 2XI9A 3FONA 1YEIH 4HU2A 2X4TB 5INCB 3QJUB 5FHBL 1IFGA 4IYKA 3BWAB 2VB5A 2DWTA 4XPAH 4X6BA 3A4FA 3ATAA 2ZXDA 3D4ZA 5JW5A 1UTDA 2ZPKH 5C9JB 4KQ3L 2NQDA 3BDYL 3DECA 3O4LE 3WJJC 1A14H 5IGXH 4RAHA 5CF3A 2ZOLB 3B37A 3IN2A 2A4ZA 3QQ4A 3FF8A 1E28B 3DI2B 5DDHB 1ZLVK 3HLAA 2OCJA 3L3GA 1N6UA 4HLJA 5GRUH 4J27A 4FXKB 4N4YB 4TULH 4WU5A 3FOLA 3FF7A 1KPUA 3QEGL 4GFTB 2X12A 4FXTA 4LVHC 1INEL 1RLBA 5IB1B 5MENB 2BJML 2NCEA 4PJAF 1RIUH 4E9WA 2HTKC 2A9CA 4XX1E 1SOQA 4NCC2 1J8RA 2CRMA 3MV8E 1ETZB 2E7DA 4ZMZA 3N0AA 3UZVB 3JWNG 4QF1A 3EGXB 5DTFA 1VEOA 4JRFA 1X9RA 4KFZC 1QR1B 3T0WA 1VAHA 4MA8L 1QO3B 3HZ3A 2VKWA 5GZNA 3SKMB 3SY0B 1DLHB 2YA2A 3N1FC 2XTJB 3ZKNC 3SCMD 1DSFH 3VH8A 3DROB 5IV2B 1G7PB 3X17A 5DJ6B 1VESA 1Y18A 1P1ZB 4KZDH 1JWMA 3FU3A 4NQCB 5LXGL 4PJ8C 4Q56A 3PL6C 1EFXB 5D5ME 3QJXA 3FFDB 4QT5B 2X6BA 3WUZA 2J71A 1HHJA 4DK6A 1J05A 5DZVA 2IDSA 4TOYL 4PWKA 3FBQA 2CKNA 2VISA 3PF2A 4WI0A 1OT2A 2RH0A 2A6DA 5JIDA 3PYCA 1E4XL 4ZAKD 4YBHA 1KWKA 4XN5A 4IRJD 3MLUL 5CBAB 3NEOA 4HMDA 4TMPA 3PWPD 2HLAA 4ALAL 4HALA 4Y5XC 5AVTB 5GGVH 5HJBA 5DJCA 3BAIA 3U6XS 5DUBB 4NQSA 2H47C 5IHLB 2Q5BA 1U36A 4KK9C 2DICA 3QZLA 2GITA 1EV2E 4MXWL 2EVHA 1KJMA 3JWDC 5FLVA 4FFYL 3L1OL 5IG7B 1EAQA 4FQJH 4ES8A 3N2JA 4XNBA 4ESKA 3NK3A 2BNUA 1M6OB 3RTLA 3RX5A 3CDFA 4JE4B 1MJ7H 2JKLA 3GXIA 4NKOB 3T6VA 1NFIB 1QACA 4KQ4H 4RRPM 4JZNA 3VXRA 4AE0A 1EEZA 1IAKB 2VLJB 2C9RA 3TVMC 4G1EB 4GRLC 5F1IA 3N42B 1KY7A 3JTSA 3HZMB 3HAEH 3FB5B 3N91A 4B7LA 1MCEA 1IT9L 1HCYA 3QDJD 1XH0A 1W2KT 5PCYA 3VFVA 4HISA 5AUMB 2YN5A 2K8QA 4HPOL 1FDLL 2HH0L 3DK0A 1XTLA 4Y8DC 3R0MA 1U8MA 1ZANL 4AL8L 4D9RD 1F4YL 4YO0A 1QYGH 4GS7C 4LHUD 5DC9B 5C0DA 1SF3A 4XC3H 1SMAA 4X99A 1AAJA 4BKTC 4DP8X 3D48R 5DZOA 4JFEB 3N85H 4XNXH 1J86A 3B3IA 1QFUL 5I8CB 3EDEA 1V05A 1A1MA 3DUSB 4Z7AA 4XRCA 1CCZA 3IFPB 2MWCA 1FYTE 2ZAIA 3EGDB 1UOVA 4OB5L 1QG3A 5EA0H 1JZGA 2ARJA 3L5IA 3VXNA 3Q06A 3C75A 1TTBA 4M6MH 3FS9A 3ZQ9A 2FBOJ 3ZR5A 3IRZA 4L4VA 1MQKL 4ZDHA 1IC7L 1XGYL 5FIEA 3TBYB 3BFQG 1CTOA 3TCLB 2Y7QA 4HK3N 4ZX3A 3JWOC 2R29A 2X4RA 1AOZA 4DFHA 3C09C 2OQJA 3SKJL 3D06A 1A1NA 3N0PB 2ATPA 4IGBA 4UQ9A 3RZWA 2XPGB 1KCSH 4OH2A 5I0XA 1JGLL 4PRPE 4WJ5B 5MP6H 2EO7A 1CFBA 1VERA 4U1LB 4Y16D 3D87B 4LLWA 4JPKL 3FU5A 1MWAB 3ZHLA 4KTYA 3LX9A 2Z31C 1NFDE 2K8MA 1KJ3H 1RJCA 4L48A 4DQOL 5L88L 5M94B 1KYFA 2FYYB 3U7WH 1CXHA 1U91A 1CD9B 2YKLL 4M7JH 2YQ3A 1GGIL 3EDJA 1XGZA 4HW6A 3B9VA 1HL9A 4W81A 5E5MA 3KPLA 3ZDYF 3KG5A 5L4IA 2ZYRA 4TLKA 2A9BA 5CEXB 2CGRL 5IW3A 3BYTA 3ZTDC 2JJTC 2H8PB 1R3LB 1KXQA 3F7LA 3NGBB 3MREB 1NJ9B 1QLEL 3TASA 3KR3L 2VN7A 1JV5A 3X3GH 1NCCL 2WUBL 3EXJA 4FTVD 1PG7L 2OMYB 1L9NA 3T2PA 1MVYA 2ZX9A 4GI9A 1IQWL 5HHOE 1MCOL 2R8SL 3OHMB 4HG4J 5L8LB 1QR4A 4AQAB 1RVFL 2WLMA 1DEEA 1YEGL 3NIGF 3Q2LA 4L9LA 4ZUUA 1OK0A 1DQVA 3O3AA 3KEHA 1UCBH 2ZOKA 2IIJA 3V7AG 5C07A 3GINA 4IIQC 2YXFA 1U2CA 4GW4B 1DQTA 2EH7L 4QY8B 5HPMA 3F00A 4K73A 4Y4FA 1E3FA 3GGWB 4Y9EA 4LCUB 2JF1A 4LIQH 1M57B 5E4AA 4KITB 4PEEA 3VFMB 5EBLA 2NY4C 1EO7A 3QDME 3LB6D 1Z9SA 3IBOA 3DGGB 5KUKA 2XX1A 4JFVA 1R0AH 2GT9A 3K2KA 3PCYA 5F3BA 4RAUB 1OALA 5DJYA 3RUGF 2JKWA 1V7MH 5D72L 4P2QA 5GXBB 7TAAA 2ADYA 1F56A 3FKUS 4OGZA 4U6XB 2VERA 2G5BA 4EZLA 4IK7A 4K3EH 5AQ0A 1P9MA 4BQBA 1QSFD 3VGHA 1BECA 4ODWB 1KBGH 1JIBA 4X98B 5E7FA 3ME0B 3TZVD 1MCSA 5B1CA 2N01B 3QFDB 1CFQA 3ALPA 1XGQA 4GBXA 4Y4KB 1LD9A 4DESA 5EPMA 3KPSB 2YBRB 1K6QH 4M1GL 5GIRA 5I9QC 3NOIA 5IBLD 3O2WL 1WQVT 1YZZA 5KG9A 4KX8A 3A67L 4XMPH 3KJ6L 5L8KB 4HUWA 4FOMA 4Y4HB 2AC0A 4OFIA 4ZNCD 2XG4A 3DKHA 4QAMB 4UU9A 3MNMA 3UZEA 5JW3L 5BUGA 5C0FB 4LESA 5DO8A 4YHMH 1T1WB 2R69L 1EEYA 1KJVA 5B8CA 1Z9LA 3REWA 2J44A 3LEVH 2WLJA 2V6HA 2AJ3A 1RK1B 3NQIA 2YWYA 2CA3A 4XP1L 5HYSA 4CSZA 2GCYA 3BZ4B 3DRQA 1GZQA 1T3FB 5L9DH 5BJTB 4A37A 4DVBB 1JDCA 2NUTB 3TC9A 1AC6A 3VSQA 4JRYA 2YO3A 3MLYH 5AW2B 4R2GC 3FPYA 5ALBL 4KNTA 3LN4B 4OKVB 1GTNA 4BQ8A 2I5YH 3QFGA 4CAGA 1FZJA 2IADB 4LT7A 4D0BB 5LGHL 5GZNC 2E4FA 1R19A 5ES4B 5L0QC 2Q3AA 2PO6A 4MJ6A 5SWZD 4RGNB 4WW2B 3U7AA 4JRXD 5IW1B 1NCAL 4KKAC 1G7JA 4NN7C 5DJAA 5BOZG 1QASA 1CD1A 3MUUA 3VFTB 4JVWA 3VI4F 4Y5YC 1ZT1B 2OYPA 4UNIA 1OV8A 3UAJA 3FN9A 2O6CA 1U93A 5EU7C 1SYVA 2J73A 5E8NA 5CLYA 3LQZA 3BYYA 2WNGA 4MDJB 4U6VH 1XHHA 1E3ZA 4OZIB 2BX5A 2VMDA 5HJGA 4WDIB 1W72L 3H0TA 5AWNL 1HNFA 2XQBL 2IWEA 4WFHD 3MOAH 5CGMA 4NKMA 5JZ7C 2QPDB 5A43C 3FOMB 1FO0A 3D18B 4ICXA 1DBBH 1G0XA 1CGVA 4M3JA 5KBLA 2H2SD 4I3SL 3L7FB 4ODSH 5D7LA 3SDXE 2A9DA 2OXHB 2MQ0A 5HY9B 2OMTB 3MC0A 3OJ2C 3GRGA 4A2GA 2YEQA 1ADQL 2GJPA 3NZSA 4K7PH 3WI9A 4CADA 4GUQA 1PSKH 4YQXL 1W16A 3DTUB 1VZHA 5GS0H 4MX7B 5F1NA 2UWEE 5AW1B 4R26L 2L3BA 3GS4A 1QRNA 4LSRL 4KDTA 4AGQA 4YHKH 2EDKA 1VLXA 2X89A 1MLBA 3OKKB 3P9WB 2Z65C 4ANWA 1IX2A 3MRMA 3UH8A 4J8QA 1BZ8A 1BQUA 2L04A 1ZA6A 1M2OA 4YR6A 3U46A 3V6FB 2CGZA 4QNPE 1MHCA 1TJHH 4IU2A 4P2RE 4ZTOL 1ZOXA 4ZSOB 3ZZQA 3MYZA 2DQHL 4J3OH 5F7FA 4OD3H 4OZHE 2E47A 5C08A 4X0NA 4L2LA 3DVNA 1Y0LB 1OTUC 5BS0B 5JPMC 4KUZL 1WAAE 4LVHB 2P8PB 1S9KC 3FO1A 1AFVH 1JNHB 4JAMA 4U1KA 5G2NA 1LO2H 1ZHLA 2BIIA 5DD0L 1E6OH 3SE4A 1ND0A 3K6NA 4YHIA 3V0WL 4DGUA 1W6WA 2AEPH 2Z8VC 1FI8C 1P0SE 2EDTA 4G6FB 4JFOB 4LLYA 4PJCA 5B1JC 5FGCB 1ECYA 1CURA 4WTZG 1G0YR 2JLLA 5CCHE 1NAMA 2V2TA 3BN9D 5E1IA 5ANMA 3P3YA 4G8IB 2NY7L 2P5EA 1IM9B 1AXIB 4P5TD 3IJEB 3U30C 3AFLA 5L2JB 1SVCP 3MU3A 5DUJA 2ZCKH 3HJEA 4IGBC 5FDWB 2EUVA 3V0VA 2BDNL 1ZGLP 4P57A 4OCSL 1JF6A 3TBVB 4Z5RB 1XF3B 1ACXA 4PJ8B 4YWGH 3V6OA 4GAGL 3PL6B 3ZMEA 4BZ1A 1IB5A 2V5MA 4J4PC 2GSMB 4FYQA 2X7LB 4PJIA 2WZPD 1D7BA 4MCYB 3VWKD 4PJ5A 4YX2H 4LSPH 3C2AH 4X4MA 3JZYA 4PFEA 2NYYC 2R15A 5MEPB 1RIVH 3MR9B 2FLRT 4TL5A 5F8QC 4Y5XB 2A4EA 2WWMD 1FH5H 2AW2A 1EDYA 5K9KA 2VL4A 4TQIA 3PAZA 1U4FA 3FT3B 4LAQL 4NXSA 5DMKA 2ZUQC 4KTDH 4YHYC 2N7SA 4K3DH 2R4SL 3MLRL 4BFIB 2KZKA 1WZMA 2C3VA 4DEPC 1QHQA 2CGYA 4HKXB 3WBDA 1HINH 2GJ6B 1URLA 1P4BH 4KKZA 1KBPA 3ZVVA 4X6EA 4DGYL 3AZUA 4YDZA 3DO7B 3TVMB 1U3HA 3HE6C 3II2A 1JK8B 1R75A 4FG0A 4Z7VF 4XMUA 3LN5A 1M7UA 1IGJA 1XR8B 5GRXG 5AG8A 4M43H 2F58L 3BPLC 3IDIB 4N25A 2W59A 2E75C 2ZWSA 3ILQC 3I2CL 4YE4L 1SJMA 3PWLA 4JDVB 4N8UA 3EH5B 1N64H 2ZG3A 4NRYB 2P5WB 3MOBL 1RUAL 5AKRA 1HJCA 3VACA 3RVWD 1NCBL 2Y25A 1TVHB 4NUPA 1JF1A 3D25B 1BAGA 4R97C 3TIEA 1HHKA 4YSEA 3L9RB 1PLGL 1VFAA 1CLOH 4BA8A 1OZTG 1XDTT 3BN3B 3O6KH 4LGSB 4OCYL 3VQ2C 1WP6A 3TBTB 4FNQA 2APBA 1DVYA 3EJPA 5A2JH 4U1MA 2PETA 4P2OD 4Z7IA 1A6UH 1A9EA 3T3MB 1KJ2L 5KSAC 2XWZA 4XVTL 4ZX6A 4HIXL 4PRAA 3RGVA 2ESVA 2GIMA 5F96H 1ED3A 1FE8L 5A6LA 2JSFA 4WUUD 4JZOA 3C09B 3Q05A 1QPPA 25C8H 2EE6A 5BQ7A 1M05B 1KXVA 4JUTA 3QQNA 4GB9A 5A2FA 2QGEA 4ZUWA 4NQQA 4G5ZL 1L7TH 2Y06H 2BVUA 5FKPA 5HGHB 4TSAL 2BXYA 4L8BA 4PJHE 2H26B 4XZUA 4F92B 4RMQA 1E67A 2Z31B 1H6TA 2QQQA 1KSRA 1UM4H 2I32A 1UH4A 4MVBD 4YIQA 3RPKA 2B15A 1QPKA 1EIBA 4NQXA 4HKZA 3AWGA 2G3XA 5I1AB 2WLKA 3C08H 2WW8A 4UB0L 4KKLD 3QQ9D 2DQEL 3VX0A 2PYEA 3JT2A 4OCNC 1C5BH 4QRSB 5B1AB 1AXSB 5SWSB 1TEFA 4B9PA 1MFAL 4PJ7B 1T21B 5F8RC 1A7NH 3ULAB 3GXNA 1W0WB 3O2VH 3EJSA 5C09B 4HH8A 2FSDA 3LKRB 3O2DL 3PDOB 1D7CA 3K0WA 3FTGB 1H9DA 2WCSA 4YS4A 3AS2A 2AJSL 3U0TA 3VXSA 1UXLA 3B9KA 4JCMA 4Q9RL 2WYZA 4IKLA 1A6ZA 3FCBA 4QXTA 1UVQA 4WZ9A 3BVXA 43C9A 4WI9A 4PJ6A 3HN5A 5T3ZH 1PTZA 1SXZA 2ICEC 3POHA 4KU1A 4U1SB 3GSNB 3NFNB 1CLZH 5KJ7E 2V7NA 4GEJA 4AI7A 4ODTL 1R3HA 3INOA 1HTYA 1UH2A 5CEZH 5BV7L 2NNAA 3JT0A 3RWEB 4U3SB 3MA7A 4X6CF 4Y1SA 3ZJAA 1FFQA 2W92A 3QIWA 3LIZL 2AAVA 2DJMA 1BXVA 4G43A 4FLQA 3QEQE 3VCLA 3GQFA 1IE4A 2X4UB 3H2WA 1AKJA 2JIXB 5T8IA 4RH4A 2QHRH 1KLUA 4N26A 4R7NA 3K81A 4YHNB 2ICWI 3N5AA 4ZMAT 4XH2A 2FH6A 3A0OA 4IOSD 4TSBH 1HT6A 2XBDA 1JXFA 2C26A 4Q14A 4D9QE 4BWWA 3WLBA 1W80A 2VXSL 4J8RB 3STZB 4LEXH 4D8PB 3FCUB 1H15A 1HH6B 4LSQL 2F0CA 3AC0A 1HC1A 2H1LM 4DFIA 5H2BA 1LEIB 4Z9KB 2ZYSA 3IGUA 2DKMA 4Z7OB 1P7QD 2KYIA 1PFOA 4P3CH 2HT2C 1X44A 1NEZB 4LSUH 4M5TA 2OYLA 4M56A 2EIKB 2X6UA 1Z5LA 2MIZA 4GSDL 3G5XB 4S0SD 2GC7C 4X6BB 3GJFH 5HGAA 3UC0L 5JW5B 3MFGB 2EDNA 2R39A 5ESAA 1A3ZA 4N2EA 3C6LD 2X38A 4N8PA 3MRPA 3PJNA 1TPXB 1ZLEA 3HR5B 5I9QB 1E2WA 3QIBC 4WGKA 1C08A 1M2VA 4GSXA 5J56B 3QQ4B 2WK2A 3FFOA 3SQOH 1RK0A 3K8MA 2CKBL 5EBMA 3APMA 3ULVF 1BFTA 3NCYP 2A83B 4FZEL 3C87A 4GJTB 4JM4H 2ITDB 3KBFA 4LCCA 5BRZD 2D0HA 4RMRA 3FOLB 3I9PA 4MAYD 3LNDA 1OM3L 1KPUB 5CEYA 1FPTH 1I7UB 2YN3A 3X1BA 1T7ZA 4QLWA 5FECA 4K3JH 2B3IA 3SE4C 2AQRA 1J1PH 4NQVA 4HJJL 4PWHA 3V0IA 3AT0A 1G7MB 2WZAA 5CM1A 4H1LA 2J88H 1CGYA 1WZ1H 5FA4B 2YAFA 4X7FC 1WSST 3STLB 4DEWA 2IH3B 3BUYA 3Q5OA 5KYXA 4IJ3B 1Y6MR 2Q10A 2N4IA 5DD5L 3VSVA 2BFVH 5HDLA 1T7VA 4NQDD 3MQIA 2OTWB 1TT6A 1YEHH 4RESB 5L0QB 3AJ7A 2Q76A 1PJ9A 1MCRA 2CO2A 3PHAA 3QXVA 4WU7B 4G8GA 3VH8B 2HMIC 3ARGD 4NN7B 2VJXA 5DD1H 1OP3H 1NCNA 5K59E 1JWMB 1EDHA 2AVFA 4Y5YB 2Q8BH 5JOPD 1JVOA 1B4TA 1YYLL 2R7EB 2UZXB 2HLFC 3MRGA 1DL7L 2J8UF 2ZXQA 4NKIH 2C1OA 3RJDA 3I6GA 5DI8B 1J05B 4V1DD 3SQRA 4NP4H 1T0PB 2BWDA 2Y3AA 4F8LA 2RIKA 2W5PA 3QS2A 1JHTA 4YHZH 1H3VA 5K1JA 5IMMA 4PJEE 1JNNH 1EPFA 1B6UA 4MJ5B 5EOCJ 1T1ZA 2HLAB 3VNZA 1OEZW 5EUOF 1RURL 5DJCB 3VFGH 4PRIE 2ZUXA 3ORJA 1SM3H 3CFEA 4NQSB 4I13B 5BW7A 1DE4A 4NO0A 4XMVA 5CN2A 1CFVH 4K5OA 1FP5A 2YK1L 1KJMB 4KQ3H 1LWRA 3L17A 4LLAA 2E8YA 3I74A 3BDYH 3QARA 2OW6A 4AC4A 4NBYB 4XP4L 4S1QL 1FRGH 5GS1A 3VFPA 1EEZB 1K5NA 1NIAA 1U3HC 4HS3A 2QQNL 2ZP8A 3JTSB 2W9EL 3MV8B 3BHBA 2FRGP 2B59B 2NY3C 5DRWB 1UADC 3VFVB 5KSBF 4EI5A 2ICES 2HKFL 4NUMA 3FB6A 5I1IL 3MUJA 3RBSA 3MV7B 3D39D 3NSJA 1GPOH 4X9GA 5F6IB 3QUMH 5DEGB 1MJUH 3WY3A 3HZYA 2Z0BA 4YO0B 1YEKL 3NPZB 2ICCA 2BIMA 2KLRA 2BJMH 1H8OA 3DXAE 3VX1A 4YPJA 4IBZA 4F20A 4Y1AA 5JPMB 4IOFD 2GJRA 1UB5A 4HV8A 5LAPA 5DLML 2X6AA 4U05A 4X7TB 5GSVA 3K91A 5I1KH 2P52A 2QGDA 1P84K 3BWSA 2MJWA 4MA8H 4L4VB 3ZE1E 3VYOA 1XBRA 3RGVC 2WQXA 3M7FB 1CICD 2Y7QB 2H7WA 4LB8A 3ZHFA 3R7QA 2X4RB 4POZD 3U30B 3WEOA 3QNZB 4JGMA 4M4RA 2CUHA 4DCQA 2ATPB 4IGBB 4LNVA 5ISZE 3SPIA 3BAEL 3CD4A 3K2UL 3P0GB 2VN5A 4AKPA 4LL4A 4X4ZA 3SBPA 4ZW7A 2B2XL 1L0QA 5AW5B 3LPFA 3ULVH 2FLMA 3MKKA 3NJNA 1E4XH 3IRPX 1JTOA 1I3GH 3BPNC 1N9PA 3MLUH 3LKSA 3ATBA 4E9RA 1WZLA 4FQXA 1NCWL 1NDMA 3IWVA 3PABB 5E5MB 2DD8L 4ONOA 1GKOA 5KAQG 3LRLA 3VM5A 1T1YA 2PPEA 4GT7A 3L1OH 3Q8FA 1MF2H 3PY9A 3Q6GH 4ANXA 4FQCH 4YHYB 4GP5B 1JV5B 3HHSA 1MREH 3TONA 4AEHL 4LLVB 4JJ5A 2B4CH 4DEPB 1I4FA 6PAZA 5E00A 1GS8A 4HCRA 1MHPH 4P3WA 4F57L 1MRDH 1IT9H 2VDPH 4OF6A 4PY8I 1KTCA 3V52H 4PVLA 3HE6B 1HI6B 2VH5L 3KPRE 3IJHA 1S7RB 2A73B 5AKTA 5E2UH 5FUCC 5C07B 2VDLB 4AL8H 4KVCL 1F3RB 1F4YH 4A7TA 3BPLB 4B0MB 4Y4FB 2WLYA 4RGOL 3KVPA 4KH9A 4HFWA 5EBLB 2OL3L 3VDAA 1L9QA 2GSGA 1QFUH 1J0ZA 5FUZH 4N0YL 2Z3FA 4OB5H 3Q43A 4DO6A 2Q3XA 4R97B 1MAML 1FLRL 1EHKB 2EINB 4NAJA 1WF5A 4PRPB 4QCIA 2DM3A 3ULUL 1NKOA 5F97E 1XV8A 2IBZX 1MQKH 1ORSA 2W0KA 1IC7H 5HI4C 1XGYH 3CUPA 3QQDA 3DV6A 3NEEA 1EGJA 1HEZA 3T4YA 5KSAB 4ACTA 1CXLA 2G5BB 3POCA 3J7HA 5HI3C 3FO2A 1CS6A 3T71A 4YLCA 5ETUA 2YPLD 3HE7D 4LCYA 4MNGE 1EXUA 3UFIA 1F11B 4M1DL 1OQOA 3ECVA 2CCVA 1XGQB 1BQHB 1LD9B 1KBWA 3BAWA 3PGDA 1MEXL 4JFFA 5EPMB 1JV2A 3F58L 5GIRB 3ULUD 3ZMNA 3VXPA 5TE6L 1USQA 3H3PL 1A4BA 4PJAA 4KROB 4DQOH 4TUJB 1EO5A 4YMPA 5KG9B 4LQFL 1ET8A 4TRPL 1WWBX 2KQMA 2FVNA 1XIWC 2WB1A 2Y2TA 2YKLH 4DETA 4UM9B 5E94A 1K8DA 4M7ZC 2XG4B 5FGRA 4FZ8H 3RGBA 4ISVB 3FCTA 5HHOB 3PGFH 3FDWA 4GQ9H 2DQGL 3O9WA 4PS4L 3SBWC 1K4DB 1KZQA 1EEYB 1KJVB 1WUZA 4CILA 1C7TA 1BZOA 2VZOA 1PL3A 5HYSB 3HI5L 2FX7L 5KYUA 5CR1A 3DRQB 1U0QA 5JW4N 1AZVA 3GTVA 1TVBA 4P9HL 3M88A 3KR3H 2I60L 4ZO9A 1U8LB 1PG7H 4NSKA 4WHCA 3CFTA 1S9VB 5CD3A 3QJZA 1JZJA 4KK6D 1N70A 2R8SH 5D1ZD 5D7IF 1KN2H 4FX5A 1RVFH 4P4KC 5KVGH 1YEGH 2BP5M 1DSYA 1SF5A 4JEGB 1FZJB 3OLEA 2ICEB 4MJ6B 2EH7H 3G6AB 4KVNH 2RHEA 2QEJA 5DJAB 1JNJA 1CD1B 2GAZA 3AU1B 4GUOA 1FHNA 3LZRA 2XHNA 2AQ3A 3T4AA 1U93B 3HUJF 1XGTA 2WCGA 1A4AA 5E8NB 1NEZG 1U8QA 2F7IA 2WM0A 4RFNC 1OAZL 3TBSB 3GRWL 3H0TB 3C2SA 5IMKA 1FVEB 1JD7A 3BD4A 4LVEA 2DQDH 3FN3A 4WTQA 4MDIA 4E41A 2IPUG 2XIBA 3CSPA 4L5FL 3I3EA 2X42A 2X4OA 2O5YH 3JV5A 1BXUA 3L5WA 5D8JL 1U8KB 5CZXD 3IDJB 4G6AC 2X6CA 5FA3B 1CXKA 3MJ9L 3CZFB 5BW7C 4PW3A 1R5VA 3C6SA 1ZLVH 2J57A 2KPNA 1HK6A 3RWCB 4WW1B 3FT9A 4G42B 4QRBA 2FQDA 1FFPB 4DOHB 4U33A 3T0EE 3O2WH 5DC2A 2HG5A 1WISA 3PGCB 1QRNB 4WEBL 3A67H 5IFJB 1MLBB 3KJ6H 3SGDI 3D2UA 4WLCA 3QIBB 3CN4A 2MOQA 5JW3H 3B83A 5KYYB 4YR6B 4EI5C 3U46B 1SDAB 2VM3A 2R69H 1UEYA 3WEXB 4WFGD 1MHCB 2CDFA 1V27A 3C5ZC 4LDCA 4L1BA 4IU2B 3ZGHA 2R9HD 3N44F 4W93A 3T2NL 4JFDD 3FQ2A 4R9HA 4XP1H 4X7CC 1XZ0A 3U6RA 4YDKH 4KAQL 3MRLB 1A7PH 3UBGA 5IMOB 5GGTA 5E1QA 3GI9L 4I1PA 1IE5A 3FO1B 4U1KB 5ECJE 3VE0A 3VH8G 4LSDA 5K5YA 3MRIA 1ZHLB 3LXAA 4M8RA 4YHIB 3TF7C 4AQEA 1DBKL 3NJFA 4B9ZA 4PRHD 4HOMA 2XRAL 2B1HL 4XOAA 4PJCB 1AGCA 1OAKL 1TU2A 4RA0C 4X6DE 5E8DL 1OKEA 5LGHH 1YJDL 5HYQA 2Y7MA 1M7DB 1J1XL 2GJZA 5ANMB 4HWNA 3L95A 3UBHA 1E50A 1NCAH 2P5EB 3MV9A 1QEWA 4XNYH 4XMLL 2DH3A 3LZFL 3MBXL 4RBPK 3T65A 4I3RL 1PGRB 1ML0A 1SBSL 4B5EA 3FTSA 3QS3A 4OLZL 3PU7A 5GGSY 4GKOA 4O4YH 4QGYA 5DMGD 3KHQA 3G5WA 4G71B 1S7TA 2DIBA 4NIKB 1KB9K 1XGUA 2J1WA 2QMKA 4HXAL 4QHNB 4PJIB 3OXSB 2BERA 4RAVA 1FZMA 3FSZA 4PJ5B 2XQYA 3CMOH 4YDMA 2DMBA 4F7MA 1FIGH 2X40A 3NBNA 3APFA 2AMUA 1AACA 4RQQB 3G6JE 2PLTA 3WIIL 4PCTA 1MIML 4MXQC 3CZKA 3RZCD 2BZDA 1TJIL 4LKXA 3D1MC 4ZS6D 4KJPC 1M1XB 2GBTA 4XX1G 1KF9B 1ADQH 3RE0A 3BISA 2RQEA 4YQXH 3VI3E 5K9KB 2HTLC 3WN5A 1IAIM 3HG1A 4WTWA 1J0HA 3DPDA 4NB7A 3JV4A 5DD6A 5DFAA 5DMKB 1TF4A 3CFNA 4OZHB 5MEND 3WXVL 4QHMA 4ZUTA 3FO0L 3P9LB 1PU0A 4MNHA 3FQTB 4NHCL 4KNSA 3LNEA 5DVKA 1IFRA 1U3HB 5FGBC 1KGCE 1ZVSB 1MUJA 3MUGA 3RUGA 3H9SD 1EH9A 1PY4A 2ZX7A 3OJDB 3FHAA 4J39A 2DQHH 2NXZB 5CINH 4RSYA 1HSBB 3KXFD 2XTJD 4OQTL 4MGXA 4AJ0A 5ADOL 4KUZH 4AV4A 4G5AA 5T1LD 4EI0A 1PKQE 3S88L 3V0WH 2CLRB 5J57B 1JPEA 1JF1B 2ADJA 3S0PA 1AANA 3TIEB 2MOVA 4YSRA 1HZHL 1H3UA 4AVJA 4AUUA 4ZXBC 1S9WA 2FECI 4W9HC 3UXFA 1XH1A 3W11C 4LAJH 1ID5I 4ODBD 1U8NA 3BZFA 1CVSC 5DYOB 4GO8A 1G0DA 1A9EB 3F84A 2YRBA 1XF2B 4DKEL 4OGAD 2WKOA 2EACA 5SWQB 3RGVB 4LLMA 3OLGA 2EE3A 3CK0L 1FL3A 1NAKH 3EO1A 1B0IA 2BDNH 1M42A 1HHGA 4LCWD 4JZOB 4QHKJ 1TQWA 4XE5B 5EB9A 3UMTA 4DJMA 2QFPA 4ES9A 4LGRB 4S10A 3BZDA 4N2MA 3FFCE 3NZHH 1GL4B 3D9AH 3INUL 4GXVL 4B7IA 2WWKT 1QLFA 4UNTA 4FI8A 3RPIA 3GBML 4NT6A 2CPCA 5HGDB 3QC6X 4JFPA 5AAPA 4W9IC 3IAGC 4L8BB 5J1TC 2J12B 3ZE0F 4JG1H 1DQJB 4A7VA 2P48B 4HKZB 3BPNB 4YEEA 4FQ1L 4Q9BA 1C7SA 4M00A 4J6IA 1IBHA 1CQYA 3PHSA 2OMUB 1BDYA 5IB2A 4PJBF 3CFBB 4UQIM 4WSGA 2WXMA 5E08L 3LTVA 5FX3A 4LAQH 1CIUA 1NKGA 1XCXA 3QJTB 2K78A 2E9GA 4HK0B 2R4SH 3VI4A 3MLRH 1H5BC 5C6PB 3OB8A 1P6FA 3VD5A 1E3XA 1RZGA 2OYMA 1NPUA 1KBVA 3VMPA 5HXMA 1KBKA 2YEZB 3U0TB 3VXSB 4RDQF 4DGYH 5BO0D 5IVXF 3B9KB 3BVDB 4G3YH 2NTFA 43C9B 4YDVA 3G7TA 1MWAL 4XPBH 5ICZA 4J12A 3BWUC 1QSVA 3FCGA 5DFWH 3RI5F 3DX9A 3TFKC 2Y1AA 5C0CE 2V7NB 4Z3HA 1N8OE 2F58H 5T3ZE 3OMAB 3ZDXE 1JJUA 4OZ4B 3I2CH 3BMWA 2UZYA 3ROOA 4UOJA 1JZ7A 5CEZE 2KPWA 3MOBH 2DQFA 3QIWB 4WI7A 2BIQA 2P28B 2ZKMX 1M1SA 5HGGS 3EG9A 4QRPD 2HVBA 1MH5A 2PXYC 2H5UA 2Y5TA 3NRFA 1HSAB 1PLGH 4W9CC 1KLUB 3CC5B 2ZOOA 3V6BR 3KGTA 4P59L 4MNQB 1BQHG 1A3LL 2FDBP 4G7YH 4FL4C 4OIIH 1OGSA 3ZDZF 4XVTH 2EXYD 1H15B 1NC4D 2VWEE 4HIXH 5D6CA 5IROC 2ADIA 4H26A 4MMYB 5HJDA 2Y7OA 1CR9H 2VLLA 4PGEA 3FTWA 1NGZA 3DDFA 4PD4K 5CLTA 1JE6A 3UZQA 4DP7X 1VCBC 2VRAA 4OZGE 3WLWC 2A6KB 2VW6A 1Z5LB 3ABMB 4HG4K 1FFNA 3V5KB 1JMZA 1KB5H 5ESAB 1F4XL 2OTUA 5HHVL 3IVKB 1P53A 5HYSG 4ODUB 3Q48A 4IRZA 4QXGH 4LSSL 4XNZC 1G94A 2VDNL 3QR2A 3W38A 1C08B 4MQXD 3VA2C 1M2VB 3KVDD 2F1AA 1JZIA 4PJDF 1GVIA 1RK0B 1XIWB 4UT6L 3VFSA 5FO8B 2P46B 4M7ZB 3ETSA 3VDBA 1GIGL 1HQRA 3VD2A 4UT9H 3F8UB 2J20A 5HTSA 1GR7A 3VWJC 2BP8A 1CDCA 2XVBA 5CEYB 4S2SB 4CSTA 5ITFB 3O2DH 3IKCA 4OCRL 2ZXCA 2H9GB 3D85B 4F7CA 3MGOB 1R5IB 2NY0C 3ZR6A 2J2ZA 5F7BA 4Q9RH 3A4DA 2Y6SC 1IV8A 2BSRB 3QEQB 3LNFA 4WWKA 1JZEA 4I2XA 3GSVA 3EJZD 2WQVA 3Q2CA 4ODTH 2AKRA 2UXVA 3CSGA 4LLDA 2H32H 5J7CC 2DQTH 5C6WH 3Q2VA 2QVTA 5F2FA 3LIZH 4DP9X 4ZFGH 4R8WL 4YH6A 3A5VA 1OTSC 4ZD3L 1N12A 3U1PA 1BVNP 1IJ9A 4X8JA 5LN4A 5JPNC 5C9KA 2DH2A 2O93L 1ORQA 1NBYB 2YZ1A 4YPGB 3W9EA 7PCYA 2X53A 3WKPA 4Z78A 2QGBA 3WJLC 1SXBA 3MRGB 3O3BB 4Y4KD 5E9DD 5B38B 3KPSD 2C1OB 3I6GB 3T0EC 4RFNB 4I4WB 3E9TA 5KYWA 3LV3B 2XYCA 1J9CT 4ZMOA 4PJ9C 2XACC 4LSQH 3BC9A 5D96C 2GUOB 2JCCE 3ZTJH 5H37G 4Z7VA 5JQ6L 1YRKA 4NYLB 4W9FC 5DQDL 4QXWA 2V17L 4XPGL 1P7KA 4JL2A 3I9AA 3WN5C 3CFEB 4GQQA 3ISYA 1BJ1H 1NOFA 1DE4B 4GPVA 3U0PA 3ETTA 1J5OL 4MB1A 2PUQT 2R27A 1QFOA 1DVFC 1CL7I 1FG9C 4H0HB 4J3OC 3LHPH 3RVTC 4NJAL 1OF2A 4LLQA 5DVNA 2E7LC 4OTXH 4HF5L 3ARDA 3IF1A 1AOHA 1OGPA 2QPUA 4L1DA 1MELA 4HS3B 1YPZE 4H8WH 1Q4NX 1LGVA 1TZOA 1NZRA 3UDWC 4LRIC 3BHBB 5K9OA 3D5OF 3P0VL 3KD4A 2Q87A 4UQCA 3TA4D 3OF6D 4EI5B 1RMFH 4N8CH 3FB6B 4TXVB 1F45A 2V7HB 3L4UA 4XXDA 4RGND 3SPVB 1JYXA 4H2CA 3GMOB 1MG3C 3I3BA 4EUPH 3HZYB 1YN6B 4XZ4A 3OPZL 5IESL 2DI8A 3N6YA 4P46C 4Z8FH 2OYKA 4D0DB 3ARFD 3E8UL 2G75A 5EU4A 1MFCL 3L3JB 2QDWA 1UB6A 4EOWL 5AD0A 4HV8B 3U9UB 1TSRA 1T2QL 4KH2A 3EYFA 4PLJC 3BVNA 3TTSA 4RWHA 3DMMC 5GSVB 4LBEA 4R7LA 1ONQB 1BQ5A 4HHWA 4X7SH 2PWEA 4Y8AA 5I2IA 4OAWB 1D9KA 2W9LA 1FV1A 3H6JA 2EYRA 4AJWA 3NQKA 4BXVA 4AENB 2P44B 1ZEAL 3N3EA 3PWPE 3RWJB 2VDRH 3TT3H 4DCQB 1MPAH 5DVPA 3SGEH 1R1CA 1YYLH 1I53A 2K3TA 4QJ3B 1J8HD 3QIUA 4HAGA 4L4TD 2R2EB 3MRBB 3JV6A 3QCUL 4OJEH 4N2NA 4C55A 3MLVL 4IS6B 1MCCA 2VCOA 1UWFA 3KJ4C 1U41A 2IQAB 5BPPA 4GLRI 3NAAL 4NO3A 2MCAA 3UGEA 4P5RA 5IMLB 2WXQA 2DL9A 2R56H 5T5FH 4Y89A 1XZWA 1ZTMA 4N3UA 4EZKA 4QTIH 5JHLH 4LSVH 4JDTH 1OVZA 1RURH 3QDJE 3CZSA 4QOKA 4EXPX 3U0WL 4FQLL 1CB4A 3B2XA 4YSCA 3UTTA 3HAEB 3CXDH 4QAWA 3KPPB 1VADB 2XG5B 5F3HA 1U8CA 3O6FA 4N24A 5AVVB 4X6CA 2YUWA 4D9RE 3UAEA 1M6UA 1A6TB 5BS0D 4TKWA 4WNQA 2OMXA 3RHWF 4WIQA 2QKSA 3WEMA 3GFUA 3ZLQC 4CNIB 4LPUA 3UTQA 1BWMA 5I6MA 3JWNH 2EDFA 1DJHA 3DXAB 4JJ5B 5F7KC 4XTRD 3V7MA 2NY6C 2HTKD 3ZHDA 1BJ8A 4YSUA 4JY5L 3OKLA 2OMVA 4AZUA 1QWHA 1PZ3A 4F3FB 2Z7ZA 3RKDC 1Z1WA 5FGSA 3NABL 5GGRB 5IBUB 1DN2A 1TZGL 3R8QA 4G6JL 4JY4A 1YEKH 1MHHA 3L3OA 4Y7OC 3FQWA 4NFDA 1HOEA 3EHBC 1KIRA 4OD2A 3BJLA 4IRJA 3HZKB 5GJTL 3VXUD 1ZTXL 3E7JA 5AB0A 5ERWA 4KDVA 2VDQB 2MQGA 3PL6D 1IBZA 3MRFA 5ISZB 3TP4A 1F90L 4QCIB 2FD6L 1R46A 5I66A 4ZXBB 2RMNA 4NCC1 1H8NA 5LNEA 3SE3A 1DFXA 1F4HA 4JPIA 3QYNA 1CU4H 3DIFB 1UURA 3CUPB 3QQDB 3WE1A 3DV6B 3BT0A 3OM3B 15C8L 3BFOA 2OXGB 1R9FA 3FN0L 2DMHA 1Y1DA 2VQTA 3ASWA 1CD8A 4HJUA 5DZLA 4CVZA 3EDKA 4Z7QE 1QTSA 1TIUA 4KMTL 5LWYL 3GF8A 5ETUB 3BAEH 1P6AB 1OAUH 5DRNA 1EXUB 4Q4EA 4A6YA 2APVA 3PIQA 5TGBA 1FYHB 2B2XH 2Z0UA 4QXVA 5K69A 3FUIA 3QDMA 1C12A 4AIOA 3FQXA 1TCRA 3U36A 4PJAB 4WI8A 1HXMB 3V6ZA 4QRRA 2GJ6D 5D2LE 4Y19E 5AAWC 3CN3A 1BEYL 4B9KC 2XXCB 1JXGA 4KNQA 3P1VA 3U9PL 1NCWH 5I6KA 3EJJX 1ESOA 3SGDH 3QUYC 2R2BB 3TNNA 1O7VA 2ZP9A 1I1AA 1ZLUK 5DJ0A 3IPFA 4CVWA 4UQDA 1U95A 4AH2A 3L4ZA 1KPRA 4BQ6A 3KPRB 2OJZL 5KYUB 3EBIA 5JW4Q 2AZAA 3JWOL 1O5DT 3OKYA 4YHOL 1JPGA 4AEHH 3MJGX 1QBML 2IAMC 1JFQH 4NSKB 5CD3B 4CMMA 3QUXD 3TPUA 2J8UA 3PHOB 4JFWA 5AVZB 3BQUD 1BF2A 1RZIB 2G0KA 4WWKC 3TH4T 2TRHA 3UJJH 3WGVB 3SDDD 4F57H 4RZKA 1QVOA 1EWHA 5FO2A 3H8NA 4UOW1 3QRFM 1Q0XH 3DUUB 3KGRA 3UYRL 3ZO0A 2LR4A 2VWEC 1I31A 4JUSA 4AM0A 4WO4A 5A40E 3D0VA 3EGSA 4RGOH 2GAZB 2Y2WA 4KKPA 5EUOA 4PRDA 2OL3H 5HVWA 1F00I 1KCVH 1QUNA 5FYKL 4B41A 5KZCB 1QSFE 4N0YH 1XGTB 3CNKA 4HSAC 5I73C 1MAMH 2PXYB 2V5SA 1FLRH 4EF3A 4LNRA 2JELL 5I76A 4MWFA 3ULUH 1IM3D 1UJTA 4QO1A 2CE6A 2N0MA 2RACA 3AMLA 3ZKSD 5IJBC 2AJUL 2SEBB 3T2QA 1B9KA 3VFNA 2F8OA 4E41B 4HYTB 3AY4C 1JZ3A 4JDZA 3MBEC 1KDIA 4RGMC 2BVPA 4N0UA 4NNYA 1ZHNB 3CFCL 5KSBA 4PU2A 3AB0C 3GSNL 4KO9A 3WFCH 3WHXB 1AHMA 4N6RA 5IW6B 3C6SB 2ORBH 4ZZFA 5I19H 2YPVL 2DWYA 2VZVA 5DS2A 3ZKMC 1W8OA 4E9YA 2Z8SA 5HYJE 5C09D 4HLEA 3V4PA 2P7TB 4NQED 3M1CA 3QXAA 4GG8B 3H3PH 3ARDC 2ED8A 1WC7A 2QMJA 4LQFH 3LPGA 3AWEA 3GZOA 4TRPH 1P69B 4WFFD 2ZF8A 3GSUA 4XXCA 3D2UB 4XNZB 4IJTA 2LVCA 5A2LH 4XBPA 4JKKA 2Q2LA 3DTXA 2EYSB 1AQDA 1IL1A 2R1YA 3FSVA 3W2DL 2DQGH 5TF0A 1F02I 4O51B 5IM7A 2PCPB 1IC0A 5EDXA 5F9AC 3EJUA 4FLRA 2CDFB 4BGDA 1PZCA 3UABA 5H35A 4M61B 1CI5A 2JJSA 1T5WA 4JRXE 2FX7H 1XZ0B 3VWJB 3U6RB 4MLIA 4FFZA 1A8ZA 3AUWB 4NPYA 4P9HH 4DIXA 5C0AE 1J1OL 2CR6A 3NCWA 4YVUA 3MRIB 2DWDA 2NY0B 1O7DE 2UWEA 2JIXD 2VQ1A 2DYPA 2VQUA 3OZ9L 1GGCH 1XSKA 3LEXA 3RIAK 5F7UA 2D73A 3KWTA 1N0XL 1L9MA 5HYQB 2I9TA 2GJZB 4WFHE 5B38G 3L95B 5IHWA 1UGKA 3WKNA 3WNPA 2B1AL 4ETQA 5C2BL 3Q13A 4M5YL 4UQ2A 4XCCH 2K45A 1AVAA 4F9LA 1ERNA 1UA6H 4WKZB 5DD3H 2ILLA 1YEFL 5FO7A 4Q0XL 2DTML 1YMMA 3MSPA 2FJUB 2C7UB 4PRNA 3BO8A 5I8OH 2EDLA 1FGVH 2FIKA 5JPNB 1S7TB 3CX5J 3X14B 1JYWA 1OAZH 1XGUB 5EOQH 4KXZH 4JFUA 2BRQA 2BSSB 3QEHB 2PWFA 4NQTA 4PYGA 1FFOA 3OR6A 1FZMB 1YEDA 2DJSA 3T0EB 2QV2A 3EDDA 4X2UA 4L5FH 4F7MB 3EH1A 1DVQA 4PJ9B 1T0NA 2QPEB 3RWFA 1PPIA 5D8JH 2VXQA 3NIGB 1TO4A 5IVZA 1OAQL 5F7MC 4LKXB 4BZ2L 2HT4D 3MJ9H 1AG0A 4FYSA 4G82A 4HWZA 2H4EA 3O6FC