1DOSA

Structure of fructose-bisphosphate aldolase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
358
structure length
343
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMSEESLQENIEICSKYLERMSKIGMTLEGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVYKAGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOLASE CLASS II
publication title Novel active site in Escherichia coli fructose 1,6-bisphosphate aldolase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 131
structure length 343
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1996-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dosA00
3LERA 2CZEA 1SZEA 5AHMA 3M43A 4HNNA 2V82A 4RXGA 1JQXA 2DZVA 3OVRA 3EXTA 4YMZA 3BG5A 3P74A 2X16A 1XXXA 2HSAA 3MYPA 3G1HA 3DHDA 4JR5A 5I3JA 1ZY9A 4UFLA 1TPC1 2A6LA 1SZNA 3EEGA 4JIQA 2HS6A 3OG3A 1TPFA 1WOBA 1SPQA 3BLIA 3LOTA 5J5RA 2DZSA 1TV8A 3NM1A 4M6VA 4JTIA 5IBXA 3KXQA 4LVFA 3W76A 5E0KA 5L6UA 4PL2A 1WX0A 2J9XA 3BW2A 3QW4B 6ALDA 5MHBA 1YTDA 4H3DA 4N6FA 1JR1A 1DJQA 2JBMA 1QPOA 3UZ5A 4MVAA 1KFLA 4JTFA 4TO8A 2CLMA 2E09A 1TTQA 1W56A 4E2DA 4QAIA 1F5ZA 4JIPA 3MWAA 4HNVA 1ALDA 3W3OA 1Q6QA 3LTSA 2GPTA 1HG3A 1TPWA 2X1SA 3EX1A 3BGGA 1TB3A 3ELFA 3Q94A 5CPOA 4J9JA 1EP1A 5AN7A 4O1BA 3I65A 1Q6OA 3TQ0A 1LM1A 3UPBA 3DHFA 1S5TA 3DU0A 3O07A 3ATYA 5F1VA 1AW2A 3ZWSA 1RPXA 1DOSA 3PAJA 2E6FA 2BX7A 2R91A 3A24A 1SFLA 3B05A 4UTWA 2GJLA 2YFNA 1LBFA 2ISWA 3NL2A 2C16A 2GOUA 4LV9A 2WNQA 1RD5A 1N55A 2QCEA 3E0IA 2Z2UA 4M19A 4S2BA 5LNWA 4ZMGA 2VEKA 1UUMA 1Z44A 3W7QA 3P5YA 4I7WA 3UWZA 2CLOA 1NF0A 1JJKA 1T0OA 3NR0A 3QJAA 1KM3A 1LP6A 5FI8A 5C2XA 1O5KA 4MLRA 1QPQA 4RZ6A 1EWDA 3FJ6A 2E6YA 1TRIA 1TO3A 3L0KA 2WSYA 4MPQA 3EWZA 3WJZA 4S2CA 4MJMA 1H61A 4P61A 2OCZA 4RK8A 2QAPA 1ICPA 2R14A 5DCEA 2HMCA 1SU5A 4MZ8A 3ABSA 4HIBA 4JYDA 3HGSA 1Q6RA 2FB3A 1VR6A 3W23A 4JY8A 3M41A 3V1PA 3S5YA 1V5XA 3LV6A 4DF1A 4Z0SA 4FNRA 1LYXA 1SUXA 1GEQA 1KFCA 1G69A 4GNJA 1OK6A 1BWLA 4O14A 1O4UA 4XTDA 4OGZA 4O12A 3C0JA 1XM3A 1R30A 3W7DA 3E49A 4EIVA 2CLHA 3C4UA 4A29A 5F2GA 3KFTA 4RV8A 3VKJA 4DF0A 2NLIA 2C15A 3W9ZA 5DBUA 5T26A 4BR1A 5G2IA 3I7QA 3Q37A 4QIUA 2E5DA 5U7SA 3STFA 3LHYA 3GLCA 4OV4A 3W2NA 2YSWA 5DBTA 3W1AA 3W22A 1WYIA 1OX4A 4D2JA 3GKAA 5LNRA 1AW1A 2H8XA 3TJXA 2PRMA 2V2DA 3NQMA 1W31A 3SFKA 4ZL1A 2Y6ZA 5C54A 1LBLA 2Y63A 4NXSA 1OK4A 3PBYA 1VJIA 2EF9A 4EF9A 5CG7A 3T40A 3QF0A 2J9YA 3LRKA 5F2LA 3C6CA 3R5EA 1YDOA 2ZZ5A 2W0UA 2DZPA 1QMLA 4MYXA 1XBYA 2NUXA 5I3IA 3GXTA 4DELA 1TV7A 5LZLA 3L5AA 1RVGA 2QJHA 4JXCA 2QAFA 3IGSA 1R46A 1LBMA 3MUXA 3EWWA 1LTDA 4MYAA 3HG4A 1H51A 3LRLA 2JKEA 5DELA 1YYAA 4RCXA 3FFSA 4Q32A 3FEMA 3G1SA 2CZ5A 3NQ7A 1F73A 3PY2A 4JEQA 3NL3A 4QSHA 4R7JA 4JTHA 2DZWA 5DY3A 4O50A 1EIXA 1KTBA 3MHUA 3B4UA 1OFDA 2ABBA 4OU1A 2BZNA 4UTLA 1LOSA 4GRSA 1FX6A 1XL9A 2FIQA 1FXPA 2ZZ3A 1H60A 1K02A 2YXGA 1Q6LA 1ML1A 2DZUA 4GBUA 4CNNA 2B0MA 3HMJG 4TX9A 5F1UA 3BARA 2X2GA 3W1UA 3SZ8A 5FEZA 4H4IA 4M6PA 1KFBA 1OYBA 2EAWA 2YFOA 2WJZA 5EL1A 5HJLA 1JCLA 3G0XA 1O5XA 1OFRA 2FQIA 4CCDA 1OFQA 5AC7A 1NEYA 4ZQCA 4IPIA 1F2JA 1GZGA 3T7VA 4EWND 3G1FA 4K7YA 1G4SA 1XBZA 1FQ0A 1S3HA 3NQ8A 2NWSA 4JTKA 2E1DA 1PIIA 5CSRA 3JS3A 4MZ1A 3TIMA 1P5BA 3S9YA 5CPMA 4AVFA 3Q2DA 3C56A 4LVGA 4JTGA 5DLCA 1EUNA 5HWJA 3YPIA 4OT7A 2B7QA 1LRQA 4KFOA 4HNUA 4PEKA 3RFAA 1G67A 5D32A 5HWNA 5BRBA 3W83A 5K9CA 5KSWA 5F2MA 1VCVA 3QM3A 5DN1A 1I2QA 3W7OA 2V0TA 3GNNA 1G4PA 4ZQPA 4UCGA 4YL2A 4UMAA 3U2OA 2G96A 1I4NA 3M9YA 4L4LA 4LS2A 5LNVA 4Y9AA 3PR2A 1Q3NA 3IVTA 2W79A 2ABAA 5DXYA 3O6DA 4UTJA 3FYPA 5BOOA 5FEWA 3MMTA 1VHCA 3OVPA 4RX0A 2WO5A 4NJGA 3NPWA 3W7GA 3W1PA 5HMSA 2DJLA 1EUAA 4DPPA 3SJ3A 3TNOA 1TPUA 4AHQA 3TAKA 1KFJA 3MYOA 3DFPA 2FLIA 1IXPA 1KFEA 2YX0A 2LLEA 2PCQA 4NX5A 1AW5A 2C6QA 3P82A 3G24A 4IMDA 2QR6A 3M16A 1KLZA 2FJKA 3IVSA 3WJYA 1ZJIA 3W6YA 1K7XA 4N4PA 5F2IA 4DEFA 5A8GA 1PCKA 4JDYA 2WNNA 3UNDA 3TMLA 1GVOA 3S0CA 3WFAA 5EA9A 4UFKA 3GB6A 3HQ1A 4FHAA 1TQXA 3KVLA 4O11A 5H91A 3LI1A 4N4QA 2C3ZA 2VC6A 4WY0B 3BPWA 4QJ1A 2AQWA 3W7MA 2C14A 1KBIA 4JN6A 2QJGA 4ORMA 4UUIA 3CWOX 4UXDA 4HPJA 3WJSA 3F4WA 5CSSA 1K8XA 2ZCGA 1L6WA 3NEVA 3TCEA 1VC4A 2DZTA 1CX9A 2CLEA 2BSLA 1MZHA 1AK5A 4X9SA 1ZFJA 2EGZA 5DXXA 2BLEA 3W88A 3FA5A 4O53A 1JQVA 4JD4A 4E38A 1KV5A 5BMXA 5IM51 2CZFA 3TW6A 5KINA 3LM7A 3AJXA 4OV9A 3R13A 2UV8G 1FWWA 3UQNA 1SR9A 4UFMA 1LCOA 4FNQA 4A2SA 3W85A 4JICA 3TW7A 2P10A 2ATMA 4L4MA 5D33A 1EWEA 2WSRA 3MI2A 3PG8A 1SSDA 4RR4A 4NNCA 3W1QA 3R12A 3O6YX 3O6CA 4U28A 1W5QA 3IIXA 1G4TA 3DFNA 1VS1A 2VFFA 4B5NA 4NVTA 1G6CA 1XI3A 2NV2A 2OZ0A 3S8HA 1OYCA 1DL3A 1H7PA 2A1YA 4QQ3A 1OABA 4RKAA 2YZRA 5KMYA 2WQPA 4XKYA 2YR1A 3N73A 2B4GA 3B0PA 3BLEA 2NWRA 3T78A 3W75A 4YCPA 3DKJA 1K8YA 4AF0B 4BFAA 3STGA 4MLJA 4IMGA 1WBJA 4LC8A 3ZFHA 1ZNNA 1FCVA 2O7SA 3U8GA 1XUZA 3A5VA 2E5BA 3MBFA 4UTTA 5TQLA 1HL2A 4DXVA 4XZ9A 3GNDA 3P5ZA 1EP3A 3TSDA 3G1AA 1KBJA 4UTHA 5CGQA 5FF7A 3M5ZA 4O10A 2ZTKA 1GVQA 4CNOA 3SGZA 2J6XA 3R8RA 4YXGA 3CC1A 4QM1A 1SO4A 3GDTA 3IVUA 2QCFA 1TMHA 3UXDA 3EKZA 3C8FA 2CW6A 1SO3A 4PC8A 4O0ZA 2TRSA 2OX1A 3PBUA 3R89A 1JUKA 2NX9A 5GVJA 3W2KA 1TV5A 2I9EA 4ZQOA 2YYTA 3T55A 2I1OA 5I3FA 3EXRA 3RNDA 3GVGA 3P80A 4MJZA 3UWVA 4UC5A 4RXFA 3SI9A 1JCJA 2CLFA 3G0UA 3WJWA 3OEXA 4U4MA 1A5SA 4ADUA 4O16A 4E0CA 3TV8A 1GOXA 1B3OA 3W73A 3W86A 1EA0A 4IMCA 3GAKA 4R34A 4UTMA 1JCMP 3MW7A 1F7BA 1O60A 3PBWA 4KWWA 3A5FA 3GYEA 3F1QA 3ABOA 1RQEA 2GVJA 3TQVA 2ZZ7A 4N2YA 3B0VC 5HINA 4HNTA 1TQJA 4NX0A 2WOQA 2B7NA 1R2RA 1DV7A 2E6DA 1BKSA 1ICQA 3S1UA 4JS3A 1VPXA 3L67A 1D9EA 3RLUA 2ZRUA 4Y96A 2H6RA 1PHWA 2FDSA 1WBHA 4YWIA 1U5JA 1FWNA 5CPLA 4YCOA 2F84A 3PM6A 3SR7A 3SY5A 2VELA 1QPNA 5BMWA 1H7XA 3EXSA 1KA9F 3QMRA 5D2WA 4BF9A 3W7KA 4K8HA 5C55A 1ICSA 4NJKA 3IGUA 3E9AA 3NQDA 4IJBA 3EX3A 1VLIA 4GC4A 4WZHA 3TKFA 1X1ZA 2XN1A 8TIMA 2C0AA 4O18A 4MKNA 4BK9A 4N6EA 3B04A 2BTMA 3UD6A 3USBA 3HGJA 4JX5A 3P62A 4KKXA 3QMSA 4TIMA 2D73A 2ZTJA 2A6NA 3PSWA 1XBVA 2A2IA 2ZBTA 3PB0A 5K4XA 3ANYA 1NSJA 1A50A 1HUVA 4AH7A 3DAQA 1FBAA 3UY8A 5HR7A 4MFDA 1L9WA 4X22A 3TC6A 3FKKA 3QSTA 3LHVA 4AWSA 3SGUA 1QO2A 3HO8A 3FKRA 4OQVA 1SO6A 1G4EA 1W3NA 4LC6A 1OFAA 2VFIA 1E51A 1KV8A 1QDSA 4WD0A 1VGAA 4XBSA 4FB7A 1JRBA 5HR6A 1GQNA 4HSNA 1C8VA 5AC6A 3LCIA 3W2LA 3TSBA 4NZJA 4M7SA 3LHWA 3N3MA 3QMTA 1PS9A 1VCGA 1XDLA 4X3ZA 3LDVA 2G5WA 2YYUA 3PVFA 4JGDA 3DXIA 1VQTA 2NUYA 3QFEA 3P67A 1T96A 1SFJA 1TTJA 1WAUA 3ZWTA 2Y85A 3G3MA 4GUHA 4JNMA 4X2RA 3LLFA 4LVDA 4AWTA 3I7RA 4R33A 2IQTA 3BW3A 1H7WA 1YADA 3QYQA 2DJXA 3LCGA 1GG0A 2A4AA 3CM4A 3NVTA 3EX6A 4DQWA 3UWWA 4JTUA 2H8ZA 4IX2A 1X7FA 4GUGA 4PL1A 1TJRA 4CQAA 3CT7A 4LS1A 3MI6A 4LV4A 1YLVA 2QDHA 2V5BA 1F6PA 3PSVA 1W5MA 2C19A 4Z1CA 2EPHA 4HSOA 3PWAA 2J88A 3H53A 1QFEA 4FXSA 1JCXA 1JULA 4YLWA 1TREA 3FIGA 3G8EA 1QO5A 3QPZA 1GVFA 3TR2A 1W5PA 1WA3A 3Q58A 2C1HA 4IXXA 4LVAA 4PODA 5FEXA 3TH6A 5CZJA 3GDKA 4NU7A 4CQ9A 4I7UA 4GUIA 4XTIA 3GX9A 1YXCA 5HULA 1LZOA 2A7RA 1I8JA 5J5DA 3VE9A 3P8JA 3GDMA 1DBTA 5KZDA 1PCWA 1UASA 2NUWA 4FX6M 3W1RA 1QOQA 3NGJA 4A21A 1P4CA 1BTMA 3L0GA 3CEPA 4UTIA 2ZZ6A 3G1DA 3UY7A 4PFMA 3THQA 5LKYA 1EB3A 2QEZA 5D04C 1X1OA 3P61A 2BWGA 2Z0IA 3W70A 3EX4A 3LCLA 1TPH1 2QCCA 3SSJA 3PC0A 5K7JA 1DHPA 3QSRA 1GYLA 4K7VA 2Z1BA 2VFEA 2ZYFA 1FWRA 4O19A 5K3VA 3N2XA 4LU0A 4RLIA 3P84A 3R2GA 1R2SA 3P81A 4FNSA 3BGJA 3DBPA 4CNPA 5IBXC 3TE9A 5AHLA 4PH6A 3TROA 4K37A 3L65A 3T44A 4WJEA 2PE4A 1BEUA 3E02A 4LUIA 4XUGA 2ZDRA 1G7VA 4HPXA 5LGXA 3PULA 3OBKA 4RZ5A 4MOZA 1PV8A 3C2RA 4N9DA 3NQVA 5D05A 3N9SA 3O63A 5KTLA 1VYPX 4Y6GA 2Y7FA 1MEIA 2ZRXA 4OE7A 3HG2A 4NZFA 5ABTA 5HUOA 1OFEA 1P0KA 1CI1A 1LOQA 3VCRA 4KFPA 1H63A 4MZYA 3TXVA 2TYSA 3C61A 4Z1DA 5U4NA 3NQFA 3C52A 3PS7A 1GVRA 1M7PA 1SW7A 3PG9A 4GE8A 5E1QA 4DPQA 3O1NA 1ME9A 4NUWA 3W71A 1OFPA 4XQ6A 5AFDA 4ADTA 1R2TA 4RJEA 1IXOA 3QRHA 4NNBA 3UWYA 3UZJA 4UTWC 2A21A 1J2WA 1GJPA 2AGKA 3DI0A 3L0NA 5AC8A 1W3TA 3TA6A 3B03A 3CPRA 1G7UA 2ALDA 3W7LA 4K8EA 3IGXA 4O8RA 5AHFA 5LHEA 4WUIA 1IF2A 4C1KA 3IEBA 4FNTA 3BG9A 4A2RA 1J4EA 1W5NA 2ISSA 2Z6IA 3GDRA 2V2HA 3GXPA 2CU0A 4IXHA 1I2RA 3NXFA 4CCEA 3LHTA 1Q45A 3D0CA 5D30A 3EX2A 4DO4A 3O05A 4UTUA 1Z42A 2YDAA 1QCWA 4UTKA 3KRSA 2Y89A 3W7IA 3QQ0A 5CZTA 4EOUA 4BI6A 4ORIA 1KTCA 3L5MA 1W37A 1K7FA 4AB4A 2H3BA 2WKJA 5I3HA 2Y7DA 4WX2A 1LRNA 1M5WA 2Q8LA 1K03A 3B8DA 4EF8A 4FIQA 1XFBA 2QDGA 1TJPA 1F74A 1XDMA 2WV8A 3I68A 2CWNA 4ML9A 3IIVA 3S5NA 1TIMA 1H1YA 2VKZG 5D38A 3W84A 3B06A 4ONVA 3MI3A 4FX7A 1UJPA 2TSYA 5BW6A 1T8XA 2WNZA 4MY1A 5HQEA 1QPRA 1TCDA 2ZA1A 1X6UA 3TSMA 1VCFA 4LW7A 1L2UA 5LGZA 3EWBX 3M1ZA 4BWLC 1TTPA 2TPSA 1JUBA 4FXRA 4E2BA 3L9CA 5G1YA 4UFJA 1Z48A 2OJPA 4O28A 3STEA 1M7OA 4PCFA 2VXNA 4XKYB 3MJYA 2P1FA 3NDOA 3H54A 3RLVA 1ZALA 4RZ4A 5A5WA 3W7PA 1JRCA 3LCFA 3ZR4A 1WV2A 2CZDA 3NL6A 4O54A 1TPDA 3DGRA 3HG3A 1U83A 1ZAJA 1MSSA 3HIJA 1ZAIA 5FF0A 1FUYA 1YTKA 3LCXA 4UR8A 3G1YA 3W2JA 3UPWA 1OG0A 3W74A 1FWSA 5H2ZA 3W1NA 2CLKA 4XBKA 1UB3A 4FNUA 2X1UA 2XFWA 5D2TA 3C2EA 1KLYA 2QCHA 3LX9A 3QEZA 2XN2A 2DU2A 3LRMA 2RFGA 4NJJA 3WK1A 3PB2A 4O4VA 1K7EA 4AWUA 2DP3A 1KW1A 3ABRA 2DZXA 1UCWA 1FXQA 3CLMA 3WK0A 5C5YA 3NQCA 1DQWA 2NX1A 3UXAA 3ABQA 2PRLA 3O8AA 2J27A 1HFBA 2V5LA 4IUOA 4HHPA 2JGQA 3E96A 1OFOA 5CZ0A 3NM3A 4IOTA 3W7CA 5HNRA 2CLLA 2PRHA 3SW6A 4LRTA 4JX6A 5D37A 4M5PA 2OT0A 3QW3A 3NO5A 1EPXA 5I3KA 2RDWA 3CTLA 3SECA 1A5BA 3MO7A 3N9RA 1WOAA 1Y0EA 4UR7A 2GQ8A 1NVMA 4OHQA 1CW2A 6TIMA 4DO5A 2QCDA 4MFEA 4TMBA 5AYYA 2GQ9A 1MEWA 3LCHA 3ZS4A 2VEPA 3PF3A 3NA8A 5LHFA 1QOPA 3LHZA 5D2XA 5KITA 3CQ0A 1DJNA 3OHIA 2R94A 3HJZA 3UWUA 5D02A 4IMEA 1B9BA 1EX5A 3N34A 2E77A 2VOMA 3STCA 2YW4A 1SZFA 5EYWA 2P0OA 3T4CA 1NF7A 1QAPA 4N9EA 4DBEA 5FESA 4Z1AA 3NQGA 4W9TA 1FCQA 2A7PA 3W7HA 5LNUA 2GUUA 5D2VA 1XCFA 3IIZA 1OF6A 3CWNA 3G1VA 1FWTA 3P7YA 3W87A 1FDJA 3KVJA 2ZRZA 1UUOA 1W0MA 1KTNA 4POCA 5AYXA 4N9CA 4O57A 1WDWA 4BI5A 1X8FA 1QR7A 1O94A 2NX3A 3CB8A 4FIRA 3DI1A 1LDCA 2J9ZA 1JVNA 3KHJA 3CIXA 3GIYA 1YPIA 3GDLA 4PTNA 4ADSA 2Y7GA 2V81A 2O7QA 2E6AA 2TMDA 3MBDA 3DFTA 5SWUA 4Z1BA 2BXVA 4UIOA 1H1ZA 4AEOA 1C29A 2YPIA 3O16A 1HO1A 2GVLA 3VFLA 4CLMA 3LXCA 4ZVJA 3RF9A 3FOKA 1GTHA 2R8WA 3HBLA 1H5YA 1SO5A 2DORA 3JRKA 3LGEA 4JTJA 3HG5A 3BG3A 3GR7A 1HO4A 4O17A 3A21A 3NPUA 4M6QA 3TDFA 3VI2A 2V9DA 4JX4A 3NZ1A 3I6RA 2HTMA 3M6YA 4JYFA 4LOCA 3NQEA 2B7PA 1N7KA 5AB3A 3M5XA 4O13A 4WOQA 1TTIA 3L2IA 3LB0A 3LXBA 3N2MA 1J5TA 4NQ1A 4HN4A 2A85A 2GQAA 2H90A 3QPYA 1PL9A 2QUVA 2ZRYA 2JK2A 5K9DA 4O1DA 3NAVA 3MP5A 3DZ1A 5F4XA 1KM1A 2C18A 2CLIA 1GWJA 2NXGA 1GVSA 3L66A 3SIZA 1DORA 3A9IA 1W54A 2JKAA 4GUJA 1SQ7A 1ZHAA 2ATSA 4KWVA 5EBUA 3E12A 4QISA 5K4ZA 2CFFA 3NG3A 3FYOA 3MHFA 1A5CA 1UBSA 4JTEA 4TMCA 5D03A 3NQAA 1W8SA 2Y61A 7TIMA 1VH7A 1RV8A 2EKCA 2QCLA 3G8RA 2ZQ0A 4Y90A 3S5OA 1GG1A 2HS8A 3JR2A 3G1XA 1GYNA 3O06A 2V2CA 2A0NA 4UFHA 5FF4A 2Y88A 1F76A 3CHVA 2NXHA 3TU9A 1LOLA 2Y62A 2E5CA 2VENA 1DVJA 4PA8A 5EKYA 1ME7A 2ZZ1A 1XKYA 3BW4A 2RDTA 3FLUA 3NL5A 3W7NA 3WK2A 1FCBA 3O15A 4FF7A 5G5IA 2ZA2A 2GJNA 3AO0A 3W2UA 3DFOA 2A5HA 4FO4A 1OX4B 1ZCOA 4TU1A 5E93A 3M5VA 4OBTA 3U6WA 1P1XA 1H7NA 1MO0A 4K39A 3CU2A 3H55A 4Q33A 1OX6A 3KOFA 4LY8A 4WOZA 3ATZA 3EB2A 3MP4A 1RR2A 4AAJA 1IIHA 4FX8A 5AYZA 1C9DA 2G95A 3IIPA 1AL7A 3NOEA 5G2HA 2G97A 3NQ6A 5FEPA 1T99A 5LNSA 1IGSA 3FS2A 4JY9A 4K38A 3LXAA 1IXQA 5EPDA 3DH7A 1SZGA 3HGRA 3BO9A 3TFXA 3LBCA 2NZLA 3NQ2A 4A3UA 3PUDA 3HOJA 1M6JA 1THFD 1FDZA 3WK3A 3IV3A 5CKSA 4QNWA 3NNTA 4UTTC 1RZMA 3GR8A 1YDVA 4QNEA 2KZHA 2RKXA 2AAMA 2VEIA 1LORA 1ADOA 1NFBA 1LRTA 2FB2A 4BWLA 1GT8A 3HPXA 4M7TA 1L6SA 3PUEA 1RQBA 1LLWA 4G1KA 2Y70A 4UMCA 2H3DA 2Q8ZA 4MY8A 1A53A 1ME8A 2Z6JA 1KFKA 1ZAHA 3P8IA 3QH2A 4IPJA 2WSQA 3W1MA 4AHPA 1KM2A 3WJXA 4DF2A 4O0KA 5CZSA 2ZRVA 5KZEA 4O15A 1YTEA 1OJXA 3C2VA 4UNKA 4UMBA 1I45A 3HGOA 4LTSA 2X30A 2ZA3A 2Q3RA 1YDNA 2QCNA 4ZQMA 3TUUA 2B7OA 2ZFAA 1DKWA 4LNYA 1H50A 1TSIA 2WPBA 1JCNA 5HUPA 2F7FA 4WXYA 3RU6A 1F6KA 2FPTA 1MEHA 3S1VA 4JYEA 4QITA 5TBOA 2YGYA 4Q4KA 3TFCA 5DCBA 2E68A 3M7WA 5F4WA 5BNKA 3TQKA 3VNDA 4DO6A 1OF8A 1SW3A 2A7NA 2QUUA 1PHQA 4CQ8A 4N02A 3S42A 1Z41A 1EP2A 4WY0F 1N8FA 4GWEA 2NV1A 3HPZA 2JKPA 1D3HA 3NYZA 1S5VA 3G3DA 5AHNA 3C2FA 3GAYA 1LLZA 4LS0A 3TMQA 3W2MA 5LSMA 2ISVA 4OWGA 2VFHA 4MUZA 2J24A 3FJLA 5I3GA 1I2NA 2FPYA 1K3UA 1P0NA 4UNLA 2QF7A 4LWWA 4MY9A 3K30A 4NJIA 1H7RA 4BI7A 1A5AA 2QJIA 2FTPA 1QWGA 4LRSA 4H6KA 4JTSA 1V7YA 4ZQRA 3IIOA 2I14A 3LBMA 3TAOA 4Z08A 2PURA 5EY5A 3LV5A 1GPWA 5AOUA 1D3GA 3W7RA 4R53A 4MIMA 3TX9A 1SW0A 1B4KA 1BWKA 1ONRA 3L21A 4GFSA 1I2PA 1TPEA 1KM0A 4K6AA 5HWMA 1LROA 1VLWA 4A22A 3RK8A 2YCEA 5G4WA 4KFNA 4ZQNA 3W7JA 1I2OA 3M47A 1KM4A 1JCYA 5DY2A 4JTTA 3INPA 3S1XA 2QCMA 2X1RA 3A23A 3KVMA 3M44A 3QQ1A 1H7OA 2RDUA 4LVBA 4S1FA 5L9FA 4LT9A 2Q3OA 1H62A 3BVJA 4N9BA 3GK0A 3W1XA 1AMKA 3KX6A 4JTLA 5EMUA 1KM5A 5G1TA 3G0SA 2EHHA 3PBVA 3UYCA 3L68A 2W6RA 1F05A 4HKPA 3LTPA 3CEUA 1EEPA 3BV4A 3F4NA 1WQ5A 2QKFA 3DFQA 4I7VA 3KRUA 1WXJA 4FEZA 3HB9A 1AG1O 1SSGA 3C2OA 5G2WA 1IIGA 1W5OA 4I9AA 4NNAA 3DENA 3MP3A 5TIMA 1VHNA 3KAOA 3CIWA 3QC3A 2ZRWA 1W3IA 3HF3A 3PUOA 1R47A 3GXNA 1VYRA 4CCCA 1S5WA 1W1ZA 3KVKA 3OVQA 3W7EA 3BLFA 2PC4A 4UFIA 4FNPA 3S5ZA 3NPVA 3EKLA 1TYGA 1VZWA 5DCDA 3GKFA 1HTIA 5F4SA 5G4EA 4WY0A 3P60A 3VE7A 4ZZ9A 1IXNA 5KZMA 4GXMA 2V8ZA 1NAL1 3F03K 1XC4A 1OX5A 1QNVA 4NXKA 4Z0JA 3V75A 3LCWA 3UWQA 3W1TA 2RH9A 3TJLA 4TR9A 4IMFA 1B57A 1GTEA 1B4EA 3TXZA 4IX0A 4K36A 3W07A 3G18A 3LTYA 2VFGA 1L6YA 1YXYA 2GVGA 3N14A 4AXKA 3BK0A 1AL8A 2XN0A 4WXZA 2ZZ2A 3C3NA 4O1CA 4Y8FA 1XBXA 2ZZ4A 3I7SA 1VYSX 4XWUA 4ICNA 3TC7A 2Y7EA 3LHUA 1OFBA 5FF3A 1DQXA 3L5LA 3W72A 2RHGA 3HPSA 2VEMA 3M5YA 4AHOA 2OT1A 3LI0A 4ALDA 2JGYA 3B0UX 2X1TA 1OHLA 3QZEA 3W1LA 4GUFA 2NXIA 4O1AA 4JDBA 5C6MA 3OA3A 1ZENA 3DKLA 3OIXA 3THAA 3GZ3A 1XUUA 4O52A 5FF2A 1K8ZA 3LLDA 2QUTA 1FCUA 4IGHA 4LUJA 1OVDA 3G22A 3IRDA 1FY6A 3A22A 2FPVA 4EVZA 4O4WA 3S1WA 2QCGA 1YXDA 3NPXA 1PE1A 1TPVA 1PVNA 4WQ6A 4C1LA 3KRZA 3MHGA 5AHIA 2YW3A 1RQHA 4HT3A 3EWYA 2QCDB 4P2VA 1YPFA 3RMJA 5AHEA 4IQLA 3M0ZA 4AMAA 3EWXA 4AF0A 5CPNA 4NT0A 1KM6A 3NZRA 1O95A 3EWUA 3DFSA 5K9XA 1TPB1 2OMAA 3TK7A 4IWWA 1MXSA 4GJ1A 4NJHA 2VFDA 3S6DA 1VRDA 1TRDA 5K2ZA 3N19B 1FDYA 1OYAA 2FFCA 5D2YA 5D09A 2V30A 2C13A 4DBDA 1JUEA
chains in the Genus database with same CATH superfamily
3GG1A 1DJXA 1ISYA 2ACUA 3M43A 4XIAA 4ML4A 4Q22A 4AC1X 6TAAA 2DZVA 3EXTA 1CCWB 3BG5A 4YMZA 2X16A 4YHGA 1Z89A 2IKGA 4JFVA 3VNKA 4J3TA 2D2OA 3G1HA 2Y2WA 3LUTA 2ONEA 4TUFA 5ECUA 2WVTA 2A6LA 3EEGA 2BOFX 5AY7A 3OG3A 3BQ6A 3VDHA 3KBSA 3SY1A 4LANA 3NM1A 3DOPA 3N4EA 3KXQA 3N17A 3W76A 3WLKX 3LMYA 2WSPA 3CO4A 4GIRA 5L6UA 4PL2A 2I5QA 3BW2A 3QW4B 6ALDA 4JQ2A 1EQCA 1Q5MA 3LNMA 1QI3A 1QPOA 1XSIA 3DECA 1XWYA 1MDLA 2VWTA 3FVDA 4MVAA 3APTA 1U22A 4P8VA 2E09A 4EPKA 4S3BA 3VIKA 1E9LA 4HOZA 1F5ZA 2YKKA 1R9YA 4HNVA 3T08A 1HG3A 2X1SA 3TOPA 1C91A 1YQ2A 3BGGA 1YBQA 3ELFA 4QG8A 3UJEA 2Z7GA 3N2CA 3I65A 2P8CA 1LM1A 3ONBA 3DHFA 4Q4OA 3DU0A 3O07A 2GDQA 5F1VA 2D20A 1HP5A 3GBDA 3PZUA 2E6FA 4GY0A 2R91A 1L2QA 1Z7AA 4HZ8A 3RDKA 2YFNA 5EU9A 3NL2A 4AW7A 4LNCA 3E0IA 2OOGA 3DG3A 4LYRA 4ZMGA 1Z44A 4H9TA 3N11A 1A4MA 1NF0A 1EOMA 1T0OA 3NR0A 5HOSA 4ZOBA 2FZBA 4RPPA 4XO7A 1Q4WA 3W53A 2E6YA 1TO3A 2WSYA 4EPDC 1LUCB 1QUMA 1UW9A 4H7VA 1H61A 3ES8A 3IARA 3RXZA 2EO7A 2OCZA 1LF1A 5DCEA 2HMCA 4WDUA 3N6HA 4OBRA 3ABSA 3W24A 1W9XA 3HGSA 3TA9A 3M41A 1CB7B 1PZ1A 3S2JA 3V1PA 3VNJA 3A64A 4QJ4B 1LYXA 4I8YA 4AZIA 2GDUA 1GEQA 3I4EA 1G69A 4GNJA 4XTDA 1W91A 1NOFA 4MWAE 3C0JA 5ENLA 3HV8A 2PU0A 3U2EA 3C4UA 5F2GA 2QS8A 1B2YA 3KFTA 2BMBA 3B9OA 2NLIA 2WMHA 1XDJA 3F2BA 3CQIA 2WMIB 4BR1A 2ZOXA 2F61A 2Q01A 4U33A 3W2NA 5GPRA 4GJJA 4HZ7A 3UF9A 4D2JA 1IEXA 2PFHA 1E43A 1XIBA 4RDVA 3PJUA 3M7SA 1HL9A 1U33A 1VP5A 4JFWA 1RY0A 3SFKA 2CZVA 2Y6ZA 1HNYA 1OK4A 1VJIA 3CQKA 4REQA 1V0LA 5E70A 1GVEA 1CBGA 5A95A 5FL0A 1YDOA 1CGYA 5C71A 3ARTA 1GQKA 1I1WA 3QVQA 4KW2A 1XBYA 4IL2A 4JZ5A 5LZLA 2PBGA 3MUXA 1O7AA 3EWWA 4MYAA 4ZBCA 3U3HA 1CIUA 1YYAA 3RPTA 4Q32A 3FEMA 1NDYA 3G1SA 4DRSA 2Y8KA 4L56A 3WMLA 2HEJA 1ISZA 3PY2A 2WYSA 1RLDA 4Y9PA 1C3FA 3NL3A 3B9NA 1M68A 2FH6A 4JHOA 1GPFA 4JTHA 2DZWA 4QP0A 1XC6A 4R85A 1KQZA 2WXDM 1GOWA 2OQYA 2RJGA 4PUDA 1C7SA 4XZLX 4A3YA 2B0MA 4P5UA 5F1UA 3VNZA 3H4WA 1JZ5A 2I56A 3K1DA 3RCMA 5FEZA 4M6PA 1OYBA 2EAWA 2XWEA 4I3GA 4P7NA 2WJZA 2XH4A 2J7HA 1JCLA 1O5XA 3FN9A 5AC7A 1NEYA 4IPIA 3ALFA 3VKAA 2B81A 2XM1A 1TE1A 4IJCA 4K7YA 1E9ZB 3JVAA 1XBZA 3NQ8A 1UR0A 3SURA 4EPBC 2JEPA 4FI4A 3JS3A 3TIMA 1P5BA 3S9YA 5LA0A 4LYQA 4RUBA 4AVFA 3JU2A 4NAEB 4LVGA 1H09A 4WKFA 1LRQA 1KBBA 4MHBA 5HWNA 2MNRA 5K9CA 1LWJA 3QM3A 5DN1A 1G4PA 4YL2A 2ON3A 1JPKA 1MUWA 1CXFA 1SM9A 5FJPA 4L4LA 4PB3A 1S2TA 3BAXA 1E9YB 4H2CA 1E5NA 2IXVA 1Q3NA 4ENLA 4Q8VA 5BOOA 1UZ1A 3MMTA 1U30A 3VAVA 1OADA 3UZZA 3AS0A 1EUAA 1BAGA 2ZUSA 3G1RA 3TAKA 4GHRA 2X2YA 3N04A 3IJIA 3MYOA 4PTXA 3UGRA 4U10A 2I17A 3B8VA 2FLIA 1IXPA 2VX5A 2XSBA 3J7HA 2YCLB 3LNPA 1A47A 8A3HA 1QW9A 1YEYA 2C6QA 3GG0A 3WF3A 3DEQA 4IMDA 2QR6A 3M16A 1EJSC 3WJYA 4QDMA 1E6XM 3W6YA 1XISA 1K7XA 1JD7A 4LSBA 3CL8A 1UP0A 3G6MA 4NRSA 5AVNA 5A8GA 2YCIX 2HE5A 3GBEA 5EFFA 1ADSA 3KOWA 5FOOA 2WCAA 3OZOA 3CHFA 5E0CA 1U2YA 2OOFA 1R3SA 4GNKB 3WLSA 4QJ1A 2EPKX 3TCSA 2W4XA 2W3ZA 5JVLA 3I4KA 3WDHA 4HPJA 1TE6A 5DMLA 2QXWA 1K8XA 1R9ZA 2ZCGA 3NEVA 3B8TA 2E1WA 3CASA 4IGNA 4Q8QA 1R3VA 2DZTA 2HISA 5JQ9A 2Y1HA 3E5PA 5DXXA 4DUWA 4QE1A 2PDCA 3LZ5A 3VIHA 3DERA 5FJRA 1KV5A 4DBWA 4N0RA 4D6IA 5A6TC 1WDPA 1NP0A 1FFQA 3LM7A 5E6YA 4OV9A 5GQBA 3UQNA 1ZP4A 4A2SA 2VCBA 2VHLA 4JICA 5ABEA 2P10A 2ATMA 1J0HA 4RR4A 4NNCA 1UWUA 1DTNA 3R12A 4XX6A 3O6CA 1QTWA 5ABFA 4C6MA 3RRXA 3TYEA 3N25A 2WZMA 5EMLA 4NVTA 2J25A 1G6CA 1OIMA 1GHRA 2WHJA 5A2AA 1OYCA 2A1YA 4QQ3A 5A6KA 5CC6A 2QDEA 2X1IA 3L23A 3B9DA 3ARRA 2B4GA 3BLEA 2NWRA 1E70M 3W75A 3DKJA 4AF0B 4BFAA 1UH4A 4MLJA 1CTNA 2EPLX 4IMGA 4U2ZA 1FRBA 3TC3A 3A4XA 1FCVA 3U8GA 2V5CA 1ADDA 3A5VA 1NELA 1JNEA 1HL2A 1T40A 3GNDA 3P5ZA 5TD4A 3ZVHB 3AIEA 4KEVA 3TSDA 5HPOA 1KC7A 3CMFA 4Q8UA 1OT2A 3M5ZA 4O10A 3SGZA 3CC1A 2ZXQA 2GOKA 3T1GA 2QCFA 3WLMA 4PC8A 4FXJA 2TRSA 2OX1A 4OTKA 3ZT6A 1Q2SA 2BS9A 3W2KA 1TV5A 3B9EA 2IPFA 4Z17A 2EG8A 2I9EA 3L4VA 1A5LC 1BTCA 2I1OA 4Y7EA 3U7VA 1TCMA 3P80A 4RXFA 2CLFA 3KOZA 4M3PA 4U4MA 3SCWA 2JALA 3W73A 5DRIA 1W32A 4LBSA 1JCMP 2X0SA 3MW7A 3E0VA 1E72M 3PBWA 4RDWA 4F0SA 1RQEA 1E0UA 4GH3A 2B7NA 2VR5A 5G4HC 1BGAA 5CLWA 2E6DA 2Y8UA 3ZYZA 1BKSA 4D1JA 3AXXA 3S1UA 4W5UA 1QU4A 1VPXA 4XSMA 5AC4A 1TV2A 2HXTA 1W9DM 2PDNA 4IIDA 3L4WA 3L4YA 1OC6A 4ICCX 1YBQB 1U5JA 1FWNA 4A6GA 2F84A 3SR7A 5RUBA 1C93A 1TVNA 2VELA 2P50A 3SQLA 3S2CA 3MMUA 2WZHA 2GJXA 3WD4A 4HTBA 5C55A 3KL5A 1JDCA 3TJIA 2XN1A 2BHUA 2RJHA 4MKNA 4PB4A 2CC0A 3N6QA 3B04A 4L1GA 1W1B1 2BTMA 2G3MA 3BLPX 3UFYA 3HGJA 1K4HA 4JX5A 1RJQA 2D73A 2ZTJA 1O12A 4H00A 1BYCA 1FHLA 4GD0A 2A2IA 4Q8MA 3PB0A 2PDPA 3QLDA 1A50A 1HUVA 3KBVA 3NYDA 2AOSA 1QK0A 4D6EA 1EFZA 1L9WA 5M3WA 1MW1A 4TX8A 3TC6A 2BGSA 3UNTA 1IEVA 1QO2A 3HJEA 3BAWA 3S9IA 2E3ZA 2G41A 5IFTA 1C92A 3ITTA 4GCAA 2VC9A 1X6NA 2ADAA 2VGIA 3MDWA 3ALGA 5A8OA 1F6YA 3SM0A 1R87A 4D8ZA 1V8EA 1SR0A 4EXBA 2BP1A 4NZJA 1VCGA 2NVDA 2XHYA 1ZQ5A 3M0HA 2G5WA 3GXFA 4JGDA 3PVFA 1ZUAX 4HHMA 1EGMA 1O68A 4JCLA 3A4WA 2BY0A 1TTJA 1DWJM 1WAUA 3AXKA 1DWIM 1UQZA 1T5AA 3LLFA 4LVDA 4RDYA 1UIPA 3R4IA 3AYRA 1YADA 2XIJA 3P93A 2VJXA 3QYQA 3CM4A 3TTYA 1ENUA 4MDPA 4DQWA 3UWWA 2H8ZA 4AIUA 4REQB 1TJRA 2IPJA 3CZEA 2WANA 2GGHA 2Z7KA 3AISA 3MI6A 2QJMA 1YLVA 2V5BA 3PSVA 4B5SA 2EPHA 4HSOA 1KGUA 3H53A 3AZRA 1JULA 2P8BA 3JZEA 3R6IA 1WZMA 3GC4A 3QPZA 1GVFA 1R0MA 1W5PA 6XIAA 2PWHA 1MNSA 1US3A 2D0GA 4R88A 4IXXA 3TH6A 4NU7A 4LB4A 3VFCA 3VNMA 4G7FA 4MPKA 4KGJA 5A2BA 1LZOA 4FR6A 5J5DA 3VE9A 3P8JA 5H8UA 1PCWA 4IG2A 1UASA 4MUPA 2YJQA 4WRHA 3EB3A 1JYVA 3HFYA 1BYDA 3LSBA 4FX6M 5IRPA 3GZAA 1UKSA 2D2GA 1BHGA 4AIBA 1C8YA 5A6BA 2XIMA 2GL5A 3SQMA 1E6ZA 2Z0IA 1AA1B 4R3UA 4LUYA 3EX4A 3GD6A 1TPH1 3H2CA 1BSLA 2PWDA 1FWRA 2R6OA 1OGGA 3EDEA 4LU0A 4RLIA 3R2GA 1M03A 1R2SA 3P81A 4FNSA 1VBGA 3DBPA 1EC9A 3XIMA 5AHLA 4PH6A 2ZXBA 4K37A 4WJEA 2PE4A 1BEUA 1G7VA 4MAVA 3R43A 3FCPA 5LGXA 4E8GA 1J01A 1W3JA 4HA0A 4MOZA 1UD3A 2PC8A 3NQVA 4ECLA 5J04A 4TX6A 1YNPA 5KTLA 1VYPX 3W25A 3UEQA 4Y6GA 4OE7A 2PA6A 3CXOA 3IAPA 2QNEA 4UZSA 3IJQA 1LOQA 3VCRA 1H63A 4MZYA 4IFRA 2VZTA 3S4TA 4Z1DA 3WUGA 1H3GA 2BNJA 3C52A 3PS7A 1SW7A 5DMMA 4GE8A 1JGIA 3O1NA 5IHSA 1ME9A 1OFPA 4CEUC 4ADTA 1R2TA 1AJ2A 2WK2A 3VINA 1K6WA 4UTWC 2PP3A 1VKFA 3M0VA 3CV2A 2XIOA 1QRQA 5AC8A 4GQGA 4QE4A 2PF8A 1G7UA 1VFOA 4D8AA 3IWPA 2OSYA 4HYRA 1POKA 1HJQA 1J10A 3TEVA 2Z6IA 2ZX8A 2PDKA 1E4NA 1JEZA 3NZQA 3SRHA 4A3QA 2A3BA 5I00A 4RPQA 4DO4A 4UTUA 3ZJ8A 1EHAA 3ANVA 1NIUA 3NZPA 4BI6A 4NG3A 1K7FA 2QPUA 4WX2A 3E0WA 5TF0A 3FJ4A 1K03A 3DCPA 4G1NA 4TVCA 4EF8A 2C71A 4GI6A 2OYLA 1SMAA 3W4RA 1XDMA 2WV8A 5GNXA 1UWRA 1JI1A 1Q66A 1H1YA 1SFSA 4LGXA 5DO8A 4MNMA 4QLLA 4MY1A 4QG6A 1QPRA 1TCDA 5DFAA 3B97A 3VNLA 3DYPA 5ABFB 3TSMA 1NOUA 1HKWA 2D22A 3URQA 5LGZA 5ABGA 5C0QA 2HROA 2RDXA 1RXOB 1XINA 3BV7A 2ZE0A 1KGWA 4KETA 4UFJA 3EKGA 3PK7A 4O28A 1B9ZA 2E9BA 2FZDA 3SRDA 3MJYA 3WMCA 3H54A 1XLKA 3GTIA 3RLVA 3ZLGA 3LCFA 4DJFA 3NL6A 4O54A 1TPDA 3DGRA 3HG3A 4C90A 2OGJA 4QCEA 3GG7A 3WLHA 5FF0A 1FUYA 1NY1A 4CU7A 3T9PA 1YTKA 3LCXA 1Q7MA 3VKCA 1V02A 2FZ8A 3QFWA 1XICA 3KM8A 2XFWA 3NVDA 1SVDA 1QATA 2XN2A 2DU2A 2YCKX 1V77A 2VC5A 3WK1A 4O4VA 3UZYA 3L4TA 1UCWA 3EEZA 3CLMA 1LWIA 1NQKA 1DQWA 1XIMA 3I3BA 2E7FA 2OYMA 2A3EA 2J27A 1OQFA 4KMQA 2PP0A 2A79A 4IPNB 3NM3A 4KEMA 3ABXA 1VPQA 1KR0A 3Q45A 3QW3A 3L4XA 2NVCA 2RDWA 1LLOA 1XV8A 1UKQA 3PZTA 1WOAA 2EEXA 1Y0EA 1PTAA 4V33A 4DO5A 2QCDA 4TMBA 1EO5A 1KRBC 2GQ9A 2PDYA 5IOBA 3N2BA 1K9EA 3CO8A 3PF3A 2D2HA 1UWQA 4YVVA 4C60A 2ZUMA 4P7OA 4URIA 5D2XA 4LYPA 1TJ0A 2CESA 3HJZA 5D02A 1UPMB 2XTKA 4US5D 5J8LA 2UY4A 4MNJA 2PI6A 1P48A 3ARVA 2AQVA 4CUCA 5EYWA 3T2PA 3T4CA 3UVIA 2Y24A 1QK2A 4W9TA 1FCQA 3W7HA 1F9CA 5LNUA 2FZMA 1XCFA 4FALA 3VIMA 1OF6A 3G1VA 1Z9AA 3P7YA 3KVJA 1AQMA 2PGFA 1W0MA 4POCA 2GJXB 1O94A 3VKDA 2ZX5A 3CB8A 2GK1A 2NQ9A 1BVWA 1QASA 1XRTA 1LDCA 2J9ZA 5CG0A 3CIXA 4HMNA 2FMNA 4NHVA 1VENA 2BOEX 5T9BG 3BDKA 3DFTA 2BXVA 4OJYA 1C29A 2YPIA 3HURA 4HU3A 3VFLA 1UR2A 3CZLA 4IH3A 1SO5A 2DORA 3T0CA 4JTJA 3HG5A 1VF8A 3BG3A 3LENA 3EWDA 4O17A 2BHYA 3M6DA 4H83A 4JX4A 4XVEA 5T8GA 4LOCA 4WOQA 5DT7A 1PTGA 2XVPA 1AH3A 3N2MA 3E1F1 2WHMA 5T9CE 1Q13A 2QUVA 4QG9A 3NAVA 2HVNA 1KM1A 2HXUA 1GVSA 2BB0A 3L66A 3SIZA 1M1BA 1PZ2A 4Q8OA 3O3RA 3R8HA 4CEXC 4F48A 4P8UA 2PDBA 2CETA 5K4ZA 3L2LA 1VD6A 3V0TA 4MWAA 1A5CA 1QW7A 5D03A 1MDRA 3VOIA 1W8SA 1A5UA 4KBXA 1HJWA 2EKCA 1GG1A 3DDMA 3PTDA 1WNOA 3GHUA 3CHVA 3SUWA 4DYKA 2E5CA 4PA8A 5EKYA 4QDWA 3NL5A 3TQPA 1MMFA 2GJNA 5JUVA 2VOTA 2GSHA 4TU1A 5HA7A 2PDXA 2ZX7A 3M5VA 4CD7A 2PGRA 4F9DA 3C2YA 5CJMA 3KOFA 2OSWA 4WOZA 5MKGA 3JW7A 3ATZA 3BLOA 1RR2A 1IIHA 5JH1A 3AIQA 2G97A 4R5EA 4PCTA 1T99A 5LNSA 4K38A 2BXYA 1DJIA 1IXQA 1TMLA 4N7QA 5CCZA 3M07A 1HIZA 3AIBA 3E2RA 1EJRC 3NQ2A 2VNCA 2J47A 3VO0A 3NNTA 4UTTC 3AAMA 3EYPA 3KL3A 5I2UA 3MSGA 2VEIA 2KZHA 3QZAA 2RKXA 1SYTA 1LRTA 2FB2A 1N8WA 4OFCA 4QSFA 4AY1A 4IG2B 1L6SA 3GYCA 3RR1A 3PUEA 2GYIA 3UCQA 2BY3A 3ANUA 3SBFA 4G1KA 2OKOA 5E0FA 4UMCA 2BY1A 2R1PA 3ITVA 2H3DA 1A3HA 4PFHA 4MY8A 1A53A 4CQBA 1PBGA 3QH2A 4IPJA 3MWCA 3W1MA 4ZE4A 4O0KA 5CZSA 4N42A 1K6AA 1OJXA 1NM9A 4XZHA 1VEOA 3BOXA 4BQ4A 1I45A 3HGOA 1K9DA 4Y9MA 3H4XA 2ZA3A 2Q3RA 3TUUA 4ZQMA 1BG4A 1UD2A 4LF2A 1H50A 1GKQA 1Q65A 3OP2A 1TSIA 2WPBA 2ISFA 1XG4A 1CGXA 3BSMA 2F7FA 3RU6A 1F6KA 2NSXA 3RPDA 3S1VA 5C70A 3B0XA 4ICMA 2E68A 5F4WA 2EG7A 3VNDA 1FHVA 2HWGA 2JIEA 2PLJA 2R1LA 4XG1A 2Z1VA 3S42A 4BQ5A 1EP2A 1XYMA 4GWEA 2FZNA 1VBJA 3NYZA 2INZA 1BFNA 1GK8A 3W2MA 1EH9A 2J75A 4AVOA 3RILA 4F0KA 2J24A 3FJLA 1I2NA 2J62A 2ZX6A 3F5KA 4UNLA 4QJ5B 4MY9A 1H4PA 4LXFA 2ZE3A 2Z24A 1TZ7A 4BI7A 2FTPA 4LRSA 1BG9A 1V7YA 4ZQRA 3WL1A 3UERA 4GXWA 4Z08A 3ARWA 4NI3A 3QOKA 5AOUA 1D3GA 2QYGA 4R53A 1R6WA 4MIMA 4DHGA 1TVLA 3L21A 3TOYA 1TPEA 3ORWA 5HWMA 2F8QA 4A22A 3EBVA 3W7JA 3WNPA 2Y8VA 1OEPA 5KEZA 4WGXA 3RO6A 1JCYA 2QCMA 3A23A 4XKMA 4LVBA 3NO3A 1KWKA 2OO0A 3GDBA 2YL5A 2XH0A 4Y8EA 2XH7A 3GK0A 4L65A 1AMKA 1FHUA 2WW5A 3CPGA 2XUCA 3PANA 4HYWA 3E6EA 4JKMA 3H70A 1F05A 3CEUA 3MVTA 3W26A 4IJRA 3F4NA 3W37A 4YS1A 1JDEA 2SFPA 4JL1A 2QKFA 3QV6A 4FOUA 4DWSD 3F2CA 3KRUA 1RD6A 2YXXA 3HB9A 5G2WA 4I9AA 4MF4A 1VHNA 1IWAA 3IRSA 4DLMA 3KAOA 5AZ1A 1KXHA 4EPEC 3PUOA 3PN8A 1HKMA 3W7EA 4DJED 3N15A 4C6OA 2ACSA 3HN3A 4HN8A 5DF0A 3NPVA 3AXMA 3UR5A 3CYJA 5DCDA 3GKFA 5F4SA 4WY0A 4ZZ9A 5KZMA 3F03K 2OEMA 3MC5A 2O9OA 1XC4A 1OX5A 4U2YA 3H7RA 3WLJA 4DYEA 1UD5A 4HMCA 3AU6A 4ZOEA 1G5AA 3LCWA 3IPWA 3UWQA 3W1TA 3WYZA 3TJLA 2G0WA 1H0IA 1B57A 4BHYA 1UWIA 2HNEA 1IZCA 3U0HA 4IX0A 4QS5A 2HE8A 2WNWA 1TIWA 3W07A 3LTYA 2VFGA 1L6YA 1S2VA 1YXYA 1J0YA 4WSKA 3VVGA 1CZ1A 1I1XA 2XN0A 1RSCA 1PSCA 3VX0A 4MG4A 2OWWA 4AU0A 4KRUA 3V4BA 2ZZ4A 4K3ZA 3WELA 4ICNA 3QY7A 1M65A 3E2QA 2XGBA 3W72A 4HU8A 3HPSA 4LJ3A 2J7FA 4BF7A 2JGYA 1OHLA 2P3EA 4MMWA 4JDBA 5C6MA 1ZENA 4FXFA 3WQPA 1K8ZA 2GVEA 3G22A 3IRDA 1TV3A 4DJEC 3AZTA 3WQCA 4GA8A 1MW2A 1RQHA 3EWYA 4D6GA 2QCDB 1L8NA 2GUYA 3LYEA 3V16A 3RMJA 3OO2A 5AHEA 4IQLA 2I9UA 3EWXA 3O0FA 3THUA 3NZRA 3ERPA 3DFSA 4B4FA 1TPB1 1QHOA 4IWWA 5PTDA 4ZE5A 4W8LA 4WJ8A 3N19B 2Z28A 3I6TA 2C7FA 1CXHA 5D09A 5CBBA 2C13A 4GLEA 1WE5A 3IV8A 1EZ2A 2OU4A 3SN1A 4HK6A 4RXGA 1JQXA 1XSJA 1J18A 1EEXA 2QUMA 3AYTA 3SCNA 3MYPA 2C0HA 3V0SA 4A3HA 3PJXA 2YL8A 4JR5A 2AMXA 1TPC1 2V68A 2GK1B 3VTRA 2HS6A 1WOBA 4Z1YA 3RIKA 3TTOA 3M0LA 1AVAA 1XP3A 2DZSA 1TV8A 4M6VA 3EWCA 1R9XA 5IBXA 2UY2A 3MCMA 5E0KA 3ENLA 3UJSA 1XH0A 1BRLA 2OXNA 4H3DA 4N6FA 3KTSA 1S39A 1ZSXA 2X09A 3UZ5A 1JNDA 4YU1A 4L80A 4AC7C 2CLMA 3CZGA 5E5CA 1TTQA 5GJPA 1ALDA 3W3OA 3LTSA 4E3TA 2GPTA 3A3WA 2Z2AA 4S3FA 5CPOA 1TB3A 4PUEA 4PZVA 5AN7A 3S6OA 1N2VA 3M0KA 1Q6OA 3TQ0A 1PZ0A 3MCNA 1GORA 1CXIA 4IIHA 1RPXA 4MWAB 1DOSA 1MNZA 3PAJA 2OZTA 3B05A 3L4ZA 4M1BA 2GJLA 1LBFA 1VEMA 2C16A 2GOUA 3S3GA 4B5WA 1RD5A 4M19A 1A80A 2VP8A 1UG6A 6PTDA 1FFRA 1UUMA 3W7QA 1LP6A 5FI8A 2Z4GA 3BGAA 4MLRA 1QPQA 1TWIA 5JU6A 3LG3A 1ITXA 3SCVA 4NYYA 3L0KA 3WJZA 2PDQA 1HZYA 1M3UA 2Z27A 4MJMA 2WVUA 2P3ZA 5BXSA 1SU5A 4MZ8A 2YBVA 5MKGB 3AYVA 1VR6A 4CD4A 3BTNA 3BSGA 4Z0SA 1SUXA 3B40A 3N2TA 1I6NA 1QI2A 1OK6A 1BWLA 4O14A 1O4UA 4B3LA 4O12A 4E5TA 4PSRA 3W7DA 3E49A 2HQAA 4J7RA 2F6KA 3W9ZA 3OVGA 4GYJA 3P14A 4QIUA 3SCSA 1X8CA 2E5DA 1ONWA 2W62A 3VD5A 1PEZA 3VOJA 3QGVA 3ZR5A 2C79A 3LHYA 4PYSA 7PTDA 3LPGA 3EOOA 2YSWA 4JNYA 4KRTA 2OYKA 3W22A 1WYIA 4NZ1A 3WDPP 1HJXA 1CNVA 1OX4A 1PX4A 3LQLA 3GSMA 4LUTA 3ITOA 4AY7A 1W31A 3QR1A 5EMJA 4ZL1A 5C54A 4HP5A 1CLVA 2Y63A 2Q71A 3PBYA 4AZBA 3WCZA 3ZR6A 4S3GA 2PWVA 1R5YA 4C6LA 1IT0A 1IYXA 4NZ5A 2DZPA 3A47A 3ZT7A 4GXPA 1RVGA 1VJSA 4JXCA 2QAFA 1R46A 4F8XA 1RCQA 2UZ9A 4HNCA 3LRLA 3AIWA 4L6HA 4D6CA 4G6CA 5CSYA 3HQOA 2CZ5A 2CBVA 2PDJA 2VRJA 3S5SA 4Q4RA 5XIMA 1WDSA 1XIJA 3WLOA 3UPMA 6XIMA 3LSCA 3ME3A 3ARPA 1E6NA 2BZNA 4GRSA 1FX6A 1FXPA 4G7EA 1K02A 2YXGA 3NXLA 1RP9A 2PDGA 2PUZA 2DPEA 4LAKA 4UOJA 4BF5A 2Z1XA 4NL1A 4A35A 4TV5A 1PWLA 2YFOA 3QPEA 2V3DA 4E6MA 4B9ZA 2FQIA 2CHOA 3EOSA 4ZQCA 2WLYA 4W85A 1QHPA 5B80A 3G1FA 1G4SA 2FVLA 3Q4DA 1S3HA 4J5NA 1KQYA 4JTKA 3FY1A 4HMEA 3WEOA 1Q7ZA 4S3KA 1GEHA 3PWIA 3Q2DA 5HWJA 2REQA 2B7QA 1V0MA 4PEKA 3RFAA 5CC5A 5D32A 1KFWA 3W83A 3GXDA 2VYOA 4JTAA 2ZC1A 5EBAA 1NWUA 5F2MA 3DUGA 3KUMA 4YVPA 2DIEA 3GNNA 3JZUA 1UH3A 3OZPA 4ZQPA 5A6MA 4UCGA 4UWMA 5JBEA 3U2OA 2G96A 2PAJA 3EDDA 3BLKA 2X40A 4LS2A 5LNVA 3IVTA 4X61A 2W79A 5AYBA 4L9ZA 2W91A 2X0YA 5E9XA 3OVPA 1WKFA 3W7GA 1QJWA 3W1PA 1QNRA 2DJLA 3ABZA 3OIHA 2DVUA 4D9PA 1B3ZA 2VWSA 5JMUA 2FVMA 1KFEA 5A2CA 1WCGA 4CQCA 2PCQA 1H1NA 4ERAA 1FTXA 5C7HA 2YBTA 4EANA 3G24A 2PTXA 4PRTA 1UD8A 3UW6A 4K8GA 2FJKA 3IVSA 1GYMA 1V93A 3W28A 4XVDA 3LK6A 1R38A 3FV9A 4DEFA 3GXIA 4JDYA 1HJSA 1WXZA 3TMLA 3WFAA 4NKCA 5EA9A 4Y2WA 2RGLA 4B3KA 1TQXA 6CGTA 1UC5A 4N4QA 1XJBA 2C3ZA 1BF2A 5JIWA 5A6BD 4WY0B 3CV7A 1EDGA 3HZ3A 3BPWA 2QV5A 1QWKA 3C5QA 3AIVA 1J0KA 1FWHC 4B91A 4F2TA 2C14A 1KBIA 4JN6A 2QJGA 4UXDA 3F4WA 3GU1A 5CSSA 3GUWA 4XAYA 4RE3A 2J66A 5A6JA 4S39A 4CNTA 1CX9A 3PJTA 2QGYA 2CLEA 3UETA 5C8BB 1MZHA 2EGZA 4HGXA 2D3LA 3R10A 3RLHA 2JFEX 1W1A1 1XH1A 5BMXA 2XZ9A 4J40A 4F9JA 1NFPA 1VFMA 1MQRA 2UV8G 2DSUA 1TJ2A 1IT7A 1LCOA 4FNQA 4NI8A 4XAGA 3SN4A 1EX1A 1JZ4A 3TW7A 4W4QA 2Y4SA 3EA1A 3AS3A 5LA1A 3MI2A 3PG8A 1H5VA 3WBWA 4NYUA 2Z29A 3CB3A 4XAPA 2VFFA 4B5NA 4PMXA 5M1TA 1XI3A 3VOHA 1AQ0A 2NV2A 2OZ0A 4DY1A 3S8HA 2PZNA 3CV6A 4RKAA 4D6JA 1BQGA 5KMYA 2VDGA 1D7KA 3F4VA 3CQJA 3WKZA 4PE8A 3B0PA 2WM0A 5LIWX 3W02A 3LEPA 4QEHA 1WBJA 3ZFHA 3RAOA 3LN3A 1XKJA 2DQWA 3KP0A 3MBFA 4GOAA 2AL2A 3BJSA 2YA0A 5IXEA 1GOOA 3N9KA 4JIRA 4WGHA 3G1AA 4JIHA 2GWNA 4E2VA 4Y9NA 5CGQA 3ARUA 3PTKA 4PMUA 4YXGA 4QM1A 3UJFA 3IVUA 1TMHA 1FVPA 3BURA 4PTMA 2CW6A 2OLHA 1PIGA 4O0ZA 4YN5A 3VGGA 3T0DA 3GIQA 1JUKA 1M53A 2BVTA 5GVJA 2ICSA 2NQZA 4IT1A 3EXRA 2PPGA 3GVGA 4JKKA 4AMCA 1W1IE 4UC5A 4NAFB 5TNVA 2UY3A 1JCJA 3ZOAA 3G0UA 3OEXA 4KRZA 4MJ2A 5CLTA 2CITA 7ENLA 1B31A 3VD9A 1B3OA 2CBIA 4UTMA 4QRNA 3PPHA 1AH0A 4XB3A 4MB1A 3DG6A 4NX0A 1MZRA 4JN8A 2WOQA 2PZ0A 3WNMA 1DV7A 3WNOA 1C90A 1ICQA 1O1HA 3RLUA 2PLCA 2ZRUA 4KT2A 1V79A 4C7FA 2FDSA 1J6PA 1E1CA 3U2CA 3OGSA 3NUKA 4E4PA 5CPLA 4YCOA 4H1ZA 3SUVA 2FMOA 3PJWA 3SY5A 4KCUA 5BMWA 1PUDA 1HQTA 4US6A 1DYSA 2OVLA 3AOFA 4BF9A 3ZT5A 1XGDA 4NJKA 3E9AA 1DE5A 1EKOA 3FA4A 4DJFD 1VLIA 2QJNA 1UZ4A 4GMEA 4GC4A 1QNSA 3K8KA 1P7TA 3S9ZA 2PLKA 2VUNA 4MNLA 1MWOA 1DXFA 4DJDA 3VMNA 3S2MA 4ZO8A 3SSZA 3TVAA 1S2UA 4RNJA 4KKXA 3KS6A 2WMGA 4R7WA 4F40A 2XYLA 3SFWA 2A6NA 3BANA 5D9MA 3TYBA 1JYXA 5K4XA 1A3XA 1UUQA 3DAQA 3UY8A 3UA4A 5HR7A 2QF8A 1XCXA 2FKPA 1GNXA 3LHVA 2YBUA 1G94A 4AWSA 1XIFA 3T42A 3HO8A 3CQHA 1F4AA 4EK7A 1BPLB 1E51A 2ZICA 3VDCA 1IV8A 1E6QM 4PBGA 5G1MA 5HMFA 5HR6A 1V6TA 4XISA 1XGEA 3MQTA 5AC6A 1EQPA 1UQYA 3LCIA 3W2LA 3BC9A 1E0WA 1AZ2A 2JE8A 4X3ZA 1CB2A 2FZ9A 4HZMA 1VQTA 2NUYA 4RW3A 4DJFC 4OIFA 4DM2A 1Z69A 3IJ9A 3ZWTA 2Y85A 3UJRA 2G37A 3G3MA 2INFA 4JNMA 4LUTB 4K1WA 4MSSA 4XZWA 2IQTA 2AGTA 2ZADA 4CNUA 3LCGA 1GG0A 3SCTA 4JTUA 4IX2A 3CH9A 3CT7A 3BCJA 4LS1A 1J11A 4GQQA 1E0XA 1XRSA 4LV4A 2I5GA 3VCCA 1XIGA 1F6PA 2C19A 4FZIA 2CKRA 3PP7A 4Z1CA 3RPMA 1RP8A 4J27A 1A5NC 5AVHA 2BASA 3DC8A 3GY1A 5M03A 4FXSA 1C8QA 1JCXA 4B2DA 4YLWA 4I5RA 2ZKMX 3G8EA 3N3TA 2CWXA 4ACZA 3Q58A 3AMDA 3WF2A 2C1HA 4Q4QA 3KWXA 3RR4A 4LVAA 5FEXA 3GDKA 4I7UA 3B4YA 4XTIA 3MS8A 2G50A 1KD0A 1YXCA 5HAOA 2A7RA 5CZKA 4LCSA 4G7EB 3KOXA 3GDMA 1DBTA 2FHCA 3EB4A 1JYNA 1B54A 3MUCA 1QI4A 4PN2A 1QOQA 3QBUA 4TTUA 1DTUA 3G1DA 3UY7A 4MADA 1N8IA 3TYUA 5LKYA 3W29A 1EB3A 1VFLA 5D04C 2HPIA 1X1OA 2XPKA 1JAKA 2WVVA 3UG4A 4AWEA 5EGRA 2ZUWA 4Z2KA 2GJPA 4JBRA 2JEQA 2PS2A 3G6LA 3QSRA 4ZB5A 1EHNA 1GYLA 3NSNA 4LEQA 4K7VA 2PGEA 2Z1BA 4MWAD 2J79A 4O19A 1OC5A 2EG6A 1TFVA 1RK5A 1EF3A 1Q8JA 3VZZA 1XYZA 1GQLA 3GW0A 4CNPA 3AMGA 1ITCA 3U9IA 2NQ5A 4F0RA 1XLMA 2XIIA 3GS6A 3L65A 4H6RA 1PB0A 1HT6A 4M24A 4XD5A 4IIFA 5CPQA 1IEQA 1JCTA 2W67A 2REQB 4HPXA 4CD5A 1LJYA 4WKAA 3CMGA 4YTQA 4C6KA 4RZ5A 1PV8A 1KCZA 4N9DA 4TQTA 1UJQA 5D05A 3O63A 4WIWA 4L9XA 3MPGA 2Y7FA 2ZVRA 4HU4A 1H49A 4NZFA 2G3NA 1P0KA 1CI1A 1XPGA 2KX9A 3UWEA 7CGTA 1OT1A 2TYSA 5U4NA 1PKMA 4AZ5A 3KLKA 5DX7A 4NUWA 1TZZA 7XIMA 2F6XA 4L61A 3D3AA 2OX4A 1S2CA 2A21A 3U4FA 1GJPA 4ZXOA 4LAUA 3DI0A 3CHEA 1XD0A 4NAEA 3IGXA 5AHFA 5LHEA 2W92A 1V3KA 4MWAC 1IF2A 4WDWA 1M01A 3PZQA 4JTQA 4FNTA 3BG9A 3COTA 3U48A 2ISSA 3TTSA 1GHSA 5CEWA 2NT0A 1W1YA 4O8AA 5CGMA 2ALRA 4IXHA 1I2RA 4JQ4A 4AG0A 3D0CA 4C6FA 2V38A 3O05A 3MKVA 1Z42A 3P2VA 3ZO9A 4JOMA 4UTKA 3OU8A 3W7IA 2FGLA 1VFUA 3AFBA 3GNXA 4AB4A 4L4OA 3I3DA 1ECQA 2H3BA 2WKJA 3AMKA 3RRAA 1LRNA 2Z1KA 3QQWA 3VOGA 1JAEA 2EQDA 2DGAA 1DIOA 3UESA 4E3VA 3D6NA 2YA2A 3QV7A 1XFBA 4XIMA 4HK7A 4ZODA 3I68A 1JPDX 4XK2A 3H26A 3EPMA 2VKZG 5D38A 2OG9A 3B06A 3VD7A 1JZ3A 2HDJA 3ZQ9A 4WKHA 3MI3A 4GGBA 4GQ0A 1Z6KA 2TSYA 5BW6A 1FWGC 1T8XA 2ZUNA 1A3WA 2WCGA 2J7EA 3AHYA 3GQYA 2E40A 3H8AA 4FAMA 2FVKA 1W1PA 1X6UA 3O7UA 1L2UA 4PMRA 2GSEA 3EWBX 1HJVA 2VX4A 4D72A 2TODA 1TTPA 2TPSA 4E2BA 3VA8A 3L9CA 5G1YA 5CC7A 4HNLA 1Z48A 1FOBA 4RDZA 1M7OA 4UTFA 4AX6A 5FJUA 2VXNA 3POCA 2P1FA 4KESA 4KWUA 3W7PA 1JRCA 3WNLA 1WV2A 4W86A 1IE7C 1U83A 2FGZA 1KCKA 3WH8A 1OBAA 4QHRA 3W2JA 5HATA 2AL2B 2GUBA 4AFYA 3ECQA 1UB3A 1O6IA 2DFAA 3C2EA 3NGFA 1KLYA 4MB5A 1SMDA 3QEZA 1C8XA 1EJVC 3N13A 4ILSA 3LRMA 1BWVA 1LL6A 1K7EA 2E9MA 1HKKA 5LYRA 3G5EA 1KW1A 3ABRA 2DZXA 3WK0A 3TJ4A 3ZLFA 3GC5A 3UXAA 1NWRA 4H8NA 4DXXA 4OVXA 2PTYA 5EB8A 1YDYA 3DBNA 3WLTA 4HYVA 3CAQA 4IOTA 3W7CA 5HNRA 2CERA 1Z3NA 4LRTA 1V08A 1WZAA 5D37A 4M5PA 2OT0A 1K77A 4LB3A 2C1GA 4PMJA 1EPXA 1FWEC 3MKKA 4DUVA 4YYCA 3FXGA 5T91A 2GQ8A 2HCVA 3OYXA 3RITA 1MEWA 3LCHA 1TWZA 3ZVHA 2VEPA 4AD2A 1QOPA 1DHKA 4DX3A 2Q8XA 2Q6ZA 2BODX 3V1HA 1CGUA 1DJNA 1X1NA 4DZHA 3AWNA 1OINA 1B9BA 2VOMA 4FPSA 2V67A 4DAIA 1E1CB 1NF7A 2Z2BA 1QAPA 3VUPA 5FESA 5FD0A 2A7PA 1I75A 2GUUA 2YZ5A 5D2VA 1UWSA 3IIZA 3CWNA 4BA0A 4X2PA 4I9TA 3WL0A 3BCFA 3IAQA 3POHA 2PODA 3FDGA 4G8TA 1WDWA 1X8FA 1QR7A 3DG7A 2NX3A 4CGTA 1JPMA 1YPXA 1P7TB 3DFYA 3FJNA 3TZFA 5DANA 1YPIA 4PTNA 2NQHA 2V81A 2E8ZA 2TMDA 5SWUA 3V5FA 4AZHA 1P6BA 4CLMA 1QVBA 1Q85A 3TWBA 3S6TA 1GTHA 3K5XA 1H5YA 4X0VA 1Y8BA 3OGVA 1O1ZA 4PR4A 4M6QA 1TUFA 3VI2A 1S38A 4RE0A 5C2GA 5LIYX 3WQWA 1HL8A 3NZ1A 3I6RA 5B7YA 2HTMA 3M6YA 4J1OA 4JYFA 5AB3A 1ONEA 4O13A 1ZP3A 3T6CA 1S1PA 1JFXA 4UB9A 3LB0A 3LXBA 4L7ZA 3NO1A 2GQAA 1M7XA 5JIPA 5BRPA 1E71M 4O1DA 1QBBA 3MP5A 5F4XA 1W3HA 2CLIA 1UOZA 3DFHA 3A9IA 1SQ7A 1ZHAA 2ATSA 4IP5A 4KWVA 4QISA 2CFFA 3NG3A 3FYOA 4UCFA 1B0IA 4GG9A 4JTEA 4TMCA 1A5OC 3WLPA 2YL6A 2A3HA 2Y61A 1KXVA 7TIMA 3LPFA 1VH7A 2ASHA 2QCLA 3S5OA 3WBAA 2P0IA 3UG3A 1GYNA 3G1XA 3O06A 4WK9A 3TU9A 1L0PA 4B92A 2CYGA 1DVJA 4RZBA 1XKYA 3QLLA 3AI0A 4HJFA 2ZA2A 4GPNA 3PZIA 4DIAA 4HK5A 3ITXA 3H2MA 3W2UA 2JF6A 2A5HA 1ZCOA 4EAMA 1H7NA 2J7GA 3AQUA 1BD0A 1GOMA 3QC0A 4LY8A 2BGQA 3EB2A 2GVYA 4FX8A 5AYZA 4DI8A 4GISA 3WBEA 3NOEA 3FHAA 5G2HA 3VIOA 2WHLA 3NQ6A 1SFTA 2PD5A 1IGSA 1ODZA 4ACZB 2F2HA 1D2KA 4NIRA 3GH5A 3PZGA 1SZGA 3HGRA 3FX4A 4JQAA 3GFZA 5HDRA 2WZIA 3CL7A 4A3UA 4GZIA 3PUDA 3HOJA 1E0TA 1M6JA 3WK3A 2INEA 3WEMA 4JHZA 1RZMA 2UWFA 1NH6A 2AAMA 2V6AA 4GQRA 2WJDA 4BWLA 1GT8A 4M7TA 4H01A 3WD2A 4EX4A 1SJBA 2VM8A 3UCDA 1OCJA 2CBUA 2Q8ZA 4PMOA 4GKLA 1EOKA 3OODA 1U5HA 1ME8A 2Z6JA 3RCYA 4GIEA 2WVVB 2PLMA 3RN6A 1KM2A 5AZ0A 4ZXLA 4O15A 3C86A 3CUGA 3KBJA 3FXYA 3L12A 4LTSA 2QCNA 2B7OA 1W9BM 3VMPA 1J9YA 4LNYA 1JXJA 1AH4A 1PZ3A 4WXYA 1NQ6A 3THDA 3M0YA 4JYEA 4QITA 3AXIA 3S83A 2OB3A 3V35A 3TFCA 5DCBA 2ISDA 4HHLA 4WDXA 1JF6A 1SW3A 3QGKC 2PTZA 1QI5A 2QUUA 1PHQA 3PAOA 1EF2A 3UXKA 3SUTA 3GR4A 4G9PA 1XLGA 1Z41A 3N4AA 3GWQA 1DXIA 1D3HA 2XISA 1NDVA 3GAYA 4LS0A 3TMQA 3BAKA 4G2DA 1ZBCA 4PMNA 3EAUA 2ISVA 1RY8A 5LXXA 1VRXA 3K46A 4H19A 3VD3A 2FPYA 1RA5A 1TWDA 1P6CA 1NDWA 4C1NB 3K8LA 2YB1A 2H9AB 2QJIA 1QWGA 4JTSA 2YLLA 3MANA 3IIOA 2I14A 4U31A 1PYMA 3VNYA 3R94A 1UR1A 2WC3A 4JFTA 3LV5A 2QGHA 1GPWA 3W7RA 1DJYA 4YTSA 3AUOA 4YTRA 4GX8A 1B4KA 1BWKA 1I2PA 3W01A 3VIIA 3TYZA 1XSKA 5HJXA 2PGWA 2YCEA 3NURA 4KFNA 4ZQNA 5B7ZA 4KPLA 5LA2A 2YDSA 5DEZA 4WEVX 1KM4A 1ZBKA 2HBVA 2VGGA 5DY2A 3FEQA 3ARYA 2V5DA 3S1XA 1KXQA 3KVMA 1H7OA 1GZ1A 3KZPA 4C6CA 4IUGA 2V69A 4N9BA 1TV4A 1KM5A 3MSRA 4A3RA 2YA1A 2EHHA 1OGBA 3CUXA 2HPMA 4U5KA 3UYCA 3L68A 2W6RA 3HPAA 1KRMA 3F2DA 2FFIA 1EEPA 3WLIA 3QY8A 3MUIA 1FKXA 2VEGA 5EFDA 1F3EA 1HKJA 1AG1O 4H9VA 5TIMA 4LCQA 3ONCA 5I7GA 5CH9A 2O9PA 1W1ZA 3KVKA 3OVQA 1EGZA 3BLFA 3OGRA 4AIEA 1TG7A 2WHKA 1S2AA 3LGDA 3EMZA 3S5ZA 1JIBA 4M51A 5IDZA 1VZWA 2ACRA 3DHUA 3VE7A 5G4EA 1HTIA 1IXNA 3NSXA 4GXMA 1F3WA 4ZO7A 4IPLA 1LQ0A 1EO7A 1DJZA 4HOWA 2F9RA 3G18A 2GVGA 4ZB0A 4AXKA 4TVDA 1AL8A 1DQUA 1HGWA 1E0VA 1XIHA 2ZZ2A 4O1CA 1XLIA 3I7SA 4DNMA 2Y7EA 4GO8A 1OFBA 3PNZA 5FF3A 3L5LA 3TTQA 3RM4A 2VEMA 5BZAA 1XLDA 3B0UX 2X1TA 3MO4A 2EXOA 4LAZA 3BAIA 4O1AA 5I78A 1R7AA 3GZ3A 1XUUA 4O52A 5FF2A 3E0LA 2JF7A 4CU8A 3LLDA 5HANA 4LUJA 1BVNP 1FY6A 4F2UA 4EVZA 4O4WA 2QCGA 4IPPA 1YXDA 2PMQA 5BCAA 3C3UA 1TPVA 4GI9A 3SCOA 1PVNA 3SUUA 4C1LA 3MHGA 4DVOA 4IIBA 3ZJKA 3CMJA 2YW3A 4PMZA 4C5YA 1AODA 4GI4A 4HBKA 1GGOA 1UR9A 1W17A 3WIJA 2ZUVA 1O95A 4D6DA 2VURA 2Y0FA 3DESA 3KRBA 2OMAA 3TK7A 4QTGA 4ZSUA 3S6DA 1TRDA 5GJNA 4K68A 1GUVA 4HSHA 2FFCA 3OBAA 3WBXA 3R11A 1JUEA 5FJIA 2A3LA 3R0DA 1SZEA 5AHMA 3S46A 3OVRA 3SADA 8XIAA 3H7VA 1BF6A 2YB4A 2XZ7A 1XXXA 4QS6A 3BJTA 4V28A 5HQLA 3FYYA 3DHDA 4V1YA 4UFLA 1ECEA 4JIQA 2POTA 3NOYA 1TPFA 1SPQA 1QNQA 1C7TA 1MVYA 3LOTA 5J5RA 4HA4A 4JTIA 1J96A 1RHCA 2F6UA 4ERIA 4ZTXA 1Q63A 3T0AA 2X41A 1XLFA 3GTXA 5D4YA 5C2CA 1JR1A 4NASA 1P0BA 4DWDA 4JTFA 2OLAA 4E2DA 3BAJA 4B5TA 4QAIA 3MWAA 4Z2IA 5FCZA 1DEDA 3ZIZA 1UBPC 1V0KA 5EMMA 3N2OA 3RX3A 1BYAA 1YNYA 6ENLA 1EP1A 4BQ2A 1X7IA 4O1BA 1O66A 1GKPA 4KIEA 3M4HA 4J2MA 1MYRA 2CNCA 2D69A 1AW2A 3B8UA 3UR7A 1Q6CA 4C6IA 1AJ0A 3A24A 4E8DA 4UTWA 2ISWA 4LV9A 2WNQA 3E38A 1N55A 4S2BA 5LNWA 3D46A 3C0QA 3P5YA 4I7WA 3VM7A 4FLSA 2F2KA 4LY4A 3QJAA 1KM3A 1FP9A 3FJ6A 3VGDA 3A4AA 1TRIA 1GVYA 1A49A 1FWJC 3ZM8A 1SJAA 3EZ4A 1B5TA 1T41A 3RCNA 4IZGA 6A3HA 4RK8A 2QAPA 1UA7A 5I07A 1ICPA 2R14A 2XIQA 4HIBA 3TN5A 4JYDA 3T09A 2FB3A 3W23A 1VAHA 2QVHA 1PDZA 3CYVA 2W5FA 3S5YA 3LV6A 1MI3A 1V0NA 3CBWA 3EPNA 2J78A 4QROA 4IGSA 1KFCA 3IJ6A 3AIRA 1MQQA 2X7WA 2Y5JA 4H8HA 4OGZA 1SZRA 1R30A 4UZUA 1V7AA 4A29A 3NZGA 3VKJA 1V6UA 2C15A 2V5KA 5A69A 1UR3M 5T26A 3AROA 3BMXA 2QMKA 2PDLA 5U7SA 3STFA 3CL6A 4XAZA 1JZ2A 4JTDA 4OV4A 4GIAA 5GJMA 5DBTA 3EDJA 3GKAA 1F07A 2H8XA 1UROA 3NQMA 4W87A 3OQ8A 1ODUA 1DE6A 4E4UA 1LBLA 1XYAA 4NXSA 1Q6DA 4CVUA 4YJ5A 4KWSA 4XZNX 1MUMA 1GQIA 5CBIA 3T40A 1H41A 2J9YA 3C6CA 2ZZ5A 1S2WA 3HA1A 4PULA 4NP7A 3VABA 3M64A 2BY2A 5I3IA 4DELA 1TV7A 4B4HA 4AZGA 3L5AA 2QJHA 3IGSA 2DH3A 4E8CA 4QDPA 1TZ9A 3LPPA 3R7MA 3UP8A 4XD3A 3NQ7A 1B3VA 1CENA 1FWBC 4JEQA 4B5UA 2J8FA 4QSHA 4R7JA 3MHUA 2ACQA 1OFDA 2ABBA 1DXEA 1FWCC 1LOSA 4H9XA 2FIQA 4GINA 1H60A 3UG8A 3OHMB 4KQNA 1ML1A 3MVIA 4F0LA 4CNNA 1ISXA 4TX9A 1LQAA 3VOCA 1AD4A 2OWXA 3W0KA 1UD6A 3UR8A 2X2GA 3W1UA 3SZ8A 1KFBA 1RBAA 3P0WA 1E6RA 4IGMA 1I0BA 1UWTA 2DY3A 1EC8A 5HJLA 3G0XA 1OFRA 4CCDA 1F2JA 2X7VA 1GZGA 4C6DA 2DT0A 4ZO6A 4FOJA 1FQ0A 5H8PA 2NWSA 3OB8A 1B1YA 1PIIA 5CSRA 4MZ1A 1D8CA 3D3FA 5CPMA 4FMVA 4MB4A 4V27A 5DLCA 1QXLA 4HNUA 3GO2A 1G67A 5BRBA 1EL3A 5FIPA 5KSWA 3WF0A 1VCVA 1I2QA 3W7OA 4PRRA 3LBOA 3QZ6A 3ES7A 4Z2GA 3M9YA 3QY6A 4ZO9A 2EPMX 4Y9AA 3E2VA 3EOEA 3WDIA 2ABAA 5DXYA 3O6DA 1X39A 5FEWA 4UQDA 3R8GA 4I8DA 3CTTA 3S47A 1VHCA 2EPOA 4RX0A 4RL3A 3NPWA 4B2DD 4GI8A 2Q02A 8CGTA 2Z25A 4DPPA 4XO6A 1TPUA 3GHTA 3AIUA 2Z1SA 4KGLA 1RA0A 3DFPA 5BOEA 4Q4MA 3WQOA 1KKRA 5JXQA 2YDQA 1LQ2A 3CHCA 2XFYA 2DT1A 1BXCA 2OODA 3WUFA 1VFHA 3ITCA 1V3JA 4QBXA 3CUJA 1PKLA 4D8LA 1TUXA 3GUGA 1ZJIA 3L7RA 4CU6A 3VCNA 5FKYA 5F2IA 2V3GA 2VZVA 3ICJA 1PCKA 3AZSA 2WNNA 3H2FA 1GVOA 3S0CA 4UFKA 3GB6A 3B3DA 4O11A 5H91A 3LI1A 4M81A 2VC6A 1IGWA 5H6HA 2AQWA 3VGEA 3RJYA 3NDYA 3UU0A 1KCLA 5I24A 2FHBA 3CAWA 4ORMA 4UUIA 4IFKB 3E0FA 1QT1A 1VC4A 4P8XA 3VGFA 3WD1A 2BSLA 1QW8A 1EBHA 2BLEA 3W88A 3FA5A 2E9LA 9XIAA 1JQVA 1JGMA 1CYGA 2BFGA 3GU9A 5CAKA 3AXHA 2CZFA 1X6LA 2DVXA 5KINA 4FLRA 2ZXAA 1WKEA 1NP2A 1FWWA 4U3CA 4INFA 1SR9A 2V63A 3AS2A 1L6FA 4AVNA 3LA4A 3W85A 1RBLA 2QV4A 1EJTC 5I79A 5BXRA 2E25A 3VMOA 2PBOA 3TNBA 3W1QA 3O6YX 4U28A 3IIXA 3ZJ6A 2GGGA 4ATLA 4AISA 4A8NA 1DL3A 4H9UA 4CVWA 2YZRA 3URAA 4NY2A 2YR1A 4H9MA 4AYSA 4M80A 3T78A 3WEZA 4YCPA 3TTEA 3STGA 1V51A 4LEFA 4LC8A 1ZNNA 3SRKA 1U1HA 1J5SA 1XUZA 3B9AA 4UTTA 3CT2A 2VI0A 3WDJA 4WSHA 1Q6GA 2AQOA 1TX2A 3WY1A 1KBJA 4UTHA 2ZTKA 3AALA 4CNOA 3S2LA 2J6XA 3R8RA 3NFUA 1SO4A 2DVTA 3GDTA 1HGYA 4W7WA 5M17A 3WX7A 2PSNA 3EKZA 4UBPC 1SO3A 1UOKA 3N12A 4AX7A 5BXTA 3R89A 3ITGA 2NX9A 3O6AA 4PBEA 3QOMA 3A13A 3T55A 2PB1A 3OTRA 5HNUA 3IS4A 3RNDA 4HOXA 4MJZA 1DP0A 3UWVA 4JAWA 4A8RA 8RUCA 4FS9A 3N6JA 1NDZA 1A5SA 3K2GA 4H9ZA 4ADUA 4O16A 4E0CA 3TV8A 1GOXA 4JFSA 1E15A 3OLDA 4KWWA 3A5FA 3ABOA 2GVJA 1YRRA 2ZZ7A 4N2YA 1TQJA 4B90A 3GH4A 3B8IA 1IWPA 3T0TA 3EA2A 3URNA 3GIPA 4JS3A 3L67A 4S3AA 4Y96A 1PHWA 3ZJ7A 3FA3A 4JKLA 4GX9A 1Q2RA 1PX3A 1WBHA 3KCJA 4YWIA 3CJPA 3W6MA 3FGCB 1Z8AA 4D6HA 1V6WA 2P88A 3T8LA 4AIOA 1QPNA 3WMSA 1H7XA 4QJ3B 5D2WA 3QMRA 3N18A 1DWFM 3OZMA 1ICSA 4YWSA 3IGUA 4C6NA 2QJJA 4JPGA 4MTVA 4IJBA 1XPYA 2XWDA 1OD8A 2XVNA 4N6EA 3WQ8A 2BDQA 4PRWA 3E74A 2PDIA 4GYPA 3M0MA 3S2NA 3QMSA 2QW5A 4PB5A 5D9NA 1SJDA 1GZJA 2ZBTA 4DBSA 1EXBA 1NSJA 4KEUA 4AH7A 1FBAA 5KZ6A 1BSIA 3W81A 4AZ6A 4HTYA 5FL1A 1PKNA 4X22A 3VIJA 5A8QA 1UMLA 3QSTA 1RAKA 1V3IA 3SGUA 2QDDA 1FWDC 4OQVA 2DSWA 4BJHA 1XYCA 3CIVA 4J28A 4QX4A 4IP4A 3LU2A 2WVSA 2VFIA 1EYEA 1KV8A 3CS2A 4WD0A 4UNIA 1OD0A 4XBSA 1GQNA 1T6MA 1MW0A 3H6OA 3TSBA 3QMTA 1PS9A 5ABHA 5IDIA 2D0HA 1WKYA 7REQA 2O92A 3NJ3A 1ZJAA 2J8TA 1S5NA 3DXIA 3M46A 3P67A 1T96A 3OG2A 3AUJA 2WKGA 4PUMA 4J3UA 4GUHA 3E5BA 4R33A 1H7WA 1XLCA 5CAHA 2DJXA 2B31A 3CUIA 2A4AA 3HU7A 3MSYA 4C91A 2BVYA 4Q4PA 4CD6A 1X7FA 2GLKA 4PL1A 1CLKA 4CQAA 4R9OA 5CGTA 4YTTA 1EIBA 1CDGA 4E2OA 1OZMA 3T0BA 2J88A 3HFTA 2WZTA 1QFEA 1D7FA 1TREA