1DOAA

Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
190
Chain Sequence
GSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Rho family GTP-binding protein Cdc42 in complex with the multifunctional regulator RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords PROTEIN (GTP-BINDING PROTEIN)
total genus 49
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 1999-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1doaA00
2BMFA 1ESMA 1MOZA 3ECCA 4LZZA 1AS0A 5J4KA 5L3VA 1N3BA 1X8LA 2DY1A 5F9HA 5AJZA 1ZVQA 5JEEA 1EX7A 2IS1A 2ZITA 4I1SA 3LH5A 4I1VA 3NKVA 2QBYA 1ZJ6A 4V0NA 1OIXA 3DL0A 1U98A 1TNDA 2AR7A 3BJIC 3TMKA 4B44A 2ZREA 1E6CA 2VBCA 4PHHA 3FHCB 1WMSA 3FTQA 3THWA 4IVQA 4LSGA 5HE9A 2CVFA 1RFLA 5HKKD 1KI6A 3DM5A 1Q1BA 1QHHB 2PCJA 4TYYA 2GXSA 3T15A 3VX3A 5HR5A 2E87A 5FH9A 2JLVA 5CK4A 2VP9A 2QPAA 4AWXA 1SXJE 3QSYA 1P4SA 3LX8A 1K5DA 4BEJA 2WWHA 5JLJA 5JSZA 1RRGA 1ZD9A 2VHUA 1KI7A 4R9UC 5EP1A 4DSUA 3KKOA 4B3FX 1FP7A 2VIIA 3MWJA 4GFDA 2XTMA 3LBHA 3AVUA 5F3WB 3MMPA 4LBWA 1DAKA 4JKIA 4LJYA 4C3ZA 4Q4JA 2GEDA 621PA 2F55A 2QROA 3K9LA 5JEDA 3ADKA 1YU9A 1Z08A 3F5FA 1OH8A 3KDSE 5IRCD 1FX0A 1UADA 2GETA 1Q3HA 1COWD 1VKJA 2OM2A 3R8FA 5DI3A 4GBMA 3A1TA 1O3YA 1P7CA 2ZXUA 1ZM9A 2BWJA 4DKXA 3HU1A 1AJEA 4G5RA 4DLWA 1AGPA 4II7A 4IVRA 2JASA 2ODNA 4DC9A 1LF5A 5L3SB 2RMKA 4QRHA 1LS1A 4Q1BA 3K09A 4N0DA 3QVUA 1OW3B 3Q7PA 3IUYA 2JIZA 1DAFA 4KO8A 1JJ7A 3PFIA 3MWLA 2QAGB 2OEPA 3QKUA 1EWQA 1OT3A 3CRVA 4MUAA 4QM7A 3Q5EA 1GITA 3U44A 3ONWA 3K0FA 4F93B 2QP4A 1OE0A 3BK7A 3DMNA 1E79D 1VMAA 2XTZA 3SS8A 5GADl 2HLDD 1ONBA 5L3QB 3PEYA 2REBA 1IHUA 2VSFA 4FINA 1OKKA 3GLIB 3UMRA 1XEXB 3V00A 4FMCF 2ZRFA 1FL9A 1XCPA 4OQXA 5EZ6B 4JL6A 1JAHA 3L82B 4WW0A 1E9FA 4E03A 1M2OB 2XB4A 3KKMA 1M6NA 5JRZA 2BMDA 4L4UA 4URYR 3QXXA 4LY6A 2NO9A 4TYQA 4QL3A 1RKBA 1MR3F 4Q7LA 3AVVA 3AF1A 2YOHA 4WIAA 5AJYA 1W4AA 3I5YA 2EW1A 2EQBA 3WXMA 4EFNA 2YWHA 3RAPR 3BC1A 1HY3A 6Q21A 4QOSA 4NCNA 3C7KA 1XJ0A 4HB4A 2ATXA 1RYFA 1E0KA 1CJUC 2DFNA 4B35A 2EYUA 3I3SR 2W00A 3BFXA 1XZPA 2OXCA 2W83A 3IBGA 3BRWD 1W36B 2C9OA 1OPXA 1X6VA 2W6ID 2H57A 2PCLA 5EP3A 4A4DA 3TSWA 1IOZA 1Z0DA 3U60B 2C95A 3AP1A 4OK6A 4FWTA 4PC3A 1AA9A 1E98A 5CITA 2ZS8A 1PZNA 3EZ2A 1QHHA 3TE6A 3ZIAD 3I92A 4KYIB 3CONA 2OCBA 4ESVA 1GOTA 1F3OA 4A8JB 5HKKA 4QXAA 3BFVA 3CR7A 4KSCA 4C0JA 1U8YA 4NL4H 2OLKA 2HV8A 2IA5A 5J4LA 1UKZA 2CLCX 4EUNA 1GNQA 3A1VA 3M6AA 2IWRA 2N42A 4EJSA 1U99A 2FEOA 2NZJA 1NMXA 3L0SA 2ZR9A 1M7GA 2JJ2D 3HR7A 3L0OA 5BQ5A 4KLNA 4ZKDA 1QHGA 3IGFA 2OBNA 1KYIA 3OFND 3W5JA 2RGNC 1XRJA 1E9CA 2AL7A 3QKRB 1CULC 2W2VA 1VCNA 1NLFA 1RZ3A 1U0LA 1KMHB 4MH0R 2VHTA 2OILA 1M7BA 4Q1EA 3IIKA 2IF0A 2WSSD 2C9CA 5EUQB 1XMVA 3QOFA 2IYRA 1E2IA 2PMKA 2ZS7A 2W2TA 4XWOA 2JIZD 2ZJ2A 3JZMA 4RZ3A 4TLCA 5FOVA 4E5UA 4OJKA 5J4YA 4UXIA 3K09C 5DIFA 1Q44A 5DN6A 3FKSD 4P4SA 5DI9A 4KFTA 2F1IA 4M1YA 3B7GA 2JATA 1N5KA 3EC2A 3U7FB 1A2KC 3VR6A 3GLFA 1SXJB 1VCIA 3GJ8A 1XTKA 1W4CA 1NVVQ 1Z2CA 4PQYA 1T91A 4D0LB 3W6PA 5D3MA 1G3MA 3IPXA 2CLSA 1DAMA 4Q1AA 2EFEB 3VQTA 4Q03A 1WA5A 4OKSA 3SYNA 1N6RA 1HTWA 2R65A 2Z4SA 3PENA 4BFWA 1E2LA 3F8TA 3HU2A 3IHWA 5L3QA 3VNUA 1XMIA 1G3IA 3CPEA 3KQHA 3ZZUA 3AV0B 1NJFA 2GJSA 3Q7QA 1BO6A 1S0UA 2HT1A 5E7MA 3CKLA 1I4TD 4RZUA 5FL7A 3HDTA 5FBWB 4M2LA 4L5BA 1AKYA 4EKDA 2VHQA 3IO5A 3B60A 4WOPA 3AF0A 2Q9CA 3QXHA 2ZSBA 3AKDA 3CX7A 4Z8YA 3ICQB 4V0KA 2HLDA 5C4MA 1NLYA 1M34E 2CNWD 821PA 2KSQA 1NG9A 2FNAA 2YOGA 4NTZA 1ZBDA 4JIMA 2O8CB 2QENA 1M7HA 3UG6A 2C78A 1OLOA 3ZS9A 3FMFA 1E9EA 1ZD1A 2DFKB 3CX8A 4CEHA 2QL6A 3B2EA 3BS4A 4US2R 5EXSA 1UPTA 1R7RA 1TQ6A 1X1RA 2JJ1A 4DDWA 4BWYA 2BEJA 3RYTC 1IY0A 4H1VA 1YZTA 1W0KA 4GZLA 4IHQA 2O5VA 3EIQA 5H70A 1KDTA 4LRWA 1VG0B 2YWEA 1ZW6A 4PQFA 4EPRA 5K8IA 1TF5A 3SE0A 1C1YA 4DXAA 1E2MA 3CF0A 4TMXA 3CH5A 2IT1A 2XNDD 4BASA 2J3EA 5IDVA 3QBVA 1H8HD 2OZEA 4Z54A 4OJQA 2XZLA 4MRRA 2GK7A 3GLHA 4OQNA 3PJRA 1RYHA 4A9AA 4Q9JA 4HLQB 1CRQA 3K70C 4PR0A 2J7PA 3L0PA 4D25A 1TL7C 4IKEA 1CJTC 1GUAA 4IVPA 4KVGA 1XMSA 1K5GA 3U3RA 1DAIA 1F5NA 5FUVA 4OI0A 4S2EA 3CR8A 4EPTA 1Z47A 4V03A 5TV2A 1KSGA 4BFUA 4C9BA 4CVNA 1FPMA 4EQ6B 5K8UA 2WJJA 3KJHA 1R0XA 1D6JA 4IFEA 3OAAA 2ZRDA 5KSYA 4XSGA 2BJWA 3V4RA 2JLQA 1XP8A 5AJVB 2Z43A 4POAA 4RFSA 2H16A 1NBMA 3G82C 3PQCA 3LXRA 1Q1ZA 1KMQA 1EFUA 1T3HA 1G8PA 2A5GA 1G8YA 2ZANA 3T1QA 4HAYA 1UBFA 1ZC4A 3WBKA 1Q57A 1W5SA 3QEOA 3LD9A 4Q7MB 5CM8B 4DEXA 1JR3D 4FW9A 4HAWA 4N1AA 4TYPA 3ZVNA 4WVFA 2YC2C 5AK0A 4GOXA 3LO5A 3PEVA 2GK6A 5KDDA 1FOEB 3WHLA 2A5YB 1G19A 3CF2A 2XNSA 4OQFA 4Q4JB 5SZHB 2BM1A 1Z3IX 4CEIB 4FCTA 4TTPA 1BS1A 3KFXA 4QBHA 1G9XA 4BUJA 3DZ8A 3RWOA 5C18A 1D2MA 1SKYB 1CKEA 1J70A 2JLSA 5BN5A 3KXLA 1CR4A 1ZM7A 1T3SA 5JHHB 4JLJA 2ZETA 5FFMA 1QRAA 4DRZA 3OE7A 5LD2B 4L9WA 3UKDA 3O8BA 1FNNA 3KQKA 2RGNA 3E5HA 5F9FA 4IDOA 4H9GA 1KSFX 1VYTA 2OBLA 3CPHA 2HJGA 3CIOA 3EASA 1E0SA 2GF9A 3UMSA 5H1YA 1PLLA 2KB0A 2PZGA 2HJVA 4TZ0A 2CL0X 2J87A 3MWKA 2XXAA 4TMWA 4PAQA 4RD0A 3MFYA 3LX5A 3I61A 2J5XA 2ODWA 2FA9A 3BH7A 4MRNA 1G17A 2X2EA 3NWJA 4OQMA 2V55B 4ABYA 5C46F 2PLFA 3CH4B 4JVSB 1P9WA 1KJZA 2PJZA 2JA1A 4GP7A 3AEZA 1QDEA 3NEJA 2IYTA 1RIFA 1KO8A 1S8FA 2FSGA 2WZQA 4OHZA 4TMKA 4GMDA 1SVOA 4MYTA 4K81B 5LB2A 1ODFA 4PO9A 4P32A 3W8RA 4B6EA 2DHRA 3BB1A 2LWIA 3QXCA 1OXXK 2GEVA 1Z07A 2XITA 4TLDA 2QORA 3JVVA 2NOAA 1P2TA 1AGRA 1Z6XA 1G5RA 1KI2A 1Q21A 2IEZA 3EIHA 3LFUA 5TVKA 1EFHA 2BJVA 1TTTA 2FFHA 5F2EA 3D6TB 2WAXA 5FBRB 1VYUA 1OXSC 4KSBA 4BLQA 1Z5ZA 2BBTA 1E0AA 3PUXA 5EXTA 1PV4A 2A7QA 3B6EA 4M8NE 2NMVA 4OK3A 4RD4A 3OIWA 2A3RA 3TUIC 5DISB 1SQ5A 1OYWA 4BLPA 1YQTA 3DM9B 4PTLA 2ZRBA 4JKYA 1FFHA 4HAVA 2Q0HA 3IDQA 3SQWA 2KBFA 2VSXA 3CPJB 4FWIB 4JS0A 4WBSA 4YMUA 3N70A 2F6RA 4DLYA 1TQDA 4M21A 2ZRPA 4ZCMA 3Q3JB 1N6NA 3TAUA 3LRPA 1E2HA 2EU8A 1KO5A 2YV5A 4TN1A 2YKGA 3IPYA 5ANRB 4J0QA 2REOA 1HUQA 3H0KA 4S35A 3CUEF 3E70C 3TW8B 5HZHA 4GI7A 1IN4A 2IXEA 2ZYVX 5JJKA 1KAGA 4EAQA 5CB8A 3FE2A 4AURA 2ZVPX 2WM9B 1MKYA 5E4FA 3UANA 1XTJA 3WHKA 3BD9A 3MJHA 3GFOA 2FE4A 3P20A 3RABA 4URWR 1XTQA 4GNKA 3AGPA 4ZDIA 4JSTA 3RVBA 3P1JA 3LBIA 4LBYA 4A2PA 4M1OA 2D2EA 3NBFA 3KUDA 1RRPA 2Q6TA 2WHXA 4B3GA 1CLUA 4YDSA 3BORA 1JR3A 4FCWA 4FMDB 3U3JA 2IHYA 4JYBA 4TSFD 4JLVA 4Q02A 2E9SA 1KO4A 5KTYA 2BHRA 2FSIA 3O8RA 2WOJA 4G1UC 2A5FA 2G3YA 2ZSDA 4RSGA 2Q3HA 3WNBA 4ASUA 1DPFA 4D4KA 2HYDA 4YC7A 1G8HA 2ZI7A 3QKSA 3T1VA 2WIBA 4ITRC 2XXAB 1ZIOA 2AD5A 3AF4A 3EG5A 2GTPA 1CF4A 4GMXA 4FIDA 2GAOA 4PPQA 1DEKA 5FOTA 1P2UA 2EFHB 1C4OA 1N6IA 2ONKA 2F7SA 2ZI5A 2H8KA 5FBLB 3EIEA 1YHNA 4JLDA 2QRNA 2AXPA 1YZQA 3PEUA 2IUUA 5JECA 1GL9B 2ZUDA 1XEWX 2YNMA 2ZE7A 1XDBA 4LPKA 5TY0A 3MRSA 5FBQB 4C0AC 1PVOA 4BPBA 3MGCA 4GSYA 3RSLA 4HZIA 2ZE8A 3J81k 2JAQA 1OB5A 4KI0A 1X8JA 5A0FA 4TT3A 1YR6A 1GKIA 2ODEA 5UKDA 3GLHB 2RAPA 2X8AA 3U61B 2CVHA 2P5SA 1II9A 1UEJA 2NO0A 2PMDA 2SHKA 3DZDA 2FFBA 4MQBA 2Q21A 1GKUB 2ORWA 1AK2A 3TK1A 5FOUA 2FEMA 4ARZB 3K70D 4G5SA 3OE7D 3KTAB 4HATA 4CZ2A 4IFBA 2FJUA 2GJ9A 1BOFA 3NEYA 2V9PA 5FOWA 1NN5A 4AYXA 2CL6X 2XZPA 3NH6A 1RJ9A 5SZIA 3SDZA 5DGXA 1F2UB 1P62B 3X1ZA 4WAUA 1C9KA 4JL8A 4Q7JB 3QF7A 2C03A 1Z29A 5JRJA 2ZS9A 5E95A 2R6AA 1SXJD 2DCUA 1G4UR 3KZ1E 5DYIA 3QENA 5CB6A 3EW9A 1YE8A 1LY1A 1SVKA 1A82A 2OCPA 4RY2A 3OEED 3U5ZB 4JBXA 1Q12A 5DE3A 3ZD7A 1GAJA 1Z28A 2P3SA 3WP0A 1KI1A 3NBZC 1K8RA 3RLFA 2OAQ1 1T5LA 4K46A 5TARA 5C1BA 3ICEA 5P21A 1GNRA 1Z6TA 4A8JC 1XXHA 3AB3A 1CEEA 1EX6A 3P26A 3K1JA 2J46A 2QNRA 3I32A 2ZAOA 4LC1A 1W48A 1OV4A 3SI7A 3VR1A 4LJAA 1J8YF 3CRW1 1R0ZA 4B73A 3THYA 1R5BA 4M53A 4NP6A 4RFVA 4V0OA 3THXB 1VG1A 4P0TA 5CLLA 1E94E 3VR4A 2QTHA 4A6XA 5FUYA 3A1SA 3ZZTA 4BLSA 1IM2A 4HDOB 2GCOA 2ODBA 1JQLB 1TUEA 2NZ8A 4MDFA 3RHFA 1VPLA 3LW7A 5EP2A 4QHSA 4URVR 4BLOA 2UKDA 4B3BA 1TEVA 4DCSA 2WOOA 1QZXA 4FMBB 1WBBA 2V4ZA 5KO2A 1WE2A 2N1BA 2QGZA 4NCHA 3T1OA 5JFGA 2VTKA 1Y3AA 2OT3B 2D7DA 3ADCA 3AVQA 2FOLA 2G1KA 3W3ZB 3NBYC 4AC9A 1A7JA 1GG2A 4BFSA 2YVUA 1CR0A 3I73A 3OF5A 4LUCA 4YMSA 1ZNXA 1R8SA 2N46A 3W9YA 2V3CC 3SYKA 1E0JA 4W7SA 3CB4A 1U2RA 2HEIA 2ECKA 1JAIA 3B82A 3QF4A 4HAUA 3GFTA 1R6BX 3N2EA 2C5LA 3QPVA 1AS3A 4YMVA 1XJCA 2WVJA 5FOXA 1KKLA 2PZFA 1TU3A 3PEWA 3QUSA 4WZAE 1E9AA 3BH0A 3EPLA 4E07A 4NBSA 1KK2A 2IXGA 2UZIR 4BZXA 2ZI4A 4JLMA 2BDTA 4KBGA 1QF9A 3WYGA 4OHWA 2Z0MA 3EPHA 4BQSA 2CJWB 4LJ7A 1XD2A 1ZP6A 2OCYC 2OUKA 5DHFA 4B48A 4LK2A 1GP2A 3TRFA 1U0HC 4YXWA 2OESA 3C14C 4X8MA 5SZKB 3ZS8A 3AVTA 2GHIA 4DCNA 1XMJA 1MT0A 3QBTA 3WP1B 5FR1A 1NG1A 4JT4A 1E1QA 1LNZA 3LVRE 3EC1A 4W5HA 5EXXA 4EDHA 2WIAA 4PSVA 5G40A 3R9IA 3GLIA 4C0LA 4PX9A 4F91B 4IDQA 4DB2A 1QHNA 2WMNB 4LBZA 1MRSA 2I1QA 4PZZA 3KTAA 3U7GA 1DELA 3WMEA 4DWJA 2ORIA 3T12A 2RGGA 2C9YA 1AKEA 4CT4B 2CE2X 5G3ZA 4KAXA 4MDEA 4KITB 1QBKC 2DWOA 4DJTA 3AM1A 1G3RA 3D8BA 4RCZA 5KHOC 4ZI3A 3ZDQA 1NP6A 3BH6A 2GRJA 5JI2E 3THOA 2VRWA 1I4LD 4DDVA 2QUZA 3DHWC 3C15C 3REGA 1DS6A 1UFQA 4LYAA 4DSNA 3I62A 1QVRA 2KI5A 1OJLA 4LJ5A 1MH1A 1M1YE 2GAAA 8OHMA 2VPPA 2OE2A 4V0MA 2CE7A 2C8VA 1CU1A 3I1FA 1KI3A 3IIJA 5FTNA 2DFTA 3MJRA 2B21A 4LX0A 4P31A 4DUGD 4ZIRA 2QT1A 3QG5A 1YZGA 3AF2A 4CEJB 4JBWA 1F60A 2CHGA 4MA4A 3AP3A 2QZ4A 2FU5C 1ZRHA 4UXJA 4RCYA 3HYTA 4PO8A 3TIFA 5CJPA 3PCRB 4HUQA 1W1WA 1Y63A 3JVUA 4IEIA 3OIUA 2HDNB 5BYJA 1FMLA 1N0VC 1M8PA 3OIYA 3TAHA 1W47A 3SJZA 4B2IA 2WJYA 5J5CA 1VECA 3T06B 1Z0FA 4CEHB 4AKHA 2XJ4A 1G8GA 2VSOA 3PITA 2J0SA 4CIDA 4PHTA 3WNCA 4A2QA 1GWNA 1RC8A 3W8NA 3KKPA 2G77B 1E3MA 1YZNA 1NY6A 3FKSA 1M74A 5AWFC 4FN5A 2JJ1D 3EXAA 4HSEA 2V7QA 1XF9A 1YRBA 4O25A 4BFVA 1QVAA 4M1SA 4UJ5A 1UKVY 3DKPA 3B1XA 5GJVC 1E1RA 2IWHA 1ZUIA 2OXRA 1AZTA 5H68A 4RD6A 1DBSA 1L4YA 2QU8A 3TSZA 3I5XA 4D26A 1SGWA 3X2SA 3UWOA 1WCV1 1S3SA 2ZJZA 4C7OA 2GILA 3NC0C 2ATVA 3PUVA 1IY2A 4DLVA 4URUR 2NPFA 3WYAA 1L2TA 1T4GA 1CS4C 2F1HA 3KJGA 3LDAA 3U44B 1XCMA 4LC0A 1CR2A 1P9RA 1ELOA 3KJEA 1XXHB 1YVDA 3CRMA 1N5JA 3VHXA 1W4BA 3A58B 4A36A 1IONA 2PZEA 3GD7A 4Q1FA 3QXJA 1VTKA 4DCTA 2C2HA 5EUMA 1WF3A 2BMEA 2ZRHA 2B6HA 1XEXA 1H8EA 1MO5A 1YR9A 2ZM5A 1XD9A 2QGNA 1BYUA 2XAUA 4C2UA 2KWIA 1E2JA 3KKQA 2BBWA 3JZAA 3VAAA 2UVQA 3C41J 3GJ0A 3U2QA 3QXSA 4G5OA 1NSFA 4Q9IA 4LYHA 3G0HA 2P2LA 1GTVA 1BMFA 3ASYA 5B2ZA 1HH4A 3AKEA 4KBFA 4UNNA 3KB1A 1E79A 2QM7A 2MMCA 3SHWA 3SU8A 3WRXC 2VQSA 2NQ2C 4D80A 1Z6GA 2FH5B 4GPTA 1VIAA 3K0AB 2IBMA 2RHDA 4Q19A 4BRWA 2D3WA 1D9ZA 1T0HB 1ZC3A 4DVGA 2FN4A 2PBRA 1JECA 2IYVA 1P60A 1HA3A 2IL1A 4XVQA 4JBYA 4C0QC 1ZM3A 1KHTA 2X19A 1KK1A 4BFTA 4B6FA 1KSJA 4OHYA 1N2CE 1E1QD 1FX0B 1G7TA 3ZQJA 3K0FB 1KIMA 1NN1A 1XTSA 2V6JA 5FOSA 4CYMA 4BZPA 5BYKA 1ZM2A 3TUJC 2JLUA 4B2LA 2VEDA 2A78A 4M9QA 1LS6A 4EFMA 4Q4HB 3KX2A 1XEWY 3GEHA 2JJ8A 2IS2A 1KAOA 1QG2A 4DT1A 2AX4A 2HCBA 4R71A 3I4LA 4QBFA 1I2DA 5IK2A 3U3OA 2AFHE 2GEUA 1NMZA 1E9DA 1IN7A 3MD0A 2O8BB 3H86A 3MG9A 2NG1A 5AJXA 2XB2A 3EX7C 1U0JA 3D7MA 5KSZA 3R7WB 1ZNYA 1Z8FA 4BECA 1XPUA 4EJSB 2OO7A 1N6KA 2GWHA 2O8DA 3K9HA 4HLCA 2B7BA 1J90A 1JEDA 4OYHA 3K70B 521PA 2IYWA 2WMOB 1R0WA 2J0UB 2H7VA 3F0TA 3W6NA 1A4RA 3TJZA 2ZAMA 1XTRA 2ZSAA 4JLKA 4ASUD 5AUOB 3CO5A 3BBPA 2WWYA 1E4VA 3OEHD 2XSZA 1UBCA 3IBYA 5HCNA 2Q9AA 5CDFE 4MKIA 2YJTD 1UF9A 5KNCA 3U7HB 4ACBA 3RS4A 5TB5A 2GVDC 1KDRA 2ORVA 1GM5A 4D82A 2KBEA 2VP6A 4JLBA 1GDDA 1E2QA 1NI3A 1OFUX 2FPLA 1UAAA 1FP6A 4Q4AA 3TSOA 2AKAB 1S1MA 4NE2A 1NVXQ 3C5HA 3M0EA 1OF1A 4LHZA 2EFDB 1N6LA 2QAGC 4GRAA 5G41A 2JDIA 4Z1MD 2GXAA 5GJCA 2F43B 2NPIA 2PH1A 2ZJOA 3CX6A 2R44A 4UNPA 1II8B 1KMHA 2O8FA 2FPKA 1DARA 1IXZA 2WWGA 3TVTA 5KDLA 5KUTA 2OAP1 2V6IA 4HUQB 1QHSA 1R0YA 1Z6YA 2HCJB 2AKYA 3IEUA 3EWSA 1G6HA 1WBDA 2CBZA 3PUWA 5GJWC 3U3MA 2O8EB 2A9KA 1VDZA 2FX3A 2TMKA 3BGWA 1OH5A 3DVLA 1FNMA 3BWDD 4LOAA 2FFQA 1UDXA 4CRWB 2QMOA 1Z6AA 3TH5A 4ZDKA 2O8DB 2F1JA 2QP3A 3AUYA 4CW7A 5IHPA 4ZKEA 3B78A 1N0WA 2MSEB 5L3RA 3VKWA 2QY9A 4Q21A 2F3RA 3HR8A 5D3MB 3OEEA 1IAQA 2RH5A 1OB2A 1W2HA 2ZROA 1FTNA 4X8OA 4MKFA 3RS5A 1A2BA 1JXMA 4NYMR 1RRFA 2QSZA 2YC4C 5M04A 2WWXA 3T5GA 4YMWA 5EZ5A 4Z8XA 2ZI9A 3WNDA 3ZH9B 2PEZA 4IOKA 2ZRNA 4AIIA 5JWOA 1VCMA 3RC8A 2C96A 4LV5B 2HYIC 5HZKA 1SHKA 3TR5A 2CCKA 3X1WA 3VNVA 4EJSC 2EWWA 2ZSFA 5E3HA 1G3UA 1KNQA 2K5UA 2Q3MA 3DO6A 4QNRA 3CM0A 4V0ME 4QKQA 2IUTA 1XXHE 3UPUA 2ZUCA 4KODA 4ZDWA 1G4AE 3ZLJA 3A4NA 2IX3A 3G5UA 4ACAA 3KL4A 4Y0AA 1E2KA 4MUBA 3VKGA 3BFKA 2CK3A 3GQBA 3GJXC 4EPXA 2FF7A 4O0MA 4Y0VA 5AJWA 2WSSA 2ZJBA 4GZMA 1E96A 3WBJA 4L9SA 1V5WA 5H8WA 1IJEA 2ERYA 3VX4A 3GLGB 1P3JA 2OV2A 4XD7D 3NDBB 5AUNB 2P6UA 1YJ5A 1IXRC 1R2QA 1IN8A 2NO1A 1JALA 3PV0A 3AVPA 2JLZA 1D9XA 1G5TA 3DKVA 5JJIA 4U5XA 2VHJA 3K0AA 3LQQA 4LJ9A 1OXTA 1ZNWA 1E9BA 4QBGB 2F9MA 1XD8A 4LI0A 4PSAA 4C0KA 4RD3A 2FGKA 4LYFA 4Q9HA 2G0NA 4JLPA 2OSBA 4PHFA 5C4GB 4TYNA 3IIMA 1UBEA 2QTFA 3SJBA 1ETUA 2JLRA 4HLDA 5KNBA 1LB1B 1COWA 4Q4AB 2HXSA 1XWIA 3EZ9A 2QMHA 2CXXA 4IOJA 1H8ED 1OIVA 1US8A 3B1ZA 4P3YA 3KJIA 1UEIA 2AK3A 3GJ5A 1LV7A 1RVDA 2B8WA 4NZYA 4BFZA 1P72A 4GDFA 3U6BA 4NHOA 3RANA 4OBEA 4CEJA 3QG1A 3LLMA 5DO9A 1F48A 4QJ5A 2X77A 4ZDJA 3A6PC 5LPNA 4KVAA 3LBNA 4TTQA 1Z0JA 4ON9A 5CYOA 4QGHA 4FXPA 4WXRA 4I81A 2ZI3A 2ZJYA 2REXB 1E1RD 1G41A 4XH9B 2RB4A 5LD2C 4LGMA 1CP2A 1OH6A 2J0VA 4DLSA 1OIWA 1U90A 4C4PA 1CJVC 3AKCA 4DLZA 5F98A 4M1KA 4B32A 5G3YA 1CBUA 2H1LA 3GEIA 4FMCB 3MAAC 5JMTA 3OFNA 4ZI2A 3QJYA 5JZVA 2QPTA 4K8OA 3CNLA 1UDWA 4W5JA 1FTSA 2QA5A 4IEEA 2QRZA 2QSYA 5DHAA 1F6BA 1WXQA 1D5CA 2AWOA 1FUUA 3RRNA 1ZUHA 1HE8B 1T8UA 2BVNA 2P0EA 4ZPXA 4MRSA 3QEJA 2IXFA 4G0NA 3HP1A 3FB4A 4EPYA 1UBGA 1D2NA 4XTRA 2R6GA 1J2JA 1HQCA 4LPSA 2ZIAA 1G5PA 3GJ4A 2BCJQ 2NO6A 3OZXA 4E09A 3PUYA 1G7CA 2OBMA 3B85A 3U3KA 2ZRCA 1WRBA 5GVRA 5IF9A 1IN6A 4MRPA 4XVUA 3ZD6A 1E69A 1JNYA 5FR2A 5JI3E 4RZ2A 4UXHA 1KDOA 2C04A 3BIFA 4R7ZA 4CEIA 1UKEA 2GDJA 4B75A 1IQPA 4LHVA 4NONA 5KOYA 2H5EA 1RE0A 1US8B 4IJMA 4NU0A 4IXNA 2VO1A 2ZJ8A 4JMPA 2YHSA 3GLGA 1XNJA 2R9VA 3P27A 3O8CA 2O52A 2WKQA 2HF9A 2C98A 2WJVA 4IDPA 1N25A 5FPYA 1SKQA 2QMUA 3PG5A 1IJFA 1KGDA 2A2ZA 2GA8A 1L8QA 2CCJA 1YZUA 3UXMA 3IHLA 2V8OA 4LDJA 2CJWA 4BRUA 2ZSEA 4LHYA 1XZQA 3EARA 4F4IA 5FUWA 3RDPA 1DVRA 2FFAA 3DOFA 3F3YA 3SFVA 4AG5A 3LNCA 4F92B 1MABA 2QN6A 2R2AA 1OFHA 5JJLA 4BLRA 3TW4A 4B74A 4KXFB 1Z22A 2LKDA 5KDOA 3K0SA 1Z06A 3CRQA 3Q85A 1G20E 3LWNA 2P6RA 1P73A 5D3QA 3GLFE 2QEQA 3FGNA 2CHVA 3L8YA 2I4IA 5CIQA 3BXZA 3BAFA 4TSFA 4DIDA 3QY0A 4JVMA 4A1FA 1W36C 4M0LA 3U4QB 3CZQA 3MLEA 2D2FA 1GRNA 4TQAA 1NN0A 2ZRMA 1II8A 1NKSA 2XTNA 4HLUC 4QJ4A 1DO0A 2R6FA 1XU4A 4C0SA 2GBLC 2WJGA 5B30A 3OESA 2OFWA 1Q22A 1NMYA 4DLRA 2YWFA 4ARZA 2WV9A 1CRPA 4TLBA 4JJKA 3VU9B 3IEVA 1J99A 3GPLA 4HZUA 1DG3A 1LF0A 4PHGA 2JCSA 3RNLA 5LB4A 4M1MA 1KO7A 4M1WA 1G291 5AR1A 3FKQA 1W7AA 1AIPA 4LBVA 3FFBA 2NIPA 5KU1A 1VYVA 3K8YA 1J8MF 1VG9B 4U00A 1A1VA 1KY2A 3UIEA 1SVIA 3IO3A 4G5GA 1DAEA 1V43A 4M22A 5E7JA 2GNOA 1PUIA 4A6PA 2J59A 1JR3E 1YR7A 1BMFD 4NYMQ 4D2IA 2OCAA 2XGJA 1KJWA 2FMXA 2R62A 1BYIA 2YZ2A 5CIWA 1VHLA 4TLAA 2QQEA 2QQ0A 1NL3A 3B9PA 4DDTA 2CNWA 1P61B 1P5ZB 3W34A 2XEXA 2GXUA 5CYPA 3CWZA 1ANKA 2W6IA 1AM4D 1EG7A 2WPDA 4QHYA 5KPJA 3R9WA 3ZVLA 5FUXA 4RZXA 5HCIA 2IHBA 4HYYA 1NLZA 3LAWA 4PXAA 4MYHA 1EWRA 4Q1DA 3NDPA 2ERXA 1GVNB 3CF6R 1ZU4A 3EZ6A 2QE7D 1CR1A 4X8LA 4BEBA 1Z0KA 1NRJB 2GKSA 1W44A 1P9NA 2QPOA 3FMOB 4HEJA 1G7SA 1XBTA 3QPWA 2W2XA 2ZEJA 2VP5A 3AQ4A 3UATA 2NO7A 5FTJA 1SVLA 2IYXA 1E2NA 3P4XA 4TYWA 2IC5A 4X8HA 3QNUA 4BFXA 1KI6B 2XNDA 4MYUA 5G53C 4IW3B 3QE0A 421PA 5FI1B 3OIVA 1YZKA 4DSTA 1CJKC 3HU3A 1S9HA 1BH2A 3KUCA 4KHZA 4YMTA 1AQUA 5K8LA 2QAJA 4O2LA 5KNDA 5JHGB 3QVVA 5HE8A 3DEFA 4AKEA 5KPDA 2RGAA 3AF3A 4HDCA 2P6NA 2ZR0A 4MGYR 1TF2A 5EJEA 2YWGA 2KE5A 1G21E 2GF0A 2Z4RA 2RHMA 5FPTA 1NBME 3VU9A 4B71A 5L8VA 5FBVB 5KSOA 4QBIA 1X86B 4PPNA 1DOAA 3N5CA 3SHFA 5FPKA 2EFCB 4PPFA 3AGQA 2G0TA 3WMGA 2IK8A 3VHLB 3RRZA 4RKEA 1CXZA 2OLJA 4OK5A 1JQJC 1UM8A 2QAGA 4A0HA 3LW8A 4ERNA 2BV3A 5B58C 5J47A 4Q01A 2RKOA 4PPGA 2ZU0C 1TX4B 2P67A 4DLUA 3RC3A 3EPKA 4LHWA 1KI9A 3TVDA 2D74A 1VIYA 1XB2A 1B0UA 2QT0A 4ZCLA 3NTUA 3ZVRA 2O8FB 2BKEA 1FW6A 3AH8A 1X1SA 2RGCA 2AN9A 1N6PA 3S1AA 3IKJA 1KK3A 1YKSA 4DUGA 1PJRA 1XFAA 3I72A 2QG6A 2OG2A 2O0JA 2XJ9A 3KXIA 1NSTA 2DWQA 1NVUQ 4KFSA 1EESA 4YDHB 4PC7A 4LCBA 4XWAA 4C30A 3W3AA 4TL8A 1OKKD 3W6OA 1IY1A 1YRAA 5JCPA 1GIAA 1D8TA 3H2YA 1KTVA 4DDUA 4OI4A 1RJ9B 4PSKA 3RS0A 4M4SA 2G1JA 3B13B 3SQXA 1S4QA 3HYRA 2GJAA 4TQ9A 3A4MA 4GP6A 3B1WA 1KI4A 2XSZD 3MUFA 3A1UA 2FZ4A 2FSHA 2GBLA 3FPAA 3OHMA 4KJZA 3TNFA 4TQUS 1GL7A 1H65A 1ZYUA 1U9IA 3TQFA 4LJ8A 3CWQA 1S3GA 3GFPA 2ZYUX 4OL0A 4L16A 3QF4B 4ZV4A 5BN3A 2DPXA 2ZRJA 3TGPA 1WP9A 4XSHA 1XCGB 5J40A 2CLDX 2X2FA 4Q9LA 2C77A 3Q5DA 3M1IA 3CLVA 2ZRIA 4Q66C 4RFSB 3RS7A 3SZRA 4TL6A 3CRRA 5BWMA 1S9DA 2VHCA 4EPVA 2J7KA 2A30A 2PEYA 3REFA 4GOKA 5JCZA 3WY9A 3H4MA 2FWRA 4YLGA 1ZIPA 4URXR 1D2EA 4C7OB 2GESA 2GCOB 3H84A 4AKIA 3C16C 1G8FA 4B47A 1E4YA 4I1OA 1T5IA 2MSDB 1NBMD 2BM0A 4KU4A 3LLUA 4TLEA 2IUSA 1HQYE 1L4UA 4LHXA 1R4AA 4MKGA 3KQLA 1MV5A 5CK5A 3VMFA 1TU4A 2J9RA 2ANCA 3WMFA 4QFMA 3U6KA 3P32A 2ZE6A 1ZMXA 3I8XA 3CBQA 4EIWA 3RS2A 2VP2A 1KK0A 2VL7A 3THXA 1WQ1R 2ZPTX 4MKHA 2GXQA 3GLHE 1DO2A 1RW4A 1Q3TA 4QGAA 2V1UA 1A5TA 1ZNZA 1N0UA 4D0NA 1XX6A 4UNQA 5EE0A 3FMPB 2PJRA 2P65A 1FQKA 4RD1A 4BFYA 4QC2A 3D3QA 4RKFA 3ZJYA 5J4HA 1Q0UA 3K53A 2YINC 3HWSA 3KXKA 3V9PA 3NVAA 2BBOA 5KYKA 2H17A 2D06A 4O3MA 1MO6A 2Y8EA 3E1SA 5HTKA 1FZQA 3ADDA 4I4LA 4NKRA 4Q1CA 2RGXA 1KOFA 3ZYCA 2AXNA 3QKTA 2G6BA 3FDIA 4Q48A 4NCIA 1NJGA 2ZQ5A 3MWYW 3NHBA 1NIPA 3QKSB 4M9ZA 1KZGB 1K6MA 2GZAA 4JJZA 4LJ6A 3QKRA 2CEAA 4DCUA 2J1LA 2GCPA 5LBIA 4FD2A 1IBRA 5JBQA 2EVWX 4KLZA 2DBYA 2LCFA 3NIBA 2Q9BA 2ZI6A 4G5QA 1BKDR 1DE0A 1HYQA 3SN6A 4NMMA 3A1WA 3BERA 3EZFA 3FMIA 4F38A 3R20A 2IS6A 3GJ6A 3K9GA 2DR3A 2CMKA 3ASZA 3BB3A 1W36D 2J0QA 1SKYE 1W0JA 5SZJA 3KQUA 3EZ7A 2O8BA 4DBLC 3FFAA 4DHEA 3HPRA 4OQLA 4WZBE 2W0MA 1SXJA 4BGDA 4QGFA 4PC1A 1G6OA 1T0JB 2Z5FA 3W5IA 1T3LA 2FZLA 5HPYB 4U7DA 2G83A 4US0R 3UG7A 3KQNA 4EQ6A 3SJCA 1LW7A 4ESHA 2C99A 2V1XA 5TDHA 1FUKA 4M9SA 2AD1A 4A0RA 4RD2A 1I4DD 1Z83A 2O0HA 4DSOA 4AKGA 2Z83A 1R5OA 3LV8A 3SR0A 1EFTA 4Z1MA 2G88A 1KNXA 3VTKA 5FL7D 2PX0A 1OXUA 3AVOA 5KSPA 5BW8A 4DLTA 4NYIQ 1P2VA 4PAMA 4Q5IA 3AKYA 1R5NA 1Q1QA 4Q4LA 1KY3A 1GRRA 4GL2A 2AHOA 3SJAA 1EFRD 3ZGXA 3FWYA 1G16A 4TT3D 5CJ2A 3IILA 2ZR7A 3R8CA 3ND9A 3SNHA 1EXMA 2WBLC 4A0GA 2VLIA 3MCAA 4KYUA 1QHIA 1T9HA 5ELXA 2PT5A 1KO1A 2G9NA 4JLAA 5IT5A 2XOKD 1F2TA 2X1VA 3P4YA 3SOPA 1J7KA 5FTKA 4PZYA 3B1YA 2I3BA 3E2IA 1ZM4A 3ZQ6A 1MABB 2B8TA 4DLXA 4HZUB 2GJKA 5C2JB 3K0CC 1BIFA 4D4MA 3THYB 1N5IA 4TTRA 3ZZ0A 2LKCA 4PANA 1CIPA 2HT6A 5FL3A 2YOFA 1G64A 2VF8A 3OAAD 4PFSA 3BE4A 2QI9C 2IYQA 4URZR 4MGZR 1VG8A 3CZPA 1KZ7B 4WZ6A 2RGBA 1HE1C 1P75A 4XIGS 3U4QA 1XPOA 5LDDC 4TL7A 5E7IA 3IQXA 3RWMB 1LTQA 2EWVA 4MYCA 1HT1E 3TR0A 5JWRA 2W58A 3GLGE 3MSXA 2NTYC 4OHVA 1Q20A 2R6DA 2QMEA 1P2SA 2HUPA 2JJ2A 3HPQA 1JEEA 3SEAA 3K0EA 4XJXA 2ONJA 2IYUA 1Z2AA 4WXPA 1E2DA 4AYWA 4TZ6A 1DG1G 1N6HA 3TBKA 1R10A 3VR2A 3C8UA 2JGNA 3T34A 4Q4HA 3AP2A 4HAZA 2D4HA 3GEEA 3L0IB 1TEXA 4A2WA 4CGZA 2E1RA 2J0UA 1NY5A 1EFCA 1RRCA 3KKNA 2WICA 3QPUA 2IF2A 4F4CA 2BMJA 1TMKA 3VKHA 3FOZA 4I1UA 4BLTA 1HURA 2WKRA 3H1TA 4QGGA 5EE9A 1S2MA 1PLJA 1ZCAA 2XOKA 3NHAA 4JLOA 4LV6A 4JT2A 2IYLD 1W4RA 1W46A 2WWIA 3R9XA 2FV8A 4HB2A 3PUZA 3DMDA 4A0FA 2ZRKA 3A8TA 1DAHA 3SBEA 4W5WA 1QHYA 4IOMA 4P4TA 1ZCBA 4LJ4A 3CNNA 5AUQA 2ZRLA 5FPSA 1B23P 4OI1A 3A37A 3PR1A 4B34A 3ND8A 1OH7A 1RPZA 1N5LA 3K9NA 4NYIR 1S96A 4EFLA 4TMTA 4NDZA 4LV8B 2WWWA 2XZOA 4WA7A 1Z0AA 1DAGA 1HV8A 1T6NA 2I1VB 2JLXA 2AK2A 3PXGA 3GCGA 5B57C 2ZRGA 2BKUA 3AVWA 1Z63A 1E2PA 1JJVA 4L8GA 1X8KA 1MO3A 3X1YA 2IS4A 3Q9LA 3V4FA 4DCVA 5CDFA 1Q1EA 5BN4A 1F2TB 1GILA 3CW2A 2H92A 1LVGA 5B64A 4R2IA 1NIJA 4A8JA 2DYKA 1U8ZA 3NG1A 1KI8A 3HJNA 2W6JD 2GZDA 3D31A 5CM9C 2GVZC 4Q47A 3SC3A 3L2OB 4HLUA 4CF7A 2BIFA 2KJQA 3LA6A 3R7WA 4TWZA 1E9SA 2A5JA 2GCNA 1ESNA 2R6CA 4QJ3A 4AG6A 4BZQA 1R8QA 1L7VC 3N2IA 1SXJC 4FCVA 2IYZA 3FVQA 2CL7X 1OFIA 1PUJA 4N3NA 4L15A 1ZU5A 3GJ3A 3LXXA 4PC2A 4B43A 4XD7A 4W9MC 2PT7A 4IOLA 1JPNA 1TQ4A 1LFDB 4V0LA 4YXWD 4E22A 3ZVMA 3Q8XB 3T61A 3I8SA 3DOEA 1NVWQ 121PA 1SVSA 4HAXA 3PVSA 3X1DA 4JL5A 1YR8A 5EE1A 1E9RA 3UK6A 2QM8A 2H18A 1UKYA 3LY5A 1NN3A 3BB4A 2B92A 2D62A 1JBKA 5DN6D 2ZUBA 1ZAKA 2IYYA 1KSHA 1DTSA 2Q3FA 4MGKR 1U8AA 3EA0A 5JS8A 2BEKA 2F1RA 4A82A 5EP4A 1S1CA 2VH5R 3QQ5A 3GLIE 1JI0A 3GJ7A 3WRYC 1Z0IA 3GLFB 4HB3A 1P6XA 3GMTA 5BXQC 1I2MA 721PA 5EXPA 4HI0E 4V02A 2ZTSA 1GZSA 5TXGA 2BBSA 4UQOA 1VHTA 2F43A 2ZYTX 2JLYA 2OFXA 4I99A 3OEHA 1TAGA 1JB1A 4JSYA 4NCJA 3T1TA 2OHFA 4B33A 2ANBA 4R2HA 1TQ2A 4UNRA 4DIEA 4PO1A 1PLKA 1EK0A 4D6PA 3FHTA 4QM6A 4UKDA 1X3SA 1HEIA 1FQJA 2QTVB 4IRUB 4AY2A 3NXSA 1W0JD 3AVYA 5A5GA 2V7QD 1JPJA 1AN0A 1UJ2A 2VA8A 4NYJR 1CJMA 4TMZA 1E32A 3EA5A 3NC1C 4R98A 4EPWA 5CLQA 5GVSA 3BOSA 1MRNA 2ZVQX 3T35A 5EE5B 4HB0A 2CHQA 4O2RA 1XTIA 4ZO4A 1G18A 4KV9A 1WB9A 2B7CA 3CNOA 3NH9A 3WYFA 1SVWA 4XOIA 1W49A 2PL3A 3A4LA 2ZJ5A 4HDQB 3FHOA 1QHXA 1OHHA 1OSNA 3KFVA 2JDID 4MGIR 2GZHA 4JVNA 5K8TA 1JR6A 4XWKA 1VCOA 2RGEA 5DLQC 1W0KD 5FPHA 2AFIE 2HF8A 4C0HA 2MMGA 2JEOA 3THWB 4B3DA 1W2GA 3QI2A 2O8EA 1II0A 4NH0A 4NCKA 1GNPA 2J41A 4Z51A 1EGAA 1OHHD 4D4LA 4IXMA 1SZPA 2WJHA 4LWZA 2AWNA 3AUXA 1SULA 1ZUNB 2ASEA 1AS2A 1AQYA 2R8RA 3ADBA 1TUIA 3B9QA 2J7PD 3X1XA 5JSZB 3K0CA 4Q9KA 1G1MA 3FYHA 1U9IC 2ZE5A 2F9LA 4XTCS 4CT5A 3EAQA 4KFUA 5EE3A 1TF7A 4DZZA 4DT1B 3S1AB 1FMJA 2J45A 2VP4A 1GSIA 4C0BA 1XEFA 1E99A 5DYGA 1GKYA 4D0GA 2VF7A 4JZKA 2XX3A 3M4YA 5DNYB 2FDCA 3B8HA 4UNSA 4FI3C 1E2EA 1NF3A 2NGRA 1GL6A 3VFDA 4A92A 2IYSA 4MITA 4XVRA 1N6OA 1E2FA 5FI0B 3RS3A 2DB3A 1OFTA 2O0KA 4QHTA 4G01B 1GRQA 1SHZA 5J4VA 4YONB 2FG5A 3ETLA 3LQRA 4PAOA 4P33A 2VYFA 3SYLA 5L3SA 2ZRAA 4C2TA 1HT2E 2WSMA 5FTLA 4M1TA 2EYQA 1G7RA 2PLRA 1OYYA 4PQRA 1XD2B 3L8ZA 2CCGA 5FTMA 2MSCB 2QE7A 4Q00A 4JVLA 2IW3A 1ZD8A 4NYJQ 5GJBA 3L43A 1E2GA 3TQCA 4MRVA 4QNMA 4D81A 1KDPA 3SBDA 1O87A 1XJQA 2OFOA 4G3XA 3VR3A 2FPMA 2BC9A 2QP9X 5AUPB 2W0SA 2ZU6A 3C5CA 2RGDA 4Q18A 3RRYA 3T5DA 1NNEA 2BCGY 3TLXA 1KJYA 4B2PA 4B3CA 1CTQA 2GJ8A 4TL9A 1DADA 3GP8A 3AVXA 1YZLA 2WAYA 2IEYA 4B76A 4LYJA 2HXYA 4P4SB 1OXVA 3IQWA 4IDHA 2CDNA 2ZYWX 3W90A 3LVQE 3DPUA 3O8DA 1MO4A 2V54A 1KKMA 4P4UA 4F4JA 4US1R 1H8HA 3B5JA 5TMPA 3EWAA 5EQTA 4GOJA 5DI3B 4AK9A 1QG4A 4KFRA 5IK2D 1IN5A 2QBYB 2Z6VA 4U02A 4IDNA 5DSZA 4F7WA 1G3QA 4QG7A 3TUZC 2D7CA 4RJLA 2F3TA 4AYTA 2WPDD 1XPRA 2JLWA 2A5DA 1GFIA 3RSOA 2PX3A 5JS7A 1U81A 4YQFA 2DWPA 2CK3D 1WDTA 1TADA 4DB4A 1JXOA 4JLNA 1T8TA 4ILEA 4UJ3A 2L0XA 1SVMA 2ZJAA 4B3XA 4ZIRB 4OHXA 5JWHA 2WTUA 2FSFA 3ZIAA 4OI2A 1NKTA 1TPZA 3C4JA 3UMFA 4GT1A 2UZ3A 3PIRA 4AD8A 4HUTA 4N0EA 4PC6A 4BE7B 2YYZA 2O8CA 1U94A 4ZCIA 1AZSC 1NVVR 2P5TB 4NPHA 5DH9A 3RRMA 2W6JA 1ZINA 3NBXX 3O47A 2EFGA 4FMDF 2RCNA 3B1VA 3VR5A 4M9XA 3KB2A 221PA 4CDGA 4A15A 3DDCA 3QIAA 3EPJA 4TMVA 3U7EB 3UWKA 2WKPA 3Q72A 4KCGA 4AI6A 2BOVA 5A4JA 4H1UA 4JYCA 1IXSB 2FGJA 3SFZA 4RVCA 2WWFA 4D4JA 4Q7KA 1W5TA 3A36A 4PZLA 1F2UA 1EFRA 2VP0A 3TKLA 2WJIA 2DFLA 4DEYA
chains in the Genus database with same CATH superfamily
1HNZB 3ECCA 5DTMA 5CEFA 2FWBA 1JX6A 5L3VA 1NYLA 2HRQA 1JKXA 3NOVA 3IH5A 1DJLA 3IX7A 4HXEB 2JGAA 2ZJ1A 5F9HA 4HDNB 1SU6A 1ZVQA 1OVGA 1V41E 2WZBA 3ZLVA 2OSVA 3BQNB 5JEEA 4MRMB 3WGYA 1JFTA 3EFEA 4IQFA 5I3ZA 2QBYA 2EDAA 4PFQA 1ZJ6A 3WL6A 1CD5A 4OLBA 2W4MA 3AB8A 4DIMA 3O21A 1N7GA 3A04A 3NUZA 1K6IA 4BMVA 1ZEJA 3U4CA 1KVRA 1Z12A 2AR7A 3HE3A 2OECA 4R81A 2ZREA 3TMKA 4EI7A 2CVOA 3H13A 1IFXA 1UT6A 1WMSA 2R751 3FTQA 3K7EA 1B42A 1HKHA 2YFKA 4HADA 4IVQA 2JARA 2NT4A 4LSGA 5ERYA 5I7AA 4FKMA 3RVQA 4DV5B 3DM5A 3FDJA 4V39A 2H7CA 3T15A 2YCBA 5HR5A 5FH9A 1GQSA 3ENVA 3UJCA 3GR6A 4G1EB 3KOXA 1E7RA 2O5RA 4D45A 4TTSA 1FC0A 5DLYA 2VP9A 2QPAA 4G9EA 4XUDA 3RKSA 1N2IA 2P62A 4N5NA 3QSYA 2JGDB 2P9GA 1Q3KA 1X3LA 4K2HA 2WWHA 3M1YA 1RBYA 4MNTA 3GMDA 1ZD9A 5EP1A 5SY4A 1Z5GA 1AGNA 1MOQA 1FS6A 1KEVA 2ZYAA 4ZRNA 2FEWB 2QL5A 1LC3A 1RC1A 2R8ZA 4YY3B 4I36A 1GA4A 1WNTA 2QD2A 2RSLA 4K86A 5F9MA 5TGDA 4AB1A 2F55A 3WRVA 1HFKA 2DQKA 2H2GA 4ZOLB 4CDRA 1WL8A 2QROA 1RYBA 2VZLA 1KZ9A 3DAHA 4UM9D 2HMWA 5ALFA 4BNDB 3CNBA 1B76A 2O50A 3ZTTA 4LXTA 1YA4A 4L72A 2FSUA 2OHHA 4EG4A 4FGZA 1I4EB 4HQRA 4WK6A 4AZ0B 4WXHA 5TQ2A 5CURA 1U7DA 5C46F 3R8FA 5G0SA 1UBTS 1O94C 3HCPA 3AXTA 3CTMA 2BWJA 3ROXA 2I7DA 3LO8A 1EG2A 4PS1A 3TRJA 4OXXA 4X1KA 4DLWA 3QVSA 4JV5B 3A3PA 3FKJA 3S28A 2BUAA 4EGSA 3AJ8A 4PZCA 2ZP1A 1MB3A 4FYXA 1UXGA 3BMOB 4QRHA 1WULS 4Q1BA 3TD9A 16PKA 3LHDA 3S27A 1XHEA 4DL9A 2JFWA 2ZSUA 4M0CA 3A25A 1JKIA 1DAFA 3QY9A 3DF7A 4KO8A 2P6PA 3PFIA 2TYSB 4RVHA 2OEPA 2IPLA 2XNKA 4MUAA 4Q7QA 5LU8A 3U44A 2A9RA 2NTJA 3VOSA 4F93B 2QP4A 3V42A 2A14A 2FPRA 3VNQA 3DMNA 2PX5A 1QC5B 1E79D 3OFJA 4A27A 5IKXA 5GADl 1LDMA 2HLDD 2IE0A 1SBQA 5BWBA 4AMBA 1KC3A 4FINA 1U28C 3NYQA 3UMRA 1XEXB 3V00A 5A4KA 4EY7A 4WCFA 1FL9A 1L9XA 1C3EA 2QTCA 4LQLA 1KORA 2Q7DA 4OSPA 4JL6A 3VR2D 1EGMB 3KCNA 4JSRA 3FDXA 3TG8A 1OBCA 4KWIA 3GH1A 4O4LB 1M2OB 2XB4A 3KKMA 3NIWA 4JU9A 4IIBA 4OP2A 4B4OA 2I29A 2FZCA 4L4UA 3V8EA 2NLOA 4RL4A 4URYR 4PCLA 3QXXA 5LA6A 4LY6A 1O95A 1KBZA 2JKZA 4QL3A 3FRJA 5B36A 4KR2A 4WLOA 2FTKE 4Q7LA 4W9RA 1GLNA 4YAGA 3EEFA 3AF1A 4MV9A 5JZSA 2AFIA 2PWAA 2XDYA 1U8CB 2EQBA 2A0XA 2GEBA 4EFNA 2YWHA 3ST7A 1HY3A 2WKSA 4ZT4A 2X0DA 3L1IA 2ZBUA 4ZVVA 2XYVA 3W5BA 3QNWA 3AHFA 2H0RA 4W63A 5L3ZA 3U80A 2YJ5A 5FLEX 3W1WA 1E0KA 1KAQA 2Q0XA 3GLQA 3MPOA 4MR7B 3VVCA 2X5XA 5ITSA 4B6OA 4H1HA 3UWDA 3ZWNA 1S01A 2HXGA 4MW0A 3GRPA 3GROA 3HVHA 2FMFA 2GWRA 3JRNA 3WO1A 3ZNQA 2J4CA 1U1EA 2W6ID 1Z73A 1K8YB 1AK9A 5EP3A 1EHCA 3NWBA 4L3OA 3SM9A 3TSWA 1BVHA 4V1CB 3UZUA 1IU9A 1PFYA 2R8PA 5JXIA 3EXIB 3TRKA 1YL5A 2C83A 3DXYA 4C43A 2Z1DA 2K2QB 5ALLA 3UV6A 5JROA 4A7PA 1E98A 1HE3A 4FC6A 4L57A 3EGVA 1XCOA 3A31A 3RF6A 3IAS6 2P79A 3MJTA 3DL7A 1ODLA 3BILA 3HDVA 1YMUA 4CCYB 4OMFG 2OCBA 5KTKA 1UJCA 3RBXA 2QW0X 3GLVA 2ODQA 3RWBA 4HAIA 1PG2A 3CR7A 1U8YA 1OTXA 2PBZA 1J8VA 1K75A 1R15A 1JDZA 4LRSB 5DBOA 5G0VA 2WIGA 4WRRA 1B93A 4WKGA 5EYPA 1Z62A 1QORA 2RAFA 1SA0B 2NSYA 3G1WA 5FNVA 4NV3A 1FB5A 2L19A 5EIBC 2BMVA 3JTEA 3PCXA 4EJSA 3CWCA 4H4EA 3H2GA 4LSMA 1I51A 1QGED 2YY6A 3HB4X 2FEOA 3G1TA 3L0SA 4UD6A 1M5UA 4RNDB 5FNVF 3AZPA 3PHIA 4B80A 4BNLA 2JJ2D 4CM1A 3H2KA 3L0OA 3RJMA 2B37A 2C20A 4MV3A 4Z0TA 3BRQA 1NZFA 2XA1A 3IGFA 5LYJF 2XE7A 1C30B 3JATB 4PSDA 2OBNA 2WM2A 4QELA 2RGNC 1THZA 4WFIA 3TINA 3TM5A 3QKRB 4ENVA 1VZ3A 1LEHA 2B3DA 3HA5A 1T8RA 2YV3A 1KMHB 1QRDA 1KQOA 4D4IA 1VE3A 2OILA 5I9MA 1M7BA 1Y82A 4ZYWA 2XV1A 4FOOA 3H1AA 3DZKA 3DF9A 5L7YA 4UTVA 1LPOA 4RA9A 3KB6A 3TOCA 3D4PA 5C8YA 2VPTA 5EJGA 4A0RA 1XMVA 4PNZA 2OHGA 4I2NA 2ZS7A 3BEDA 4YPVA 6ABPA 2BFFA 4M9CA 2WU0A 1SUDA 2FUCA 3O1LA 4JITA 5FOVA 4E5UA 1KZ1A 4NCAA 3AUFA 4OHBA 2ACVA 5DIFA 3N6RA 1RYDA 4X85A 4HFMA 3IUSA 4P4SA 3JALB 3OF2A 5FUBA 4PG4A 2W2PA 3IULA 3VVBA 1N5KA 2DH5A 2P1RA 2R3SA 2I4OA 2IUEA 3RC2A 1H1LB 3HKDA 3ODGA 5BT8A 2GLXA 3U1TA 2GBPA 3AUUA 5IJ9A 1ZPDA 1A04A 2VHXA 4CIBA 1TCVA 2I8LA 4JOBA 4AMGA 2ZBDA 3CZ9A 1W4CA 4KMMA 1JRLA 1NVVQ 3P9CA 3IMFA 4I4TB 1QMGA 5GOTA 4RJKA 3C7CB 1G3MA 3FPCA 2CLSA 4Q1AA 4Y67A 4EVRA 2VAXA 3VQTA 3UMYA 2GN6A 4Q03A 4BQQA 2XRMA 2BELA 2R65A 2Z4SA 3PENA 1P1HA 1A76A 3IHWA 3AOEA 5L3QA 3EMKA 1A8UA 1A9XB 4HRAA 3SX0A 1ZXBA 2WTBA 4DQ0A 3FB1A 4BNTA 1WY7A 3ELDA 3QP9A 1BO6A 4IFIA 3AWDA 3RC1A 4DG5A 3T3NA 4RZUA 4NFYA 4K7JA 3CHYA 4NMXB 1GAXA 1XZNA 2CXNA 1Q0TA 2FOIA 2F3PA 3MRXA 1N1EA 1RI3A 3OJCA 4J49A 2F1OA 4RJIA 3VC2A 2XNCA 1Y6FA 2YMMA 1ZESA 2V3WA 3GZJA 2J3KA 3TQOA 2VUHB 3V7FA 3F3SA 2ZB2A 1KY5A 2OWDA 1I9GA 2G9RA 3CX7A 4P38A 3WI7A 3ICQB 2HLDA 2XLCA 5GGXA 1M34E 2AOUA 2CNWD 3C6YA 3N8DA 3TBFA 4JLUA 5C4MA 3JQ8B 2KSQA 2OFFA 4P1ZA 2YOGA 1ZBDA 3I0MA 5EMLA 1NAIA 1M7HA 3INTA 3UG6A 3VV3A 1OLOA 3C1TA 2W6QA 1JHQA 3QFRA 1ZD1A 2H1FA 2QL6A 3B2EA 2PQ0A 4MS4A 5EXSA 5F7XA 4PS0A 4HDRB 1R7RA 2WEKA 2JJ1A 4YJ3B 1E5DA 4BWYA 4PZDA 4IDBA 1GPAA 5EKSA 2VSQA 4WEOA 3RYTC 3ZY6A 5DM0A 2H3EA 1MRZA 2PZBA 3QHPA 1XVIA 1W9MA 4OB7A 2O5VA 1BWRA 1XKTA 1ZOPA 3O4JA 1KDTA 2J07A 4LDAA 4LRWA 3UGQA 3TKYA 3MYYA 2YWEA 2IODA 3OQVA 4HY3A 5G4KB 5K2OA 1FDIA 4P3PA 4X95A 3O8OA 2HM7A 4TXHA 4DXAA 3VJRA 1E2MA 1EAYA 2LVBA 3CH5A 4BASA 3UUGA 3FOFC 4QU5A 3O5AA 4F85A 1Q0LA 3PE3A 4OJQA 1CR6A 2CXOA 2GAIA 3GLHA 3HG7A 1GGJA 4E6EA 3I6YA 2F3QA 5T41A 5C8YF 5LL6P 1CRQA 1X7XA 1SKBA 1YL6A 4J0DA 4PR0A 2J7PA 3A6JA 2J67A 2GPYA 4UARA 3S2ZA 4B3JA 2UXDB 2PXHA 3E5RA 2CFOA 2VUTA 4WBNB 1EUDB 1Y8RA 3V55A 1XMSA 3RTDA 2BHLA 1NJ2A 4KB5A 4AJ4A 2KYRA 3AG6A 4ZD6A 4J0GA 4UU8A 5FAXA 4JYZA 1CC1S 2NU7B 2PX6A 4TXJA 2FQ1A 3AETA 2PX4A 3CA8A 2VDNB 5TV2A 3V1KA 4N40A 4PG8A 2CKMA 1V5EA 2WJJA 3KJHA 3V1TC 1P44A 1R0XA 2HHHB 3OAAA 5KSYA 2HHLA 4YVFA 1MD9A 5AKLA 4POAA 2DECA 3G5TA 4RFSA 3GAFA 4XQ0A 3QIVA 3LXRA 4GKKB 3HSKA 1ZMTA 3UEOA 1PHPA 2PMFA 3AY6A 4JA0A 5IAGA 1GRCA 5LZ2A 4CCAA 4RNCA 4IIJF 1IMJA 5EN4A 1UBFA 1ZC4A 2AFHB 3WBKA 4RVUA 3QEOA 5CM8B 1Y80A 3RIMA 4DEXA 1FFYA 4N1AA 1P9OA 1VPEA 1VGQA 5F64A 3TTWA 5JQGB 1W4ZA 4QPZA 1PCXA 2PX8A 4FPXA 4I5DA 3O84A 3TD6A 4M83A 3AEYA 2GNPA 4IHJA 1KETA 2VWPA 1ORTA 2QUBA 5KDDA 2VUSA 2A5YB 2DTDA 1KPHA 3STWA 4UUNA 2R6ZA 4M6WB 2PVSA 4FBLA 1WQ4A 4N3AA 5TIIA 2Q4TA 4JOCA 3HSSA 1DU4A 1RHJA 2VJMB 5B1EA 2ZATA 1YIOA 4PFJA 3KFXA 4YI3A 4ZREA 1XTUA 4L50A 2B69A 5IJ9B 3JARB 1XCBA 2O3UA 2JEYA 1ADFA 4RFLA 3L79A 1CKEA 1OWMA 3G17A 1J70A 2Y9PB 3B1KA 3JQBC 1ZW1A 4WZAA 2M98A 4JLJA 5JHHB 5K8JB 4MUNA 4K3UA 4GQIA 4L9WA 4WEQA 5F9FA 4IDOA 1L5VA 1KSFX 1VYTA 2JAUA 2JGRA 2JVJA 3FWKA 3HCWA 3GZNA 3L1KA 3UMSA 3A6HA 2GF9A 1QCCA 2PH7A 2BR5A 2KB0A 2PZGA 3GZTB 3A14A 1V8DA 4EHBA 2XXAA 1VL6A 4PAQA 4HDKB 3GMSA 3B6IA 5AMXA 3OJ0A 2EFJA 3ME5A 3G8DA 2X4IA 3RHZA 3OKPA 1ODTC 3K5WA 1PGJA 1G17A 4OQMA 2PLFA 2VDQB 5K01A 4TV9F 1VIVA 1KJZA 2D8AA 2JA1A 2ZIZA 3N7AA 3Q8WA 3V8RA 2QN7A 3A9CA 4E5KA 5K3FB 3CZMA 4ZEVA 3L06A 3L0YA 2IYTA 1KO8A 3OZSA 3PDHA 1MC1A 4TMKA 2RHGB 4GMDA 3K1AA 4K81B 3VPHA 1ODFA 3W2EA 1A97A 1EGVB 1MXFA 1XG5A 4OP1A 3ER6A 1XAIA 4IGIA 2LWIA 3HXOA 1QDUA 2KS6A 4XWTA 1KYXA 2HIAA 5ALKA 1DWUA 4RTMA 2BZGA 2QORA 1Q50A 2AE1A 2DLNA 2NOAA 5FULA 3ZY5A 5TVKA 4AULA 2EZ9A 3O6VA 2R1TA 4PZUA 5F12A 1ETHA 5IXSA 1QGZA 3N0TA 1HX7A 2WAXA 1XKLA 5FBRB 2DXIA 3B1JA 4KSBA 1Z5ZA 3G0IA 3WA6A 4N7RA 2AV6A 3G2JA 3PUXA 4ZCQA 5KVCA 4UFNA 3I39X 2HTFA 4PW0A 3ZGVA 1UPCA 1QONA 2C82A 1YNSA 4RD4A 1LJLA 5JYBA 1JH9A 3K6SA 3G2QA 1RLOA 1SQ5A 1C7FA 4EHDA 1OYWA 3DMHA 3L4KA 4FS8A 2JRLA 1AUXA 4UBJA 4CM6A 4KIWA 3DM9B 1KRHA 1YASA 1FFHA 1N5RA 1JPUA 2I87A 3EG9A 3R3YA 3WADA 3FRHA 2Q0HA 2QJOA 3TEMA 3V2IA 4R16A 4CHTA 1T3GA 2XRFA 4EUHA 1YUBA 3KTFA 5YASA 2JAOA 2OXTA 2CY0A 3QEAZ 3CPJB 4JS0A 4Q3OA 2MHCA 3EZLA 1YB6A 1B6GA 3BWEA 2FPPB 1EWVA 4M21A 2FP3A 1AB5A 3Q3JB 1JXQA 1N6NA 4L4ZA 4QXQA 3RVMA 2RH4A 2JI8A 1PV2A 3HYLA 5EWJA 4ZEXA 2YV5A 4TN1A 4QO8A 3IPYA 2YKGA 3U5TA 2QN2A 5LQUA 1QTQA 2O3RA 5HZHA 4U7HA 1KOGA 2ECFA 5JC1A 1YS6A 2J8ZA 3KYDA 4AURA 2ZVPX 1MEOA 5C7LO 1B26A 3CLKA 2C0QA 2D8MA 3R1IA 4GICA 3UANA 1FRNA 1ODSA 2Y77A 3K16A 3C3BA 2YN0A 1RRMA 1XTQA 1X94A 3AGPA 2JIQA 1ML3A 3DT9A 2AEEA 1YONA 1B2RA 3RVBA 3NJ4A 2JK0A 1FFBA 1C8LA 4B4UA 1ZD2P 3IELA 2QLTA 2D2EA 5C8VA 3NBFA 4JY7A 1RRPA 1ZD5A 2Q6TA 4B3GA 1CLUA 2DR0A 3LA8A 2R4QA 4TKZA 2XRZA 2IHYA 3W5CA 3AU8A 2QZPA 1KO4A 3CG0A 4P22A 3TOXA 4PLPA 3CUYA 3UENA 2G3YA 4WGGA 2Q2QA 2ZSDA 5B7QA 4GVLA 1DPFA 3IMGA 5LLTA 3I01M 4NNJA 3T1VA 4O1HA 2WIBA 2UZ1B 3OOWA 4ITRC 3UCFA 4FHFA 3VC7A 4BPRA 1ZIOA 1MIOA 2W2LA 3OX4A 3ETDA 2O2EA 5LP6A 3W9SA 4IXWA 4FIDA 1M2NA 3BCSA 1DEKA 3PIDA 1OT5A 2QT9A 4OB8A 1G42A 1L7BA 1C4OA 3V34A 2JANA 3BMQA 3E3MA 5DNWA 3WL7A 4AT1A 4ZI7A 5FBLB 5LP6F 4DNPA 2IEGA 2TMYA 2QRNA 3N8KA 2NNLD 2PKWA 2YNMA 1Q0ZA 3KSUA 1H0SA 1I8TA 1CWUA 3ANNA 4RKWA 3MGCA 5ALWA 3UWMA 5JJ5A 5K8CA 2I71A 2PXCA 2JAQA 3ZKWA 4KI0A 1Y7HA 5IJ0A 3OQ6A 4RH1A 3TXXA 1V71A 3GLRA 2WC1A 4NBWA 1YR6A 5G2OA 3N2KA 5EXDA 1DRWA 3SKYA 1MHPA 2ZKIA 3DZDA 3GN1A 3GRRA 3TK1A 4F9FA 2ORWA 4Z7NB 2XYRA 4PLWA 4WH0A 1QH1A 2ZXEA 3NWOA 4PTZA 3KEFA 1YKFA 4LE0A 1LBIA 4R1LA 1BOFA 4MWZA 2BE7A 2V9PA 2HNAA 3IIEA 3ZI7A 1YE5A 4AYXA 4MI6A 1HNWB 2XZPA 5IKEA 1NYRA 3ONNA 1XZFA 2Q5CA 3MJFA 3X1ZA 4D8TA 1Z4OA 3QF7A 3INYA 2C03A 3P45A 4YH1A 5JRJA 2OR3A 3BHMA 4CKXA 2AT1A 4FUTA 2CBGA 3MF4A 1NW9B 3R3VA 5AXDA 4YCCA 1QGOA 4FNOA 5DYIA 1L7OA 4HHEA 5CDYA 1M2FA 5A9RA 2QR3A 3QFFA 3PZRA 3EW9A 5BWLA 5CB6A 2QD5A 4BZZA 4GOOD 3GUVA 2OCPA 4EW3A 3OEED 2ZB4A 3C5WP 3ELUA 4JBXA 1VGRA 2RAUA 4NZ9A 4WY8A 3KBOA 1JU3A 1EUCB 2P3SA 2V7XA 3GNQA 2NV2B 2VRCA 5JAHA 3NBZC 3S55A 1SCUA 1A9RA 1CUCA 2GJ4A 5TARA 1XU9A 5TQJA 4CL2A 3ICEA 2G17A 3Q12A 4KVZA 1AF4A 1GNRA 4DR7B 2DPLA 1XXHA 4J2OA 3PPIA 5ENDA 2OZPA 2J46A 2QNRA 3KYCB 3LNTA 3NZEA 2O0LA 1OV4A 4G24A 4LC1A 4Y2YA 3SI7A 4F97A 1GG5A 1NU6A 3PXXA 4JOQA 3KEQA 1AURA 1WUKS 3PQ7A 3JWGA 3NAZA 4RFVA 4V0OA 4F6RA 1H2XA 4QTUB 3LPAA 7REQB 5HYVA 1U7PA 2QTHA 4W4TA 1C9EA 3A1SA 2X76A 1GN9A 1UBHS 4HQ0A 2I65A 3SFTA 1QV7A 1PD0A 1SXGA 4XJTA 1VMKA 2A1UB 4MDFA 4JJ7A 1VPLA 1UDAA 2HMYB 3WJ2A 3ZBQA 2C8JA 3ZU3A 4E3WA 2CUZA 3FVVA 3H9EO 2AJBA 2WOOA 3OLVA 3I2KA 5KO2A 2QMQA 3F5DA 2PHZA 5KS2A 4HGZA 3UPDA 1YRWA 4BL5A 3EGDA 4QE3A 1Y3AA 2V7PA 3P9PA 2G4VA 3F73A 2OGSA 3AVQA 3CW8X 3EVCA 3KV1A 2G1KA 3E27A 4ZVKA 2QRKA 2VYCA 3C7AA 3S8MA 3W3ZB 1VSUA 4DTCA 4AC9A 2PGOA 3RIGA 1K4KA 3BMNB 3JQGB 2HL6A 4B45A 4CTOA 1M33A 4LUCA 1KFKB 1N32B 4YHHB 1GV1A 3OQHA 1PW7A 2HMSA 1N3LA 3EMBA 3Q2OA 4ENQA 4A1OA 4JBNA 1YVUA 2Y68A 1FFSA 3BCUA 2AJTA 1DXYA 1QPZA 4AN0A 4K0KB 4JGBA 4HAUA 3OHSX 1ZNQO 3NT5A 1AS3A 1J1IA 4KPUB 5IUNC 1PZMA 2WVJA 3HFSA 3EDRA 3NTQA 2ERCA 1E3WA 1ZI9A 3OJFA 1DC6A 4M36A 3WLTA 4NBSA 3L7MA 4GVPA 4PSUA 3RS9A 2F8SA 1ZAYA 5KB3A 2NZWA 2Z98A 3A9TA 2BDTA 4QTYA 4WY2A 1QF9A 1T1GA 1T2EA 1JHZA 2GF2A 1O9BA 3CLTC 4FSHA 3EPHA 1PR2A 4ND7A 5DHFA 1XD2A 3S99A 3ZD9A 5A7FA 1M34A 4LK2A 3WL8A 1GP2A 2AMVA 5IYZB 2FFJA 3C14C 4BGEA 4Z7OB 5JUWA 5IC5A 3H2BA 3S0JA 1H4VB 1XMJA 2H06A 4JT8A 5AK5A 3RTCA 5FR1A 1NG1A 3T1YB 1V4BA 4JT4A 2H4YA 1Q1GA 4NOKA 4W5HA 3ZZMA 4EDHA 5BV2P 2WIAA 3H0CA 2QDKA 5G40A 4EOGA 2BEWA 1DJNA 3LUHA 4WPGA 4C0LA 3GLIA 1F3LA 1XQ9A 4AUEA 3T41A 4F91B 2G5PA 2XPCA 3DNMA 3R8XA 2IU0A 4IDQA 1MRSA 2JLBA 4C3VA 3KTAA 1IG3A 2AMFA 2C4TA 1AUVA 1E1NA 2P4UA 3U7GA 1IBMB 2HU7A 2ORIA 4AWBA 4W8HA 1KARA 1MO2A 3E5MA 4K6HA 2D5CA 4QOFA 2VF2A 3HCAA 2W42A 3EIFA 3BXFA 2GEKA 4MLDA 1HFWA 3GFRA 3IKMB 4R01A 4R7GA 4ESOA 2Y1XA 3OLXA 3PVZA 3ZDQA 1YOVB 3WAJA 3WB1A 4YUZA 2GRJA 3A28A 3KT6A 4JDPA 5JQGF 4AF8A 1DS6A 1NBIA 4HG2A 1QRUA 5BR1A 2XDQA 1X80B 1SOMA 3KTOA 1I3KA 3O3MB 2XYQA 3N5KA 4XOUA 3CIFA 3ZGLA 4J2HA 5B53A 8OHMA 2ZYGA 1CU1A 1WMEA 4ETWA 2M1XA 4AY5A 4DC0A 3OEWA 4L9AA 2HV9A 1WCYA 3LWDA 3G13A 2FP4B 5CT8A 3MTIA 4DV3B 2VUIB 2JIDA 1YCDA 4FEGA 1QSGA 5DM2A 2WM3A 3KPVA 4MA4A 1SHJA 2QZ4A 3UV7A 2XQFA 2HNBA 1R4NA 4G0QA 2FU5C 1ZRHA 3RRJA 3IS3A 4UXJA 4PO8A 1BW9A 2O2GA 1DP4A 4G8CA 1W1WA 4QYSA 1EE2A 4LC9A 3VYTB 4OGFA 2J3LA 2C2OA 5BYJA 1FMLA 1SJ9A 1IPHA 1N0VC 3F9CA 3HACA 3K8ZA 5DTIA 3TAHA 2XUGA 2ZIWB 4BCCA 3TZCA 4NU6A 2BGRA 4BIMA 3PPVA 2C42A 2VSOA 1WPGA 3MT7A 3IP8A 3QX8A 1RC8A 1KEPA 5TT0A 4UZEA 3S5UA 1C7JA 3A6KA 3KOZA 3GVHA 1ACLA 2W6CX 1DDOA 1PFKA 3P52A 1IBLB 5T3YA 4FEEA 1ENOA 2XNJA 4FN5A 3SX4A 3UHOA 1UJBA 3OZTA 4S1PA 2QVXX 1YRBA 2BEWB 4L8FA 4INZA 5CCXA 5B3LA 4UQPA 4M1SA 3OZCA 1YK0A 3ZCUA 4MQ4A 2XUQA 3PGKA 2E1PA 4EF5A 1H1TA 3B1XA 4L27A 3U40A 1GNVA 1XWWA 2OXRA 4G1MB 1MTZA 3FSRA 3U0VA 4DE5A 3LRXA 2QU8A 1NLMA 1SBHA 2Y1GA 2JA2A 1BXGA 5HIAA 3I5XA 4ZVPA 5FV7A 1M9NA 1RXWA 2I99A 1WCV1 1PZHA 3EGOA 4LX8A 2HJWA 3A2MA 2GILA 4UVDA 2Q1SA 3NC0C 2ATVA 1XN1A 1JJAA 4URUR 2NPFA 4MAMA 3N2GA 4N9WA 2NX2A 4JR1A 5AYVA 2F1HA 4LMPA 4HP8A 3EQ9A 5EIEA 2XE4A 5I3CA 4J4BA 3KSMA 1KOLA 1WMBA 1N5JA 3CRMA 3VHXA 3PX3A 3LC2O 5DHUA 1U2QA 1W4BA 1E5TA 1U1CA 3A58B 3GFFA 1K1EA 3KZMA 4KC0A 4Q1FA 5F21A 2ZOSA 4ZOLA 2PUDA 4IJUA 3ELWA 4IEFB 3RHSA 1ZGZA 3Q3EA 3OM9A 1AY0A 1YR9A 4LQ4A 1KDVA 1K08A 2EIXA 5HILA 3DWIA 3DHVA 1T6BY 2QB5A 3OWOA 3ADOA 1OAOC 3EZGA 2JK1A 3L77A 3MRVA 4M0EA 3RC7A 2R60A 5CXXA 4CNQA 3ASYA 3UJDA 5B2ZA 1TYCA 2W8ZA 1VDMA 3WC4A 1MG5A 1E79A 2A59A 3G7UA 3SHWA 5CBPB 5DM70 2NQ2C 4GPTA 3OLCX 4H27A 2IBMA 3MNFA 3OX1A 4Q19A 5EIBD 3WLEA 1KIFA 2D3WA 4M8SA 3FTPA 3OLWA 3N0VA 5AI4A 3G9UA 4JZYA 2Z6QA 1UXKA 4Z9YA 3CUWA 1Z3CA 3QPBA 4GXNA 4Y2UA 2VNSA 1NULA 3D3EA 1A9PA 1JI3A 1Q95A 3L7JA 4QDTA 4XVQA 2PKYX 5KREA 4JBYA 4Z4FA 1QTIA 4NZMA 2RHHA 4XCVA 4OMDA 3R5HA 2X19A 3EYAA 3WQBA 4B6FA 4MWTA 2EZUA 1E1QD 1G7TA 2GN0A 1QP8A 3PYMA 4WERA 3ZJVA 3V80A 2JFFA 5FOSA 4MW6A 3T7RA 3EXG2 1X0VA 1ZM2A 3TUJC 4J0HA 2SICE 3T7DA 4B2LA 4JJFA 2CFTA 3KKKA 4M9QA 3WLKX 5KTRA 4NZOA 1KP2A 2GNAA 3HGTA 4TMFA 4BX2A 3KX2A 5BV7A 3GEHA 2CLMB 1IEQA 2IS2A 2B4YA 2WP0A 2DPHA 2AX4A 3C8HA 4QOIA 3T0FA 1G9SA 4DCGA 4QBFA 1MOPA 3E22A 1QFYA 4LXQA 4RETA 4L7VA 4YP0A 2AFHE 5IK2A 3U3OA 3H11B 5CW1A 1QDLB 1XFDA 4JODA 1A5SB 1OZAA 5EJ9A 2O8EB 1A8SA 4GHWA 3IE1A 4F2PA 4KBYA 5LM3A 3OKAA 5ICEA 4W5OA 2O8BB 3EXEA 4HQNA 5AJXA 1KVTA 4O2AA 3HGQA 1F5SA 2JFBA 1USKA 1TKRA 2BKAA 4BATA 5KWJA 3U9TA 1YGYA 4EJSB 4MA0A 4AO8A 9ATCA 2O8DA 2B7BA 2VG8A 1E1LA 1LSJA 4YT5A 4B46A 4BU0A 4OYHA 4A8HA 4WBNF 4Q3NA 521PA 1DIOB 2J6BA 4MWSA 1P19A 5K3FA 1IIBA 1CQIA 2B1RA 2NSDA 1QOZA 2WD7A 4K9PA 1ABBA 2R87A 5DHQA 3QWIA 4PGFA 4ASUD 5AUOB 3CO5A 3BBPA 4KXWA 2J9ZB 2WAAA 1E4VA 1JFSA 3IQFA 4H3VA 1XZDA 2M6KA 2XMGA 2HSEA 1UIRA 5HKLA 1KVQA 1T43A 5FNZA 5B4UA 5D3ZA 3IBYA 5D85A 4E5DA 2EG5A 4GP9A 3CKYA 2JKYA 4P82A 1UF9A 1IHYA 4LG1A 2BKXA 4Q3KA 4ACBA 3OD1A 4BKRA 4KUEA 4C4RA 2PUFA 1K89A 4HH4A 1GM5A 2ARKA 2CJYA 1KKUA 5KQRA 2ZQYA 3UJPA 5LJLA 1HNNA 1BH6A 1KYWA 1LVUA 3DAYA 2WF6A 1BE6A 4EO4A 2R7MA 1MX5A 1V26A 1UAAA 3TSOA 2O6HA 4NE2A 1NVXQ 2KLBA 3A6FA 3BGOS 2FWAA 2VDUE 1YJCA 2HU5A 3C5HA 3HWRA 1IBCA 4KR6A 4WA8A 4YJ3F 1NHWA 3AFOA 2QAGC 4GRAA 1WWKA 1YT5A 4OQYA 4FYJA 4OH1A 3EODA 5G41A 4AECA 5KIAA 5MN6A 5B58T 4MVJE 1WCIB 1TK3A 1K7XB 3AM5A 2PR2A 3KLMX 2XT6A 2CMHA 2H52A 3Q6IA 1DARA 4GSKA 5JNUA 5KDLA 3TSAA 2Y0DA 1HE5A 4PG6A 3EEIA 1F9EA 4FMPA 1TO6A 2HCJB 2PBLA 2QUIA 5EHNA 4RGVA 1WBDA 1X2BA 4MP3A 3DEYX 1B8PA 1DB3A 4DR1B 3SQNA 4W1PA 2DJIA 3DVLA 2JI6A 3JQ9C 4IMRA 3FPGA 4FDMA 1N2OA 1NE7A 4LOAA 3HJRA 3O8NA 4D46A 2UYYA 1YB4A 3DEKA 3ZCVA 4CRWB 2QMOA 3AUKA 4N4AA 3RB8A 3VTAA 2QVZX 5IHPA 5JRDS 2ATCA 4ZKEA 3B78A 3GAAA 2ZT5A 4L95C 3ZNOA 2QY9A 2J3IA 4ECEA 4YRSA 3MT0A 4Q21A 2F3RA 3HR8A 3LCVB 1H3EA 2ABWA 3MQFA 1JU4A 4MZXA 1Y8ZA 3PJEA 2BFFB 2ZROA 3D7KA 1JG2A 4HYTA 2E4YA 4ARSA 1L7NA 3JQ9A 1A2BA 3U39A 3TL2A 1YSCA 2HA5A 5F5XA 5IJXA 4AJKA 1KAHA 1DXHA 3WNDA 3JYNA 1OTYA 5EL0A 1L5FA 4FOSA 3ILSA 3MWDA 3ZC3A 5JPCA 3TJMA 5J58A 1TZKA 3OUTA 1O03A 3H83A 4LV5B 1UH5A 5KTMA 3I2IA 3W5DA 5JNLA 2XBLA 2CCKA 2AOVA 3SAJA 4EJSC 2DM6A 2YQZA 2QG9A 2K5UA 3TDKA 4QNRA 3CM0A 5LOVA 3UPUA 4DUPA 2ZUCA 3ZLJA 2YS6A 3VM6A 5H4GA 3O9VA 1ONPA 4ACAA 3LT1A 1NYQA 1YCGA 1QQ6A 3OPYA 3ZVKA 1YC5A 2C92A 1VL1A 3DHNA 4QDUA 1IUNA 1L5KA 3I30X 4PNHA 1G4HA 2ZJBA 5H02A 4DCPA 1P4RA 3KYJB 1RAEA 2ZIGA 5ENVA 1DEXA 5H8WA 4Y8VA 2H5IA 1U5BA 2ERYA 1W52X 3HBNA 3HYNA 4HC4A 3RROA 3ZHBA 4AIRA 5CLIA 1TT5A 3GLGB 4QDOA 2IPOA 3NPMA 3TCXB 4DQUA 4Y9SA 3UT5B 1OX4A 5AUNB 2P6UA 1FJGB 1XCJA 2NO1A 2JFUA 1AKVA 5EIHA 1NNUA 1I2CA 3CCCA 5M7EA 3IUJA 5FBKA 1PJSA 1TM1E 4U5XA 2VHJA 4R1PA 2PVCA 1HORA 4J90A 2F9MA 4LI0A 4XYGA 4OJNA 3N53A 1KMNA 2CNKA 2G0NA 1T2AA 5KYXA 4PWYA 1A69A 3KVYA 4O3FA 4ZEOA 4BUZA 4CIWA 1LBHA 3CNEA 2UYOA 3D4NA 5D2CA 4YP1A 5HK8A 1AV6A 2DBRA 2QTFA 3SJBA 1IATA 1DBWA 1ETUA 2GAJA 4HLDA 1LB1B 2FPIB 5DZSA 3VOAA 1EDZA 4Q4AB 1ZZEA 3EZ9A 2QKYA 4ZOCA 4IOJA 1QHFA 1XZ8A 4RU1A 1E89A 1B8OA 1VRCA 2J48A 2PFGA 4JAVC 5F33A 3WKEA 1PG5A 2H9YA 5D01A 1RVDA 3Q3CA 4GDFA 5DYYA 3U6BA 3BKXA 2XE6A 4M89A 3LLMA 1DIAA 1AKWA 1WDLA 2NUPB 4BMPB 1F48A 4UC0A 5JW6A 2IKSA 1L4GA 2AIRA 3ICOA 5DBHX 4LF9B 3B51X 4K1XA 4OA8A 4EG1A 5LPNA 4MGEA 2EKPA 2ORED 1S8OA 2B4QA 3LBNA 4TTQA 5CYOA 3Q9SA 4U6QA 1C7ZA 2YASA 1DTWA 3OSUA 4GYKA 1W30A 2AZMA 3Q3IA 2YJ3A 4CQLB 2ZBFA 3GEMA 4MV6A 2ZWAA 2ZI3A 4C4OA 1NW4A 1D0IA 1E1RD 2H63A 2REXB 5M3BA 3WLMA 1PL7A 2BUCA 1FLAA 2NT3A 2MINB 2RB4A 3FCOA 3Q8LA 3QOXA 2G82A 1OIWA 1CJVC 2YYAA 1GSAA 2OOKA 3AKCA 3AUSA 1LW6E 3OOHA 4HNTA 1AGXA 3F5MA 1CBUA 4MYRA 3P0HA 3GEIA 4FMCB 1K98A 3TRHA 5IUKC 5HK9A 5JMTA 3OFNA 2P6MA 3ND5A 4XM0A 5JZVA 1P33A 1Q0QA 1DFIA 2QPTA 3CNLA 4OKNA 4TROA 5T7BA 5FQOA 1I1HA 2TRSB 4W5JA 1FTSA 2QV0A 1LA2A 4PYMA 5KBYA 2DF8A 1XVUA 2PGXA 2QRZA 3SICE 1D2GA 2APJA 1NW3A 2H2HA 4GMKA 1QNFA 5K0ZA 1QYDA 1H4SA 3KAPA 1QR6A 1E5QA 2E0IA 4TWBA 4HNGA 2IV3A 5EJ4A 2P0EA 5K0LA 4FHGA 2Q99A 1ULZA 2UXBB 4G0NA 3HP1A 1G0OA 3D6NB 1UBGA 1PWYE 1D2NA 4XTRA 5BWOA 3QLJA 4LPSA 4AUMA 4O4JF 3GJ4A 3T7KA 2BCJQ 3OZXA 4E09A 5BSTA 5EWMB 4BJ1A 4M7RA 4UASA 1SUFA 1OLUA 4WJLA 2JPDA 3U3KA 3QMPA 4BX3A 2CUNA 621PA 5IF9A 3FSEA 1IN6A 2B9EA 1JFLA 1P29A 2I7CA 4HD8A 4XVUA 3AY3A 3ZD6A 3FPJA 1L7DA 4JQZA 5JI3E 2G07A 3SK0A 4I4CA 1K4MA 2C04A 4RZ2A 4CF5A 2IELA 4DIFA 4CEIA 4ZT3A 1FYFA 2GDJA 3LSYA 2XKKA 2BGTA 2EX0A 4NONA 2C8KA 2B4KA 4MVXA 3VZSA 1YJAA 2H07A 1RYYA 1RE0A 4JVOA 2HGZA 5ALDA 3WBFA 5F2KA 3DWFA 1AHHA 4JMPA 3PE6A 1XNJA 1RQNA