1DO5A

Human copper chaperone for superoxide dismutase domain ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
QNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the second domain of the human copper chaperone for superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HUMAN COPPER CHAPERONE FOR SUPEROXIDE DISMUTASE DOMAIN II
total genus 35
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1do5A00
1UXMA 2AF2A 1E9OB 1AZVA 1E9PB 1B4TA 2E46A 2WKOF 3H2QA 1E9PA 1SXBA 2WYTA 3PU7A 3HFFA 1XTLA 1SXSA 2ZKXA 2WYZA 3CE1A 1CBJA 2WKOA 3GTVA 2E47A 1SXCA 1IBHA 1SDAB 1CB4A 1IBFA 2ZKYA 3GZQA 1IBDA 2VR6A 1Q0EA 2Z7UA 2C9UA 1B4LA 1SXZA 1QUPA 1E9QB 1F1AA 4L05A 2AQNA 1SDYA 1SRDA 1SPDA 2ZKWA 2SODB 3F7KA 1OZUA 3KBEA 4U4IA 3SODB 4A7SA 2R27A 4BD4A 1OZTG 2C9SA 2ZOWA 1L3NA 1OALA 1E9OA 1N19A 3GQFA 3ECVA 4A7QA 4A7VA 1U3NA 1EQWA 1JK9A 3GZOA 2WZ5A 1F1GA 2AEOA 3CQQA 2WZ6A 4N3TA 5KBMA 2LU5A 2Z7WA 4A7GA 3ECWA 1YAIA 1PU0A 1N18A 3K91A 1DO5A 2K4WA 3MKGA 4OH2A 1SOSA 1SXAA 2AQPA 1BZOA 1EJ8A 3LTVA 2JLPA 3S0PA 3QQDA 1HL5A 1IB5A 2Z7YA 1YSOA 2VR8A 1KMGA 1DSWA 2VR7A 4A7TA 5KBLA 1BA9A 2AQTA 2Q2LA 4B3EA 3RE0A 1JK9B 3CQPA 2WWOA 3KM2A 4FF9A 1TO4A 3KH4A 5KBKA 1ESOA 1E9QA 2XJKA 2C9VA 2AQQA 3F7LA 1PZSA 1YAZA 3HW7A 1F18A 3GZPA 4A7UA 3HOGA 1FUNA 3T5WA 2NNXA 1JCVA 1SXNA 4BCZA 1Z9PA 4A7GF 3L9EA 3KH3A 4MCMA 2GBVA 3MNDA 2V0AA 1MFMA 1IBBA 4MCNA 3L9YA 1PTZA 3ECUA 1UXLA 1HL4A 1Z9NA 2GBUA 2APSA 2XJLA 2GBTA 2JCWA 3H2PA 3KM1A 3QQDB 4OJAA 1COBA 1P1VA 3KBFA 4N3UA 3GTTA 1S4IA 2AQSA 1F1DA 1TO5A 2WZ0A 1XTMA 2WWNA 2Z7ZA 2AQRA 1OAJA 1OEZW 4BCYA 5CU9A 1XSOA 1RK7A
chains in the Genus database with same CATH superfamily
4HUWB 3REWA 1VB9A 5IROC 3QGVA 8PAZA 1SXBA 1LHZA 4P2RB 1FAIH 1P2CA 1KIUA 4QR7A 4EF3A 4LXFA 4PRID 1K5NB 3QS3A 1J5OL 2JJTC 4LCWE 1AGDB 2ARWA 3WJMB 2ZKYA 3ZZ1A 4NRZB 2JLLA 5DQ9A 1IEBB 1CZ8L 1IM3D 1CD9B 3FO1A 3APCA 2JJWA 3MOAH 3F7YB 2QPUA 4S2SB 3ULVE 1PMYA 2UYLB 4L5FL 3VWJB 2FSEA 3OGCA 4TNWK 3O2VL 1HHGA 4AVKA 4NKMB 1TQVA 3GPSA 1TTUA 1NDMA 3QQNA 2Z31B 2NQCA 4ZFZA 5AB9A 1TEYA 2XLLA 4F24A 4NAMA 4NAJA 4MA1C 2WKLA 2W1NA 2G2NA 3DTUB 4HS6A 5DD1H 3K8LA 4G7VL 1VCAA 2E5EA 4N2NA 5GGUA 3ZRFC 4A7GA 3BAXA 3OAYH 4WEBL 5E4EB 2IBBA 5DS2A 5T8IA 1JIBA 1GS8A 2WN2A 4XN8A 4M1DH 4K3EL 3N43F 3MYJA 1OTUD 1XGRA 4IDJH 3GMLA 1IMHC 2JLPA 4G6AD 4J8RA 4JPKL 2PO6D 4LARL 1SEBB 3CTTA 1T1YB 2OTWA 3KVDD 1GZHA 2EO9A 5F3BB 3L2LA 5EEUA 2LHAA 3FCBA 3JTTB 3UJJL 3RU8H 4AGOA 1PY4A 3AT8A 4MHHG 3PHQA 4GAAA 4ZQKB 3DX6B 4Y8AA 4WUUE 3NGBB 4GNKB 4QRSA 5KWYC 4XOCA 1XD1A 5I6XB 3RTQA 2GHWB 3O6ML 4ESKA 4P46C 2FWUA 2Y1YA 3HE6D 4D9RE 2NYYD 1R5VB 2J1WA 3DIVA 3KYKL 3VTTA 5I8OL 3QEHB 4X7DC 1W2KT 3WLBA 1RZGA 3ARBD 4XVSH 4AYID 4U6XB 2GTZB 4H88L 4XCEA 3EYVB 2WBJC 4MA8L 4YSEA 4FZ8H 5JR1H 4AIZB 5C2BL 3LNFA 1CG9A 1FO0A 2LU4A 3W38A 2AK1H 3WS6A 4JUSA 1EDQA 1KTBA 5DMIH 2HWZH 2IBGA 3MRFA 3IFNL 1B0RB 3CHRA 3IU3B 4G6KH 2ZOLA 2A9AA 4FYTA 3BUBA 4MRBA 5CEZD 3EW3B 1NBYA 2W65A 1T20B 4Y89A 2ITFA 4GT0A 1MG2C 2G3MA 2NSQA 5CHNA 3ULVF 1S9XB 3M1CA 4FQLH 3ESUF 1PX4A 5E8EB 4Y4HD 4MA3B 4Q89A 3UIZA 1ZWIB 4RZKA 4OB5H 3IJYA 1HXYA 1XTLA 2YC1A 2WO3B 5FYJU 1PX8A 4FTVB 3D9AL 2DWXA 1S5HA 1QYGH 1IQWL 4RGOH 4OZGA 1ZV2A 4ZOBA 1ZLWK 2A9NL 4DN4L 5B1BB 5BXFB 4XMVA 4JO2H 3H7BB 5AOZA 4DNLA 5FHBL 4R90L 4TQ8A 4JK0D 5D7SL 4WNJA 3OMIB 1KFAH 1JPGA 4OZFA 3UJIL 1QSFB 2C3WA 3Q06A 2A6IB 3ARFC 1CFNA 4KKAC 1GGUA 4LFHD 2CDGB 2WZPD 2YEQA 3BUQA 1KEGL 3DJTA 1OGAE 1WH0A 4YOKA 2XG4B 1CDGA 1UM6H 5DSCA 3V5DB 3B7SA 1SLVA 5L2KE 1J0IA 3O0RL 2F74B 2ICEA 1ZTXL 3LVEA 2E75C 1RZFL 2OK0H 4A37A 5DHYB 3DUSB 1DANT 1LXMA 2ZIDA 2C3GA 2UVFA 4JFYA 4K8RL 4L5FE 3NH7L 4G2AA 3X1BA 1ZVYA 1PQZB 1UT2A 3VG0L 5IR1B 4HT1H 4R83A 4EDXB 1QHQA 5AZ2H 2OZNA 4ZZFA 1YEEH 1ZSDA 3UYPA 5I15H 4JG9A 3IXAB 5JHBA 3RA7H 3MYJB 5KUKA 2AK4A 3NIGF 4BBWA 4NQEE 4C4UA 4PRIA 4Q6IA 4DPBX 4X6DB 1S9VB 2YMXL 2WHVA 3O2WH 4FABL 3LZOA 2Q86A 4ODUB 3TX4A 3O4LE 3VM5A 1NC2D 2ZUYA 3MRMA 1F58L 4HK3J 4HGMA 3II3A 3CVDA 1NIDA 4LLQA 3Q1SH 4PJ5A 4U1LB 3AS0A 5ECJE 5JHDD 3GSQA 2AQ1A 1C5DA 1NFDA 4QJ5B 3FN0L 4YHMH 3IB4A 4QRPE 3UTSA 1KC5H 5CKGA 2G75B 3FU0A 3DV6B 5D7IE 3LKOA 3JWOL 2ERJB 3T4AA 4FYQA 4PBWD 3X12A 3KBFA 4JFTA 1D5MB 4JM2B 3BKCL 4KXZI 3FMGH 3MV9A 5F9JB 1BF8A 1KULA 1U8OB 2X70A 3DTXB 5D4IA 1AGDA 4OIIH 1X5KA 2AQRA 3QH3A 3WJMA 3ZKQD 1XGTB 2HKFL 4AYSA 2WOBA 5SV3A 3RAJH 3U9UB 3JTBA 4E0RB 4P2RA 3L3KA 4RIRB 3L8QA 3OB0K 2XC8A 3E3QC 3BW9A 5AOLA 1JZEA 3B7UX 5FECA 1NMCB 3OKKA 4AWJC 2EKJA 1HH9A 1BMZA 4JO4H 4QHLB 3OKLB 4IJ3C 4R97B 1J1PL 2VR9A 4C56D 1BQRA 4YE0A 3RI5K 5LJYH 1RFDH 4GSXA 3MNVA 3FFCE 4X5QA 1J9CT 4JQIA 3VH8B 2BNUB 1TQSA 1V55B 2DDQL 2DYPD 2Z93A 5AENA 2FGWH 3DSFL 4KKLC 5EC2A 3S8WA 2FZ3B 5F7KC 4AK2A 2NY1D 2DQHH 1DVQA 1ZA3A 2IAAC 1TJIH 1MCRA 3DVNB 1EX0A 4U7SA 4UM9D 3KWTA 4JANA 4DJMA 5AD0A 1G9NL 3WEXA 2OPCA 5F0PB 2FGWL 4BK5A 1ZLVH 5KVDH 4QXTB 1U8MB 4JZJB 4M7ZC 2IG2L 4JFUA 5JW5B 5JLZB 1MWAB 3ZN6A 5EN2B 1CICA 1AACA 1JNNL 4ORZC 1CYXA 1HILB 1KJ2H 1IKFH 2IH3A 2X0VA 4WKZB 2X9YA 3TYGL 3MGTA 2CG9X 1DJSA 3QCVH 4JPIA 3MV11 1AGEB 4EZLA 2IDUA 4BINA 3LS5L 3MRPA 5DZPA 3L3HA 3SDDC 2VN5A 5KOVC 3FH5A 4XVTH 3OB0H 3QCUL 5J6HA 1Z5YD 1INQB 2CA4A 4ZMYA 1PFCA 4LLDA 4P05A 1J1XH 4HBCH 4ANVA 2BXZA 2OZ4L 5LQBL 4A63A 3FO2A 5I5IA 2WXLA 4M6MH 2QQQA 3Q44A 1MIMH 1W6LA 3UTTE 3HVDA 5KJ4A 5CCHE 4L37B 1JVOA 3HR5A 1I9JL 3QFDA 1ZHKB 2DD8L 3H9SE 2X89D 3WLWD 3CZFA 3R18A 3NJLA 5FKPB 4X5RA 3UTTB 5LWYH 3D39B 1KOAA 1XIWD 3GRWH 4FXGB 5GHWH 5DJYA 2GSMB 1XGZA 1JCKA 5JIPA 2FBJL 3P30H 3RDTD 1E6JL 1FZJA 3NCEB 4WV1A 2QKIA 1KG0A 2QQNL 2JTDA 2EO1A 1LO5A 1NC4A 2J1KA 4S11A 2D03L 1II4E 4PJ8B 5D1ZA 3RB5A 4A55A 3MRNB 4UV4H 3ZT5A 4N3UA 4UQIM 1T7ZA 3FOMB 2AQSA 2ZP8A 2NW3B 3N0AA 4I8DA 4XH2B 4ZNEA 3GBDA 2BP0B 5BCAA 3NIGB 1LEKA 3MUJA 2OSYA 5JDJA 1Q94B 4HUCA 1OCWL 2E6JA 4K94H 1MJUH 3SE4C 3ZKMD 3S3PA 2BCMA 1MWAH 3DOIA 1E9PB 2LAGB 1BAFH 1X9LA 3FQ4A 1LDPL 2JQMA 3GXFA 4QHMA 5LBSA 4OCWL 1W72L 5E2JA 2OK0L 1Z3RA 1D5ZB 4L3CA 3IKCB 1Q9WA 2K6ZA 3L7EA 1Q0EA 3PHAA 1ODAA 3S3DB 1EZVX 2I5YL 5E99H 4XPAH 4M48H 4NO5A 4RAUB 5ALBH 4XC3L 5CLTA 5C09E 1A9EA 3D4CA 3I75B 4EQ2A 3MUY1 4A7SA 4YH6A 1N67A 3QWRD 2WSDA 5DJZB 3EOTH 2LFGA 1P5UC 4U7KA 5I1IH 1WC7B 2W0FB 2X6BA 1T6BX 5D1XE 2JNZA 3FB6A 3FB8B 4CU8A 3D7PA 1GS6X 4XBPA 4OFYA 2FJHB 3K2UL 3ALXA 1NCNA 2O5NA 4JAMB 3WTUA 5CZKA 2I25N 4YXLL 2X6UA 4ETQA 2XIIA 3RWIA 1T03L 3VFUB 2AFNA 3MR9B 3PQYB 1F4YL 3P73A 4PJAB 4BFEA 2K4WA 2JKNA 4MWFB 4LSPL 3MRGB 3GK8H 3HKFA 3C6LA 3WIHH 1SHWA 4GRLC 3CSGA 4X7SL 2FDBP 4RWYH 4Z8FL 4WKXA 2Z0UA 4O4YH 5EOQL 1BQHG 2DQJL 3X13B 4WEMB 1LP9A 1JGVH 4HCGA 4G7RB 3EYSL 4JDEB 3IRPX 1XQ4A 2EDXA 1IGCL 5KTEH 1GSMA 3SDAD 3D06A 1XZ0A 3GSUB 5LBSH 3OKLA 5JHLL 2COVD 4ZS6C 1SYVB 3IFLH 3MODL 3GMQA 4X5WA 3P3YA 4MA8H 5DXWA 5HHME 3TTYA 4FADA 4NQUA 3IGUA 3BUYB 4NBYB 4E68A 2N56A 2R29A 3DGGB 4XODA 2HPOA 3ZDYE 1Z0NA 5D70H 1QRNA 1CCZA 3NDYE 1TSHA 3BWZA 1XFPA 3V52H 5IB2B 1IT9L 2O6EA 1TUPA 1U8OA 2CBQA 2X70B 1N6QH 2R1YB 1DSFL 1RZKC 4KNQA 1UM4L 3QARA 5DJ8B 4HG4K 5TDOB 3FN0H 3ML8A 4M61A 1KPUB 4KHXH 3TCXA 4YHML 3D69B 1FSKC 4JZNB 5EBGA 5GGSA 1WT5C 4AVHA 4IRSB 1SYVA 1BWWA 2UZPA 5BOJA 1D6EA 5DR5L 3FH7A 3L2NA 4NUMA 4C8XA 1JUFB 5B4MC 4K3EH 4XB3A 4L3EE 2YSSB 1P7HL 2ESVE 3CNKA 4G7QB 1XGQA 1EDHA 2WGNB 4OFPA 1NM9A 3MRGA 2NNFA 3I2CL 3V0EA 4DTGL 1ERNA 2FL5A 3L1FA 5K33A 1SXZA 2KMWA 2A6JB 6FABH 1QUPA 4PJ9D 1KB5B 4R5XA 5SWQB 3OZ9L 1IJNA 1NL0L 2X44D 4P3WA 1EEUA 4X9FA 5B38A 2B9BA 4B9KC 1UYWL 1PQZA 4YHNA 3K6FA 5LG6A 2WTOA 5FYLH 4R8WL 5ANMA 4Y4KD 1NCCL 4EN3B 5BS0B 3W57A 4YR6B 3MGAA 1OAYH 2J88L 3MNZA 4UU9A 2EYRA 4P59H 5HHVL 3ZRSA 5G5DA 4NFBA 5DMIL 4YFEA 3U0TB 1ETB1 1C08B 1P4BH 2G0KA 2IBZY 1CXEA 2AI0H 4MJ5A 3ZJAA 4H2CA 2BC4A 4KV5F 1WQVT 2CQVA 3UJIH 5BS0E 2DQFA 5IEHA 3ZZQA 1TG8A 5H35A 1YNLH 4LVNB 2YK1H 2H1LM 3PDOB 1MJJA 3WL9A 1PD1A 4FQ2L 3O8XD 4PI0A 3VFGL 2E6PA 1YN6A 4JRYD 4IBUA 1ZLSH 4CVUA 3FS9A 3H1ZA 1YEHL 1CFQA 2X6MA 1JV5A 4N2GA 1G7JA 3EJZC 3H3KA 1UWEL 4IU2B 4P9HH 3TT1H 2L8AA 1KBKA 3ZSSA 1E3XA 5E94B 1MJ8L 1UFUA 3HHSB 3ABGA 1AIZA 3WBDA 4PGBA 1EV2E 3MYZA 2DTMH 3BGMA 1Q0YL 3WFBH 1ZVHA 4AMXA 2GPZA 4RBPH 3FFOA 4OM1L 2WLKA 1PS3A 2PR9A 2Z65C 3WELA 3UBGA 2P4AB 1N70A 2OMWB 1AE6H 1EDYA 3VWJC 3ISYA 4WW2A 5F72S 3MFFA 1B0RA 1BQLL 3NRFA 2XVLA 1SJMA 8FABA 1MFVA 2ITDB 2Z92A 1OGTA 1FGNH 2ZJSL 1NDTA 4P2CG 2Z31C 1FO0B 2YOCA 4ZFQA 6CGTA 1LWHA 5F6HI 2P1YA 1JPEA 4JHUA 3HR5B 4ALAL 4Y4FA 1BQSA 1QLFB 1WIPA 4KX7A 1K4CB 4R4FL 4EI0A 5I66A 3ABLB 4QNPE 3MVSA 5EPMB 5DRXB 2WXQA 5I8CA 4PWGA 1QLRB 4ZTOH 5ES4B 4WWKD 1KB5L 5E2UH 4Y4HA 2XTJE 1UD6A 2DQTH 2X4NA 2XACC 3BVTA 2X4SA 4R0LA 5HDQL 3S6CA 1TZ8A 2CO2A 2VW6A 3FUKA 3PWNB 1OAYL 2VWEC 3IE4A 4UIMA 4XWGH 3FB5A 5K39B 4LAQH 1U3HD 5EBWA 1RV6X 1TCMA 3BKJL 4L8CA 5EU6E 2XQYG 3NCYP 3GJFB 3NIFE 1HILA 5FCSH 1J0KA 1KIQA 1MAKA 3FQNA 2QTVA 2AQ3A 2I24N 1W0WA 2JKSA 3UEQA 3DPDA 1J87A 1A6VH 1FRGH 2P5EA 1LVEA 5AW6B 4P46B 5ID0B 2MSPA 2XKSA 3VVWA 3WFCH 5C0BD 3B3IA 3PWPE 4OLYL 3PQYE 2M2DA 3EO9L 2XN2A 3C6LB 4AG4H 1PVHA 4P99A 1B0WA 5AZEH 1N10A 2H26B 4GY4A 3FN9A 1MCIA 2WBJB 4GAGH 2FT6A 1BPVA 2DAVA 5GGRB 4HGWA 2YR3A 3C12A 3CLFH 1JRHH 4GXUN 2BNUA 3UTSD 1KJMA 2Y0SA 3RFRA 1DEDA 1R34A 4UAHA 5D6DA 1OCOB 3RY6A 3FTWA 1C8QA 4AIOA 1RURH 3LIZL 3KPRD 3SCMA 3P9MA 1SVZA 1PG7W 1RH8A 4P3DB 4ES8A 2EADA 3L6FB 2NZ9C 3NTCH 3OAUL 4JG1L 4JRXD 4LP5A 4S2SA 1L0YA 2PO6A 5CD5D 3MJ8B 4DEUA 4PV8A 3KVPA 2VDLL 3OLEA 1GC1C 5F7EL 1NLBH 1W80A 2X1QA 3D4GA 1I85C 4H8QA 1PLBA 1PZ3A 5GS3A 3HLAA 5D1XA 4JKLA 2BVPB 1DVFD 12E8H 2GEEA 1YYLH 2NNXA 4N0UB 4RGNB 1FVCA 1NCTA 4LMQI 2PPDA 5GZNC 3L6FA 2F7PA 3G6DH 1A8JH 1JGEA 1OARL 5M7QA 3QHZH 2HUEA 4H8WC 3T71A 3ZGIA 1G7MA 1IGTA 3V4VH 1S3RA 2K7PA 1OP4A 3J7HA 3QAQA 1CE1H 4GRWB 3RNKB 2AV7B 4HC1H 2NLJB 2H32H 2X87A 3D30A 3HZVB 5T5FL 2NXZD 2XN9B 3SD2A 3ARFB 3QC6X 4PB9L 4XP4L 1DANU 1NAMB 2QV4A 3FTXA 4J27A 4CN1A 1IM3A 4RMQA 4YVUA 3QXUA 1PZ5A 5GS2D 5MHSD 2YD9A 2LVCA 2VSCA 4P04A 3SDYH 3RX7A 4PJ8A 1TEGA 4A38A 1AQKL 2DQIH 4GKNA 5FOBA 1RK1A 3EF4A 5IJBC 3QJFA 2WANA 1B4TA 1KG0B 4YDNA 2VJXA 3UO8B 1VJSA 4ONOA 2XV0A 3JV6A 3TT3H 4MNQE 1YA5A 3TA3B 1DLFH 1KYOJ 4G9DB 1EAJA 35C8L 2J6EH 5KYXA 1CYWA 1JK8A 1ROWA 1JWUA 2JQZA 3CC1A 3L5WA 4YDIL 2XIBA 3BQUD 3NUKA 2R9HC 3D25B 3FSOA 1L0PA 2YMTA 3HG1D 2X40A 3VXRA 4EOWH 4M03A 5I76A 3EFDL 3P0VH 4JDTL 4WU5B 2MCPL 5IESH 3LQZA 2YGVA 5IIEA 3DJRA 3F7VB 5T33L 1JK9A 1DN2A 4X9IA 4GSUA 1NC4D 5EU4A 3WXVH 4FA6A 1NBZB 3RG1C 3TJEH 4QLRA 1GS7A 4C59B 3A6BL 4N1EA 4UDTB 5F2FA 1F8TL 3RWGB 2J1ZA 4HKBB 5DT1L 4MSWA 1H3PH 2BVTA 4BSVA 3D0LA 2ERJC 1M6OA 4GUPB 4XX1E 4YUEH 4LL9A 1DLHB 1NBVH 4GXFA 4RISH 2VN3A 3TA4D 4BZ1A 2BHYA 4R7VA 2BSDA 5J7CC 2X89A 1FVDB 1AJ7H 4HUMB 4I77H 3PV7A 5I82A 3S8FB 1OXYA 3AXLB 1VGKB 4AZUA 3NZHH 2BVOA 1RPUA 5EUKA 2ATPA 3OQRA 4POZD 1FNSL 4WRLA 3JWDC 4N2HA 5IG7B 4YUEL 1T0OA 2DL9A 4KKCD 4DKTA 5E1AB 2OZ4A 3FT1A 5L4JA 5F1IB 4DH2A 1ZCRA 4EE2A 2IALB 3GM8A 4R97C 4N24A 4GO6B 1Z9PA 4HEMA 1UWFA 1ECYA 2B4CL 4KAQL 1CL7L 4F33A 3FQRA 1QWNA 4KUZH 1AR1D 1RCYA 3TBSA 4NO2B 3T8XB 3ARSA 4M8RA 2HUHA 1I9JH 3DECA 3DXAB 3SJVE 2BZ7A 2GBTA 4M62H 2QLVB 1XGYL 4HPOH 5FM5M 5DEFA 2ZXAA 3J27A 3NK4A 3V4VL 3S4SA 3OAYK 1WD9A 1R5VA 1PYWB 2A2QT 2L7UA 3X1GA 5FLVA 2CLVB 4P23B 4M7ZB 5D5MA 2E7HA 5HYQA 3ZDXB 5CIPH 2KDGA 3T2NL 5IJVB 2ICWA 4LHJB 4OU3A 1RP8A 4PLKC 2HJKB 5CJOH 4KDTA 4LSPH 4MDIA 1WA1X 4Q4IA 3BI9X 1IGFL 1EVUA 1YPZF 2LE9A 5L4FA 3U7YH 3HZKA 1P5UA 4FXLA 4PJ5B 4U1LA 1OCZB 5CZVL 3UMNA 2AV1A 3U9WA 4PRHD 2DZEA 1F4AA 3DX2A 5JQ6H 4JGUA 4KMLB 4KXAA 5CR8A 5IM7B 1VZIA 4ODWA 5HGHA 1W72A 2H1PH 4X4YB 3GPEA 4KV5E 4MGXA 4KXBA 4ZOCA 1ED3A 1AGFB 1HH6A 2MQCA 3F84A 4WI7A 4XZUB 4LU5L 5DK3A 1EHLL 4IBLT 3MU3A 2AV1B 5E00B 5GRVL 1T4KB 2FHFA 3DNKA 5L2KA 1ZV5A 1N5AB 2VGLM 2BM3A 2F5AL 1NDMB 4Z77B 3K80A 1KCKA 4I77L 5J12C 1JVLA 1U8QB 3GLAA 1AQDB 1AMYA 3L2MA 4PJGB 3FT3B 4X8XA 3VW3H 2XYBA 5AVYB 2P8MA 1KLUB 4F37F 4YX2H 4U1NB 1JWMA 2W5PA 4PJFA 1DQJB 2IADB 4PJ8C 4HIJB 1P84K 2XX1A 3A6BH 4HFWA 1LYQA 2DM7A 4XHJD 2F74A 4JM4H 5IVNA 2GTWB 4KVCH 1TZHA 4QWWC 1JZ5A 4LSUL 4GW1A 1MCHA 2RQ8A 2XG4A 2YAPA 4LOFA 3V5DA 3QJTB 4FI7A 2CUAA 1NCAL 5T3XD 1SJHB 3DVFA 3FNKA 3IFLL 2EZ0D 2AQTA 4PWJA 3WS3B 4UV4L 2E56A 1IARB 4PPTA 4E41B 5EHFA 3X2QB 1PW3A 4N0CC 3S5YA 5K9OB 3CQPA 2X0WA 2WYIA 1SYSA 2AGJL 4JDTH 3WKMH 1SDDA 4M4RB 3VE0A 2XJKA 1F3RB 2GTQA 5KVEE 3IAQA 3K3QA 2J5WA 1XGUB 4N28A 2V9TA 1N5YH 1FNFA 4K7FB 2XI9A 5H2BA 1I9IL 5I6NA 3J2PA 5LWYL 2IV8A 3BUTA 3F6IA 3H0TA 4ZPTB 4XBGB 1U8HA 3QIUA 2R2BA 4TNWF 3V0VB 1YEWA 1UEMA 4YXLH 3TCLB 5KSAA 1HN1A 1RKRA 3AJ7A 5ITFA 3KPPA 1HKFA 3TBVA 4TSCL 1HHIB 3M45A 4XHQA 2QPSA 3KPOA 1NEPA 4ETQB 5C0JB 3OVUB 4Z0BL 3FCSB 2H0PA 1J8RA 3KLSA 1QQDA 1YG9A 4FEIA 3TNNB 1M6OB 4GUPA 3SCMC 3TPKA 4D8PB 4U33A 4XN5A 3WFHB 5C08A 1D7BA 1HWHB 1PIGA 1LNUA 3RY6C 1JN6B 4QRBA 4WGKA 1BREA 2EUWA 1RIUH 3EGSB 1S8DB 2EP6A 1K2DB 1MHEA 4GKOA 5AZUA 4JFDE 4XC3H 5HDQH 3R4DA 1OE2A 4ZFGH 3QDAA 2CDFA 2ZAIA 4LIQH 4ADGA 4MAYC 2I32A 1E43A 3L3IB 4BFRA 3LNIA 1LM8V 3NOIA 3R06B 1N7ML 5EFIB 1B2WH 3IBEA 5AOJA 4OZIF 1BVLB 2E3VA 1T83A 4NM8L 1KY6A 4P5TD 5CKAA 5F93C 32C2A 4TUJB 5AVQB 4Q97A 4N6RB 5A16A 4JO3L 1XX9C 4JFWA 1SRDA 1TNMA 1NCGA 3PPSA 1TVBA 2PCPB 2Y6SD 4KITB 3LHPH 1QA9B 2MNJB 1KTRL 3G5ZA 3RZWA 1LK2B 3LN4B 3WKYA 2BLFA 3U25A 3QWOB 3NJHA 4R7LA 1NCDL 4O02A 1Q94A 4P5SA 1NAML 1A7PL 1KJ2B 4AL8L 1EQWA 2QFRA 1AZZC 1ET8A 2XTSA 3B5GA 3QJFB 4BFIB 3MV7A 4W6XB 3N1QC 4G8GA 1WLHA 3RKDD 2IOOA 1KXHA 3IDXH 4L4JA 5I0VA 3RNQB 4ZUWB 4Y5VB 5F89A 1ZVSA 4J2QA 2JKWA 4BWTA 5FYKU 1UXWB 1KXQE 3T4AC 1HL9A 1YN7A 4KKNA 2I27N 3EGXA 4IRSC 2CLRB 4JY6A 4LCUA 1FNGA 4DSYA 1BX2A 3G5VB 3B9DA 4KU1A 3UTTA 3US9A 4B9GA 1UATA 1G7MB 2VKXA 3MRHA 4HJEA 2AEQL 3FFDA 3NA9L 1JK9B 2UYLA 4L9DA 3BSHA 3QPQD 1A1NA 5FUOH 3MZTA 4G80B 1ZLEA 5B8CA 4ZMNA 5I75B 3MHZA 4L5FH 2AXHA 3HS9A 4DCQA 3GS0A 2MFNA 5BW7C 3V4UL 3WYRA 4WI8A 3GZPA 4QOKA 3N40P 1TTBA 4DP1X 1QOKA 3HB3C 4RDBA 1CTMA 2EIKB 5EFIA 4XPHL 3U46B 4X0KB 5T5NG 4C4BA 3OC8A 4K7PY 5CU5A 4UB0L 3CAFA 2WKGA 4OJYA 1OTTD 4ERSL 2WP3O 4PV8B 3MJ8A 1A5FH 4YZFE 3RZCC 3IJ9A 5D8JH 43CAB 4XGZA 2YQ2A 4FTVE 3BIBX 4L1HA 4G9DA 3BKMH 4YHZH 5BMFL 3TN0A 4YVNA 2Y69B 1D9KD 3GXDA 5EN2A 4LNRA 4NDMA 1A4KB 3Q1EA 5D7KE 4XMKH 2A77H 4IDJL 5JXEC 5T1LA 4WJG3 3NQIA 1DJWA 1SEQH 3DO7B 2AF2A 1KT2B 4FKKA 2ZX6A 3NH7H 3DJZA 2GCYB 4GXUM 4UILL 1QI4A 2GJ6A 3MLUH 1MRDH 5E7BA 3U7WH 3WENA 2F8OA 3O4LD 4QXWA 1CDIA 2ATKB 3QXAA 2AS5M 4LVNC 3FB7A 1JZGA 4G7YL 4JGJA 4JM2F 4QEGA 3V0JA 2AV7A 2W9DL 1J9SA 4P2OD 4UOW1 5T1KA 4IU3B 2NW2A 5E9DA 1XGUA 3P1VA 2ESVD 3IU4H 4MQTB 1SDDB 3CXFA 3VE0B 4ENED 2ZP0T 4KJQC 1L9NA 2D9CA 2XHNA 2OR9H 2XIDA 4L4TA 3W1ZA 3SE8H 4QYAA 4LKXB 3VRJA 1KCVH 2HFGL 3TS8A 1CN4A 3TWCL 4XO3A 1CFSB 3K5SA 2W38A 1NLDL 1XH3B 5SX5H 1HYRC 2F1AA 4X0KA 2BJML 2WMPA 1OLZA 2J8UB 2YQBA 2HG5A 3I9GH 1K4CA 2HVKA 1E3FA 5I18H 1ROCA 2V5YA 2DMBA 1EEZB 4G5ZH 4OV5B 3N91A 5ALCL 1GCYA 4WF7A 1YHPA 4NJ9H 5EBMB 2DQCH 3U6XA 4QRUA 1NJ9B 2CIKB 4P5MB 2Q8BL 1QW8A 2NY7L 3HIZA 3PP4L 3WNLA 1U58A 2IAMD 1IX2A 2V2XB 3KLAB 4ODUA 2Q86B 4XXWC 1ZT1B 5EV7A 3S2AA 4D9LH 2VO5A 3F85A 4HX1A 4BIKA 2AJ3B 4JFPA 3OKEA 3GGWA 1RULL 4DQOL 4JO1L 3K2IA 3N06B 3T1FB 5FDYA 1HZKA 4UT6H 4XT1C 2PCFA 3DUHA 1Y7VA 1QABA 2F8IA 4CKQA 3BIAX 3GB7A 5FO7B 2YPVH 2PW2B 2VQ4A 3LPWA 1U8IA 2Z9TA 3V5HA 3HS0B 5DEJA 1KGCE 3I02A 1QSEE 2XWXA 4PGEB 4XE0A 3U30C 4Z7WA 3G6JE 2J5LC 4IKLA 4ZI8A 3C8KA 4W9EC 1WF5A 4EDWH 1JFQH 2CBMA 2A9MH 4LLMA 4U6VL 4X99B 2O61B 2ZUSA 5DJ2A 4JFQB 2N7BA 1VIWA 2WLYA 2XX0A 4Y16B 5GHWL 4GOSA 5EPMA 5DEGA 2C9QA 3C6LC 3R06A 3LSOB 5CGYC 1FV1A 1KBBA 1IGMH 4WJ5B 5K9KA 3KLQA 2CDFB 4NHCH 5HI4D 4EI5A 3BAEL 3T8XA 2FQGA 2EVIA 1FO0L 1MW0A 1L7IL 3QZMA 5GJTL 1UWXH 4QXGH 4D9RD 5FO8A 4Q6KA 3RPIA 3VXTA 2OZ4H 5LQBH 3KZ8A 3U6XS 2R69L 3BJ91 4K3GA 5DD0H 3FCSA 2WLLB 5JPMA 1HAUA 5LN4A 3QUZC 1TQBB 4UI2A 1UH2A 1D5RA 2YC1B 2OMVA 3SQOL 4BZ2L 2BRRH 4OBSA 3HE6B 5ERWA 2QADD 2MOGA 3LQAH 5CZXC 1MIEH 3MLRH 4YDVB 4P9MH 1F90L 3DKHA 2XFXB 1UUNA 4RGNC 1S78C 2CUHA 2QGBA 2DQUH 1Z9OA 4RA0C 2YEZA 4NNXA 2DQTL 3V9EA 4JKPL 1BBDH 2PW1B 2WQUA 3APDA 4MZIA 4PTTA 4D3CL 3V95A 4PJBB 3LQAC 3QUYD 4IRSA 3K4ZA 1U8JB 3PWUA 1P7QD 1ZDSA 2P7TB 1Z9MA 1U2CA 3CDCA 4O58H 4P4RA 4PJDB 2XWRA 3C5SB 3UZVB 5IB3B 1CR9H 3MDJA 3VXOA 2BNQA 3NEEA 3SDXB 4L4VA 3RIAK 1TT6A 4PJ6A 4APXA 5BVJB 3N5AA 1GKOA 3S97C 3GM0A 1BG9A 5CN1A 3ULVD 1F13A 1FGNL 5IGXH 5G5DB 5MI0B 2YLHA 4QUOA 1KBVA 1JWMB 1XD0A 3HAEA 4HALA 2HG0A 3NJKA 4FTVD 5IT2H 4HIHB 1KGXA 5ICYB 5SX4H 3ULUL 3BUPA 3DIFA 3TA3C 4X5XB 3OD3A 4UUJA 4YSPA 3DX8A 3C5JB 4JR9L 3QWQB 5DFWH 4IMLA 1KYAA 3BYTA 2FATL 2W60B 1MFEL 2FO4A 2IG2H 3ETBJ 3KJ6L 1PTZA 1KV7A 2KPWA 2P8LA 1QHPA 5IMKA 1KACB 3RGVA 1BAFL 1T83C 2GFBB 2K9FB 1AIFA 3VI4A 3VMOA 1IUZA 1PAZA 2EDKA 3F3HA 4UQCA 2ZWYA 1L5GA 3GI8L 4Z3IA 3ORJA 1EMTL 2WZ0A 2F54A 3CFQA 3CPUA 4KNSA 2FH6A 4P2QE 2ZSVA 4ZO7A 2C1PB 2OMBA 2VQUA 3TBBA 2AJVL 2M83A 3UPAA 1IBYA 2L04A 4NZUH 5CU9A 3V4VA 5C0DA 2CIKA 4UT9H 2JB5L 1IO4C 4YDKH 2UY7B 4JPSA 4KK9C 5B3JE 2DEWX 1RJLA 1HK6A 1U93B 3IDMA 3DARA 2G9HB 1P4BL 2W0LA 5D7LD 3KE0A 5DS8B 3TF4A 2XWEA 2XWDA 3LNDA 1NCAH 4N0UA 3RHWF 4S10A 4DEWA 1K8IB 4BK5C 1S7TA 3PIQA 4HPYH 1FFNA 1E5ZA 4BQ8A 4UAOB 2AQNA 3HNSH 4XCNB 4XWOC 1X7SA 1XH3A 3BKCH 3FHAA 4RSVA 3FU8A 5LCVH 25C8H 5FCUH 1KXVA 3T77A 5JPMC 4OJFH 2AANA 1N2RB 1T0NB 4F9LC 2WXMA 3ECVA 1KN4H 2YSTA 3P9MB 3Q6GH 5TJWK 1QBLH 3EJPA 5AVSB 3H9YA 4J6RH 2WZ6A 4JZOA 4YJZL 2EDDA 5ABZA 3K8KA 4MMXC 4KUCF 3STLA 4ZYKA 3FB7B 2VZ1A 4JM2D 1A6AA 3NSFA 4CVWA 2GKIA 1XGPB 2PKDA 4O9HH 3QNYA 1SOXA 3FPXA 3ULAB 1QHOA 1EO5A 5SWZB 1G5AA 1KY7A 4P23C 3IJ8A 4DPRA 5JQ6L 1FG2A 3MCG1 3GSVB 3L45A 3G6AB 2QKIB 2DY2A 1WFUA 4NQED 1E2VA 3PJLA 4LSDA 3CFDA 3OV6A 4KOBA 3GUTB 1R75A 2WY3B 1Y07A 1P1ZA 4FDWA 3NCXA 5GJSL 4ANKA 4BFFA 4NENA 4XP5L 3FB5B 3QRGL 5K39A 3CFJB 1KCUH 4NCC1 3VI3E 5L6YH 1R1CA 5EO1A 1FORH 3IF1A 2DWYA 2WN3A 3LNHA 4HK0A 3QJSB 5LAXB 3TO4A 3K71A 3MV8A 4ELMB 4NNYA 4EI6B 1GGCL 4WGVB 1E3ZA 2BNRB 1HXKA 1W16A 5JDSB 1CK0H 2ZP9A 4XP9L 5IHZA 5AFAA 1GIGL 5MERB 1EHNA 1WG3A 3IAGC 1F4WL 2ETWA 4Z76A 1NUDA 4M7KH 1R4XA 4NKIH 1CK0L 5CWSA 4TQPA 3DMMA 3FW6A 2Z64C 3TFKC 1A6PA 2B7DT 4M93C 3VGFA 4M43H 1GW0A 3OF6A 3KCPB 1MFNA 5J12B 4BZYA 2ZAHA 1FGVL 4JBSA 1Y0LB 1ZGLB 2R1XA 2GIYA 4KMTL 1A66A 2A1WH 1EAOA 1Q1PA 2EAEA 5E6IA 3TNMA 3SDCD 3U0PA 3IK2A 3WHXA 4M29A 1KYFA 4I48A 3DYMA 4XH2A 2NW3A 4AENB 1HS6A 4FNLL 3CE1A 4JFFB 1XSIA 1DVZA 3FSWA 1MCCA 3MRNA 5K93A 1OAXL 4HWEH 3LEXB 1WJ3A 3BN9C 4O5LL 4LSVH 2X2IA 3PHOA 3BEVA 3BVVA 3VO0A 4GUCA 1ZLDA 1INDH 3HG2A 4JRFA 1TJHL 3HHSA 4NUJB 1U8KA 1QKZH 1U21A 4LE8A 4JY4A 1MI5E 2AVFA 3MRRA 1LWRA 1NCJA 1IEAA 3OPUA 3T0ED 4OI9A 1NCWL 3CZFB 4F8NA 3AU1A 1JGEB 1XF5B 1TVHB 5AYUH 1OSPH 3AZUA 1T7XA 5FUZL 4YSSA 4DWHA 1WFJA 2QHRH 3PL6A 3TIDA 3WN5B 3T77B 5IEHB 3QIUD 4HDIB 1GGIL 4NQCB 1UA7A 3X3GH 2WM0A 2WNWA 2A1WL 1F3DH 3EJRA 1AGBB 3OJDB 4J28A 5DMYA 2NNAA 4E42B 4LQ1A 3T2PA 3DTXA 2GAZB 3QIWB 1M57B 1PJ9A 5J6SA 5CFAA 2WIIB 1XF4B 1JAEA 4NHUA 4AYFB 4ZBJA 4MAUL 3EGSA 1AGEA 4ABVA 4MX7A 3IXTB 4AEIH 3SCMB 2GIMA 3GMMA 2OMYB 1MFAH 2WSPA 2W88A 3QDJD 3NJGA 5E8PB 3KLHC 2CUIA 3DO4A 1JXGA 3KM2A 4OLZL 3GJFK 3D6GA 3MRDB 3KPQB 2FCBA 1E9QA 4G70B 4M1DL 1CDYA 2UY6A 1QASA 5JORA 3SJVD 4MAYB 2J12B 5GISL 1NWPA 5I74C 3VD7A 3D3VA 5KVEH 4UIKH 3V0VA 5AD0B 4A7GF 4OKVA 4TQEL 3ZKNC 4DN4H 3H0TB 4XP5H 5E4IA 5FF6A 2O93L 3DHJA 2P8LB 3HCVA 3TO4D 4LVEA 3H3PH 2XVBA 4Z7VE 4ZW5A 3X1FA 1Z1WA 1U2HA 1A6VL 1FRGL 1MEXL 4ZFOB 1ETJA 3QO1B 2GHZA 3U4KA 4BGLA 3HPLA 3KR3L 4TNEA 4TNVF 2HMID 1N9PA 2XWJB 3QA3B 4UT7L 4WW2F 5T1MB 4QDGA 2HRPH 2VN4A 4DO5A 1JHLH 1R0AH 4MZRA 4OIIL 1FE8H 2X2YA 1OSZA 3UL4A 2MNWA 2X4NB 5DVMA 3HNTH 4GB9A 2ZXWB 2LU3A 3PABB 4K8RD 3UH8A 4Y5VC 1JJUA 1U3YA 4ZTPH 3WMQA 3TYGH 3TF7C 1OSPL 3QDJA 3T4AB 4U1KB 1J8KA 3VGAB 3FT3A 1HYSC 1IGIL 4GEJA 3C5ZC 3NRQA 1OGTB 2EE6A 1EAPB 3KYKH 5EUOE 3MLXH 5FYJL 3QHFL 4GQQA 2BK8A 1ZIAA 3P02A 3FFCD 2OMWA 4P4KA 4HPYL 3D07A 4JDEA 4UT6L 4PRPB 5I75C 4ORGA 2H2PD 3ARYA 1P4IH 4JDZB 3IDGB 1JL8A 5IK3B 2ZKHH 3HB3B 4P2RE 4E9RA 3KPSE 3B6SA 1V7MH 2UV3A 4KFMA 1WUNT 2AK4B 5EG6C 4JO4L 4WTQA 4X4ME 4MAYA 4PP2A 3MR9A 4YQXH 3SDDA 2YA1A 2F5BL 3P4MA 3N6YA 3RZCB 1L3WA 3UAFA 4HF5L 2WZAA 3BP6B 4JDVB 3RVXD 1MXDA 5CM1A 3IU3A 4Y2DD 3O41A 1P9MC 5DF0A 1UH3A 1NFIA 4QTHB 4R84A 5L8KB 2OSLA 4JFYB 1JGLL 2DJ4A 5C1MB 2UUDK 4KRPD 1T1ZA 3BSGA 5GJTH 1FYTD 1A9EB 1NSNL 4XBEL 4I13B 3QCTH 1HDMB 3H4FA 2VUKA 2FATH 5DZNA 3QUGA 3AMLA 4Z95H 2YWYA 5AW5B 4N87A 2R2CA 2WQ8A 5DZLA 2DJSA 2EYSA 4QRTA 3UYRL 4MQXD 1XF5A 5C9JA 5E1IA 2F7IA 3F8UB 1TVDA 3MRRB 3MRQB 4WI0B 5BXFA 4F8QA 2JKIS 3MLRL 3OMNB 4G72B 4PJEE 2NR6D 2RQEA 3PP3K 4FCAA 4YIQB 3C75A 4EZMA 3V4PH 1JWSA 2FJGA 3AWGA 4JFVA 4HFUH 5E2VL 1I8IB 3ARGC 1CLVA 5HD8D 2EKSA 3MZGB 5HXMA 2WGXA 3QNZA 3AXLA 1ACCA 4ZODA 2HFFA 5IK3A 3ZKSD 4AE0A 4JFFA 5KYNA 1BBDL 3BP4A 4WNSA 5CHNB 4D3CH 3TJHC 4DGVH 1KELL 3N42F 1FYTA 3SYCA 1U58B 3JZ7A 4JB9H 3X1NA 2AHIA 4JPWL 2DLFH 4W9GC 1P7QA 5C3LD 1L6XA 5F21B 3QUYA 3L08A 5DD5L 3O8XB 1ET5A 2GITA 5HGBB 4YNYA 4Y19A 5DUBA 1UJTA 3JWNC 5ANME 4BJLA 1J05A 3QEQD 3CFCH 3TGXA 1HEZA 1QBBA 3GXPA 3NCBB 3B1UA 3QDMD 4X6CF 5FCUL 2C3HA 3BAIA 3BSZL 2HT2D 5GSRA 4HOZA 1W8NA 2QDVA 5K9JH 4CC0A 5IIEB 5E8OB 5IROD 1SPDA 5F9WB 4PSRA 2IFFH 2D2OA 3L3OB 2SODB 5DMJB 3SODB 3UGUA 4HBQA 3X3FH 7PCYA 2MNUA 3EDDA 3D08A 1DQMH 4M6OH 1AO7D 1K5NA 4A7QA 3L3JB 5J6HB 3L48A 5IVXE 5EU6D 2AC0A 4YBLC 2J44A 4FLHA 2VM9A 3VXPA 1KGCD 3L17A 2DMHA 1EEQA 1LK3H 2HVBA 1I8LA 3HS0C 4IHOA 4WWOA 4TLUA 2CHWA 2JKRM 3U30B 2J5LB 2MPAH 1IKOP 5DZ9A 4HJSA 4RRPM 3L4TA 5F71A 1JF6A 5EU6A 3ATAA 3IU4L 3E9TA 5JLZA 2QPEB 4HJ0D 5D2LB 3S0PA 3BKYH 4Y16C 1LJMA 3P4NB 4Z7OE 3VB8A 2A9ML 1NOLA 1VKXA 1FZOB 2OXGA 2CR6A 3KEHA 5IW3A 5EZLA 2A6DA 2WWMC 3T9WA 5C09D 3KJ6H 1L7TH 2VLMD 2UY6B 3QAZC 1ESOA 4D0DA 1JZ6A 3WTXA 2ENYA 1J8HB 2XFGB 3OGOE 3AVEA 2G5BA 3RWFA 3QO0A 5FO2A 3BVXA 3H9HA 3CPLB 2YAFA 3FQWB 4CADA 3E80A 3LIZA 3NCWA 3T2QA 1A9BA 4MCZB 4ADIA 2EEXA 3T6QC 4NHUB 3FTGB 2ZUUA 3II2A 3QUZB 1TQBC 3FO1B 2IQ9L 3QIWA 4IOSA 2PYED 4I0PC 4WCYH 5IVOA 3EFFB 3EOTL 3VDAA 1H15A 1UYWH 4XCNA 5GZOD 4P46D 5JOFA 4KOCA 1Z6JT 3HE6C 1I7TA 3RGVD 1A6ZA 3T3ME 2CK0L 3HMXA 3HPJB 3H6JA 4HIIA 1QWUA 2X12A 3PNWB 3QQ3B 1WZ1H 4OZHB 3ZT6A 1NCHA 2F9BT 4LEBA 2IGFH 3VDBA 1MHHA 4NPJA 4L29B 1DL7H 1DVTA 4E9XA 4ZFOL 2VDOL 4MCZA 2ZX7A 5DK0A 4Z7UB 5ESQA 3AU1B 1U6AL 1UXMA 2AI0L 2BFVL 3IMUA 4UT6A 4LSRL 4LSTH 1FPTH 2CLZA 2CRZA 2R2HB 1TZAA 5LDUA 2H47C 2VL5B 2H3KA 4J3OD 4NP4L 1T80A 2X6AA 3QDME 5FGRA 1MFBH 1ORQA 1FN4B 3FK3A 4FGMA 4DF9A 1W9XA 1BQ5A 1JRHI 4TUKL 3NIFB 3MC0A 4L3EB 4UQEA 2H2SC 4RSYA 1KPRB 5DR5H 4PWEA 2QTEA 2OXGB 4AIEA 2YAEA 5HPMB 3WUZA 5IKCA 4L4VD 4RFEA 4UCFA 3RY4A 1KDIA 1HQ4B 5MI0C 3O6LH 4AENA 5JHLA 1XCWA 2QR0B 2YBRB 3W39B 1BBJB 1OP3K 2FT8A 15C8H 3S96A 5DRNA 4GIPD 1LE9A 3B56A 1KIQB 3BX7C 1YEJH 3G04B 2DBJA 1WFTA 1MCWW 4GSRA 5BJTA 2WQAA 5GS0D 2QVIA 4QGTA 4TUKH 2BIQA 5F6HJ 2ILLA 3NN8A 4ZNCD 2EIBA 4Y2LA 3EJJX 3LXBA 2VC2H 1G9MC 1FO0H 3IJHA 4NQXA 3U4EA 3UAAA 2J3SA 5I1IL 1IEHA 1HHHA 1S7XB 5T1KD 4XXDB 2K6WA 1WZAA 5DGRA 2XYCA 3ARFD 2YD3A 2KDYA 4PVBA 2X4TB 3MMEB 5EIIG 1UQSA 3LXAA 2AJSL 3FRUA 1GAFH 3AACA 4J3BA 4LLDB 1XDTT 4XMLH 2DOCA 5DMKA 4RMSA 2N01B 5F9OH 2IQ9H 1G9HA 1FYTE 4PGDA 2BOCA 3H7LA 2M8XA 1UZ8A 2A4EA 1Y18B 2D31A 4FF9A 3DHPA 4YSOA 1MY7A 1G7PA 3RL1A 3O8XA 4YHOL 5JA8B 4FKHA 3T08A 1ITCA 1RUQH 4Z5RB 5F7DB 3N2JA 4JHVA 4XPHH 4BQ6A 1H3XA 3JTSB 1JGUL 1TOXA 5GZNA 3OZLA 3T3PF 4DTGH 1QKZL 3M86A 4N1HB 1T21A 1J9QA 2FHCA 5ESAB 1TJHH 3KPPB 4KXDA 2C7UA 5ITFB 3TBVB 4TSBL 5G4NA 5F9DC 1CGSH 3ARED 1IZKA 3K4DA 4UAOC 1EIBA 1FWXA 4B95C 5I17B 2X9XA 3NCJL 3S7GA 3H6AA 3SE3A 3TBTB 3AUWB 1I1FA 5JPMB 3MJ7A 1WIUA 2FLMA 5IVXA 5D7IF 3MNVB 1XTMA 3V4LA 3GK8L 3G08B 2F15A 4BSWB 5F3HB 4L4TE 5IUSA 2F68X 3TEYA 3L4ZA 4AX3A 4ES9A 3T2NH 1C9SA 3QEUA 2VN6A 4MMXB 3UP1A 1A14H 4U1MB 4NQEA 5E7FA 5BQ7A 4TKWA 3SPJA 3MJWA 3V55A 1PKQE 4BRVA 5JHDE 1IGIH 1M1XB 2Y2WA 1ACYL 4FQPA 1DFBL 3NPSC 4OGQC 5DFAA 3SKNA 2X09A 4FG6D 3LSOA 1U8PA 4JFDD 4YHIB 3LKQB 1LO2H 3SBRA 4UTBL 3FT2B 3Q0HA 2IADA 4LOUD 1ONQA 1D5MA 4GI8A 4JM2A 4Z7NF 4GAJH 1M7IA 4GQZA 4L05A 2AJZB 2QKIC 4HIEA 5I0YA 4BFNA 2X38A 3AMKA 5J4MA 4PJCE 3QUMA 2K7QA 2X9ZA 4NSKA 1MH5B 5KVEL 5TFSH 5C6TH 5KVGH 3RWDB 2CU9A 1I3VA 2PETA 3EOAA 4G7YH 4OJEH 2YLKA 5GS0H 4OZFG 1T6WA 2F5AH 3T0WA 3N85L 2D9QB 4K5LA 4M7JH 3QVAA 4OFKA 4A2DA 4XZUA 4P5TA 1AGFA 3OBAA 4OLUH 5T3XL 1S7VB 3GBLA 1WBXA 5C0FB 2ZYSA 4XTRC 2ZNWA 3KJ4B 3MV8E 4DZ8A 3D39E 1XEDA 4R5VA 1EFQA 2X1XR 4O2FB 5C07D 3HZYB 3P54A 4M93B 4UIKL 4AITA 2F61A 2IPKA 1D6EB 4UUJB 5F6IB 3ATEA 4TPRL 4MDIB 4B3EA 4KK8D 1WEJL 2A0LD 1V10A 4U6HB 1B0GA 3BD3A 3FU7B 4MNQA 2VOTA 4Y1AE 1WA0X 4KX8A 3G5XB 2NXYC 2I85A 1YUHA 4TVPL 4UDUA 4HKXA 5DMGD 5INDA 3NIDE 3ZYZA 1IC1A 1WFOA 4NWTH 2B20A 4JKWA 4MD0B 4PRHB 4PJ5E 2I9LB 4A1RA 3U1QA 2W9LA 4RFOH 2F54D 4OLWL 4X9HA 2X4OB 1NCBH 1U2YA 4APXB 2AJUH 1WCQA 1MNUL 1AZUA 2VLLA 4IQHA 2CDGA 4M62L 3TN0D 5LNDA 1XGYH 4HPOL 3IFOB 4BK4A 1OAXH 4HWEL 1KNOB 2ZOOA 3ZDXE 5GRUL 5KSBA 3C87A 4AQZA 4HHAB 4NYLB 4HBCL 4YXKL 4WI5A 2Y5QA 3EGDB 2Q76A 3NYKA 4TF4A 1MREL 5I1GL 1UD4A 3V6ZA 3F58L 5DRWA 4F7TA 3ECBB 1RHFA 4G9FE 3L16A 3FU9A 2K70A 1P5VA 4AC4A 1AH1A 4QKXB 1JNLL 3WN5C 1OAJA 5A3ID 1GGTA 3CDYA 3JV4A 2ATKA 3F7PC 3LIUA 3QXAB 1HWWA 2F53D 2I60H 3QCVL 4RZCB 2Y1VA 5EUOF 3UBFA 4PLJC 1HFUA 2D7TH 2LQRA 4E5XG 4FMFA 4L8BB 2IH1A 4XP4H 5CP3A 3HI5L 3QIWC 3ZL2A 2K9UA 3KYNB 1R3JB 2F19H 5MEQA 1C8PA 3EH1A 3ZDWA 1AJ7L 4BE5A 5I15L 4KJYB 2Q3XA 4JHBA 1S9YA 1G7IA 1Z9SB 3VXUA 4N5UA 2AJUL 4NQCE 3PP3H 3C60D 3DUUA 3ETTA 1IAOA 4K3JH 3D0AA 3VX0A 5DHXB 1EFXD 2HWZL 3DURA 2O5XL 2BIIA 4E42A 3TM6A 2WLZA 5I74B 1TYJA 2G2RB 3QZNA 1WEJH 2RALA 1YJDC 3MROB 3FRUB 2R0KH 3KXFD 5FUZH 2QSTA 3L7EB 2O5XH 4Y1SA 1E50A 4GI9A 4U1HB 3LS5H 1D5ZA 5AVTB 2EH8L 2EDYA 1HHJA 4G80A 4H8WL 4OF6A 4V11A 1I1YA 2ENJA 1GGCH 1Q9KA 2XG5A 2B59A 2NX5B 4YDJB 2G4EA 5D5MF 2YAHA 1INDL 3ZE0B 4OLWH 2J21A 2KZ1B 3J8F7 4HUKB 5CBAA 1XH2A 1JDAA 1P6WA 1T1WA 2YD2A 3G04A 4A7TA 4YS4A 1NA8A 3R0NA 2YXFA 2R4RL 2FX7H 4XMUA 4N86A 4OZIE 2BSED 3FOMA 3H3PL 2ZX5A 1HQ4A 4X4KA 3OKEB 2NSXA 1R9FA 4N2KA 4M8QA 1CDJA 1PZ5B 1ZHNB 3OSKA 5C6TL 4FZEH 1BAWA 4W6WB 2Z4QA 4GRLD 4U2YA 1HIML 4WSKA 5CJQH 2UUDH 4GP8B 3QZWG 3VXSD 4L8SC 3VGAC 2R1XB 3C5ZB 2P28B 5I6LA 2YUVA 4DIXA 5FKPA 2R2HA 4J1UB 4R7XA 2VXTH 3BLBA 5D1QD 1Z9NA 3OHMB 4XP9H 1ADQH 5KSAD 5KEZA 1KGIA 2ZTBA 3D2UB 3DOSB 3PG2A 5D7SH 2R23B 5CCKH 1YNTB 2IMNA 2ZQKA 2B2XL 3BAJA 4NRYB 2ARJQ 4OJFL 5KVGL 3EYFA 3W5NA 1AD0B 2BCKB 4ELMA 5BZWA 4PMEA 5GIRB 3HR6A 4NQVA 5DT1H 2V33A 4EQ3A 2CIIA 1EGJL 1KJ3H 1I8KB 5J5EA 4JQXA 1RUML 4YPJA 3H9ZA 1M6UA 5JZ7D 5HHPA 5HYFA 1NEZG 1ZEAL 4DKEL 2V9QA 4FHKA 3TPUA 3BZ4B 3V6OA 3ZX1A 3BP5B 4EIGB 1RD6A 5JUEL 4APQB 1ACYH 2C3VB 4OLXL 5KJRH 4N68A 5H94A 4EPSA 1W0YT 3PY9A 3L4WA 3KBHE 1OAZH 3S35X 4KMQA 4XN9A 3TCLA 5EZLB 2RGSA 2XWTA 2Y9RT 2GCYA 4IOFD 2AW2A 5D5ME 4DPAX 2C9SA 3QPXL 4E9YA 1IC0A 1ULVA 3D05A 1XEUA 4P2QD 4JGMA 4MNGB 4P46A 4P49A 5ID0A 2P5EB 3KW8A 2GK0B 1FG9C 3POHA 1THAA 4IOSD 2LGNA 2DQDH 1DQQA 2FWOB 4XN2A 1AR2A 3LRSA 3PP4H 5D6CB 2QSVA 1OSYA 2FX8H 1SLWA 3BP5A 1P9MA 3EGDA 3EHBD 3MCKA 1HH9B 1FJ1A 3Q2LA 4PJ7F 4XNUH 1JF1A 4PCYA 1FBIH 1FZMB 4JY5H 3ECQA 2KYIA 1H5BB 1KFGA 3RWHA 2VDOH 2D0HA 3B34A 4AKOA 5C71A 5D7IB 2EVJA 1IB5A 3ARGB 4XNBA 1ZXKA 2UZIL 5FKAA 4PD4K 1Z3GL 2VDOB 4PB0H 3BAWA 1GGBL 2VC2L 1YNTA 4PRHA 4MD0A 3VSVA 2R1WA 2KUTA 3OMZA 4QJ3B 3CZLA 2VWEE 3HHRB 5GSRB 1A1NB 1CXLA 4P4KC 4OQTL 4FJZA 1AOZA 3MRHB 4P2OB 3SQOH 1AQDA 4BZ2H 3UZEC 2K3HA 5HHQB 3O8XC 4KQ0A 3BZFB 4HQQL 5I1DB 3STZB 2IPUG 5IY5B 4DFIA 2EVHA 2VE6A 2W91A 4KPHL 1SF5A 1XL6A 2FWSA 3KWUA 4PG9A 4AM0A 5F9WC 3N0PB 3MRCB 2QGCA 2MWCA 1HL4A 3CLEL 2BWIA 3L3OC 4MAZA 3ZR6A 2B1AL 1CBVL 4NP4H 4F37K 3MV7B 4LSRH 4DVRH 5KS9B 1SEQL 1S9WA 3NEXA 4RQQA 3W2DL 4YBLB 1HVXA 5TDNA 3T2OA 3WTYA 1DUYB 3OX8B 4HCIA 4R4BB 2UXVA 4IMKC 4JRXA 4JJ5A 1FNHA 3CN3A 2R0ZL 1ML0A 1PGRB 3CFKA 3WHE0 4NSKB 3EBHA 4YBQC 5D7JA 4X5XA 2HPTA 3FUJA 5AVRB 1DBBL 1MLCB 3ZYIA 2JQAA 5ICYA 4QRTB 3WGUB 4Z7WE 5A16B 5CLWA 1MRFL 2KI6A 1W8OA 3U79A 1SDAB 1DCLA 1JG9A 1HOCA 1DUZA 1YDPB 1PYWA 1YO4A 3ZMNA 1CF8H 4X6FB 1AD9B 4F8TA 4YZWA 2G60H 3OKNA 4GFXA 2GJPA 1BZ7B 2W9EL 4I1RA 5I1JH 1I3GL 4LSTL 3D4ZA 5E03A 1PEZA 2VH5H 5AL0A 3P77A 4AYEC 3CBKB 3ZO0A 4ZMPA 3QAZB 4W9IC 4BD4A 3ZT7A 4P4RB 5D72L 1WTGT 3QEUB 3B7RL 2EC9U 3QS2A 1JOIA 1JI2A 1JN6A 5AKSA 3PXHA 5DYOA 2UZIH 4KY1L 3O41B 3V6OC 1RZ8B 5IB5A 3VFRB 1D5XB 3X14B 4GRMA 1O9VA 4PJIB 4Y2OB 2XDHA 3VU1A 2JV6A 1U8NB 4LCWD 1KB5A 1WHPA 4JMXA 4NO3A 1BCIA 1T2XA 2OR7A 4I0PB 1G9ML 3JVFC 3B2DC 1HHKA 2ICES 3HE6A 3CU1A 2M26A 4ZPTA 5J0BA 2X6VA 1ZT7B 4S1SH 3TT1L 1L6PA 1JGUH 2Z7YA 5CINH 3MOBL 3BQUA 4J3UA 4X98B 2W65B 3P3RA 4AM0B 1EXHA 4MVBC 5EZPA 1ZHBB 5CZRA 3VTMA 2OTUA 1RL1A 2Q8AL 1FDLH 1M3IA 3QYCA 4N2EA 3ECBA 3SGKA 5IWLA 1OT2A 3IVKA 1D7DA 2HJFB 1F45A 2GT9A 2ZOKB 4TNFA 2OA9A 1ZS8A 2CPUA 4MBRA 4PRNB 4B5ZA 2D3JA 3HJ0A 4IRJA 1A25A 4Y2DA 3T8VA 4FNPA 1XCQA 3WE1A 1CE6A 1SJHA 2NZ9D 4AGPA 1WZ1L 3HZMB 4G71B 4N9GB 5ID1B 1TLMA 2QGDA 1H6FA 5ALCH 1RZJC 2A5UA 2GTZA 3DWTA 4XCEB 2L4OA 4D7PA 5I5RA 5I2IB 1FI8C 1QZ1A 2NOYA 2W9DH 4UQ3B 4X6FA 3D1MC 1MW3A 4I2XA 4X6BA 1KEMH 1XMWA 1CLZL 1UXLA 5BRZE 3CFMA 1ZLSL 4EBQL 4UDUB 2GQHA 4NZFA 5INDB 2VMEA 3TEWA 2MCG1 3V52L 3RWHB 3N40F 4FHJA 5JQHC 1KLUA 1JWUB 3C8KB 3V6BR 2CH8A 1GZQB 1TZGH 3AABA 3QORA 1U8QA 2BSRB 4OUOA 2VDKB 1CDCA 5F3BA 2YUZA 1NFDF 4L8DB 2E27H 4PJHB 4ODSH 5F7LB 5IBTH 1QR4A 1GYUA 2DQEH 3B1TA 3P0GB 4CILA 3ZTDC 2X2UA 4MXQD 3N1MC 4GMSL 3ZDYB 5B3NA 2VT0A 2JIXD 3H2WA 2QR0A 5AG8A 3T1FA 4YQXL 2OJZH 2OL3L 2YRZA 3IPEA 4HX1B 1A5FL 4XN7A 3BGAA 5C0RH 3GKZA 5ADPL 2BRRL 2V9RA 2DI9A 1E9QB 4LMQE 2EJ1A 3U1SH 2OS7A 3INOA 1KXTA 3RUGF 4YDLC 3TZVB 3S3SA 3HMWL 3V0GA 3F7KA 5CNHA 1DN0A 1AG0A 4OIFA 4ZOAA 3JXAA 4DGUA 2A77L 4DKAA 1SLUA 4M9PA 4H8PA 3F83A 1NSNH 5LB1A 5HY9A 3PPEA 3E8VA 1SNRA 3KL3A 2WIIA 3MCLH 3E1ZA 3BQUC 2BVUA 2R9HD 1UACH 4OT1H 2Y07L 1EERB 1S2EA 2WQWA 5IBUB 3AM8C 5JO5A 4NO5B 5D9SA 1MQKH 1ITBB 1A3RL 1I7RB 1VHPA 1AAJA 1UC6A 1YC7A 3ARGA 1PIFA 3QJQB 2SEBA 1CMOA 4OLVL 1JGIA 2V5SA 3HFML 3IKCA 3KPSD 3FTGA 3LTVA 5BO0D 1MCNA 3I9PA 5G55A 1R3HA 5ECGA 1X7QB 4U6VH 1U3HA 2XPGB 2YOAA 4UQDA 5B38G 3H9HB 1BD2D 2KT6A 4JY4B 2FX9H 4Y5YA 1G7HB 2G3XA 4ONHB 4RWYL 4Z8FH 1ZMYA 3CXDL 3ESVF 3K5RA 5AWNL 4LF3A 4YHPB 1S7QA 5D7LB 1INEL 1E5YA 1IGJA 4X9GA 4ODSL 5KBDA 3NPSB 3RBSA 3T0BA 5FV1L 3Q5YA 2JCCA 1ZVNA 1T0PB 5EEVA 1QD0A 2OSWA 3V8CA 4Z7NB 5T3ZD 3ARVA 3LZFL 1QR1A 4D9LL 1UWEH 2IDFA 2WB7A 1R46A 5B1JA 2FJFA 4IIQC 4F7MB 5LNEA 3TPUB 5GSVB 4ERSH 3DBXB 5HYJD 2X88A 5FAAA 5EO0B 5FA3B 4O2EB 1GZPA 4PIBA 2P49B 1QFWI 4ZNEE 1E0OB 1F02I 2CKBH 3FZUD 4JFZL 1YMHB 4BYHA 4K07A 3P3UA 3MLTA 2WVUA 3B2VH 3ZIYA 4HLZG 5D71L 5FFLA 4OFQA 3ARDA 3KJ4C 3H2QA 5GQBA 5KS9E 5TK2A 3RQ3A 3NA9H 1A7BA 3KR3H 4PJBF 1WBZA 1L9PA 2J73A 4BHUI 1W91A 2AEQH 3ZTCC 4BELD 4DGWC 3NJNA 1QTSA 4WTXA 3RGBA 1U92B 1S7XA 3GS7A 2YGPA 3RB7A 3CVHA 2XZAH 2VLKE 1CFMA 2CSPA 2CJ3A 4Y9FA 4OKDA 2CKBL 4JFZH 4Y19B 4PLKD 3MUGA 2BP8A 3FCTB 3WEAA 1RZKL 5F6IC 2FK9A 1BM3L 4LRNH 3TA3A 2F5BH 2QT6A 1G9EA 4TS6A 2NXYB 1PNCA 1R19A 4HETA 4TVPE 1OAKL 3ZTJH 3DMMD 4LSSL 4JZJA 1KJ2L 3EO0B 3B9EA 5D2NA 3VB9A 4F2FA 4FLOA 4UT7H 3GI9L 4UBDD 5EA0L 1UTDA 1F6AA 5C0AE 1CS6A 1A0QH 2BW5A 2ORBH 3EJYC 3EFOB 3AGWA 4DGYL 1I8IA 5HHOE 1L0XA 4NOBA 3UCRA 1ODUA 1IGJB 1RIHH 3SY0A 1H0DA 2ZXQA 4ZSOB 2O5YL 5E94A 1QUNA 3O3AA 1Q9OA 5DRZA 2VLKD 4J3TA 1MAMH 4OZ4B 3K46A 1NBQA 1ZE3H 4MMZB 1JZJA 2NX5A 5CIPB 3MXWL 5SX4I 5KN5B 4L0ZA 4M6ML 3D39D 3DXAE 5A2AA 3T0EE 32C2B 4TUJA 5DS1A 5HJBA 2Q7YB 2LV4A 4OZHA 3FQ1A 1LP9E 3R0MA 5D1XB 3T8MA 3MNWA 2EVGA 3VD5A 1FFNB 5T3XE 4GKSA 4HJGA 1YAZA 3D18A 4WU7A 1QZNA 2H8PA 4PR5B 4R9HA 5AAWC 5ICUA 4L23A 4WTZG 1SXNA 4W4OA 3S35H 3DYOA 1KENH 2CUMA 5F97E 3SQBB 2CBTA 3GHEL 4WFHE 3PDDA 1DFBH 5T3ZH 4A2LA 4A67A 3RWFB 3QULA 4JDVA 4AYMC 1DE4A 4G8GE 4CVZA 1M2VA 1QSZA 3D09A 1KIPB 3T0EB 5KYYB 1MHCB 3FUDA 4FFZL 4EI5C 2A6JA 3SE6A 1I8MA 3MAWA 4FXKC 2YBGA 5FOJA 2EEDA 1ZPUA 5AOMA 1MCOL 1O75A 3KLKA 1S3KL 4BKTC 1DVFA 2BVYA 3L1OL 4KK5D 4IGBB 4CW1B 1U41A 5DA0B 5GISH 1BD2E 1YJDH 4JDZA 4Q2ZA 4HSAC 5TE6L 1J1PH 4AGLA 1KDJA 1PZAA 5I16A 5F7HA 2OKMA 3GJFA 3VJ6B 1H19A 4ODBD 4DVBB 4XBMA 1CTOA 4IMLB 1GGBH 4ISVA 4L8CB 4KQ4H 3ZR5A 1ZJAA 3L9RB 2WXPA 1HNFA 4FCHA 5DC2A 5IR1A 5GXBB 3GZQA 2P24A 2R83A 3IFOA 4L8SA 3KHQA 2YRBA 1BW8A 4LEXL 4IEFB 4JO5A 3L3JA 1BFVH 4LL4A 2GJJA 3IMVA 1TZHB 4TL5A 5AB0A 1EHKB 1RZ7L 5TK4A 5C7XH 1DJZA 4YX2L 4KI5C 3SDXA 3AG3B 2VDLH 5F7EH 1RHHB 4EVNB 2WIMA 1WAAF 1CFNB 1YEDB 4W1TA 5L8JB 4L8SB 1DJXA 2DYPA 1E27B 1OM9A 2FJUB 3QG7L 4MRCA 4AM0Q 5HGBA 1MFCL 3L9RA 2OTPA 1BXUA 3FQTB 1EHLH 1UUSA 1T5KA 5L2KB 4H44C 1T4KA 1E8YA 2JFCA 3G08A 3WJJA 1F4XL 2ADJA 1RIHL 3MBWB 4FLRA 2HRLA 5H37H 3EOBB 5MENE 1NM4A 4FTVA 4E9QA 5J3HD 4PJBE 1ZWIA 3WMPA 2CRIA 3F58H 3RKDC 2YXMA 3HG1A 4AH2A 3O3BA 1IGFH 4M1CC 2N1KA 1Z5HA 4X9YA 3WIIL 5E6YA 3B8SA 1HQRB 1QACA 2B1OA 5EBLA 1MG3C 2DKMA 2FB4L 4FQLL 4J4PD 4KMTH 1DDHB 4PUBL 1JV5B 4ELKA 2Z91A 1CIUA 4GS7B 4IRSD 2A4CA 5JW3L 4P57B 4ACPA 2P42B 1DYZA 3KPTA 4YL9A 1TQCC 3PV6B 4Y7OC 3SN6N 4APQC 3SQBA 4X6CB 1JZ2A 4G6JL 1BMGA 2MRYA 3SPVA 4PN6A 1OE3A 4NOFA 1CJYA 3QPQC 2PLTA 1F4WH 4CBPA 1F8TH 3P77B 2HT3C 1EJOH 2Q0ZX 2NNAB 3EG9A 4NQDE 4HD5A 1M1SA 1H8NA 1TLKA 2ZXCA 1CLYH 4N8PA 4LRIC 1ZA6A 3MBED 4XVUC 3HJEA 5AVXB 5ELIA 2PXYD 4S1RH 2B4CH 3CVBA 2AK4D 4WWNA 3EH5B 4ANXA 1KCUL 1R17A 1SFHA 4FZEL 4QRRB 1F86A 2HLAB 3SKMB 4G82A 1MRFH 5CEZL 1A21A 1LMIA 4LT7A 4HH9B 1J48A 3HI6L 1ZTXH 3HNVH 3LZRA 2H9GB 3D5OF 3P4MB 1O5PA 1WWBX 3CX2A 3JUYA 4LSVL 4PI2A 1H5BC 3W9DA 4OM0L 2GJZB 3CN0A 4PFEA 2YFOA 1BBJA 3ARDD 1OWRM 2YBRA 3HI5H 2ZICA 3W39A 2ZF9A 3QUXB 3BXNB 5EOCL 1NBVL 5F1KC 3G6JB 3NRPA 2FYYA 3HUJE 3NSDA 4G9FD 4PRAA 1OCRB 1JERA 4FX5A 4ODTH 3NVQA 4OGZA 3VFTB 1JV2A 3VFVB 5MHSE 1JNLH 4P4KB 1RMFH 4KXZH 3D0LB 3KPRA 4XE5B 4P2OC 4H5SB 3B9KC 4OLEA 3FSZA 1S5IL 5DURB 4FQHA 2JI1A 2ED9A 2FSDA 4Z7UA 5DGQA 2AEPH 3WJLC 25C8L 2Y72A 4F80A 4NT6B 4BXSV 4OSUH 2YZ8A 2HRHA 1MVFA 4GO8A 3NBNA 1OARH 3WDIA 3LS4L 3BO8A 3R19A 1UKQA 2I07B 4UZSA 4NQSA 4YHKL 5FB8B 2VSMB 3MV8B 4I87A 2YD4A 4N2AA 2YAOA 4P59L 5HHVH 2IWFA 4GEIA 4PJCF 4N8VG 3B2PA 4MD4B 3U4BH 3RE0A 1KCRH 5CN3A 1YYML 4F8OA 3LJ3A 4U05A 2YHGA 4X7TB 3QG6A 1ZLUK 4WTWA 4PS4H 2XY1A 4JRXE 3SDYL 2WVSA 4H0HB 2Y7OA 4PCSA 1DQQB 5CO1A 2Y7QB 4AQAA 2PTUA 3O6FA 2JXMB 2W92A 3QEQB 2BOLA 4DQAA 4D0DB 3WSQL 5C0AB 5ACZB 5I28A 4JG0L 1WFIA 2YZ1A 4E9SA 3HBPA 2VW7A 3DV4B 2BDNL 4L1SA 4PHZA 3RJDA 4HUVA 3ARUA 3MA9L 3ARBA 5GRUH 2ZG2A 1LEGB 1WAAE 4N1CA 4HWUA 5DUML 1AO7B 3QNXB 3ZE1B 3HG5A 5FW8A 3RTQD 2BDNH 3CX5K 4MJ2A 3ALPA 3QJRB 3O81A 1BLIA 5AW3B 3NJFA 2Z34A 3BZ4A 2QVTA 4XMLL 1PSKL 4BA8A 4RGMC 4UYQA 5JNYB 2YPLD 3VFPA 3G5WA 3AY4C 1HESA 4JFOB 5IMMA 4M4PA 4G5ZL 2H8PB 4KROC 4PR5A 4PRIE 4YGAB 2Y3AA 3L5JA 3V6OE 2IWKA 5I0DA 3PFUA 3GD1C 1HCVA 1C7TA 1AXTH 2JIXA 2PF6A 3O9WC 4ICXA 4GG6E 3ZZLA 1KTLB 3C6LD 2WTRB 3A5VA 3GF8A 3S37L 1X4XA 2YPKA 5FK9A 3S88H 3BGFB 3TWCH 1G7QB 4P5RA 1J88A 3DV6A 1J05B 1B4JL 1GPOL 1KLFA 2H32B 2Y23A 4JO1H 1L4IA 5DU7A 2HXAA 2ZXDA 4W9HC 4YE4H 3KPRB 1IGCH 4HGWB 3TVMC 4WUUB 5TE4H 5CINL 3GZOA 5I6KA 4FL4B 3VFTA 2C4FT 2H26A 3VFVA 3BP4B 1QSEB 3L81A 3V10A 4AJ0A 5L8LB 1KGJA 4DHLA 1B0IA 1ZDQA 5D1ZB 1K9TA 1DO5A 2BSSB 4BFKA 3T65B 3MN8A 3DX3A 3VH8G 3SD5A 3FU6A 4F15C 3U2SA 3HTLX 5IBLD 3CUPB 4PRDA 5TE4L 3GNML 2WW8A 5DUMH 4HH9A 4LGPB 5EBWB 5AUMA 2EEFA 1QA9A 2XBTA 3BZEB 1I9EA 2BIOA 2JE8A 2P47B 5DHVA 3MA9H 3PWNA 5C9JB 4LL1A 4BXVA 1V05A 3ASWA 1C16A 1FCCA 3UIYA 4ZTOL 1K85A 4PJ9A 5F9OL 4JCMA 2EXYD 4H7VA 4L1BA 1CLZH 2EYSB 3HBQA 3GDCA 5E9AA 1Y6KR 2VXSL 1Z5LA 4UNUA 1JHKH 3GSNL 5ENWA 3CQFA 1J7VR 1O0VA 4JQIL 5DHDA 4E9TA 3LEVL 5BRZB 5JDSA 5E8OA 1K72A 1S5IH 5BPPA 1HI6A 3ZTNH 2NY6B 3EO1A 5LAXA 3K71B 2XBZA 5IF0A 1WIOA 3O2DA 3CIAA 3NACL 3QQXA 4XOEA 2P7TA 1G6RL 1QLEB 3TZVC 1S8DA 4YDLB 3KM1A 3TA3D 5FDWB 1XIWA 4PD4J 2VDMB 2R29H 1MI5A 3AAZA 5DD6A 3UBXG 4PJEB 4G11A 3BQUB 1ETZB 3HBZA 4WFEE 2LFEA 2N59A 3QQ9C 2EH7H 2BIPA 2E9GA 3V0FA 4JANB 4WUKH 3DJ9A 5DJ0B 3I3BA 5JYMA 2FZ3A 1IM9D 2VISB 5DD0L 5KSVB 1S9XA 2DRUA 2VC2B 4KPHH 3P4OA 1SXCA 1TETH 1OW0A 4LF3B 2HAZA 5D7JD 2MKWA 4Y5YB 2WJ7A 4L18A 3MRQA 4WI0A 1EZVY 5DRWB 5D96C 1RUKH 2HCZX 1IFHH 4HHAA 4U0QB 2NY0D 4PVLA 5C8JA 5IMLA 1KNOA 1RQ5A 5CJ8A 4WDIB 3WS3A 1BHGA 3A67L 1BVNP 2NSMA 2H3XC 1DL7L 3DOHA 4AIZA 5CCJA 5IB4B 3I6LE 1TU2A 3UPRB 5AOKA 2SEBB 1MUJA 1HC1A 4GW1B 4BKSC 4LCYB 1YRKA 3CFCL 4H8HA 2VABA 4FLQA 2WZ5A 1GMEA 1L9MA 1K8IA 4ZTEA 3AREB 5JXEA 1SZNA 4N3TA 4J3SA 4B6ZA 1AANA 4TXVB 2NZIA 4UM9A 4UMSA 4JFQA 1G6RA 5DQJB 3SE8L 4FC3E 1X5ZA 3KPMB 1V5JA 4YAQB 3EBGA 4DK6A 4IIQB 4UB0H 1XH1A 2FTAA 3CIQA 5BZZA 4EJ1C 1DBKH 5HHNA 3VA6A 6FABL 2EECA 2OTWB 3KEDA 1SEBA 1I8LC 3QO1A 2R0KL 3AG1B 3B2XA 4MA7H 4DFHA 3DRQA 1BQLH 1RULH 1T66C 3ETBF 5I9QB 3IKKA 4AQEA 4N85A 4IKIA 3VRIA 2X3AA 4YC2C 3V7AE 1Z32X 3A4FA 3VYOA 1NEZB 4CW1A 1MVYA 3SYQA 3EYSH 1KGWA 4PRIB 5KYUB 2C9VA 1XGQB 2BY3A 1NDGA 1MVUA 5BNXD 3ESMA 3LKSA 1NCOA 4OLXH 1IIIA 2LVEA 3MRDA 3F04A 4N2DA 5L4IA 4MLIA 1JHKL 3O3DA 1DE4B 1M7DB 3DI2B 4PV9A 5HHQA 1N7MH 4WCYL 3FOLA 3DIFB 4OV5A 1KJ3L 2V3FA 3D69A 1IT9H 3DUSA 5JHDA 2F7OA 3LDBB 2ID5A 3ESOA 4PJ5D 1RXLA 3LKNB 5DYFA 3ZE0E 1FGVH 4P23A 1QBML 1TO5A 4GXVH 3O11B 3QEGL 1NC2A 3UROR 1ZTXE 4M5YL 2V37A 1PKOA 5AG9A 1Q9LB 4PWIA 1E4KA 4ZG1A 1T6VN 2BY0A 3NPZB 1KCVL 3VMPA 1RK0A 5C3TA 4WK4B 4PSPA 1ECZA 1FQ9C 1OSZB 5CUSH 3S5LG 3UPRA 4FA7B 3TONA 4C57C 2DPKA 1T04B 4NUQA 4QGYA 4MMXA 5ESVA 5JW4M 4MMZC 1UCTA 4F3FA 1FC2D 2PW1A 4ZMQA 2WLIB 1FAKT 2VL4A 5HYSB 5E08H 1IEAB 3CSTA 4HU2A 3H7BA 3NJXA 1KZYA 5CJQL 3Q9QA 3L1OH 1JHTB 1ZHBA 2BMKA 2CDEB 1HEHC 2VQ1B 2XA8H 1RLWA 3Q1SL 4NC1C 4QRRE 5T5NF 2C5DC 1P0SE 3SBQA 3WE6A 3K2MC 1F2QA 2AITA 2P43B 1CGYA 3KBEA 3OZKA 5D1XC 4GUQA 4S1QL 2O5ZH 3KPLB 2N3JA 3GWJA 1KT2A 3QHFH 2CKBB 4X4XB 5EF0A 5E6SB 5CF3A 3P73B 3DO7A 4MTMA 1FVDA 1CU4H 1A2YA 5IQ9A 2C9RA 2F2HA 4N22A 4XMPL 3UBXI 2AEOA 1U42A 3LNEA 5F96L 4H2AA 1J1XL 5DJAA 2E9WA 1VGEL 1HAWA 2OMYA 3ECWA 2A83B 2BY2A 4DOHB 1J0YA 5L0QB 2DQ6A 3B9AA 4ZMTA 1PU0A 2R59A 2BOCB 3ATDA 5FKAB 1EGJH 4IS6A 4MJIB 2EDRA 3T0EC 2UX7A 3SGEI 2DLGA 4K8RH 4LASL 4EI5B 4X7CC 4KKBC 2CO3A 1VADB 4FXKB 5A2IH 3FQYA 3EYVA 3CMOL 1QBLL 3HAEG 1UOLA 4YGVB 2GY7B 1DSWA 5D7KD 4NBZB 1FIGH 5LDSA 1YPZE 2F53B 1HSAA 4IGBC 5B21A 4HDIA 1KYDA 3L4VA 1W72H 1DUZB 5CJXA 3D2UA 1WZKA 5F44A 2HLFC 1TO4A 2CXKA 5IFJB 5H8DA 1BD2A 3RVWC 5I19H 2AABL 3B2VL 3DBXA 2I9TB 2QBWA 3G5VA 2N1TE 2X0UA 1P1ZB 2JWYA 1MJ7L 3LMJH 4M1GL 3MUZ1 2YD1A 1I7UA 2HFEA 3NK3A 4XMPH 2B0SH 4FJYA 3C60B 4BKLB 5B1CA 4NIYE 1BZDA 3KLHD 1CFBA 4X6EA 3T65A 1U91A 2VITA 1PG7H 4NO0B 3RJQB 1EFXB 4AW4A 4XOAA 1V27A 1OGAA 2QJDA 4B0MM 1NANH 4G43A 4KI5E 3UTZB 4AEFA 1ZT1A 2R4RH 4LOEA 2IXQB 1IJ9A 3K81A 1GOHA 1WICA 2WWNA 3GRWL 5F88B 4A2EA 2V2XA 1V3JA 3GSOA 3LMJL 3ABKB 1X7TA 4M1GH 3VXUE 4NN7C 1I7UB 2HFEB 2NY3B 1G84A 5DO8A 3VXUD 1MHPL 3RL2A 2KLSA 3VFOB 3KCPA 1A7OL 2ITCB 1EUTA 2LAAA 4XCYA 5M95B 1X7QA 5BUAA 2DI7A 4KJWD 4Z78B 1WWCA 3ROOB 2XV3A 3SGJC 1UOVA 5T33H 3UAJA 2EEAA 5I0WA 1AMXA 4RMWA 3PS6A 2VIRA 1V3MA 1R33A 4PS7A 3ZE2E 4TLSA 1ADQA 4YGVA 1NCWH 2AXFB 2NDFA 2BINA 5EZIH 4WJKB 5ISZA 3FF8A 1YY9D 3U6RA 3MI6A 4GKZA 5IHLB 1JD9A 3O6MH 2EUZA 5EIVA 4Y8DC 3N55A 4QF1A 2IVFC 3DX1A 4ZPVA 4NFCA 4GG6F 1XCTB 3MRKA 2IGTA 1UACL 3FQWA 4GS7C 4N0YL 2NTFB 3VCLA 1HYSD 3K0WA 1OL0A 2IH3B 1VCBC 2DLIA 3C5ZD 4KDTC 1TQCB 4WKZA 2NW2B 5E9DB 3ES6B 3CXHJ 5CS7A 4WFFE 1CICB 4JHAH 2P45B 3GDBA 4QRPD 2GK0A 1E40A 3GJEA 3SGDI 4GKLA 2IIJA 1OCWH 3QI9D 4OZFH 4LU5H 1EEYB 5D1QB 4H25B 1U8LB 4G8AC 3NZ8B 2L7QA 5BV7H 3QNYB 2H2PC 5DK2A 5DVPA 1SM3L 1VFOA 3MBXL 5F7WC 3MLXL 3N41B 1AHWC 1OY3B 3LXUX 3QDGB 3CZJA 1B4RA 5EC2B 5D2LA 4FE9A 2XZZA 4JVUA 1S46A 4IRJD 3RUGE 2Q2LA 1E4XL 1UZGA 2NTFA 1A7QL 3VDCA 1OT4A 5HYSA 3V0DA 2VDLB 3O6LL 1NPUA 1ACZA 2WINB 3IDJA 4HCRH 1VENA 2BX5A 5C0EA 4ZO9A 5HHPB 4Q9RL 2OMTB 1IL1B 3RAJL 1LLAA 4U4BA 3BRDA 1M56B 1B3JA 4LDCA 3UZQB 1CTNA 4KWUA 2DWDB 5B1KA 3DROB 4GAYB 4UQ9A 3CD4A 3D48R 1R3LA 2IOIA 2PYEE 3PWLB 4N25A 5A7BA 5BZXA 5E1GA 3PYCA 2KZBA 5J1AA 3QUXC 4DERA 3QYNA 3SYOA 2GTWA 1DVSA 1ADWA 5KZCB 3CXDH 5DRXA 2C1OA 5E8DL 4KHTL 1N3NA 1QFWH 4XXWA 2WQSA 5DFVC 5PCYA 4MB5A 1MI5D 3KYMA 2KC0A 4U6HA 2P5ED 4X50A 3QJHB 1U93A 3ET9F 4CVXB 1RJLB 3IGAA 5EF1A 3O6FD 4IS6B 4MJIA 1TMCB 1YNKH 3DSNA 4TQEH 4MQXC 1EO8L 1NFDB 3B9KB 4PJHF 4HEPG 1ZIBA 3T6WA 1BX2B 2FQEA 4OF3A 1FNGB 1Z7JA 3IETA 2CK0H 3IVKB 3QQ4A 4RNRB 4LLYB 1NINA 1E4WL 3QUKA 4WNQA 5FR3A 2BVQA 4TLKA 2V8LA 3EXJA 1FNSH 3CFEA 3LKSB 1OHQA 2RR3A 3A6CL 2QZQA 2XFXA 5AKRA 1TFPA 1WBYB 1H3UA 2X4UB 2B15A 2VLJD 4CU6A 2IJ0C 2VXVL 3KPLA 4LPYA 1S7VA 3ZRCC 2BH0A 5HD8C 2MOQA 4AEIL 1YECL 3GJFH 3GSWB 3QUXA 4BFIA 4AJYV 1DQVA 3E6HA 4XP1H 2WWKT 2FJGB 3ILQD 4AC2A 2PWHA 1KJ2A 4BKLA 1RZJL 5E2WH 5IP4A 4CL7A 3IT8D 3PGDA 3PWVA 4PEEA 5E2VH 4AJVA 4MXWL 1RAMA 2DEXX 3VQ2C 4Q9QL 5E2TL 1CFQB 5LGHL 4Z3HA