1DOSA

Structure of fructose-bisphosphate aldolase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
358
structure length
343
Chain Sequence
b'SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMSEESLQENIEICSKYLERMSKIGMTLEGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVYKAGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOLASE CLASS II
molecule tags Lyase
source organism Escherichia coli
publication title Novel active site in Escherichia coli fructose 1,6-bisphosphate aldolase.
pubmed doi rcsb
total genus 131
structure length 343
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1996-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dosA00
3TROA 3A23A 1QDSA 3M9YA 1RVGA 3LI1A 3WJSA 4TX9A 2VEMA 4LC8A 1WDWA 5D2YA 1L6WA 4IXHA 3G22A 1ICQA 4UXDA 2F84A 4JYFA 4AMAA 3P8IA 3MP5A 5G1TA 1G4EA 2G96A 4JTJA 5FF7A 4GE8A 2J9YA 4HNNA 1KM5A 4NXKA 4TIMA 3T55A 4R7JA 2CZ5A 3MO7A 4KWVA 2OT0A 2ZZ4A 2E5CA 5C5YA 1DV7A 3V1PA 3LTYA 5LNUA 3SY5A 5FESA 1HL2A 3W3OA 4LTSA 1B3OA 1O5XA 2Y7DA 2QJHA 5AFDA 2NLIA 4FNPA 1O60A 3W83A 2H3DA 4UFKA 1FXPA 3GAKA 3LLFA 3NPWA 4HNVA 3QW4B 4XBSA 3JS3A 1OX4B 4O14A 1TPEA 3CEUA 3PULA 2P1FA 5EA9A 2B0MA 3WK0A 4EVZA 1NSJA 4YMZA 3TNOA 5KZEA 3UWVA 2ZRVA 4IMDA 4NZJA 1Q6QA 4QAIA 1FWNA 4MZYA 1OABA 4JTLA 4NZFA 3OIXA 1JQXA 3W1LA 4Z1AA 4L4LA 3MI3A 1LRQA 3NQ7A 5D03A 1YPIA 3QF0A 5KINA 1QWGA 3N73A 5HUPA 1SSDA 4JICA 3UD6A 4QJ1A 4CQ9A 4UMCA 5D32A 3N9SA 2Y6ZA 1SQ7A 3LI0A 5LGXA 1JUBA 4IPIA 1UJPA 3UWWA 4A21A 1EB3A 1GT8A 4M6QA 3O06A 2YDAA 3GR8A 1VHCA 4HNUA 3NXFA 2BZNA 1WOBA 1D9EA 4MKNA 2A7PA 2YXGA 1ICSA 2Q8LA 1DKWA 2ATSA 3SJ3A 4XUGA 4UUIA 3TJLA 1GVQA 2DP3A 4IJBA 1KTNA 3QW3A 4BWLC 3QC3A 2DJXA 4UIOA 4Z0JA 2QCDA 1PVNA 3W88A 3GKFA 5H2ZA 3I7SA 3NQGA 3ATZA 4N4QA 1YDVA 1I2QA 2CWNA 1K03A 1Z44A 2NWSA 3G24A 1P0NA 3G1VA 1R2TA 2WQPA 3JR2A 3TSDA 2Y61A 1LRNA 4MJZA 1LCOA 3B03A 4IGHA 1VYRA 5AYYA 5D2VA 1M6JA 1ZFJA 2YSWA 3QFEA 4Z1CA 4DO5A 3QMSA 6TIMA 4QM1A 3RLVA 1VH7A 4NT0A 5LNSA 2X1RA 4HPXA 4JDBA 3QJAA 2GJLA 3W2UA 1FWRA 2OMAA 3BPWA 1C29A 2FJKA 2C18A 2YW4A 4ZMGA 3OEXA 4KWWA 4O10A 4ZQOA 3M5VA 4NJIA 2DJLA 1I45A 2BWGA 5EL1A 1MEHA 2WJZA 1ZAJA 1G4SA 1Q45A 4YCPA 2RHGA 5CGQA 3W2KA 4AWUA 4LUIA 3QQ0A 3SSJA 1H7XA 1EP3A 1IIHA 4ZQMA 1XKYA 4DQWA 4ICNA 4JD4A 1DORA 4PC8A 2VFEA 1TRDA 1SW7A 4OU1A 2QCMA 2DZVA 3UXAA 2BSLA 3LRMA 3M1ZA 3TC6A 1F76A 1XBYA 4JN6A 2R91A 3GAYA 2FB3A 3HPXA 3G0UA 3W2JA 2DZTA 1TPC1 3LDVA 4CCEA 4LVAA 4JTIA 2EHHA 1QPRA 2CLEA 1KA9F 1D3GA 4WZHA 1GYLA 1JCYA 5CG7A 5FEZA 5D02A 2Y7EA 3G0SA 2C3ZA 1P5BA 3KVKA 1MXSA 1XCFA 3SGZA 3UY7A 2NWRA 4GUJA 3TJXA 4BI6A 3G1DA 1EUNA 1VLWA 2XN1A 2VFGA 4D2JA 4JTTA 3VCRA 4UTTC 5CZSA 1QPOA 3G8EA 3C2VA 5TIMA 5HWMA 5K9CA 1IGSA 3FYOA 4MLJA 3PR2A 4OV4A 3EWZA 3FJLA 5F4XA 1S5TA 4IOTA 5HJLA 2H3BA 3KX6A 3NEVA 4M5PA 2ALDA 1K7EA 4X3ZA 2V2CA 1H1ZA 3NQ2A 4LS2A 2FDSA 4P2VA 4KFNA 3T78A 4UTHA 4QSHA 4FXRA 3A22A 2CLHA 3W87A 4XQ6A 2NXIA 5ABTA 2CZFA 3TQ0A 4LU0A 2G97A 2X1TA 5F2MA 1P4CA 3VI2A 3NDOA 4FNTA 2OZ0A 5GVJA 3TU9A 1KW1A 2ZZ1A 3ABOA 3HIJA 2CLMA 4GBUA 3ABRA 3B0PA 3W7KA 2WOQA 5FF3A 4DELA 2GVLA 4JTKA 4NJHA 2V9DA 2GJNA 4NUWA 4UR7A 1AMKA 1OFPA 2P10A 3IGXA 3W6YA 4E2DA 4POCA 2NX1A 2O7SA 4LV4A 3W7GA 1G6CA 2BXVA 1BWKA 4N2YA 4RXFA 3TR2A 2O7QA 1F5ZA 1VCVA 4UTJA 2Z2UA 3KHJA 4I7VA 1JVNA 3NGJA 4LW7A 4WOZA 3TXVA 1VRDA 3O15A 3Q58A 3TK7A 3W70A 4MJMA 4XWUA 1MO0A 4CCCA 1KLZA 4I9AA 1TB3A 2QCGA 1JR1A 3BW2A 1I2OA 3NQ8A 4QNWA 4FX6M 3L21A 3BGGA 2QJGA 5LHEA 4LWWA 2ZYFA 1Q3NA 3DU0A 2JGQA 3OG3A 4AAJA 1THFD 3NM3A 2KZHA 1HTIA 2EPHA 3VE9A 4JTGA 2Y7GA 4N6EA 4ML9A 4MY1A 5AN7A 1GG1A 2I14A 1UB3A 3NQCA 2VFFA 5DBTA 1TPFA 1ZALA 3L5MA 4JX4A 3GB6A 1OFEA 4LVFA 4WY0B 5LZLA 1QPQA 3QRHA 3LHUA 1YYAA 3HG4A 1JCMP 2VOMA 5BRBA 3NL2A 2X1UA 2VEIA 1SU5A 5HWNA 3BW3A 3HF3A 3WJYA 3M47A 4PA8A 3OA3A 5AHLA 1JCJA 2C1HA 4R34A 1KM2A 1KBJA 2ZZ3A 3C2FA 5K9XA 3S1UA 1AG1O 3MJYA 3EX2A 3WJXA 1TPVA 4CQAA 3RMJA 1YTEA 3KAOA 3PUOA 2CFFA 2QCNA 1KFLA 4PEKA 1LDCA 4RZ4A 3SR7A 1A50A 4UTWC 3ABQA 2A5HA 1I2RA 2X1SA 4MLRA 3LHYA 1KV5A 1OFRA 1Z42A 4EWND 4ADUA 3GR7A 2YFNA 5DLCA 2LLEA 4PCFA 4K37A 1BWLA 4DXVA 1GQNA 1KTCA 2TSYA 5CPNA 4TO8A 4LNYA 3SGUA 3UWQA 2V5BA 1WXJA 1F05A 3NR0A 2GOUA 2B7PA 3CB8A 3D0CA 2I1OA 3UNDA 2W79A 1F73A 2XN2A 1FX6A 2Y63A 3S1VA 1HUVA 4A29A 1OX4A 5DBUA 3FEMA 1T96A 2FLIA 3LCIA 2YX0A 4RKAA 3PBVA 3HO8A 1O5KA 2AAMA 4O54A 2X2GA 4ONVA 2NUWA 3TCEA 5LSMA 5TBOA 1QFEA 1ZENA 5L9FA 3BW4A 1QNVA 3S42A 4FEZA 2ATMA 2EAWA 1TTJA 1H7RA 1TTPA 3LHWA 4O15A 2RFGA 3VE7A 1XC4A 5L6UA 4DF2A 1WV2A 3E9AA 4MIMA 4NNBA 5K3VA 2C14A 2VELA 1TREA 2ZA1A 3W7EA 3I7QA 3Q2DA 4TU1A 1X1OA 3G8RA 3MMTA 1EA0A 1KM1A 3G0XA 3OVRA 5DCEA 2VXNA 2ZTKA 3GDMA 3LX9A 4O4WA 5G5IA 4ZL1A 4I7UA 1GG0A 1H7OA 4WQ6A 4DBEA 1SO3A 1ME9A 4GUGA 4FX7A 1ICPA 2A4AA 4IMGA 3LXAA 1H61A 4JXCA 1QR7A 3N9RA 2RDUA 3O63A 4BR1A 3NNTA 1V7YA 1WBHA 1K7XA 2RDTA 3EX3A 1KBIA 3B05A 4NQ1A 2HTMA 1RQHA 1AW5A 1QAPA 2V82A 3LCWA 3IRDA 4C1KA 1WAUA 1LOLA 4GC4A 1OF8A 1YDNA 1ML1A 4K8HA 2CLOA 4CCDA 2Y89A 1L9WA 1SZNA 1TMHA 4JS3A 1N55A 4Z1BA 5K9DA 3A9IA 4ZQPA 5IBXA 3A24A 1IXQA 3OVQA 3CM4A 3BG5A 3GDKA 5I3JA 3B06A 4NVTA 3UPBA 3EWXA 1EWEA 3NQVA 5AHEA 3W1XA 2CZEA 1GVOA 1P1XA 1KLYA 1IXPA 5HQEA 3GDRA 2QR6A 1DHPA 5I3GA 4XKYB 4DO6A 2A6LA 4LRTA 5AYZA 4QITA 1IF2A 3NQFA 1FY6A 2TMDA 5CSRA 1YXDA 4A3UA 4JNMA 4CQ8A 1UASA 5BNKA 4NJGA 4O1DA 4TMBA 3WJWA 2ZRYA 3P60A 5EY5A 3JRKA 4UCGA 1M5WA 3FS2A 3UZJA 2YR1A 1LBFA 4BI5A 5F1VA 1TYGA 1QMLA 3E49A 3PVFA 4BWLA 3HJZA 3L5LA 3KFTA 4HT3A 1VZWA 3LXCA 5AB3A 5F4WA 4ADSA 1YDOA 5MHBA 5EPDA 4QNEA 4HPJA 2JKAA 3IGSA 4H4IA 2E09A 1W3NA 1DL3A 3PM6A 4BK9A 2HSAA 4WY0F 1PV8A 5SWUA 3FKKA 1M7PA 4N02A 1KV8A 3DFQA 4GRSA 4NU7A 3L67A 4OT7A 4HIBA 3LXBA 3FLUA 4UFMA 4FIQA 1GVFA 3M6YA 1TJPA 5AC7A 4FB7A 3NG3A 2A6NA 2H8XA 3L2IA 4CLMA 4WXYA 3DKJA 2VEPA 2FQIA 3IIXA 1XDLA 1SSGA 1T0OA 2TYSA 4HNTA 1OG0A 5DXYA 1LP6A 3W7DA 1KFKA 1OHLA 4UNLA 5HR7A 3EWWA 3M16A 3C8FA 3N2MA 3P84A 2Q3OA 3P80A 5D2XA 1GVSA 3IVUA 3TMLA 4AWTA 4UNKA 3THAA 3TC7A 3CHVA 3L0NA 5I3HA 2QDHA 4UTKA 3W23A 1EWDA 3VFLA 4JY9A 1FCBA 2VEKA 4O19A 2Y88A 2E68A 4TMCA 1B4KA 4UR8A 1PCWA 4CNNA 2FTPA 2TRSA 5F2IA 3ELFA 5CKSA 3IIZA 1SR9A 3UQNA 2R8WA 1FCVA 2AGKA 5KMYA 2FIQA 2VFHA 2H8ZA 2OX1A 1K3UA 1SZEA 2C16A 2WSQA 5KZMA 4K38A 1SO6A 3B4UA 3G1AA 3W2NA 3EWUA 3GDLA 3TQVA 2ZRWA 3DHFA 5DY3A 5EBUA 1K8XA 1S3HA 4K39A 4UFLA 3ZR4A 2PURA 3FKRA 4JGDA 1EX5A 2C15A 1KFCA 1AL8A 3NO5A 3S1XA 5EYWA 1W5OA 3A5FA 3UYCA 5D09A 1QOPA 1PS9A 1XL9A 5HWJA 4AWSA 4JX6A 1OYBA 1PL9A 3W7RA 3QSTA 3CU2A 2ZRZA 3PBYA 4K7VA 2CU0A 3IVSA 3BLFA 3Q37A 3YPIA 4Q4KA 3LCXA 5DXXA 1F7BA 3WFAA 2NUYA 3P5YA 4NXSA 3TQKA 2C19A 3N14A 3PSWA 3EXRA 4Y8FA 3BLIA 3PUEA 2A7NA 4R33A 1J4EA 4DO4A 1VPXA 3MBDA 3S5ZA 4DPQA 1N8FA 1VGAA 3MYPA 2QCHA 4W9TA 1W5PA 2EF9A 3TXZA 4HHPA 3CIXA 3L5AA 3V75A 3H55A 4E38A 7TIMA 1F6KA 6ALDA 3LCHA 1ONRA 2QCFA 2WSYA 3LOTA 3TKFA 1VJIA 1VYPX 5HR6A 2ZA3A 1YLVA 3P62A 1O94A 4JTUA 3TSBA 2YW3A 4JTSA 1WQ5A 5J5RA 4ZVJA 2V81A 3N3MA 3IIOA 1W56A 2YPIA 1J2WA 4FNSA 1E51A 3UXDA 3LCGA 3CC1A 5LNWA 5G2IA 3O16A 5EMUA 3P61A 3QSRA 4PFMA 3WK1A 3W1TA 3M41A 5G4WA 4NNAA 4OQVA 1LYXA 3LHVA 4KFPA 2FPTA 2Q8ZA 3LTSA 2J9ZA 3MYOA 2CLLA 4IQLA 5BMWA 4M6VA 3W73A 5CPMA 3TUUA 4I7WA 3HG3A 1W3TA 4KFOA 2NX3A 3MHUA 4FNRA 3CTLA 4ZQNA 1TPUA 4O13A 1GPWA 3GX9A 1NFBA 5CPLA 4QISA 4XTDA 2GVJA 5C6MA 4IMCA 4OV9A 1AW1A 1SW0A 4K6AA 5LGZA 3TIMA 3EB2A 3PUDA 3DXIA 5IBXC 2Y62A 3P8JA 3DH7A 2A0NA 4U28A 2CLIA 4GNJA 3NPXA 3MBFA 3P74A 1TPB1 4EF8A 3MUXA 3MI6A 2HS8A 3TH6A 3W1RA 1LORA 1I2PA 2ISVA 5K4ZA 1X8FA 2OT1A 1SFJA 5F2GA 3B0VC 1OFOA 2VC6A 3W2LA 1GVRA 4OGZA 4RV8A 3AJXA 3DI0A 3G1HA 2CW6A 1LLZA 3O07A 3HPSA 4X22A 4RJEA 3NM1A 2JGYA 2QCEA 1YPFA 3KOFA 4IWWA 3EXTA 4LC6A 3W1UA 1L6YA 4L4MA 2FFCA 4N9DA 3NZ1A 1XUZA 3W7PA 1DQWA 4RZ5A 3HQ1A 1O4UA 1LBMA 1UBSA 1W1ZA 2QAPA 4Z0SA 2E6DA 3W74A 3HB9A 4MY9A 2NXHA 3T44A 1DOSA 1C9DA 4X2RA 2G5WA 1LROA 1VS1A 4MOZA 4NNCA 1NEYA 3IEBA 1JJKA 3DHDA 2I9EA 4WD0A 3DGRA 4GXMA 3L0GA 1GJPA 1OK4A 5D38A 4BF9A 5LKYA 1XI3A 4ADTA 3NQDA 5G4EA 2FPVA 1VR6A 3CLMA 4IX0A 4N6FA 1SZFA 3QMRA 3DI1A 2GUUA 1OF6A 4MZ8A 1TIMA 2WNQA 3G3MA 1SW3A 3PWAA 4RCXA 3N34A 4DF0A 3NQMA 4XKYA 4FNUA 1G67A 1EIXA 3LHZA 2RH9A 1Q6OA 3W1NA 3CPRA 2H90A 5AHIA 1JULA 3EEGA 4AB4A 1IXNA 1RD5A 1ZNNA 3HGSA 3QYQA 1ALDA 4WUIA 1XDMA 1EPXA 1H63A 4FNQA 4PL1A 3P81A 1SUXA 3M7WA 4N9CA 1EUAA 3TAKA 1R2RA 1Q6RA 4A2SA 2WKJA 2QUUA 2TPSA 5IM51 1BKSA 3ABSA 3E0IA 3M5YA 3SIZA 3NPVA 3EX1A 3UWUA 1F74A 1OX6A 3HG2A 4HSOA 4UMBA 1YADA 4K8EA 3DFPA 1K8ZA 3B8DA 3STCA 3LERA 2B4GA 1N7KA 3R89A 2ISSA 3M43A 4NJKA 1TSIA 4UFJA 1KFBA 1MEWA 3RFAA 2DZXA 4RXGA 3GYEA 3S1WA 3R8RA 5FEXA 4O11A 3L66A 3QEZA 4UTMA 4MFEA 1I4NA 3DBPA 3G3DA 1VLIA 1OYAA 3B04A 4GUIA 3C2EA 4A2RA 3TE9A 2W0UA 3QH2A 3NQEA 1GOXA 2EKCA 4O50A 3PAJA 5BMXA 1VQTA 1IXOA 2J88A 2PRHA 2YYTA 4AXKA 1RPXA 4UFIA 1FWWA 2E77A 3WK3A 2V2HA 3W7HA 3STFA 1A5BA 1WX0A 2NXGA 1AL7A 4NX0A 4O52A 3NAVA 2JKPA 4JR5A 3RLUA 3PB0A 1TCDA 2ZZ2A 3STGA 4C1LA 4Y9AA 4DPPA 4IPJA 3GXNA 5BOOA 3CQ0A 4J9JA 3CWOX 3MP3A 1XBZA 5FEWA 5K4XA 1Q6LA 1LBLA 2YGYA 3F4WA 3ZWTA 3K30A 4P61A 1DQXA 3IGUA 1TO3A 1RR2A 5FF0A 4FX8A 1OFQA 3O6DA 5DELA 2VKZG 4IUOA 5T26A 1FDJA 3SECA 3HBLA 5AYXA 2R14A 1JUKA 3TDFA 3QM3A 1TPH1 4AEOA 3L68A 1WA3A 5J5DA 4OWGA 3DFSA 2QUTA 1X7FA 1H7WA 1OFBA 1LLWA 3E12A 4LVBA 4JDYA 4Y90A 4E2BA 3THQA 5HINA 3CEPA 3MI2A 2ABAA 1YXCA 5AHNA 1JRCA 2QAFA 3C56A 3MWAA 2GQAA 2Z6JA 4O12A 1XUUA 4OBTA 2JBMA 2V0TA 2ZFAA 3LGEA 3R5EA 3DENA 2YZRA 4RR4A 3B0UX 3UPWA 3NA8A 3W1AA 3GNDA 3GKAA 3O8AA 1QOQA 2C6QA 4EF9A 3UZ5A 2E5BA 4RZ6A 2V8ZA 5AOUA 1XFBA 1A5AA 4O1AA 5KTLA 3QZEA 2V2DA 4Y6GA 3RF9A 5KITA 3IV3A 4K7YA 1H51A 5AC8A 3PY2A 5A5WA 1DVJA 3EWBX 4ALDA 1GYNA 4FO4A 2DU2A 1ZAIA 3PG8A 3TX9A 1W0MA 3KRUA 2AQWA 3FA5A 1U5JA 5D2TA 1QCWA 2Z1BA 3DAQA 1UCWA 1FCUA 2NUXA 2R94A 4PH6A 5CPOA 4BFAA 3T40A 3C3NA 4YWIA 1KM3A 2DZSA 1QO2A 2PC4A 2VENA 3KRSA 3FIGA 1B4EA 3A21A 3P67A 4FF7A 4ZQRA 1K8YA 1AK5A 2WV8A 3LCFA 5TQLA 3BVJA 3PF3A 3W75A 1R46A 5DN1A 2ZTJA 2ZRUA 8TIMA 2YYUA 4H3DA 1W5NA 1CI1A 2EGZA 1T8XA 1Z41A 1ADOA 3LRLA 1ME8A 2ZBTA 4BI7A 1JUEA 2E6YA 2DZWA 2QCLA 2BX7A 1XBVA 3LM7A 2HMCA 5HUOA 4ZQCA 1A53A 1R30A 3IIPA 4MY8A 5E1QA 1GEQA 3H54A 3FJ6A 1K02A 2QCCA 4DF1A 2C13A 3EKLA 1XBXA 3BG9A 4CNPA 2B7QA 1TV5A 2YFOA 3HGOA 3W7CA 1OX5A 1A5SA 1VHNA 4X9SA 1FDZA 1EP1A 3EX6A 4MZ1A 1PIIA 3U6WA 2QDGA 3MW7A 1HFBA 1K7FA 3HGJA 5I3IA 3CIWA 3C52A 3EWYA 3I65A 2A2IA 1D3HA 1W3IA 1OK6A 3W7QA 1PHQA 5F2LA 3W22A 4FIRA 3GVGA 1KTBA 2V30A 2ISWA 3W9ZA 4WXZA 4LOCA 3W86A 1J5TA 3HMJG 3ZWSA 3W85A 3TA6A 3TSMA 1GTHA 1U83A 5DCBA 1FQ0A 1HO4A 1Y0EA 3G1SA 1NVMA 4AHPA 4XBKA 4G1KA 3MP4A 3UWYA 1IIGA 3GNNA 2BTMA 1H7NA 1QO5A 2VFDA 3L0KA 4UTUA 5K2ZA 3S5YA 1G69A 2OJPA 4IMFA 4E0CA 1RV8A 3TW7A 2OCZA 1OFAA 3L9CA 3LV5A 1TRIA 3LLDA 4U4MA 2V5LA 3L65A 4O0KA 2GQ8A 4O1BA 2UV8G 4R53A 4S2BA 4WJEA 3M5ZA 5FEPA 3FFSA 1FCQA 5CZ0A 4N9BA 2NZLA 2X30A 2Z0IA 5G1YA 1LOQA 4GUHA 3HG5A 5CSSA 1SFLA 2RKXA 1UUMA 1JRBA 1Z48A 3NL6A 4AF0A 3LB0A 3O1NA 3T4CA 4JEQA 4O16A 3W84A 3T7VA 3CWNA 3W72A 2NV1A 5H91A 1FBAA 5G2HA 3I6RA 1W5QA 2YCEA 4IX2A 1OVDA 5LHFA 1WOAA 1SO4A 2PRMA 5U7SA 1SO5A 3NPUA 2CLFA 1T99A 5AC6A 3S6DA 1ZJIA 5KZDA 2IQTA 3EX4A 4Q33A 1TV8A 4RLIA 1H60A 3PS7A 2VFIA 1F6PA 2E1DA 1LOSA 2P0OA 3S8HA 1UUOA 1VYSX 1V5XA 5AHMA 3QMTA 1QPNA 1W31A 1YTDA 3A5VA 4JTHA 1H50A 2NX9A 3F03K 3N19B 1ZAHA 4CNOA 3OVPA 3W7LA 4O1CA 1BEUA 2ZRXA 4LS1A 3ATYA 4H6KA 4Q32A 3NQ6A 4LRSA 4DBDA 4OHQA 5F4SA 1JCNA 2E5DA 4JYDA 4M7SA 4JYEA 4LV9A 1OJXA 1BTMA 3TV8A 5LNVA 1GZGA 3C4UA 5F1UA 4LT9A 1KFJA 4O18A 3MHGA 2G95A 5KSWA 5HULA 1CW2A 1SPQA 3P82A 1KM0A 3NQAA 1TQJA 3Q94A 3SFKA 1NF7A 5LNRA 3FYPA 4LS0A 3C2OA 3P5ZA 1PHWA 3BV4A 3W7IA 2GQ9A 4JY8A 2X16A 1RQEA 4B5NA 2ZZ7A 3KVJA 1L6SA 3DFOA 2B7NA 2ZZ6A 1I2NA 3W7MA 4O8RA 4O17A 3SI9A 1VCGA 3G1XA 3E02A 2H6RA 5C55A 3H53A 3C61A 3W7NA 3KRZA 3KXQA 1WBJA 3W76A 2ZZ5A 3OBKA 5G2WA 3C6CA 3C0JA 4AHOA 3LHTA 3N2XA 3RK8A 5DY2A 1S5WA 3USBA 1SZGA 2QCDB 3W1PA 3HPZA 4YLWA 4TR9A 1B9BA 3W2MA 3EXSA 1PE1A 1W8SA 2ZA2A 3G18A 4UTLA 1TV7A 3DFTA 4AHQA 3QPYA 3GK0A 4JX5A 5AHFA 3GXPA 5K7JA 4O0ZA 4Z1DA 4MYAA 3LCLA 3VKJA 4GFSA 3S0CA 3CT7A 2DZUA 3NVTA 5I3KA 3G1YA 1R47A 3O6YX 4NJJA 1I8JA 2QJIA 3GIYA 2J6XA 3TMQA 3R2GA 3O05A 4FXSA 1F2JA 4JTFA 3QQ1A 4ORIA 4Y96A 1ZHAA 3AO0A 1G4PA 1PCKA 3WJZA 4MVAA 1H7PA 2HS6A 1H5YA 4UTWA 2FPYA 4HN4A 2A7RA 3IVTA 4IXXA 3DKLA 2BLEA 2ZDRA 5HNRA 4PTNA 1ME7A 3HGRA 3ZFHA 3BLEA 3HOJA 2DORA 1YXYA 2ZQ0A 3ANYA 4YCOA 1M7OA 5CZTA 4WX2A 1W37A 3F1QA 3BGJA 1KFEA 1TTQA 2QKFA 3NL3A 4GUFA 1TPWA 4EIVA 1FWSA 1LZOA 1AW2A 1W5MA 2QEZA 2B7OA 3R13A 3RU6A 1G4TA 1GWJA 2WO5A 3M44A 4N4PA 3SW6A 2JK2A 4JTEA 3O6CA 2WNZA 4KKXA 4EOUA 1C8VA 1H62A 2D73A 3R12A 4MFDA 3UY8A 1KM4A 1LRTA 3LTPA 5FF2A 1LM1A 3NYZA 4HKPA 4O57A 4QQ3A 5HMSA 1FDYA 1H1YA 3W1QA 2A85A 5E93A 5FI8A 3S5NA 4UC5A 3GDTA 3KVMA 2GVGA 5D33A 3RNDA 4UMAA 2E6FA 2QF7A 4MYXA 4IMEA 3M5XA 4RX0A 3GXTA 5I3FA 2J9XA 4FHAA 4MUZA 3C2RA 1DJQA 1ZCOA 3TFCA 4LVGA 4ORMA 1MEIA 2Y70A 1TQXA 4LY8A 2ABBA 3GLCA 3S5OA 1XXXA 3STEA 5D2WA 1TJRA 2A21A 3NL5A 2NV2A 1G7UA 4AH7A 3S9YA 1FXQA 1MZHA 3PBWA 1FUYA 2XFWA 2Y7FA 5DCDA 1DJNA 3QPZA 3EKZA 1ZY9A 1RQBA 1W54A 3VNDA 1CX9A 2CLKA 2PE4A 3TFXA 2PCQA 1O95A 3PB2A 3PC0A 4DEFA 1DBTA 1JCXA 5C2XA 1P0KA 1KM6A 1EEPA 4YXGA 3F4NA 5CZJA 1R2SA 2WPBA 1L2UA 3I68A 2A1YA 1TPDA 4M7TA 3P7YA 4Z08A 3BO9A 2Q3RA 1A5CA 1TTIA 5D37A 1NAL1 5D05A 4PL2A 1OFDA 2RDWA 4JIPA 3INPA 1EP2A 1GTEA 3PSVA 1JCLA 3LBCA 3M0ZA 1MSSA 1B57A 3W1MA 4O28A 4MPQA 3ZS4A 4S1FA 1WYIA 1XM3A 4O4VA 3OHIA 3G1FA 5U4NA 2WNNA 3PBUA 4S2CA 2J24A 2CZDA 3BARA 2F7FA 1VC4A 3NZRA 3PG9A 1S5VA 3KVLA 5FF4A 3WK2A 4JIQA 1HO1A 4OE7A 3W07A 1JQVA 4K36A 4A22A 3U2OA 4LUJA 3LRKA 4XZ9A 3TW6A 2PRLA 3U8GA 1X6UA 3BK0A 3W7OA 3LV6A 1VCFA 4UTTA 2GPTA 3LBMA 2C0AA 2Z6IA 4PODA 2XN0A 3DFNA 3TAOA 1YTKA 2WSRA 4GJ1A 2J27A 4M6PA 2JKEA 1LTDA 3IIVA 5A8GA 5E0KA 4O53A 4UFHA 4QIUA 1OYCA 3I7RA 1NF0A 3E96A 4RK8A 3UWZA 4GWEA 4NX5A 2E6AA 3MHFA 4UTIA 5D04C 1FWTA 2Y85A 4M19A 3DZ1A 2W6RA 4HSNA 4WY0A 4N9EA 5EKYA 4AVFA 1G7VA 5D30A 3GZ3A 2QUVA 4XTIA 3W7JA 2ZCGA 3W71A 1X1ZA 2DZPA 4ZZ9A 2FB2A 4WOQA 4LVDA 3SZ8A 3NOEA 5BW6A 5C54A 4YL2A 3FOKA 4AF0B 1HG3A 1RZMA 3BG3A
chains in the Genus database with same CATH superfamily
3ARSA 3LI1A 3M9YA 3DN5A 4DLFA 5LIWX 4BQ5A 2VEMA 4LC8A 4LANA 1BPLB 3N6HA 3ZSTA 4UXDA 4AC1X 1MQRA 1TG7A 1DXFA 3H2AA 3GM8A 3KWXA 1RK5A 3E2RA 2J9YA 4C1NA 4M80A 4L9YA 4R7JA 3MO7A 2ZZ4A 3BJTA 5C5YA 1UHVA 2XFFA 2P8CA 2CYGA 1O5XA 4GNKB 4XV0A 2QDDA 3QBUA 1QNQA 2O4QA 4S3GA 2NVAA 4FNPA 2H3DA 2XISA 2DFAA 3GXFA 3WDRA 4XKMA 4O14A 1TPEA 2PGWA 3PULA 1BVWA 5KZEA 2JALA 1GZJA 4NZJA 1EJRC 1R87A 1FWNA 4F0SA 4NZFA 2WC3A 1AQFA 2XIJA 3CB3A 5D03A 1YPIA 3STPA 1QWGA 1CXEA 1OQFA 1SSDA 4QJ1A 1JGIA 1MYRA 1NARA 4R27A 4UMCA 1JF6A 1GQLA 4CEXC 3SB0A 1B3ZA 3GVVA 1VPYA 4UQAA 3LENA 3WQVA 2YDAA 3WH6A 3NXFA 4B4HA 4UOQA 3SCOA 1XIMA 1E6RA 2D3LA 2XM2A 2ATSA 3SJ3A 3TJLA 1GKQA 1JFXA 4IJBA 1KTNA 4PMUA 2FYMA 4BWLC 1ZTVA 1XQLA 1HKKA 3QC3A 4UIOA 1KXVA 3E38A 2H9AA 2EBNA 1RY0A 4LBSA 3I7SA 4U10A 3NQGA 1QI4A 1YRRA 1Z44A 1E1FA 1MFUA 3TSDA 2W5FA 2C1IA 3LU2A 4PSPA 1A5LC 2QPXA 3WF0A 3URQA 3RILA 3UGVA 5IFTA 1Y65A 1US3A 4DO5A 2G4JA 3RLVA 4MDOA 3RJXA 3S2LA 5E0CA 2GJLA 3W2UA 4Q8VA 3BPWA 1C29A 1YKWA 2YW4A 4ZMGA 3OEXA 4ZQOA 1AH3A 1REQB 1T5AA 3M5VA 1OC6A 2DJLA 3WFZA 1MEHA 2WLYA 4UBPC 3E5BA 7CGTA 4GYPC 4PMRA 2I7GA 4GI8A 1UP2A 5CGQA 5C71A 2HVOA 1JZ3A 4MUPA 5DFAA 5BXSA 1XKYA 2D3NA 1EHNA 4ICNA 1XX1A 4OU1A 2DZVA 3TLQA 3UXAA 5C0QA 2ZICA 3DG7A 4JN6A 3VPLA 5BWFA 3HPXA 2QIIA 4KW2A 2QS8A 4CCEA 4LVAA 2EHHA 1KA9F 3A3HA 5I09A 4PULA 1FKXA 1UR0A 1GYLA 1JCYA 3VD7A 5CG7A 5FEZA 4L61A 2Y7EA 1XRFA 2A3BA 1UOKA 1P5BA 2O56A 2HK1A 4TTGA 2YLAA 4H1ZA 5C2CA 3UY7A 2HV5A 2NWRA 4HHLA 4GUJA 3TJXA 2XN1A 2VFGA 4D2JA 4G9PA 1XLGA 1JDDA 1CWYA 3C2VA 5HWMA 2YXOA 3AHXA 3GH4A 3EOLA 4KRTA 3EWZA 3FJLA 4L5ZA 2H3BA 2VDIA 3KX6A 3NEVA 2ALDA 4F4RA 1P1MA 3NQ2A 2ZE3A 4LS2A 3RX3A 1K77A 1E43A 1HJUA 3T78A 2WSKA 3A22A 2CLHA 4JKLA 1GVIA 4AY8A 3W38A 2FGZA 1PZ2A 2NXIA 2B81A 3TQ0A 3R6IA 2G97A 2X1TA 2YA2A 4FNTA 5GVJA 4AIBA 4JN7A 2ZZ1A 4GBUA 1VEPA 4XD6A 2WOQA 3W7KA 2Z2BA 4JTKA 2V9DA 2GJNA 3I6EA 3OGSA 1KQZA 1UC5A 3O2LA 2JFEX 1AMKA 2P10A 4JZ5A 4E2DA 4FOKA 4ZXLA 3UESA 1JPKA 3N6JA 4AU0A 4FLRA 2BXVA 1BWKA 3P2VA 2DUXA 4RXFA 2BVDA 1VCVA 3IGHX 3KHJA 1LWJA 4JNYA 4TQTA 3BSGA 3TXVA 1CCWB 4CCCA 2QULA 4GO9A 3AMDA 2X0YA 3VMOA 7PTDA 3BLDA 2ZIDA 1EEXA 3BGGA 2QJGA 5LHEA 1ZL1A 3CV2A 4AVNA 2ZYFA 5EMJA 5BROA 1Q3NA 3OG3A 1LL7A 3FSUA 4HPHA 3NM3A 1HTIA 1RVKA 1DIEA 2EPHA 4JTGA 3CZLA 4GZEA 2D2HA 4GYKA 3CV1A 4ML9A 2ZKMX 3UXKA 3MVIA 1GG1A 1WO2A 1UB3A 1CGVA 4YTSA 2VD8A 5E6ZA 1Q2RA 4BEQA 4LVFA 3QRHA 3TLLA 1MQQA 3HG4A 1JCMP 2VOMA 3W29A 3HF3A 3WJYA 2PS2A 2Z1WA 5AHLA 4R34A 1B54A 4RZBA 1XRSA 3CUFA 1CEOA 2ICSA 3R4IA 2G8ZA 3WLNA 2CFFA 5C2GA 1LDCA 2PDBA 4U31A 1Z42A 2PDLA 3O0KA 3ALGA 4ADUA 7REQA 5DT7A 3GHTA 3ZLGA 5DLCA 1VBJA 4K37A 2PMQA 1QW8A 1CPUA 4LH8A 1LLOA 1TA3A 2PBGA 1GQNA 5JBFA 1PKYA 2VX4A 4TO8A 4LNYA 2CZVA 2B7PA 3D0CA 2E3ZA 2I1OA 3PZ9A 3IJDA 2EPOA 1AQHA 2WQDA 3MMUA 3S1VA 4DUXA 2DT0A 4J3VA 1OX4A 2FLIA 1RXOB 1O5KA 3TOPA 5LSMA 3CAWA 4R7OA 5TBOA 1TKKA 4LEQA 2YLLA 2VZOA 4JL1A 1EDGA 5L9FA 3KP0A 1LL4A 1C90A 1B0IA 4W88A 4XUYA 1XYZA 1H7RA 1TTPA 2QDEA 4DF2A 5AKQA 1HKMA 4MMWA 5K3VA 1M9HA 4KGJA 2FDMA 1WAWA 1O5RA 2PU1A 3I7QA 2OYKA 4GIAA 4AD0A 5JIWA 2QUNA 3Q2DA 3PPGA 4TU1A 1EA0A 3B0YA 2FHCA 4KT2A 3OVRA 5DCEA 2VXNA 4IPPA 2XVKA 3HQOA 5CJMA 2O9PA 4DZ5A 1L6GA 4AFYA 3BICA 4FR1A 2PDQA 5G5IA 2DDXA 4I7UA 1GG0A 1AJ2A 5ABEA 1SO3A 1ME9A 4FX7A 1E73M 1XSKA 4IMGA 4IICA 1R3VA 1QXLA 1UD3A 4Y7EA 1WBHA 5CBBA 4NQ1A 1AW5A 1QAPA 1MW3A 3IRDA 4GC4A 6REQA 4CCDA 1ZBKA 2D23A 1TZ9A 1L9WA 4NYYA 1SZNA 5C9WA 4Z1BA 5K9DA 3A9IA 4V1XA 3CM4A 4XZWA 3GDKA 1DJWA 3UPBA 2VTFA 3DHUA 1EWEA 3KS6A 4CVUA 2P0IA 1P1XA 5IOBA 5HQEA 3GDRA 4B92A 5I3GA 4KCWA 4XKYB 4DO6A 4LRTA 5AYBA 1WE5A 2EQDA 3N3TA 5CSRA 3DUGA 2OYMA 4JNMA 5CG0A 4TMBA 1V03A 3WJWA 5EY5A 5EMLA 4L4PA 3JRKA 4IZGA 2XVLA 1LBFA 2IKGA 2DW7A 5FL0A 2Z00A 3UEQA 5HOSA 4PUKA 3E49A 3PVFA 2GSHA 4PFHA 3T08A 4HT3A 1W91A 2PUZA 4ZGYA 3UG8A 3M0KA 1YDOA 1NELA 5MHBA 5EPDA 3TJ4A 2C0HA 3E0VA 4Q6JA 2JKAA 2VYOA 2PGFA 2W61A 4LYRA 4ERIA 3FYYA 3A4XA 1KCLA 2HSAA 3H2NA 2DH3A 4QXIA 4WY0F 1PV8A 3FKKA 2OPJA 4KMQA 2E25A 4QE4A 4OUEA 3VGHA 3WIJA 3U7BA 1XR2A 1SYTA 2Z1KA 3URAA 3AWNA 1UPMB 4YU1A 4FB7A 1V4YA 1HJSA 1KXTA 1I1WA 4KERA 4KCVA 3BANA 3DKJA 4RNHA 2VEPA 4DJDA 4ZO6A 3ECQA 3IIXA 4NAEB 2CBIA 2D20A 5CC5A 2Z4GA 4DY1A 5HR7A 3LZ5A 3M16A 4Q8PA 1YDYA 3AYSA 3C8FA 3N2MA 1CZ1A 3DERA 1GVSA 1UQZA 4UNKA 3THAA 4ZCWA 3TC7A 3AQUA 5I3HA 3CL6A 4JY9A 1DWAM 2PPGA 1FCBA 4INFA 1V3KA 4C60A 1PCWA 3KDOA 5CKSA 3IIZA 3UQNA 5FJOA 1R7OA 3OZYA 5KMYA 3IJ7A 2ZWYA 2YCJA 2H8ZA 5B7ZA 5D9MA 3ITCA 1W9BM 3OZOA 2R1LA 3AMLA 4XBJA 4LBUA 4R9OA 5KZMA 5A6KA 1SO6A 3W2NA 3DHPA 3EWUA 4IGNA 2R1NA 4JFTA 1BXBA 2V38A 3PFMA 4W5ZA 4V1YA 3TYCA 4K39A 1AH4A 4UFLA 4MPKA 2JQXA 5AZ1A 3AS3A 2PDMA 5EYWA 1W5OA 2V3EA 3UYCA 1XL9A 1C93A 5HWJA 1NWRA 3SADA 4U33A 3JUGA 3WD0A 3QSTA 3PBYA 2WMIA 2DT3A 4AZ6A 2BY2A 3SAZA 3IVSA 3Q37A 1RK6A 2WWDA 4Q4KA 4HZMA 1UR4A 1H2JA 5A6JA 1TVPA 4GKTA 4GBDA 3P5YA 2A3LA 3PUEA 3V5CA 1G9HA 4A6GA 2MANA 4HN8A 1XSIA 5EU9A 1J4EA 2CKSA 3S5ZA 1U22A 3P0XA 3AOFA 1TR1A 4JKMA 4DNMA 3VK5A 1F6KA 2QQ6A 3VD9A 3SRDA 3LOTA 5HR6A 2HNEA 3OBEA 1BQGA 3P62A 3ARWA 1O94A 3ZO9A 3TSBA 1PX4A 4WDXA 5J5RA 3IIOA 3EPOA 1Q4NX 3QPEA 4XIMA 2NQ9A 3QLLA 3QSRA 3H4GA 4QJ5B 4B15A 5G4WA 5DMLA 4NNAA 4RE0A 3FGCB 2FPTA 1JNDA 3MMWA 1RCQA 4JHZA 1R85A 3MYOA 4G6CA 4YTUA 3VZYA 3AIWA 4GYFA 3O6AA 3QGVA 4KFOA 2A3EA 3CTLA 2EXOA 3WNNA 4O13A 2XGIA 3CZ8A 2PLCA 5CPLA 4OECA 3QKZA 1W3JA 1AQMA 4K2SA 4U2YA 4IMCA 1CLXA 4OV9A 4S39A 1SW0A 1D7KA 5LGZA 3TIMA 7ODCA 3PUDA 5IBXC 4FP1A 4ZODA 4LFYA 1W3HA 4U28A 3SQMA 3FA4A 2BOGX 3N2BA 2VD9A 3V3WA 3MUXA 3MI6A 1R38A 1IE7C 1LORA 5K4ZA 3PPCA 3QZAA 5F2GA 3UR7A 2OO6A 1V51A 3H70A 3RYSA 4D1IA 3O07A 3LBOA 3HPSA 4DM1A 1WNOA 3NM1A 5M2FX 3KOFA 4IWWA 3EXTA 4L4MA 2FFCA 2AQVA 3FNDA 1AA1B 1HW6A 1A0EA 1OY0A 1UBSA 1W1ZA 4YIWA 2QAPA 1UH2A 4O0QA 3T44A 1NQKA 2G5WA 4MOZA 2C8NA 2AKMA 3IEBA 4OTKA 4KWUA 3DHDA 3NYDA 3DGRA 4IQJA 4LX4A 2DVUA 1EJWC 5IDZA 3W81A 1Q7ZA 2PTWA 1U1UA 3PTQA 3SDOA 3PNZA 5G4EA 2FPVA 4QG8A 1EPVA 3CLMA 4IX0A 2QPUA 3SCPA 4G56A 1H0IA 1YNPA 1J6PA 2GUUA 1OF6A 4ZA0A 3W0KA 2FTWA 4D6GA 1KXQA 3G3MA 1HJQA 1SW3A 3I10A 3AXXA 1UZ1A 4FNUA 1IQ8A 4HTBA 4XIAA 1Q6OA 3TOYA 3QYQA 4H9UA 4WUIA 5D4YA 3R8GA 3OG2A 4H9XA 4RDYA 4N9CA 1EGMA 4B9YA 1Y8BA 4GK8A 1XGZA 2TPSA 5IM51 4QP0A 2OQLA 1JZ5A 3E0IA 4GIRA 1U33A 3UWUA 1OM0A 4HSOA 3MB9A 4UMBA 1YADA 1V8EA 4B2DD 3AUOA 1FHUA 1E6SM 3N25A 3CAVA 3R89A 1JYVA 1B3XA 4B3KA 1KFBA 3UR2A 4ZENA 4BF7A 4Q7IA 3GQYA 4A8NA 4QRNA 4RXGA 4PMOA 3R8RA 3P14A 3VIPA 4MFEA 3WEOA 3VMNA 1MRAA 3DBPA 4URIA 3G5EA 4A2RA 4J4KA 1EA9C 1GOXA 1KRBC 4HNCA 3W27A 4S3CA 1IXOA 2OZTA 1W1PA 2J88A 1RPXA 4JFUA 1KQYA 3R7MA 3WLKX 2PDJA 4CD5A 3STFA 1A5BA 1VFMA 1WX0A 3URNA 4B5VA 3RU8X 1ECQA 4DWSB 3DC0A 4O52A 1JYNA 3NAVA 4J27A 3CHFA 4GHRA 1Z32X 5FSEC 2V68A 1AODA 1RBLA 4DPPA 3BSHA 1MUWA 3WUFA 1Q6LA 5CJ5A 3F4WA 1TWSA 4FLSA 1OT2A 1OC5A 5DELA 1JZ4A 3APYA 4IUOA 1FDJA 2VVSA 5AYXA 2R14A 4GVIA 3BXWA 1EJTC 3UR8A 2Y8KA 1Z9AA 2QUTA 3WNPA 4KBXA 3CUZA 4MAZA 3IUIA 1R8LA 4EPBC 3NGFA 1IZJA 1UROA 4PYSA 1HL8A 2ZX7A 1YXCA 2W9MA 3C56A 3MWAA 4US6A 1LUCA 4OBTA 2V0TA 3SCSA 3W1AA 1G94A 3LG3A 4HJWA 4EF9A 3UZ5A 3G1RA 3DYMA 4O1AA 1ISZA 2PGEA 1DPMA 4IH3A 1NM9A 2YCLB 3EEZA 3RM8A 3RF9A 5KITA 3IV3A 5AC8A 3LNMA 1GYNA 4FO4A 1Q6FA 3SCRA 3V5FA 2Q02A 3KRUA 1FH9A 3DX5A 1WPCA 1U5JA 5D2TA 1QCWA 4QCEA 3C5QA 1EJ7L 2R94A 2DVTA 2CXEA 3T40A 4HZ6A 4IFOA 1YNQA 1W9DM 3T09A 1PBGA 4GMEA 3VD5A 4TVUA 4P7QA 5M3WA 1K8YA 1ZP4A 1AUSL 3PF3A 3W75A 1EQPA 3VKCA 1H5VA 4BI7A 1XRTA 2HVNA 2Y0FA 2BX7A 2GGEA 2YB1A 1PWMA 4F79A 1A53A 1R30A 4PUMA 1E4LA 1PKMA 3GTFA 4HCLA 3KTSA 3EKLA 1Q66A 3BG9A 2YJQA 1TCMA 1TV5A 2HJPA 2CEQA 3W7CA 4LJ3A 2ALRA 5J04A 4U3CA 1BAGA 1PIIA 1HFBA 2YCKX 1JDFA 5I3IA 3EWYA 4IUGA 2A2IA 3W7QA 1PHQA 2YL5A 4GLEA 3MSGA 3UZWA 1XIJA 4C7DA 5C9UA 2OWCA 5I2UA 3BWWA 3H7VA 3VM7A 2VRJA 5CC3A 4FI4A 3AIQA 1FRBA 3R58A 3H8AA 4YJ5A 1WZKA 4NRSA 1PIFA 1Y0EA 3AIRA 4JPGA 1NVMA 1C8YA 4AHPA 2QVNA 2XFRA 2BHZA 1CBGA 3MP4A 3GNNA 4PUNA 1RV8A 3AYTA 3TW7A 4TTUA 1OFAA 2O9OA 5ABHA 3LLDA 3L65A 2BNJA 4L1XA 2PP0A 4I90A 1XF0A 4K1WA 3U5YA 4GX9A 3USZA 3HU7A 5I3DA 3CO8A 4Y8EA 4N9BA 1XLBA 4HA3A 2Z0IA 5LXXA 3E5PA 1O66A 5CBJA 4ZOCA 1LOQA 4GUHA 1SFLA 2VQTA 2RKXA 3CWHA 2J8GA 3QOMA 4AD2A 3WUGA 4CD6A 4V15A 3CWNA 5H91A 4DVOA 1W5QA 5LA0A 1WOAA 1SO4A 4S3JA 5CAKA 4IGSA 3WLHA 2GWNA 3GIQA 1DTUA 4JTQA 3PPHA 2CLFA 4PTWA 3NFUA 1PX3A 3B9OA 1GOWA 1UD6A 2FZBA 3PAOA 2PWHA 3EX4A 4Y9MA 2A3CA 4GXPA 4KPLA 4PBGA 3M7SA 1UOZA 4DRSA 1H50A 4JBRA 3OU8A 3N19B 1E5JA 3N9KA 1HKVA 1I0DA 5J8LA 3ZR6A 1BEUA 3ATYA 4Q32A 3ZYZA 1FVPA 3IUDA 4LRSA 3WLSA 5F4SA 2XIOA 2QF8A 3WQ5A 4JYDA 4M7SA 4JQ4A 1OJXA 4ICCX 4DJFC 3CZGA 1KRAC 3GG7A 4Q22A 1KFJA 2VGGA 4O18A 4OIFA 4ML4A 1MUMA 5KSWA 1Q85A 4IFKB 2G37A 3Q94A 1NF7A 4PBEA 1OGGA 4LCRA 3V18A 3T42A 4D6EA 3N4FA 3W7IA 3V5OA 1EJSC 2X16A 2OELA 2CBVA 3KVJA 3IJ8A 1T6MA 2QHAA 1JI2A 4HHHA 5AVNA 3D47A 4O17A 5H8MA 2VL4A 3SI9A 1VCGA 3GH7A 3C61A 3KRZA 2F8QA 2GJPA 2P76A 4Z2IA 1WBJA 4GY0A 3OBKA 3C0JA 3L4UA 3N2XA 4DZIA 1S5WA 2FH8A 2H9AB 4TR9A 3E2SA 2IQDA 1J5SA 1W8SA 3WH8A 1TV7A 3PZIA 2RJGA 5CPQA 3WLMA 4O0ZA 3ARYA 4B9ZA 4D8AA 1W1IE 3WLTA 2QGYA 3I3DA 1QI0A 3EOEA 2QJIA 2MNRA 1F2JA 4JTFA 3QQ1A 4ORIA 1ZHAA 3FJ4A 1G4PA 2Z24A 3GU2A 6PTDA 3WJZA 3PTDA 1H5YA 1REQA 4X61A 4DZAA 4CVWA 2XUCA 1JYXA 4IXXA 1RBAA 1UWQA 3DKLA 4AZHA 4PTNA 4LY4A 2PBOA 2VOTA 3V7PA 1P6WA 1E4NA 1ZJAA 4YCOA 3KHDA 1W37A 1UYQA 2ANUA 1KFEA 1W32A 1EFZA 1TPWA 2WW5A 1TMLA 2WXDM 5C9XA 1A5NC 1W5MA 3R13A 1E70M 1LT7A 4U5IA 4RUBA 5FAGA 2XDFA 3O6CA 4KKXA 1UD8A 2FZ9A 2F38A 1KM4A 3NYZA 1DYSA 1OD0A 3TONA 3W1QA 3B8TA 3S5NA 1K4GA 4UMAA 4TX6A 2QF7A 4MYXA 4RX0A 2J13A 3WQ8A 1X6LA 1AZ1A 2J9XA 1S39A 4E2OA 2Y70A 4KEUA 1CXHA 3GLCA 4ACYA 1EC7A 1LQ0A 3LSCA 2R6OA 3AI0A 1G7UA 2DPEA 1CXLA 1FXQA 2YDQA 3PBWA 4F40A 3AS1A 2NQJA 4IMAA 5DCDA 1XS2A 3EKZA 2FHBA 4I6KA 1RQBA 1CX9A 2CLKA 3H6OA 4HOWA 2PCQA 1O95A 3AS2A 3CL7A 4GI9A 3TWAA 1S2VA 2D24A 4DEFA 2G3IA 4YN5A 4M0XA 4GISA 1NQ6A 1KC7A 1QNOA 2VCBA 1P6BA 1BRLA 1F4AA 1XRVA 3ITGA 2WPBA 3IPWA 1L2UA 4EK7A 2A1YA 2IXVA 2ZE0A 2ZVRA 5H8PA 1I9CB 5I77A 1A5CA 1TTIA 1B90A 2JIWA 4PL2A 2PAJA 2YL9A 1VBUA 3WENA 2J25A 4KGLA 3T0TA 2XIBA 3ICJA 3W1MA 4UQCA 1C8XA 4N7QA 4S1FA 3UPMA 2REQA 2XPKA 1JZ7A 2J24A 3ARVA 2BY0A 3BARA 4F2BA 5FF4A 1HO1A 4F0HA 1DQUA 3FCPA 4HZ8A 4LUJA 3NDYA 2Q09A 3LRKA 2EKGA 4PB5A 3TW6A 1X6UA 2R82A 3BZJA 5C70A 2GDVA 4L4OA 2VR5A 2GPTA 2C0AA 4PODA 5HPOA 3DFNA 1NP0A 3TAOA 4GJ1A 2F6XA 3NQBA 1LTDA 4O53A 3ES8A 4EACA 3WF2A 1Y5WA 1MDLA 1OYCA 1SFSA 3E96A 4RK8A 1RCOB 1SJAA 4XZBA 3MHFA 3WQ6A 3BMXA 3BOFA 3RLGA 1G7VA 3T0DA 1UKPA 3GZ3A 1HN1A 3W71A 4C90A 1UKQA 2FB2A 1VFLA 4IIBA 2WSPA 1IV8A 4QLLA 2PODA 5C54A 4YL2A 4AF0B 1UD5A 4YS1A 1HG3A 4W87A 1S1PA 1VFFA 1XYBA 4OKDA 3A23A 2NSOA 1RVGA 5AC5A 2WM1A 4LF1A 4PTMA 3VCCA 1WDWA 5D2YA 2BXYA 3WBAA 4JYFA 1PX8A 4QHRA 3TTYA 3V1HA 5FF7A 4HNNA 4NXKA 2VCAA 2CZ5A 4KWVA 2VC7A 3EKGA 1UP0A 4GQRA 1TA3B 1NWSA 4XVEA 4J3ZA 1B3VA 3SY5A 5FESA 1VFHA 4BEUA 3V0SA 1O60A 1R3RA 1PDYA 4UFKA 3TYBA 4EPKA 2PA6A 3GAKA 3LLFA 3MU7A 3QW4B 3JS3A 1OX4B 4YTRA 2VCCA 2CC0A 1A3HA 2EG6A 3BURA 4EVZA 1NSJA 4ZSUA 4W8LA 4YVPA 4IMDA 1Q6QA 3VIIA 4QAIA 1FWDC 1XG4A 3UERA 2BOEX 4NYUA 2GGHA 4JTLA 2FVMA 4Q7NA 2NSXA 3EPMA 1LRQA 1TWDA 4QR6A 1X98A 1GOQA 3MQTA 3QF0A 3CBWA 5KINA 4X2PA 3N73A 5HUPA 3UD6A 1V6VA 3WDPP 4XVDA 5D32A 3RRAA 2O9RA 1TFVA 4F2UA 5LGXA 3GUGA 4IPIA 1G0CA 1UJPA 1EB3A 1GT8A 4M6QA 3O06A 3UFYA 3GR8A 1Z89A 1V0MA 2JF7A 2G41A 4HNUA 3AJ7A 1WOBA 4AEFA 4PCNA 2YXGA 1ICSA 3MSRA 1EYWA 1A4LA 3THCA 1XH0A 3G6LA 2XM1A 4PMVA 2XGBA 4Z0JA 3FK4A 3W88A 3GKFA 2G0WA 3N1AA 2MUCA 3ATZA 3F5KA 1W9VA 1EBHA 3NJ3A 3G1VA 3JR2A 1CENA 4QS6A 1LRNA 3AFBA 4IGHA 6REQB 5LXEA 5AYYA 5D2VA 1M6JA 4K3ZA 3ZMRA 1ZFJA 1U30A 3EBVA 3QFEA 1QHOA 3QMSA 4Q8OA 4W5UA 5MKGA 4HPXA 4JDBA 4RNJA 3SQSA 3QJAA 1FWRA 2PU0A 2FJKA 2C18A 5A69A 4PE8A 3AZTA 3BOXA 4CU6A 3MVTA 4NJIA 3TZFA 1I45A 4DBUA 2WJZA 2PP1A 4DI8A 4LXFA 3ZZ1A 3WN6A 4YCPA 4EWJA 3W2KA 4LUIA 3QQ0A 3S2JA 3MY9A 1J0JA 3NURA 1EP3A 4ZQMA 2E8ZA 3GUWA 4DQWA 4JD4A 1DORA 1EOMA 2GUYA 4Z2LA 2VFEA 1SW7A 4MB1A 2QCMA 1DE5A 1VRXA 1EL3A 4KQNA 3LQGA 4I9JA 1F76A 3B8VA 3GAYA 5A2AA 1XLDA 3KLKA 3G0UA 3W2JA 1J96A 4IG2B 5FJPA 1EO5A 1QPRA 3LUTA 4WZHA 4QGCA 1B30A 4AZGA 3IJLA 1B31A 3G0SA 4EPDC 3CUIA 1JDAA 1GQIA 1VLWA 3G1DA 3E6EA 2XVNA 4JTTA 3KCJA 4UTTC 5HNTA 1QPOA 1ZB5A 3G8EA 4MNKA 4D6HA 1Z6KA 4F8XA 5K9CA 3FYOA 4MLJA 2PEVA 3R43A 5HPCA 1E1CA 4M81A 1H1ZA 2V69A 3GIPA 4TUFA 3DG6A 4NAEA 4XO6A 3GHRA 4P2VA 4KFNA 2Z25A 4QSHA 1BHGA 3W87A 4HVXA 4B5UA 5H8UA 3S47A 4YPJA 4LU0A 5F2MA 1OIMA 4Q6XA 4G5DA 1EDQA 2DUZA 1XIHA 4DO7A 3HIJA 2CLMA 3HQPA 3ABRA 3B0PA 5AC4A 3L4XA 3V16A 4DELA 5BZAA 3VD4A 1DJZA 4NJHA 1VJZA 3IGXA 4JFVA 1I0BA 3W7GA 1G6CA 1EZWA 4N2YA 1OCJA 3LPPA 1F5ZA 4Q8TA 4HOZA 8RUCA 2Z2UA 3UU0A 2TAAA 2VRKA 1VRDA 1MO0A 4KS0A 1KLZA 4JQ2A 3ME3A 5HJYA 1TB3A 2QCGA 1I2OA 1VEMA 4Q7BA 3UNTA 1S2WA 4B4FA 3B9EA 5BWAA 4AAJA 1THFD 2WMIB 1A5UA 1WUEA 2W62A 1W1A1 1Q8JA 2P3EA 4CNUA 1UMYA 1ISVA 3NQCA 1TPFA 3PZQA 4WHBA 3GBEA 1XKJA 1OFEA 2VZTA 5LZLA 1QPQA 3LHUA 3K8MA 3RX2A 1UG6A 1E6ZA 3GDBA 1JGMA 1SU5A 3BW3A 3M47A 2C1HA 3PZGA 1KM2A 1RP9A 3C2FA 2DW6A 2AKZA 3S1UA 3MJYA 3WJXA 3GFXA 3NVDA 4Q8NA 3TA9A 4CCZA 1V0KA 1UH3A 1U5VA 1KFLA 4WKFA 1ZQ5A 4UTWC 2A5HA 4F3HA 4MLRA 3H12A 3LHYA 4EWND 3GR7A 4XD4A 2AMXA 3FGCA 2ODOA 4DXVA 4XX6A 1KTCA 2OGYA 2VRQA 1WXJA 3GTXA 2EO7A 2XN2A 5DEZA 2DIJA 4EE9A 3CL8A 3MUZ1 3FEMA 3SGGA 1FFRA 3R0DA 1GQKA 4RKAA 3LCIA 1R3QA 2PDIA 1Z3NA 3PBVA 3S1GA 3HO8A 4YHGA 3TVAA 1W9UA 1Q6EA 3VX1A 2AAMA 4ONVA 2NUWA 3TCEA 2QUMA 3VMPA 1EF2A 4K8GA 4PRTA 1UKOA 1JL8A 1XC4A 2J7CA 1TJ2A 1WV2A 4MIMA 3W7EA 2X0SA 2ZA1A 1TV4A 2IUZA 1IGWA 2P53A 3NCOA 3Q67A 1JF5A 4EXAA 3MMTA 1KM1A 4MTVA 2CITA 2VC9A 1QWKA 5BRQA 3WBEA 1ENUA 1PKLA 2ZTKA 1F8IA 3VCNA 2QT3A 3GDMA 3LX9A 5DO8A 3H2MA 4O4WA 1UW9A 4M1RA 4WQ6A 2J7FA 1TELA 3QTPA 1E6XM 5LIKX 2RDUA 3BDKA 3J7HA 3SUSA 3DDMA 2PSNA 1K7XA 1KBIA 3DG3A 1IEQA 1RQHA 2XSBA 3FAXA 4C1KA 3TTEA 4H8HA 1LOLA 3ZJ6A 3VYLA 2E40A 3OP2A 1TX2A 1I75A 4K8HA 3BCJA 3PPFA 1BYBA 5CPTA 2Y89A 4C7FA 3CMJA 1TUFA 4ZQPA 2IS7A 3BG5A 1Y5VA 1E4IA 2DSUA 1TR9A 3B06A 4NVTA 4JNZA 5DT5A 1BLIA 5AHEA 2CZEA 2NQLA 3BL3A 3U2CA 2WAGA 1HIZA 3SCVA 1DHPA 4B5TA 1VFOA 1RLCL 4KH2A 1ODUA 1FY6A 4A3UA 5BNKA 3S6OA 4QX4A 3V0TA 2ZRYA 2PWUA 4UCGA 1M5WA 3CK5A 3FS2A 3UZJA 1WDSA 4BI5A 2XIMA 4J1OA 3A4WA 5C7HA 4DXKA 4BWLA 3HJZA 3KFTA 2X40A 1W8GA 1VZWA 5HNUA 4ZO7A 4Q3MA 1HXJA 3WF4A 3B9DA 4NILA 4HPJA 1KNWA 1VEOA 3W4RA 3KL5A 3M6DA 1WDRA 1W3NA 1DL3A 1UR9A 3CHEA 3VOHA 1OGSA 1F4HA 1KV8A 2YIHA 1B1YA 4QG9A 2XWEA 4HIBA 1QHZA 4JIEA 4UFMA 3M6YA 4XISA 1H41A 2A6NA 2DSVA 5A6BD 1V3MA 2D2GA 4JIRA 2IPFA 1OG0A 2PI6A 1KFKA 1OHLA 1SJCA 3A4JA 1W9XA 3EWWA 4H7VA 4S3AA 5CQ1A 4XK2A 3T2QA 1NOFA 3QGAC 2CNCA 4DWSA 3CHVA 3L0NA 2QDHA 3U2ZA 2BGNE 1EWDA 1QVBA 2VEKA 1WCGA 4O19A 4UR8A 1IT8A 2B31A 2ESCA 1WXYA 2TRSA 4HQVA 1ZS2A 2FIQA 2QZRA 4ILSA 2C16A 2J6VA 1HJWA 1P0EA 3PBMA 6A3HA 4K38A 5E9AA 3KCLA 1S1RA 1XLJA 5EBUA 2X8RA 1DJGA 3ZR4A 2QJMA 3FKRA 4JGDA 1SJDA 1EX5A 3O9NA 1XLHA 3S1XA 3GG8A 3DESA 4MDPA 5FA5A 1OYBA 1F8MA 2G3FA 3CU2A 4K7VA 4WDTA 4JQ1A 5CAHA 4P8XA 4W7UA 1EOKA 1RSCA 4GO8A 3GO2A 2NUYA 4IJRA 3PSWA 3NOYA 3EXRA 4Y8FA 3QOKA 1A47A 3BLIA 4GQBA 2YCLA 1DWHM 1WB0A 9XIMA 4DO4A 1Z8AA 6XIAA 1N8FA 3OBAA 2QCHA 3N17A 1OT1A 3H7RA 3TXZA 3CIXA 1QT1A 3ORWA 3L5AA 3VZZA 3V75A 4E38A 1B3WA 1BVZA 3LCHA 4R85A 3ARTA 3DEQA 2ZA3A 1YLVA 4LNCA 2PWGA 4JTSA 4ZVJA 2WJDA 2V81A 1W56A 1EXBA 3HMCA 3LCGA 3CC1A 3OZPA 3UXDA 5LNWA 4PCTA 4HP5A 1J10A 3W1TA 3M41A 3MA8A 3BCDA 2OOGA 1XLFA 3EA1A 3GHUA 3WCZA 2Z7KA 2Q8ZA 4US5A 4CN4A 4GACA 2CLLA 3MUIA 2QMKA 3L23A 5CPMA 1W3TA 1EJUC 4NAFA 1E0UA 4J7RA 2NX3A 2BG5A 2VNCA 3NSNA 2HE8A 1GPWA 3A6OA 3GX9A 1NFBA 3PJUA 4P5UA 3KDNA 3R11A 5FD0A 5C6MA 3ITLA 3GC2A 2GVYA 3U5UA 2OEMA 3A12A 1PWLA 2Y62A 3MZNA 1NWTA 3TN6A 3NPXA 3MBFA 4HYRA 3FAWA 2G3MA 2EG8A 1UR1A 4JEJA 2Q01A 4YNGA 5ABGA 3ZQ9A 2HS8A 3TH6A 3W1RA 4C6DA 2PF0A 3LM3A 2OT1A 3KL0A 1SFJA 3B0VC 5EB8A 1H3GA 3W6MA 1JPIA 1GVRA 4BF5A 4OGZA 4RV8A 3WDJA 3PTKA 2CW6A 4LUSB 4M24A 4E4UA 4EX4A 4CU8A 4LCSA 3CUHA 2QCEA 1YPFA 1AJ0A 3RJYA 1JZ2A 3W1UA 1L6YA 3BMWA 1PKNA 5M1TA 2C91A 4TVDA 3PFRA 1LBMA 3VGDA 2YBUA 4H8NA 2E9BA 2OXNA 4GQ0A 1I6NA 2QIWA 3ALFA 1DOSA 3TW9A 5JUVA 4NNCA 1VS1A 1HJVA 1QUMA 3M0LA 3EA2A 4DIAA 2PZNA 4GABA 4GXMA 3QC0A 2FTYA 1OK4A 1EXPA 3O0FA 1W1VA 4R5EA 4BF9A 1Z7AA 4IQDA 1I60A 2O9TA 3ZT5A 1HKJA 3WEMA 3DI1A 4QAWA 1KXHA 3PWAA 1UR2A 5AY7A 3NQMA 2L5HA 3LHZA 2ZADA 2Z27A 3W1NA 3CPRA 4AB4A 3EEGA 1IXNA 1RD5A 1XGDA 2WVVA 3A47A 2QPSA 3UWEA 1EPXA 4AD4A 4WSKA 4JN8A 1H63A 3QV6A 1SMAA 4FNQA 1SUXA 3M7WA 1EUAA 1T8QA 4MKSA 2WKJA 4A3RA 4C6BA 4FA3A 1BKSA 3CLWA 3EGJA 3OHMB 4BCEA 4LGXA 3GFZA 2PDKA 1JZ8A 1F74A 3DFPA 3GHSA 3B8DA 3STCA 4C6QA 2HQAA 3LERA 4GY1A 1GGOA 1RCXB 1CLKA 4UFJA 3H2CA 4I9MA 1MEWA 3RFAA 2DZXA 1DJHA 1G01A 3DFYA 3K1DA 3NZQA 1J11A 3GYEA 4RW3A 3S1WA 4IFKA 4IPNB 3ARXA 3S6TA 2ZXQA 4O11A 4EAYA 1JYWA 1I4NA 2W27A 2XVPA 3WQ4A 1KKRA 1OYAA 4DBWA 8XIAA 4GUIA 3OYXA 1R9ZA 2YCIX 3QH2A 3NQEA 4U2ZA 4Z2KA 1GVYA 3PAJA 2WHJA 1ISYA 4ERAA 3DOPA 4GVFA 2YYTA 1UWTA 4AXKA 5M5DA 4XAFA 4J5NA 3QZ6A 1FWWA 3QR1A 3WK3A 1QPKA 3WELA 4JIIX 4HHMA 4DYKA 2O4MA 2JKPA 1Q2SA 4ZE5A 4C6NA 2G3NA 1WZAA 3STGA 4C1LA 4Y9AA 3LK6A 3QXBA 3GXNA 4UWMA 1JDEA 1UR8A 3N2CA 5D9PA 3ZWTA 3K30A 2J74A 1DQXA 4GI4A 5FF0A 4WDUA 5E6YA 3O6DA 1V02E 1JIBA 5T26A 4I8YA 4LUYA 1EGZA 1JUKA 3TDFA 2X05A 3VUPA 1TPH1 1YQ2A 1WA3A 3IUHA 2WLZA 3KW3A 3FVDA 1X7FA 1H7WA 3THQA 1EH9A 1YMYA 3ITVA 4XD3A 3VDGA 2WMHA 4O12A 1XUUA 2JBMA 3LGEA 1E9YB 3LY0A 3DENA 2YZRA 1CECA 1V6TA 3GNDA 2C6QA 4RZ6A 1XFBA 1A5AA 2CWXA 4LUTA 4EAMA 1CXIA 1E0TA 5AYIA 1G1YA 4Q4OA 4K7YA 1DVJA 2OU4A 2R1KA 3WD2A 1BGGA 3PG8A 3TX9A 4JQ3A 2AQWA 4TV6A 5A6LA 5E5CA 5A8QA 2WCSA 2OODA 4BFAA 3C3NA 1XIIA 2GJXA 2DZSA 2PC4A 3TTOA 3FIGA 5CSUA 3A21A 1ZUAX 5JBEA 1DP0A 1LG1A 4HU4A 3OLDA 3CXOA 2WV8A 3LCFA 2DQWA 4ZEPA 1R46A 3ONCA 2BVTA 3NZPA 8TIMA 1CI1A 1F3EA 1NP2A 3EMQA 3LRLA 1ME8A 4DYJA 1JUEA 4OUIA 5C9RA 2E6YA 4P7RA 4MKVA 3P3BA 2I17A 5G4HC 4F48A 4D6IA 1GEQA 5CC7A 1K02A 4DF1A 3B8IA 2BOFX 1BRLB 4KWOA 3HQNA 1J9YA 3N12A 2Z28A 3AWOA 3GU1A 4FR6A 2W4XA 4QG6A 1HKIA 3BLKA 1OX5A 1TWWA 2HRWA 3BAKA 4BQ4A 1FDZA 1EP1A 2BVWA 4I5RA 1K7FA 4C6IA 3HGJA 3C52A 1UH4A 3I65A 2WHLA 4QDPA 1XGEA 3N4EA 4UQEA 5BXRA 3W22A 3P0WA 9CGTA 2REQB 4CD7A 2F2KA 4LOCA 1S3TC 3QVQA 3P6LA 3HMJG 4LAZA 1GTHA 1FQ0A 1HO4A 2NV9A 3TC3A 3TYEA 1OB0A 3UJFA 3EMZA 3W02A 1BGAA 1IIGA 3NUKA 3UWYA 3ZM8A 2YB4A 3APTA 3KBSA 4UTUA 5K2ZA 4M3PA 1G69A 3LSBA 2VHLA 3I4EA 2YA0A 3D3FA 3L9CA 2NT0A 3QY8A 3UA3A 4U4MA 2V5LA 3LNPA 3GS6A 3WDHA 3U9IA 2UV8G 4MWAA 3CZJA 3M5ZA 4HK5A 3WLOA 3T07A 3BUVA 2XH7A 3R10A 5FEPA 2XZ9A 3F4VA 2HBVA 3VIKA 1CNVA 1VFTA 3AIBA 2V5DA 3AUJA 5G1YA 1E6NA 4MNMA 5T8GA 8XIMA 1WZMA 3C0SA 4JKKA 4QE5A 3WD3A 1JRBA 4GVHA 3H7UA 4AF0A 5EFFA 3LB0A 1UIPA 1HX0A 4JEQA 4O16A 1TMQA 3T7VA 3W01A 2QMJA 2IPJA 5ENLA 3WH7A 2ZOXA 1JAEA 1ZLPA 2YCEA 3K4AA 4IX2A 2PRMA 1NWUA 1SO5A 1XD1A 3KM8A 3NPUA 1WUFA 3KBJA 1GOOA 3AHYA 5AC6A 1ZJIA 3P93A 4L9ZA 1EDTA 2XJ7A 1J6OA 2FJUB 4PN2A 3OLEA 4RLIA 2WZIA 2VI0A 2P0OA 1QPNA 3H4WA 2ZUNA 3A5VA 3GG1A 3MPGA 3OZMA 1ZAHA 4CNOA 1N82A 3XIMA 4C6FA 3OVPA 2I5GA 3QHNA 5FACA 4H6KA 3NQ6A 3I3EA 1CGXA 1J0KA 1KGWA 1R9YA 3QYSA 1O7AA 4JYEA 3HV9A 3UCDA 4UQBA 2WVTA 1Y5XA 1GZGA 3C4UA 1UUQA 3GXMA 5F1UA 1OADA 4A8RA 3OA5A 3NQAA 1TQJA 3SCTA 2DSZA 1ZBVA 1ZGDA 5LNRA 4LS0A 5TD4A 3HZ3A 2YBTA 3CS2A 4IPLA 1X7IA 3WF1A 3BV4A 3LA4A 2J4GA 3BAIA 1HNYA 3REQA 2ZZ7A 4Y9NA 2C79A 3WY1A 1LWHA 3I3BA 3W7MA 3RMEA 2VT0A 3G1XA 2H6RA 3B4YA 3ABXA 2AMGA 3D6NA 3KXQA 3SCWA 4EPEC 1ITUA 2A3AA 2DZBA 4H6RA 3UA4A 3B9NA 3QY7A 3VDBA 1IWAA 1SZGA 3EDEA 3W2MA 1OWQA 4C7GA 5D9OA 1HGYA 3A4AA 3WDIA 1VFSA 3EDDA 3QPYA 4W85A 4JX5A 3GVRA 3BLPX 4D6FA 2QYGA 3EMCA 4A4AA 1CLVA 4Q8WA 1MZRA 4PUUA 9XIAA 2GYIA 2HDJA 2YBVA 1R47A 3O6YX 1I8JA 3GIYA 1FWEC 2J6XA 1JEZA 5MKGB 4E8CA 4ZTYA 5C7VA 3XINA 2GWGA 4W93A 3PBGA 3KL3A 4MVAA 2HS6A 4UTWA 4TX8A 3W25A 3PZMA 4HN4A 3H2OA 4CEUC 4LAMA 2ZDRA 5HNRA 4P8UA 4UB9A 1E6QM 1W17A 4MADA 3WQOA 2OGJA 5I24A 2ZQ0A 3M0HA 3RR4A 2PC8A 3GVQA 5CZTA 2Q71A 5I0DA 3BGJA 2QKFA 2E9LA 3WMSA 3NL3A 4EIVA 1OC7A 3PZVA 1FWSA 2WC4A 2QEZA 2B7OA 1G4TA 3CYVA 3PJTA 4W7VA 2GDQA 3T0AA 3SW6A 2JK2A 1H62A 4IG2A 3LTPA 1XDJA 2IPWA 1H1YA 5ABFB 1TV3A 2WVUA 2A85A 3KVMA 5D33A 3BGAA 4C6JA 3MSDA 4KRZA 3GNRA 2QGHA 3NO3A 3O3RA 4MUZA 4OVXA 4WVXA 1ZCOA 3TFCA 1CYGA 4YYCA 4ATDA 3MV11 3S5OA 1XXXA 1VJSA 3STEA 1PTAA 3QHOA 3NL5A 2NV2A 2NLYA 4PTVA 1I1XA 2BXZA 1E1CB 1FUYA 2PP3A 2Y7FA 1FWGC 5G1MA 1DJNA 3FHAA 3G2GA 4HMCA 4EP8C 3LMYA 1BXCA 3PC0A 5E9XA 3W28A 1DBTA 4HU8A 4RDVA 4MWAD 1L2QA 3T8LA 1UZ4A 1JG9A 1WP6A 1SZRA 5CZJA 2PF8A 4ROPA 3FJNA 3I68A 1F07A 3VAVA 4DHGA 4M7TA 1X39A 1KCKA 5D05A 3INPA 2POTA 1H4PA 3PSVA 1JCLA 3LBCA 4J3TA 1GQJA 3OPSA 2D2JA 2VUNA 4AIUA 4O4VA 1FHVA 3OHIA 3G1FA 4EANA 4QCFA 6TAAA 4JQAA 2OSXA 2JIEA 4V33A 1Q6DA 3NZRA 4XAGA 2QNEA 1S5VA 5AVHA 3W07A 4K36A 3ZOAA 3U2OA 1SGJA 3MUY1 4XZ9A 2PRLA 4F2TA 3U8GA 3KP1A 4GH3A 3BK0A 3LV6A 3TEVA 1OCQA 4F0MA 4UTTA 1MDRA 1KKOA 1VB9A 3DECA 4HPGA 2XN0A 1XLIA 1GCYA 4AMCA 4FXJA 5H1WA 1E3XA 4M6PA 5E0KA 4QIUA 1JPHA 3ES7A 2YA1A 1NF0A 2OYLA 1TVNA 3WL1A 1UIOA 5HQLA 2WBGA 1LT8A 4JOMA 1FWTA 2ZX5A 2Y85A 3SUUA 4GVGA 2QUVA 5T9BG 3BZGA 3URBA 1J93A 1TVLA 2DZPA 2OO0A 1UKSA 3C0LA 3SCUA 2SFPA 4R7WA 3ZJ7A 4Q4PA 2D2OA 3NOEA 1ISXA 1LF1A 2XIQA 5BW6A 3BAYA 1BWVA 1XISA 4GJIA 1DJXA 1D7FA 1QDSA 2POZA 4M6UA 3WJSA 1ICQA 3U48A 3UG4A 3UCQA 2BODX 2F84A 2OSYA 3AMKA 3L4TA 3N29A 1G4EA 4JTJA 3HM7A 4HMNA 1DWJM 3TYDA 5BU6A 1KM5A 3A3WA 2OT0A 3C0QA 4XAPA 2BBFA 2E5CA 2QJJA 3CV6A 1DV7A 3V1PA 4C6KA 3SSZA 3W3OA 1B3OA 2DSWA 4HB7A 5AFDA 3IWPA 2VMFA 3RM4A 3MCNA 1A0DA 1FXPA 3LPOA 3HTWA 2CLPA 2CETA 3CV7A 2BP1A 3WK0A 4YMZA 4Q4QA 3TNOA 4ZB0A 4G2DA 1ZBCA 3NEHA 3VOFA 2X09A 2J8TA 3SCQA 4O1EA 4AZ5A 3OIXA 3VIOA 3W1LA 4L4LA 3MI3A 4I5UA 4LQ1A 3PJXA 4AIEA 1ZRQA 1LQ2A 4JICA 4CQ9A 3VIMA 3KUMA 1GHSA 2DVXA 2R24A 2Y6ZA 4D8ZA 3LI0A 3WQEA 1JUBA 4ACZA 5IDIA 3UWWA 3GRIA 4A21A 4CQCA 3ABZA 1VHCA 4M51A 1H49A 3KTCA 1X8CA 4AD1A 2C1GA 1D9EA 4MKNA 3UJEA 2A7PA 1DKWA 3ONBA 4D71A 1GVQA 1Q8AA 1GOKA 3QW3A 4NRRA 2DJXA 1PTGA 4TV5A 2QCDA 4GGHA 1PVNA 5H2ZA 4M56A 1FHDA 5DF0A 1YDVA 4XG1A 4W8BA 2CWNA 2W3ZA 5D8ZA 1K03A 2NWSA 3LQLA 1XHGA 1P0NA 1R2TA 2WQPA 1US0A 1LCOA 3B03A 3MKVA 1P0BA 2YSWA 4NI8A 4P8VA 4Z1CA 6TIMA 5B7YA 2ZX9A 1VH7A 4C91A 4L64A 5I5RA 3BTNA 3WMLA 2NQ5A 4GKLA 4S38A 3L12A 4BQ3A 3VX0A 1GVEA 4KEZA 3W6LA 2UZ9A 1LWIA 4WLCA 4O10A 5EMYA 4TXEA 2PTDA 3B8SA 4LB4A 2BWGA 3MDWA 4GQGA 1GHRA 1ZAJA 4NZCA 1G4SA 4XAZA 4NZ1A 3R25A 2ZUVA 2RHGA 4G8TA 3SSJA 1H7XA 1IIHA 5HMEA 1AD4A 3S83A 3H4XA 4PC8A 4JTDA 1TRDA 2PWVA 1JDCA 2D0GA 1O1HA 2BSLA 1KGUA 3M1ZA 2G4FA 4XZIA 1XBYA 1Q63A 2DZTA 2HNHA 1E9IA 4AD5A 1XG3A 3LDVA 4ZXOA 4CQBA 4QS5A 1D3GA 1XYAA 3LEPA 4DI9A 5D02A 3SRKA 3KVKA 1TWIA 3OQEA 4FSAA 3SGZA 4NP7A 4IGMA 4BI6A 1D8CA 4KEMA 3PNUA 1GOMA 7ENLA 2Q6ZA 1W3KA 1DJIA 3S4TA 2HPMA 1S2AA 2Y2WA 5TIMA 1IGSA 3UYIA 3PR2A 4ZOAA 1S5TA 4IOTA 4YHEA 3MT1A 5A95A 3AAMA 4X3ZA 2V2CA 3H2EA 4J35A 3EAUA 4QEHA 1DIOA 2PDWA 4UTHA 4UOJA 1HKWA 2EPMX 3SN1A 1KCXA 5MF5A 4XQ6A 4AQLA 4HJFA 1ONWA 2QVHA 1P4CA 3VI2A 2OZ0A 4IHCA 3TU9A 1KW1A 3ABOA 2HCVA 3VKBA 4KRUA 1OIFA 3ENLA 2GVLA 5FJRA 1CXFA 1K6WA 4NUWA 4UR7A 4IIEA 1OFPA 4POCA 4C6PA 2HROA 4Z42C 1S5MA 1FP9A 3TR2A 2O7QA 4D6CA 1YHTA 4XZMX 1T40A 5ECVA 3NGJA 4NKCA 3BH4A 4L1WA 2WCGA 3O15A 3TK7A 1QU4A 1W1B1 3BC9A 3KE0A 4HMEA 4A05A 1M1BA 3LD5A 3M0MA 2XGZA 4QNWA 3RR1A 1J18A 1E1EA 3GG0A 2DZAA 3L21A 5FJIA 1M7JA 4LWWA 1EC8A 4YVXA 2JGQA 3AS0A 3CPUA 2KZHA 4DJFD 7XIMA 3EB4A 2RUSA 3FX4A 3VE9A 3IAQA 3NO1A 3RUBL 3UGRA 2VFFA 2OKTA 1ZALA 3L5MA 4JX4A 4ZO9A 1XC6A 4NZ5A 4WY0B 1K9EA 3R0KA 1J01A 1SVDA 3NL2A 4LYQA 5HWNA 5BYWA 3OA3A 1JCJA 3EDJA 5FL1A 2J79A 2P3ZA 5K9XA 2WNWA 2I5IA 3EX2A 1TPVA 4TOQA 3VTRA 3T2PA 4R9XA 1W3LA 2PWDA 3KAOA 3PUOA 4PEKA 6ENLA 5AZ0A 4A35A 1AH0A 3A64A 3TTSA 2Z7GA 4RW5A 2FGLA 1ISWA 1IWBA 3OO2A 5AECA 4V27A 4W86A 5A3HA 1R6WA 4PCFA 1FH7A 3EOOA 1BWLA 1KR1A 3IJ9A 3WNKA 2TSYA 3DCPA 1YIXA 3SGUA 3B3DA 3UWQA 3WF3A 1F05A 3NR0A 2GOUA 1VP5A 3JVAA 2W79A 5A94A 4NAFB 2CHOA 3L4ZA 4GZIA 4A29A 5DBUA 3RPMA 3VINA 2VDHA 1QW7A 2X2GA 4BS0A 4GC3A 1H0GA 3QLDA 2P5NA 1NOWA 1GORA 2ZUWA 3BW4A 1QNVA 3AIUA 5C8BB 1GEHA 4FEZA 2XU2A 2YL6A 1DHKA 1OEPA 1XLLA 4O15A 2RFGA 5L6UA 5A6BA 5LIXX 2YDSA 4NNBA 2C14A 2VELA 1TREA 2DIEA 3L2MA 3LS9A 4E8DA 3G8RA 3FDGA 2BDQA 5A2BA 1VENA 2OLHA 1UQYA 4LUSA 4KIRA 3N15A 3RCNA 4PTXA 3QKEA 2V5JA 4AX7A 2NW0A 3RLHA 4ZL1A 3FW6A 2DSKA 1H7OA 5HJXA 4GUGA 4DWSD 4FLQA 1H61A 1QR7A 3N9RA 3O63A 1CGTA 3NNTA 1V7YA 2RDTA 3EX3A 3B05A 2HTMA 3AICA 2V82A 3LCWA 4OOUA 1R5YA 2WKLA 3CQKA 3ZIZA 1RA5A 5BCAA 4A3YA 3K8LA 5BOEA 2Z29A 1KRMA 1TMHA 2E1WA 1ZU8A 3MS8A 5IBXA 1IXQA 3OVQA 3M0XA 1EHAA 3TN5A 1YX1A 5I3JA 3EWXA 3NQVA 5CPSA 1GJUA 1KLYA 4I3GA 2W63A 4W8AA 2QR6A 1BQCA 3WQGA 2A6LA 3BAWA 5AYZA 4QITA 1IF2A 3GNOA 1YXDA 2GFTA 4NHVA 5KEZA 4O1DA 2WVVB 1RJRA 3WD1A 4P7LA 2XWDA 3EPNA 1TYGA 2J7BA 1E3ZA 2GZXA 3L5LA 4UQDA 2XSXA 4OFCA 3MKCA 3F2CA 3LXCA 2E9MA 5F4WA 4ADSA 1ADSA 4JL2A 4QNEA 2QW5A 1QBBA 4H4IA 3N11A 2E09A 1GOIA 3PM6A 4H2HA 5SWUA 3T9PA 4H19A 1JCTA 4H6EA 3RAOA 4NU7A 3L67A 4GIEA 4OT7A 3LXBA 3WH9A 4FIQA 1Q7MA 3C8NA 4UQ9A 1S38A 5IFPA 4XSLA 1V6UA 2WANA 5IRPA 3GC4A 3VIHA 3SM0A 2XG9A 3NZGA 2FQIA 2P88A 2PGRA 3THUA 1XDLA 1SSGA 3F5LA 4UOZA 5DXYA 1LP6A 4PTDA 3C86A 3E0LA 4AZ7A 4UNLA 2PDGA 3I4KA 3ZR5A 1BFNA 3BQ5A 2VGIA 4H9VA 2WKGA 3P84A 3FY1A 3P80A 5D2XA 3CHDA 3WQCA 4AWTA 3BV7A 2J75A 1J0HA 3F2BA 5JH2A 3W23A 3AXHA 2VP8A 3SRFA 2ISFA 3D46A 3MKKA 2Y88A 2E68A 1QI5A 2OWXA 4CNNA 3U4FA 5F2IA 2RDXA 2AGKA 1MRQA 1L0PA 4CGTA 2GK1B 4IIHA 3N13A 2OX1A 2VQUA 1K3UA 2WSQA 4MAVA 1TIWA 4C5YA 3B4UA 5HMDA 2XH0A 3GDLA 3TQVA 2ZRWA 1FTXA 5DY3A 2BS9A 1K8XA 1S3HA 3GD6A 4JFWA 3EYPA 5I6SA 2PURA 2C15A 1KFCA 3NO5A 3VNKA 4Z2JA 3XISA 1BKHA 5D09A 3U0HA 4AWSA 4JX6A 2OTDA 2PDFA 3W7RA 2Y5SA 2FVKA 3VNZA 4XZNX 2RGMA 3YPIA 5DXXA 1OCNA 4HMDA 1EZ2A 2GGGA 4Z2GA 1DJYA 3WLPA 1CIUA 3N14A 4LUTB 1V6YA 1XIFA 3WLRA 4DJDC 2A7NA 4R33A 4DJEC 1VPXA 2KAUC 3MBDA 4TVCA 2X0HA 2ZUMA 1VGAA 3B97A 5GNXA 4W9TA 2ZUSA 1TJ1A 3S5SA 1D3CA 3CHCA 3VM5A 3UXLA 1V7AA 2ZXBA 2VC5A 1NIUA 5DMYA 3AZSA 6ALDA 2QCFA 5FJJA 2HK0A 3RRXA 4DAFA 3TKFA 1VJIA 2JF6A 2GJXB 2YW3A 3CT2A 1WQ5A 1F6YA 3W53A 3F5JA 1KBKA 4FMVA 2YPIA 4FNSA 1E51A 3O16A 1O1ZA 4US5D 4PFMA 2ACQA 3WK1A 3JZUA 1E6PA 2WMGA 4I8DA 1OZQA 4OQVA 2IQ0A 4H41A 3MANA 4KFPA 4AZCB 1CT5A 3LTSA 1MUCA 4K1GA 5BMWA 2PDXA 4M6VA 3W73A 4YTTA 3TUUA 1M65A 4M8UA 1XQKA 1W9PA 2VZUA 4RL3A 5E70A 3WG6A 3TR9A 1J0IA 4DJFA 1XIEA 1E5NA 1PYMA 4MJ4A 3WMCA 3SURA 5IXEA 2R9RA 2INEA 4WF7A 4K6AA 3EB2A 2ZUTA 2PCEA 3P8JA 3CQIA 2A0NA 4H04A 4QE1A 1X6NA 3LLXA 4EF8A 1PUDA 4LAOA 4C6MA 4WCJA 2GSJA 1I2P