1DOZA

Crystal structure of ferrochelatase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords FERROCHELATASE
total genus 118
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA02
3GOQA 1C9EA 3M4ZA 4KLCA 2H1WA 2JH3A 2Q3JA 2AC4A 1TJNA 3HCPA 3W1WA 4KMMA 2Q2OA 2DJ5A 2HRCA 2PO7A 2QD4A 2AC2A 1HRKA 4MK4A 2Q2NA 2QD2A 2H1VA 2QD1A 1DOZA 2PNJA 3LYHA 4KLRA 1L8XA 1C1HA 2XVZA 1QGOA 2HK6A 4KLAA 1LD3A 2C8JA 2XWQA 3AQIA 3HCOA 3HCRA 2XWSA 2QD5A 4F4DA 1N0IA 2XWPA 1AK1A 4CCSA 2QD3A 1LBQA 2HREA 2PO5A 3HCNA 2XVXA 2XVYA
chains in the Genus database with same CATH superfamily
1ZXXA 1JP7A 1NFQA 3GVXA 4JBNA 3ORQA 1FMTA 1Z7BA 4BNDB 3EF3A 3KR2A 1OSNA 2AYXA 1JTFA 4AY2A 2D1QA 3KIPA 2YOHA 1TT5A 3UWPA 4KVAA 2C7OA 1H5NA 4ZKEA 1LBSA 4K86A 3WL8A 1GYQA 5EA2A 3RHSA 1AQYA 1VYUA 5KO2A 4AX4A 2Q27A 4GSYA 4DIBA 3EDYA 3HWWA 1HE8B 3S7ZA 4B6JA 3DFIA 5BN1A 1T1EA 4FHZA 4R40A 1N9GB 2E49A 3TQOA 2J41A 3JQFA 4ND4A 4NHEA 1TQ8A 5JCZA 1Q91A 2QE6A 2YNMC 3V4FA 3ZW7A 1RWPA 5LNK1 2FPGB 2IYTA 4HJXA 4FHDA 1WUKS 1X8XA 2PR7A 3AEYA 4QU5A 4U6QA 1Y1TA 3MAJA 4KAAA 3PE3A 5TS3A 3WNDA 2PYDA 2EP7A 4NNOA 2FWPA 4U7FA 3SVZA 4U2GA 2P5SA 1NX9A 2PQ6A 3QKUA 3GPDG 2VQDA 4HLDA 4R0VA 2B69A 4R1UA 4EA9A 2P9EA 2CLIB 4HYYA 4OIFA 3SHVA 4EG4A 1BVHA 3CNOA 8GPBA 5HQ3B 5MN6A 5FNVB 1AZSC 4DZZA 4GDFA 1WCXA 2FX3A 2V4ZA 4GXRA 4OXXA 4UZFA 1N78A 3R7DA 4RHXA 2ZRNA 2ZZKA 4I50A 2VF5X 5KUTA 4IBOA 3ORFA 2UYQA 3LL4A 4PXYA 4P4UA 2EX0A 3RF7A 5JIBA 3JZDA 1YVDA 1CUWA 3C6YA 1UXGA 2Q9BA 1CERA 1USKA 2X6QA 3HHEA 2Z56A 1GTL1 2XX3A 3WO1A 1R64A 2HI0A 1CQIA 1N3LA 1U2DA 5CIYA 1UMCB 2VN8A 5KNDD 1OHHD 2ZIEA 5DE3A 3JVEA 4BLOA 3O1HB 4BO6A 5AW5A 5A5FA 2VYVD 2X13A 3NS7A 3U31A 4D7AA 1JWAB 2FQQA 1S89A 4BX2A 4EY8A 1DADA 1VP3A 1C0LA 4GBJA 1RKBA 3PJEA 4OFBA 1QRUA 3PA8A 4PPGA 5JZSA 4REOA 3A6JA 4NCBA 4HDMA 1N6RA 1GLNA 2HWUA 2QRZA 2ZE5A 3BWMA 2I3ZA 3N9IA 4O63O 4QNMA 2WFZA 1RP1A 1AV6A 4OGLA 1V1JA 1E1DA 1P3Y1 3PI7A 4YP9A 3MJ4A 2H08A 4UM8B 1Z6QA 5EERA 5DOVA 2I76A 4QARA 4KSBA 2CLSA 3TF5A 1MOPA 4IJVA 4MYUA 3DMYA 3E9NA 2V9ZA 2YFHA 3CLVA 3RSZA 1O0BA 4ZYXA 3UY4A 2FDCA 2IP2A 1QH0A 4HX2A 4I50F 1ZBDA 1JDTA 4DQ0A 4QTZA 5FAKA 5LXTA 3BH7A 1YRBA 3RB8A 1UPUA 4U6NA 2HLDD 4GOKA 4WNAA 1N2OA 1G60A 4WLVA 1OUMA 1T5LA 4K9KA 2JRLA 3SOZA 3UG6A 5KVCA 4Z4EA 4AZ0B 1FSFA 3DW1X 4RX1A 2PNJA 4YRKA 2QQ0A 1T1GA 1RHRA 4Q39A 3PC2A 3A1SA 1BX1A 3TRKA 3U6BA 3HB4X 2WWXA 3E9MA 2AQIA 4RV5A 3U7IA 5FL3A 1IB0A 5AW4A 1WP9A 2O9JA 3TFQA 3TQQA 3OJCA 4XQEA 1JEQA 2BCGY 4J49A 3R3VA 3MIIA 3ETNA 4QKQA 1MH1A 1UJ4A 2O4CA 2JIOA 3TZHA 4LECA 3K0EA 4KC0A 3H5LA 3NTRA 2Q3JA 1JX6A 1QYDA 2YJ5A 1RYEA 4XSGA 2WKPA 3CPSA 1G4AE 1OX4A 2V98A 4LJ5A 1ZJ4A 4WGFA 4YJHA 5CT5A 4GMGA 3UK0A 1PBTA 2QTWB 4IVQA 2Z09A 4V3CA 5AKGA 5HIMA 2NAFA 2WD8A 4URXR 3OLCX 4PPYA 1G9TA 1MX5A 1W6UA 4HQOA 4YRLA 3SS8A 5A4JA 2SKDA 5TC4A 1YACA 4QXAA 4F5ZA 1KE1A 1U3VA 4N18A 1GZ3A 3GP8A 3DR3A 1M2EA 4KQGA 4MJXA 2RI1A 2RAUA 2WFLB 2AYZA 3NHRA 3GBPA 1H0SA 3IQEA 4J2TA 3OZIA 1PZHA 4TPKA 3UK7A 4D3SA 2DBZA 1C8LA 1BE6A 2ZTUA 1ZNYA 4ECEA 1HL7A 4KU4A 4EZIA 2KE5A 2Z2IA 3H6HA 3T5GA 4QLOA 1RXWA 4CKCB 3BBPA 4OQPA 2H18A 3DXFA 4IOKA 3VXKA 4X0EA 1FUUA 3I8SA 1G18A 2VZ8A 2W2OA 4RMGA 5HA5A 4D9KA 5C81A 4Q4LA 4LS3A 1AG9A 1U1GA 1U2GC 1P2FA 3RYHB 1EQAA 3O2SB 4C21A 1SVSA 2C99A 4PICA 3HEBA 3T9FA 3NR2A 5TQ2B 2BAGA 4MKXA 4O2BF 2ZBEA 4DLSA 3GIWA 3PQ5A 1GZ6A 2VT2A 2JJMA 3AUSA 1LC3A 2Q50A 3DVAA 3GHHA 3N2KB 5I5EA 2PMWB 2GM3A 4HB0A 4Z7OB 4PHGA 2ZGVA 3A0UA 3HCAA 2O0LA 3LHKA 4LYDA 4DEVA 3NHKA 4FSXA 1SKMA 4HAVA 2F3SA 2C07A 4MQFB 1OCEA 2FSVA 2K2QB 3T9DA 4BNFA 1DQNA 4Z3OA 1SXJA 4G26A 4RQTA 3DV9A 1PFYA 4PO8A 2R6ZA 1YR2A 1L5LA 5IM4F 1TE2A 3GLIB 1FBTA 2COEA 3H4TA 4EEZA 4L3OA 4G1EB 4I36A 4B83A 4QBKA 1MHPA 4JP5A 3VPFA 4EMSA 2BGNA 2OD7A 5H68A 1OX5A 2XSZD 1PAUA 3LYHA 3PUIA 3RBVA 3IDZA 3NGMA 2QPTA 3HLTA 3UFXB 1XTSA 5HTOA 3RC7A 4MJ3A 4DJ5X 2OHHA 4Q9NA 1FNMA 1P33A 2ZB2A 1MUUA 1KQGA 1C4WA 1VHJA 2JAXA 4XYGA 4YDRA 4B85A 5JXGA 2ZUFA 4I7EA 1RYNA 3N2GB 1Z33A 2OZPA 1EX9A 4MEAA 3FOWA 4U2CA 3RSLA 4M89A 3RIMA 4EDHA 2O2JA 5BXYA 3A14A 1A72A 3B89A 1J56A 2V0CA 3ZWWA 1JG2A 1WB5A 5BSKA 2WFLA 3LIIA 1NVVR 3K4PA 4Q1CA 3ZG6A 3D6JA 4OKSA 4I5FA 3O8RA 1XGKA 1YFKA 3IUPA 4YP0A 4XGIA 1W1UA 5D6NA 4KR9A 4E46A 2XJ9A 5E2IA 2QD4A 4QXMA 7AT1A 1V45E 1N6HA 4K0KB 1QO0A 4FQ8A 2D4AA 1Z26A 1QHSA 1XO1A 3SM3A 2PUVA 1B73A 1PK8A 3GMSA 7ADHA 2EWWA 1GITA 1MH9A 1M83A 1SCNE 2OC4A 1NNLA 3AQIA 2GN2A 3E61A 3SC3A 3STXA 3V1LA 3ZLTA 3FD8A 1A4RA 1G1MA 4CG1A 1L7EA 3SHTA 3KHUA 1AO0A 5G4LA 4GZLA 5CH3A 5CCXA 4NZOA 2IGTA 4LJ4A 3WZMA 3M6XA 3WLQA 2IS2A 3ONWA 3DZCA 5FD8A 2PZEA 1R15A 1W19A 5CR9A 5KSPA 3T4EA 4UXHA 3FPKA 3KDSE 3PCTA 1OFGA 3GT4A 3PA6A 4OOFA 2BE7A 4YRTA 1VMIA 3TXXA 2OE2A 3GH1A 1NUHA 2X15A 2NP7A 5A9RA 8OHMA 2GA8A 4ISBA 5DJ5A 3W7BA 3EOAI 3NHJA 3NBUA 3WXBA 2WWTA 3MWFA 2ZSEA 2DQ4A 1R4MA 4XSVA 4GP7A 4ITUA 5L3QB 2DH5A 1RJFA 4JVLA 5ILGA 3EXG1 3OIDA 1GU0A 1JQEA 3SEFA 1GCGA 1TA0A 3MWGA 1D6SA 4WN9A 1RI1A 1L4YA 1ZX1A 1XTUA 3PF8A 3DBVO 2QJRA 4QU0A 2OTCA 5FQOA 2NXWA 4YUXA 1SKYB 5A4FS 3PNOA 4C7BA 3LUGA 1K4MA 2FPXA 2A1UA 2W6JD 3PFNA 3KPYA 3PC3A 1LRLA 3VMMA 3ZEIA 5GTDA 3QXXA 4KMMA 1DMRA 2C9CA 2CFCA 4N6OA 2XOXA 3W2EA 4IM7A 1CHNA 4E6PA 4OHRA 1G5QA 4L4RA 3TR6A 3U80A 1E9DA 3RUAA 4WJZA 4PAQA 1RWMA 1KAOA 4JP2A 1QKIA 1KVQA 1CUSA 1XVLA 2CXPA 2G9RA 2HK7A 3L8EA 3DCIA 4X5OA 3U3MA 3JQPA 4QT0A 4C76A 1YDHA 2YZKA 2W2TA 4OLHA 4GKBA 2VFAA 4E33A 1IBCA 4Q00A 2JHCA 1OGYA 2BFDA 2FOIA 4E3ZA 5C4IA 5L6MB 2GJ9A 4IJ5A 4TKZA 1YZGA 5ALFA 5K3FA 1TVEA 3X2EA 4MYCA 2BFCB 2PUBA 2Q8QA 3K2QA 4YDHB 4JVMA 1R0XA 4WXMA 4OHZA 3ERCA 1AMUA 5E7IA 2H7VA 3T5TA 4LDNA 3A2LA 4UM9B 3PEWA 4LRYA 3KS9A 4JXKA 5LQSA 3MPOA 2P2YA 3WMEA 4Q9DA 4EZEA 5LQAA 2ZIUB 2Q1YA 4B81A 3M6MD 4D99A 2PWAA 3PRHA 4ZO8A 5HKOA 4QUAA 2XAUA 3E2IA 1XPOA 1QLHA 3PWKA 2Z04A 1EFTA 4MUXA 3UXHA 4DN6A 1AZLA 4WX2B 4MQ6A 2XQKA 1WBJB 4XWAA 4F2PA 3DV0A 4K7JA 1G41A 5I9BA 4E2YA 4EI8A 3NONA 1GL9B 4TM8A 5A2GA 4J1QA 2GRUA 2H9IA 4CVNA 5HBRA 2O1EA 4LJ6A 1MAWA 3AVYA 2GEJA 3D7RA 3NTVA 3RVSA 4ACBA 3G0HA 4HXYA 5GP1A 3GJRA 1ST2A 1RWNA 2EP8A 2NM0A 3D43A 4OXIA 2OV1A 1BC5A 1NT4A 1XFDA 1T9DA 3TYXA 4R8LA 5EJFA 4KNWA 4DCOA 2C5SA 2JCGA 3I9LA 4P4NA 2EL7A 1ENPA 3E53A 3OHSX 5BV7A 4O1IA 1OIXA 2FMHA 3EXIA 3OJLA 3QFCA 2IKSA 3PWZA 4HWPA 3T1VA 4XWOA 1X7YB 4FN5A 3OJOA 4ZGBA 3CLHA 3GB9A 4PC1A 4DRXA 5AJUA 4FZ3A 3G82C 1Z56C 1U2EA 3QPBA 1ZR4A 3HUFA 4LJYA 3FROA 3KHTA 5BSHA 2BSQA 1E7SA 3C5EA 2VTBA 3AWIA 3IIEA 1FJXA 3ZE9A 1ZUIA 4BB6A 4DR4B 4YMUA 4HPXB 1RLOA 4A5SA 2PGIA 3T8YA 4BX8A 1Q92A 5ADWA 5DNUA 1K7CA 3Q3CA 1KSHA 1P1CA 1KQPA 4H7KA 3ND6A 4HBZA 3K0FA 1C9NA 4RETA 4I8XA 3M4XA 4LY3A 3MJRA 4RY8A 4URHA 4D9NA 3TLKA 1YFJA 4RTMA 3T3PB 2PE5A 5LB4A 4K6GA 5HCIA 1SOWA 1MRSA 5FPKA 4NMXB 1DQSA 4A91A 5C7OO 4RZHA 1KI8A 1H2BA 3KV3O 4B84A 1Y5LA 4GI3A 5BYJA 3FSJX 2GHQA 3S2YA 3VR3A 5BSRA 1E89A 2W9XA 5HJ2A 4NCJA 4X8MA 4ZVUA 4DJEC 3PYLA 3LO8A 1VG9B 4CGZA 2PD6A 4JJ4A 4FXOA 5EQJB 2QUIA 3VVLA 1AS2A 1TRKA 2JCVA 2ONJA 3IE2A 5EMHA 2R1ZA 1ESEA 2F67A 4FDMA 4C05A 3B6MA 4M0FA 3ZWBA 1MKYA 1CEYA 3V8PA 1TQ6A 5JJ5A 3KZXA 1VIVA 1TPYA 3JARB 1BOOA 4PN3A 5EJ4A 3PPWA 3I1YA 1SA0A 1QZXA 3RRZA 1M7GA 1S7CA 3H4MA 4DG5A 2BKLA 2RGXA 4PCAA 1XSEA 2Y66A 4JQOA 3GFTA 4MARA 4NH0A 1H8HD 2ZTVA 2C8VA 5JMWA 1QFXA 2FMXA 4MKZA 5K3BA 3OWHA 1KI1A 3SLGA 3KWMA 1NJFA 2Z1DA 3E4CA 3HCWA 5LZ8A 4AJOA 5AXAA 4ZFNA 5KSWB 2NYVA 4NNPA 1W75A 2JJ1D 1I13A 3MC1A 4R2KA 2VP2A 4Y2TA 2X8LA 2QY6A 2FUG6 1KYVA 2YZ2A 4CLDA 1IJKA 5K4GA 3EPKA 1A71A 4BE7B 3NUGA 2FZCA 2OY0A 2C2XA 2QG6A 2REBA 4YHBA 3SSNA 5BNTA 3C45A 4LQLA 2QD1A 4QOEA 3EIUA 4DLUA 5BNFA 4AYTA 4FB5A 2EGGA 4IMPA 3HXTA 4M9SA 1YMQA 3PDCA 2RGAA 1SVKA 1SXIA 4DMRA 2W5UA 1T9AA 7MHTA 3T99A 3HVUA 4HDMB 1BN6A 2MINA 3FMGA 2I4RA 1B41A 5H02A 3UK6A 2WHYA 5JAMA 2QPAA 3QY9A 4LEIA 3CX6A 4I8DA 5TVGA 1BNCA 1U2DC 4E7OA 1HYHA 3EZ6A 1QFJA 4GYYA 3WIVA 3MJFA 1HYEA 1ZNZA 4M0UA 1LBHA 2ZRCA 5D1HA 5HRUA 3BXOA 3IVCA 5CB8A 1F0KA 3I23A 1E1CB 3T7AA 4ARBA 4E2FA 2C88A 1NKVA 4GPIB 1FS5A 5EWJB 2HMVA 4LKOA 1U7HA 3K2IA 4V2IA 4FC7A 2F55A 1C9KA 1G3QA 3UMFA 2P75A 1GCAA 3MSCA 1DAEA 2AN4A 2OXTA 1YRYE 1WPXA 1XCGB 3C7TA 3EIQA 4ARUA 3TVTA 4LVCA 1U0EA 2NU6B 4CR8A 4YALA 2HCJB 2DLDA 2A5FA 3A4MA 3AKEA 2C7GA 4MR7A 4D45A 2VP0A 3AP3A 1DWQA 1QQ5A 1CUGA 4IX1A 4KVGA 4KUEA 1A9PA 4O8ZA 1Y1RA 1JEJA 1NV9A 1WDMA 2WIFA 4UQLA 1ID8A 2QI9C 4OL0A 4EGFA 1KAHA 4UNQA 1ATIA 1SPXA 1NW6A 1ZOSA 4RTNA 1Z0AA 2AWOA 1OR8A 2A88A 2PWZA 4P38A 5HMLA 2COKA 3GGJA 5FX2A 3VNSA 5CLFA 2ZITA 1U04A 1PW7A 4WKPA 4BNWA 1HH4A 4A23A 4BCBA 2ADOA 2II6A 1FDVA 4MCAA 4J6EA 4BQIA 2OBFA 2ZRPA 3O92A 3VI4B 5I4BA 4YFVA 1A9SA 2ADFA 3H2KA 3TZ6A 2KPOA 2ZUDA 1HLPA 4YROA 1ZCFA 2NW6A 3AIMA 3PC4A 3T9CA 3W9UA 3BJEA 4AJPA 4ZEOA 1PGJA 4YMLA 1ZH2A 4PC3A 5KWJA 5FBZA 3Q3VA 4J16C 3HPRA 2Q0SA 4OBWA 2P1ZA 2VF7A 5DYIA 2WWYA 3KTDA 4FONA 1AS3A 4M8LA 4N76A 2DPLA 2XOEA 4GG1A 5FFMA 2OBXA 4DV5B 2Z30A 1A1VA 5CDYA 4FSHA 3GJXC 4XD2A 4NK5A 5LXTF 1XTRA 1NX6A 1JT2A 1B3BA 2XWQA 3CNQS 5AI5A 5T7BA 1AKQA 1B15A 1O8BA 2DLNA 3GJ0A 3OJFA 3R3YA 3PQ8A 4UNSA 5D2CA 1VL5A 3VVMA 2ZBGA 3NQ41 1B74A 3P2IA 3JWEA 2FEPA 1X0XA 4V0OA 4IQ0A 1NFFA 2FZEA 2NP6A 4JR2A 4DIEA 5FLXA 2CDNA 3ND9A 1Y1PA 2SHKA 1KTVA 3A8TA 3T3DA 4OX9B 1GU1A 3ZTTA 2BJHA 2JIPA 4TV9A 1N5DA 3U3OA 3L1HA 4I5IA 1Q7BA 4FDAA 4JS0A 4CI0B 2OAQ1 4NJEB 3MTDA 3N86A 4BUCA 1YCDA 1AH2A 2VT6A 1UBMS 3EJ6A 5AKEA 2BMFA 1BH6A 1RSZA 1TU3A 4MEBA 1KWKA 3EZFA 1DOAA 1WZNA 1AY0A 1ZW6A 1U6JA 4HGQA 1QDUA 3IDOA 1QIMA 1RXEA 1HE4A 2GBPA 3LFTA 1JEDA 2B6NA 2M6LA 4AXXA 1UP4A 1QQ7A 5D84A 3VKHA 2ECFA 3IKVA 3PLNA 3AH8A 4ITVA 1KS2A 3TDMA 3QEKA 1JBEA 1JBQA 3HQ4O 4KLCA 5CEJA 1AQNA 1W59A 1VPDA 3REFA 3A1EA 1AN9A 3P9SA 4BKRA 1M8FA 1VSQA 2BFMA 2Y99A 3R8FA 3WNCA 2F4VB 2IYLD 2ZRJA 4GBMA 1K92A 2OXFA 2W2PA 3CPHA 3D4IA 2AWNA 3VZQA 4YJ2F 1L0BA 5LBIA 3E82A 3OPMA 5ESWA 3V4RA 3MMXA 5T5QA 4RSHA 4OVKA 3B9PA 5CW2A 2BRUA 1OVMA 2DH6A 4EG6A 2E2WA 5CEFA 2KMLA 5E2AA 2JFFA 2MMCA 5L51A 2Z8YM 3DMGA 4X65B 5JS2A 4WMLA 3UAXA 4F6CA 2NSDA 1NP3A 2XB8A 4MUGA 4BU0A 4FXPA 1N6NA 5BQ3A 5CYOA 1RXVA 1I0IA 5A4KA 4FGKA 3A32A 1E2UA 3C5CA 1ESZA 4N6GA 5T6BA 1UM9A 2GEBA 4I81A 3P52A 4C89A 3IHWA 1OZHA 2C2WA 5EHIA 3JQAB 5HRAA 1W48A 2C59A 4ROSA 4WTOA 1LI7A 3NIWA 3MS4A 1NQUA 2ZJ7A 3E15A 4GLLA 2WF8A 2RHBA 4DRXB 1YZVA 4LMBA 5FWXA 4QECA 3R7WB 5EHQA 5MGBA 1NOIA 2AJTA 3DT8A 1OTYA 2FFHA 5LLTA 3DFZA 1KJQA 1VLMA 5EP1A 1U63A 5F4ZA 1HQKA 3K9WA 1PJCA 1E9CA 1DE0A 3IPYA 3WKCA 2F1KA 3EE6A 1E7QA 4AMZA 5B36A 1D2NA 2RG1A 2P6UA 4MS3B 1MABB 2XD9A 5K0TA 2V7UA 3C1AA 3FBTA 3UMGA 1FFDA 2LZ0A 2YWDA 2YVAA 3DDNA 5I51A 1FB5A 3JQ8B 1H93A 1E96A 3AIKA 3DOIA 4RY2A 1J8VA 1G20B 3KUXA 2O8EA 1JW9B 2FRDA 1YS1X 4B46A 2XCOA 4YJGB 1JALA 1IZ8A 2W2KA 2FSHA 1IWOA 3CX4A 4WZAA 5JJKA 1AUVA 1FFSA 1ZCAA 3L0IB 2XCLA 2O3RA 4LOIA 1N8KA 2C2BA 3QJGA 3TINA 3JYLA 5CYGA 5B1IA 3T9BA 2QTZA 4LKRA 1L4KA 1L8OA 5KSOA 3ITDA 5CMLA 4HB4A 5IKPA 3K05A 3NANA 3H5AA 3U3ZA 3L04A 5I9MA 1CP2A 4OK3A 1EBBA 1RRGA 4YGXB 1SH7A 2AR0A 2NV6A 1PWHA 1PJBA 3R3HA 1JHAA 3T1NA 3ZWNA 4B4KA 1WKBA 3EMDA 1XDSA 2RONA 1XRNA 4ON9A 3N58A 5IYZF 5JRDS 1UBJS 4E1VA 2G06A 3TNYA 2X58A 1EFVB 3LCJA 3BF8A 2A7QA 2W0MA 5EIHA 1QGDA 1X2EA 2P6MA 4L95C 4OFZA 2B8NA 2H51A 4QYIA 1KK3A 2XKBA 3Q3HA 1P45A 1TVCA 2P2CA 3O4GA 4KFTA 1M1ZA 4RGBA 5B2EA 4B6GA 2AG0A 3CVYA 5AKJA 4KQJA 3QVMA 3IAFA 3OCVA 1HO3A 3MWDA 4FQ7A 4L9AA 4W82A 1RQ2A 5HE9A 4A8TA 1GL3A 1Z45A 3FWZA 3AW9A 1HK7A 3WKAA 2NTVA 3A7EA 4L07A 1QX4A 3ROKA 2A1TR 1ND6A 5I7RA 4OLJA 4EL0A 1LRJA 5ALIA 3QQ5A 2CSXA 3OTWA 1E3IA 1UBCA 3V1UA 3L1KA 1E64A 3CLTC 4P80A 3SJ7A 1H0RA 3F98A 3SAJA 1IEVA 2V4MA 3PFBA 4LE1A 1NJ6A 1QCDA 5EC8A 4GMXA 4EWLA 4BXOB 4WACA 3T7CA 3U0BA 4PG5A 4PQEA 1TJPB 4QGBA 4X44A 1UC4B 2JEOA 2OO7A 5JAUA 2CV0A 1K5DA 3FKJA 5GONB 4X6LA 4QYIB 1D5CA 1UF9A 1K6EA 3PF9A 4AJHA 4GM1A 2PGLA 1EUZA 4BY9E 5TPWA 3HJFA 2AFIA 3WQSB 2NMVA 4KP7A 4Q7QA 1HYGA 4LCJA 2NU9A 4MW7A 4YT2A 1CZOA 1NQXA 2PG3A 2GEDA 3DKRA 4TQ9A 3RC8A 2OGSA 1EGVB 1VXRA 2IEYA 2Q5OA 1C3EA 2GI4A 1RT9A 3JQ7B 4LSZA 4AICA 1NNEA 1S2OA 2OBBA 3H97A 1ZGCA 1ZJZA 2WAMA 3LUBA 1Y4DE 1P1KA 2AKAB 2HRQA 2ZJZA 5CCBA 1Y98A 4FDTA 4QU8A 3CVXA 2MR6A 3VNAA 4QDJA 1HY3A 2RK3A 4TOIA 4YI5A 3R8XA 1KBQA 5ECDA 5B7PA 5ESDA 2OXCA 3R7SA 5KS2A 2VATA 1Z6ZA 1Z4LA 4CMJA 2B35A 4BFZA 3AJRA 4G5QA 4IILA 3OO1A 1M3SA 1YR9A 5AVZA 1G20A 1NW3A 2WMDA 1Y8CA 3FDZB 3NC1C 1F9AA 4JYBA 1W4CA 1TIPA 5E95A 1Q74A 4FJ2A 1B93A 2WT9A 4P1ZA 3W4JA 2XB2A 3WI7A 4B17A 3ME5A 4C6HA 2QRVB 4KK3A 3UEOA 4KR6A 4AVYA 2AR9A 1TK9A 1X9HA 1MO5A 3I0MA 2XAAA 5TJHA 1ODFA 2G28A 1UC5B 2VHYA 4QG3A 3CZCA 1RPAA 3N8HA 4WERA 3Q9NA 1YUMA 3N28A 3T7DA 1BEEA 3I9V6 5F9HA 3AXSA 3EQ8A 4OV6B 1A98A 1J6UA 4BTEA 4ND2A 2F8SA 2I3GA 2YS6A 4ND6A 3EOBI 4G0UA 4WASA 1FPMA 1LV8A 3Q11A 4QDKA 4Y6LA 3T52A 3I5XA 4BAGA 1AKWA 1JDVA 2XUGA 2AGVA 3P9CA 1Y6RA 1GKIA 5BO5A 3SG0A 3BN3A 1P3JA 3RAPR 2BKEA 1A4XA 3LKDA 1FDWA 3O5AA 4MV7A 3PC8C 3OP1A 1ZGBA 1KOLA 1BMDA 1DBPA 3IAEA 2A9OA 1GZ4A 3GUZA 3AEXA 5KYXA 4XVQA 1ZU4A 4HH0A 1TA4A 4OA5A 4CMHA 3WLOA 5K0JA 5DHQA 1ULHA 2OUIA 4ZT2A 3CNLA 1E2HA 4LBWA 3GAMA 4YWJA 4CUZA 1J24A 2VLBA 1PZXA 1ZLXA 3FVTA 1U8FO 4G0VA 4XCVA 1O6FA 5A04A 1BU5A 1MOZA 3JVUA 4ARAA 5K6AC 1N8TA 1P2DA 5JSYA 1VG8A 2A9JA 4RZ3A 5FBKA 4BNKA 2QSJA 2VTBB 2UVQA 4KQIA 4KWEA 3RABA 3IHTA 4WT7A 2VPQA 1QUEA 5FBQB 3UHAA 4CKXA 5BW6B 2EYQA 2PLNA 3F96A 3H7IA 1G2OA 3L8ZA 2BEUA 4F6RA 1G21E 3QJYA 4RHFA 4AULA 5C7IO 3M49A 3SC6A 4HPWA 2H59A 3EIOA 3ESQA 3QUBA 4YUYA 5KOYA 2D13A 3NYQA 3P0HA 1H23A 3DKKA 3F7OA 3K94A 4HADA 5FOVA 2WJVA 3N3AC 4S0ZA 3RYIB 4IVPA 4EAQA 2CMDA 2OM2A 3OZ7A 1DV1A 1JDNA 1OILA 2GTPA 3DDWA 4L7VA 4UM7A 4UUBA 5JANA 3OKAA 4YP7A 2R1VA 3CRMA 5C53B 3WMWA 2XD4A 4BO9A 1N0HA 4D1YA 3MGCA 2AIRA 4LSWA 2J0UB 4ZDWA 1C7JA 1THZA 2FUCA 3KD2A 4GDMA 1RAHA 2D59A 4LQCA 1AHHA 3D8BA 3QFHA 3KELA 2HWYA 3K9BA 4KRXA 5EEHA 3TL6A 5KOHB 3JRWA 4J7AA 2H4ZA 1WZEA 1O08A 3DPSA 2GN9A 3LZCA 4OAOA 1EP9A 1W8IA 1GPDG 1U9YA 2JPDA 3HV2A 4LDRA 1IY1A 5IUNC 1MVNA 2Z83A 3NAMA 4TTAA 5JBQA 5A0TA 5CVVA 2W2LD 3EEYA 1NVUQ 1CJVC 1RFLA 3GO4A 2AC2A 2A0UA 3F8TA 3BTSA 3M1IA 2JFVA 3OVMA 1A97A 2LNDA 3PUYA 4E14A 2C7PA 3JAWB 2V45A 1DKUA 3TG8A 3AEUB 3KCNA 3NPMA 2GEVA 3CXUA 3OT4A 1KYWA 3OKFA 3BMOA 3C7AA 1SHZA 5DXAA 4DBVO 4WEQA 1BVUA 4LK2A 1QYCA 3CZ5A 2NZYA 4K46A 4IHJB 4EFNA 1GGFA 1ZR2A 3OCCA 2GSWA 3NCTA 1NJ1A 1RXYA 3H8WA 1XZIA 4XM1A 4I55B 4DEXA 4FS3A 4KPFC 3ZTWA 1QTNA 4EG0A 5TS2A 1E2GA 1U8CB 2IZ6A 2CK3A 3EEIA 4X84A 1ZNQO 4Y2YA 5GY7A 1RPJA 2WJ3A 3I76A 3KEOA 1AM4D 2BEUB 5PGMA 5IN5A 2YWJA 4O2BB 3OCXA 1IB6A 1PK7A 2PRIA 5LQKA 1WBDA 4ZT4A 1R0WA 2WUEA 3LWNA 2Y0PA 1MVOA 4N49A 1VGVA 1V48A 4HT3B 3B52X 2HB6A 3NNSA 4HN2A 4ZAWA 5I9TA 1RC0A 3FPSA 1WF6A 2QVLA 3BXPA 2FPKA 1S1CA 3K6RA 1TADA 2B4QA 3VHLB 4HX9A 2P91A 4UTNA 3OPXA 1MORA 2QT0A 1WUTA 3SYMA 2C84A 5C37A 1OX4B 4GICA 5A6SA 1S6YA 5L6LB 4X1KA 1N2CB 5B7NA 4J0FA 1JE1A 4DUYB 2EX1A 1L2TA 4PX2A 4XLLA 3ETDA 2GO1A 4DAEA 5J4LA 5A7FA 2EZ4A 1P61B 1S8NA 5JWHA 3I6YA 4YP5A 2CUTA 1EXWA 3CLSD 1RS0A 1RM0A 2CL7X 1TKCA 4RS4A 5BY2A 1EK0A 2R8BA 3K7EA 1FX0B 3L6UA 2BISA 1DFHA 1DO8A 1XL0A 2VK1A 2KLHA 1BMTA 1P9OA 2P2DA 2Q99A 4ENVA 1AUQA 1NIPA 1TYZA 2A0XA 1PDWA 2DWCA 2IU4A 2GK4A 2JHFA 1GV0A 2PZLA 3KU1A 1NBIA 3DJFA 5F7JA 3G2HA 1Z2DA 3ANYB 3BTUA 4C0KA 3DTVA 1JEYA 3WQHA 4KGVA 2WWGA 4AURA 2FUKA 3BS4A 3ZWOA 2IYPA 1NR7A 2X2FA 1U0TA 3F8SA 4UMFA 3WSVA 3ZU2A 1GRRA 1CUBA 1FTSA 2YUTA 3A4VA 1MCZA 5KNDH 1QOZA 1BKSB 1TO1E 2OYRA 2EHJA 2VZEA 4X3CA 2FDRA 1N2CA 1VJTA 2V7EA 1OV6A 3PXUA 3ZIDA 4FGZA 3Q41A 4H16A 2XVZA 5LB2A 4ARCA 1QF6A 2FYTA 1CNMA 1L5HB 5DNYB 4OQDA 3ZI4A 5JAPA 4B48A 4Z51A 3DR5A 4CUJA 4AJEA 1IXSB 4MGHA 3H5NA 1LPOA 2UZAA 3L4SO 3L8YA 4ZRMA 4L9SA 5J63A 7GPBA 1SCQA 1HDEA 3NDBB 1F14A 1REQB 3DZIA 4N7JA 2QXUA 2H4XA 2XQIA 2Q2WA 4ZD6A 5IHPA 4NI5A 1D8AA 1ZICA 2PV7A 1E4YA 4INJA 4R9VA 4ZXPA 4ISCA 4LPKA 2ZUTA 5E9AA 4DT1A 4E5DA 1B6SA 4XX0B 4R6WA 3E8SA 4OI2A 3C6MA 1P60A 5IYZB 4ID9A 4WW0A 3EUAA 3QPWA 3VU9B 4DGQA 3O8BA 3EIWA 2E4ZA 1FTYA 4KHPB 5JBIA 2CLFB 3NTUA 2F3UA 4OYYA 4ZCPA 5TPWB 2ONKA 3VH4A 4C7MA 3MQ4A 2RAFA 3FDJA 1X74A 4RTKA 4I2NA 1PWXA 1V6AA 2YCBA 1NLFA 2B78A 1X39A 4PG7A 3SZLA 2V5VA 4AUEA 4PHFA 5AT1A 3I2KA 3OBIA 3BFJA 4M86A 4G1MB 1GYPA 2YC2C 4OCZA 4ZYWA 3P27A 1J0XO 1QVZA 4ENSA 1P0PA 5B30A 4BLPA 2FTKE 2Z0MA 3LZDA 4X91A 4BE9A 2JLSA 1W8DA 3FYUC 5MF6A 3BFVA 5K03A 2GZMA 1V71A 5K2OA 1FNSA 3E7WA 1UK7A 2JB9A 3QWFA 4JT9A 3X1JA 4BQRA 4YX9A 1NQ5A 2VAPA 3TAHA 3TOSA 2PGNA 2WAYA 3QE4A 4NRDA 4BNJA 3WGGA 1N6OA 4FU0A 4RDIA 4U3JB 4MWSA 3V9PA 3W05A 3ZDEA 2ZWAA 1X7WB 5BNWA 3A1FA 1Y7HA 5UKDA 3JAMA 4ENPA 1RD4A 2XT0A 2HH9A 4KYVA 4AQ7A 1PYDA 5FEUA 3BGOS 4WJKB 1BXRB 4G5OA 4CG0A 2B61A 3GFGA 3V8NA 4P0QB 1Z15A 2NTEA 3IV7A 2PLAA 5IFLA 4GOXA 4CMBA 2IZ1A 5BMOA 3L46A 1OXVA 4U2KA 1RI4A 1J06A 2PGJA 4JLVA 2Q7OE 3OAAA 5KYWB 3DMNA 1P4SA 3GJSA 4JC0A 4G1CA 4W1SA 2ZUBA 4NFHA 1ADJA 1FRZA 3RG8A 4AT1A 2Q2VA 4NAUA 1QTQA 1XRMA 3NWJA 3EPPA 2ISCA 5KZMB 4Q1AA 4CM7A 3DDSA 2NYUA 1M73E 3EFHA 3WL6A 1M1XB 1XU4A 2IIQA 2BM1A 2O57A 5FWYB 3TZLA 1CUZA 4Q16A 1I5EA 4CFZA 4P6VF 4RL6A 3BA1A 2V59A 4J0GA 2O54A 4GT1A 4DYHA 1PNVA 2DHEA 3JZAA 1ZK0A 1DL5A 1FFGA 3HDHA 1EUDB 4MO2A 2Q3DA 4XB2A 3IOCA 2WIJA 2R6AA 1LPSA 3EZGA 1YL5A 4D8YA 2XRMA 2AEJA 2QMZA 2VL7A 1ZIPA 5FIUA 1GZ7A 3NHZA 5THQA 1IOVA 2P2GA 5FP0A 4BYMA 4RM2A 4OI1A 4C0AC 1LF5A 2VYND 3DV0B 3HEMA 4Q1EA 2C4WA 2ZSBA 1MZVA 1ZGJA 2REQB 1NQAO 2AOTB 2AB0A 2XXBA 5JD4A 1MC1A 1Z5WA 2O19A 3UYLA 1UFVA 4O6VA 3QWBA 3NTLA 2OCYC 3FWNA 4D8TA 3OA2A 1KAEA 1VBFA 3MBIA 4YQZA 3SDBA 1QK4A 3N2LA 2WV9A 1GGVA 2V0NA 4Z4HA 3LPLA 3EW7A 5B55A 3JQRA 3N2IA 5DRTA 3RKRA 1SFRA 3RRBA 3W3AD 4DC0A 5JAHA 2A0KA 3FZGA 3UYKA 4KQ9A 3FZYA 4FEGA 4U7JA 5DW3A 5KTKA 2YZNA 1DC8A 2X2OA 5ELMA 3V2GA 4BDTA 4ILEA 1I10A 3VSEA 1VHLA 2ENUA 2BKAA 3EF0A 2R62A 2YHIB 4CG2A 1UDRA 2OV2A 3DZGA 1AGNA 4GUAA 1K2VN 3HCOA 3K0CC 1ORTA 1X1AA 1AGYA 2VJLA 4GKVA 4D9GA 2ZWMA 3E3MA 3R9IA 5JS7A 2P30A 2QWXA 5K20A 3I32A 5E6SB 4NFSA 2PT7A 2ZTHA 1IEQA 3FB1A 2OCAA 1TI7A 4A6XA 4RM3A 3PJDA 4CTKA 1M6HA 1G291 3C1UA 2YX1A 4ER7A 2VDUE 3NT2A 5HUJA 1SOAA 4RIGA 3V3TA 3VV3A 3PQEA 2RCYA 4BB0A 2PCLA 4A27A 3GUCA 2AVNA 3QW2A 3QLVA 1WQ1R 3A6KA 3ASYA 3I12A 3JWPA 2AQ8A 5GZ6A 4GGMX 1SC1A 4EYEA 2HA0A 1OYOA 4GOLD 4GR5A 1LJLA 4RYDA 1LEHA 1EX1A 1R5NA 5AKKA 5FOWA 4CEJB 3H42B 4PZDA 4BP8A 4I14A 1DLIA 5DTJA 2QRVA 4M1WA 3SDZA 1E7WA 2GEFA 4NE7A 3B6KA 4CLRA 4DWOA 10MHA 4F3TA 1S2MA 1RLUA 4HNAB 5EINA 2WNSA 3U56A 1RBMA 2MYUA 4CM5A 1QH8B 4O4IA 4L5JA 3CFYA 4XOIA 1Z2CA 4RKYA 3T4UA 1UODA 2IXTA 5BOVA 2PMKA 3K6SB 1XNRB 4X6XA 2YV1A 5D85A 3WHKA 5IT0A 5FEMA 2GN6A 4URYR 1O95C 3MHPA 3AR4A 3N2NA 2WV7A 2M1ZA 4WPGA 3ONEA 2GN8A 4YV1A 2AG8A 5SICE 1OF1A 1Y1KE 1ISHA 2WJ6A 3LAWA 3OEHD 2L2QA 3M4NA 4QEDA 3GBSA 1X77A 3VU0A 1RKUA 1G7TA 3IAS6 2JIRA 2Q21A 3MGAA 4O4LA 2XLBA 1PIWA 2AZMA 1QWOA 3KYDA 4BNIA 5FUBA 3ZWKA 5AHOA 1BQ3A 1KIMA 1HDCA 1MXHA 4Y2UA 2D2EA 4GH5A 4XGQA 2YIMA 5FFNA 3TCXB 3ZGXA 1M0EA 1PT7A 1LLCA 4N12A 2VHEA 7REQA 1K3UB 4AXBA 1JMKC 3VR3D 3QPVA 2PY6A 2X14A 1PGNA 4PLWA 2ZT5A 2XEDA 4FC6A 4X85A 3CX8A 3SY8A 5FPHA 3FUXA 5FWNA 4M54A 1LX6A 1PR3A 2JAUA 3FNQA 3I6MA 4E15A 5ALOA 1D9XA 2H2DA 2WU8A 3FOZA 1VOTA 4QUHA 3JALA 3WMXA 2WVJA 3JW8A 2EWMA 1ZI6A 1VHTA 2LD4A 4EDFA 1YKGA 4Q24A 3QMMA 3TLEA 5I7WA 1T26A 3MIZA 4E31A 1H1TA 1FTNA 3GZNA 3OESA 5D6OA 1JMYA 3O4HA 3OAAD 3MELA 3NNDA 5E4JA 4B6QA 2O8BB 4XYEA 4RJJA 1EG2A 1PO7A 3GLQA 3N0TA 5KOJB 2IYYA 1OVGA 3AT1A 3OZUA 2B2CA 1ND5A 3QVWA 5MGNA 3FHTA 1Z0ZA 4ENWA 3NBQA 1F1JA 2WFMA 3IQDB 2WYUA 3EGWA 4WZBE 5IC5A 4B3IA 1Z36A 1NLYA 3IVMA 4PS1A 3ZVLA 2O06A 4W5RA 4PFJA 4A0SA 1RWOA 2J1LA 2QRMA 4LMRA 2E1RA 4NBLA 1XZQA 3E3OA 3LSYA 2FQWA 3QF4A 4PIPA 3GCDA 4YJ3A 4C3OB 4TZ0A 5IWAB 1MOSA 3IAAA 5EJEA 5A9SB 1TM1E 2VJKA 2HN9A 3R2JA 1PVOA 4KE9A 5IMSA 5EE3A 2E3JA 4B71A 2YICA 1IHXA 3KSZO 2Y1FA 2PMEA 1WABA 3EQ7A 3DLHA 3I8XA 4IIGA 1J42A 5JVDF 2WAAA 1W2HA 2Q1TA 2JLWA 1H1LB 4ZTZB 4REQB 5JTTA 4H35A 4KH1A 3OCUA 2Z4TA 1N3BA 2J6IA 3NXSA 3OLYA 2L17A 5AIBA 1PT5A 4OXYA 1MF7A 2Z2JA 2G1JA 5BT9A 2VH5R 3GGPA 2AC4A 3K9QO 5KX5B 1E9EA 2XXAA 3MERA 2JBAA 2Z6VA 4PWZA 4YONB 1IUNA 3KSAC 5F52A 5AW2A 4ALJA 2VJYA 1Q7GA 2ZJFA 3WADA 2IL1A 1B2LA 5J4HA 2V97A 2V6MA 3IOBA 2CXRA 3P9PA 3ZHZA 1CY6A 1FU4A 1X1CA 1B42A 2X4LA 2X9QA 3QI7A 4TTIA 2BFEB 2NUPA 4QPJC 4R8KA 3UUWA 4NJMB 2ZJOA 1BCSA 2BJVA 1F6DA 1GA4A 4YV7A 5LOVF 4UTPA 4QEKA 2OO3A 4MI9A 2X22A 3GPIA 2IU0A 2OM6A 3R76A 4OUDA 1N2EA 2IYSA 4TMXA 4DC9A 1DRVA 1LY1A 3K3PA 4I3GA 3KAKA 2GEKA 2YNMD 3C41J 3CUYA 3OE5A 1TDJA 2OYCA 3THWB 1WNTA 3VZBA 3B1ZA 5IAGA 1JQ3A 4DB4A 1DQZA 1NWCA 3IAS1 1JR6A 1J49A 1RYMA 1DTEA 1PS8A 3M6AA 4DQXA 2XXAB 4ND3A 3OE7D 4ZVTA 4E4TA 3FJYA 3ASVA 1D6MA 4HGPA 4CTNA 1PNQA 3E5HA 3N2GA 4XDHA 1J0CA 2FEKA 4ZI7F 3LW7A 5BOSB 1L6RA 1YJBA 1QC5B 4BNTA 3WB0A 4D0SA 4U7DA 2YBDA 4WBSA 3HA3A 4PW0A 3N8IA 3BXFA 2FB9A 1VSVA 4L4ZA 1U7PA 3KKQA 1WLSA 1KEKA 3VPGA 3OX1A 9LDTA 3BPSA 4B82A 5CT4A 5ECWA 4I4NA 5JDIC 3TIVA 1LGYA 2RHRA 3IDSA 3PCRB 1DKPA 1NW8A 1SCUA 2DM6A 4BLTA 5SZJA 1EE1A 3GDHA 2GXSA 3V4LA 3TW6A 3ZHQA 2Y1EA 2A5LA 1YB1A 1MVLA 1RC1A 4BX0A 1KXJA 2ORIA 2AG6A 4DLAA 2IPOA 3ZDCA 5D01A 4AZSA 1GUZA 3O2NA 5TT0A 1K7XB 4DM4A 2X9NA 2QTTA 4MWEA 4DIMA 4E88A 4PYJA 1SQFA 1TECE 1SO8A 1H69A 3IKMB 3MCUA 3MWLA 4KFSA 4KQ6A 5T64A 4HRYA 3VSDA 4MTCA 4A8PA 1YV9A 1E3LA 3LPDA 2IHNA 1SXHA 1V9CA 2WICA 2GAOA 3N07A 1DP4A 5A1JA 4P83A 3N6VA 4RD3A 5E1BA 5CTAA 4MLZA 2BRUC 5MFPA 4YP1A 1J1IA 1X7XA 4JL6A 1QZ3A 3IIJA 5C1OA 5C4GB 2I8AA 4WFKA 2G67A 1VI2A 4PLPA 4RPGA 1T13A 4B3BA 4Z5XA 3O1LA 1EJ0A 2QROA 2WTXA 4INOA 4MK4A 4RWZA 5JAIA 3IMEA 2JFOA 3WDMA 3IVXA 3WGMA 5IS2A 3ST7A 1P80A 4D44A 3UOGA 1F38A 2FDXA 4KWTA 1CS0B 3I42A 4H59A 4E5NA 2DPHA 4EHJA 4JJ8A 2BMDA 1MQAA 2AZXA 5BSGA 2IWHA 2RG7A 2X8AA 4KSYA 4MW4A 3RROA 4ZGGA 5IUJC 2BHTA 3TCKA 3AJ9A 1VA5A 1LBQA 4P8RA 4X1KB 4CDNA 1DJOA 2R97A 1H85A 2HUPA 3FYTA 1KMIY 1MHTA 1H3FA 2ZSUA 2AJ8A 3SHQA 4EFKA 3UMMA 3LWZA 5JPCA 1LLQA 1P0MA 4M6WB 2ZFUA 2I6SA 4MCHA 1TJNA 1KEZA 4G67A 5FJJA 3DVRX 4LOLA 3GJ8A 3H16A 1Y7LA 2J9ZB 1Z6YA 2VDOB 3FFBA 3IAM6 4RD0A 3TFWA 3ZLUA 1Y8ZA 3EB9A 2QX8A 2ZYIA 2RARA 1I33A 2Y3IA 1RE0A 1SCUB 5K4AA 4LX8A 4LV6A 1A5ZA 5CBPA 5TEVA 1EXMA 3S2SA 4TMWA 3GT3A 3I9NA 1DDGA 2EX4A 3KXKA 1L7DA 1CZRA 1EGHA 2X8BA 3DSRA 4RAQA 4UAGA 4A0GA 4EI9A 4YUAA 2RKBA 2QM3A 4NXMB 1OXKB 3HFSA 1VBMA 1R6XA 4PONA 3ENNA 4EHIA 5CNIA 2NGRA 2JH9A 3L82B 4Q34A 1CB7A 1L5GB 1NC1A 4RZSA 3T7JA 4UUPA 1FXWA 1L5OA 1U8XX 1X15A 1DWPA 3PZBA 1FMFA 2FR8C 1D2HA 3B2NA 5TGTA 2LVBA 4N39A 1Z47A 2YMLA 5ALEA 5BN4B 5L3ZA 4E1AA 2PJDA 1KZ9A 4IWYA 1FJHA 2Y1WA 7MDHA 2DCUA 3AHJA 3FPCA 3V8VA 3CZ9A 2C95A 3T7TA 2XPCA 3HBLA 3D4BA 5CP8A 5IM5A 3X43A 4AAYA 1DAFA 1UPFA 2AMYA 4ZDKA 2JJ2A 2VHTA 4A6DA 5JYBA 1SBIA 1CV2A 4G5YA 5AM0A 1DEOA 2IDJA 4O2RA 5CHYA 3TZEA 2W0SA 3Q5GA 3T7IA 4O1HA 1AK1A 3HABA 1BS1A 2WPDA 4RGVA 5AVSA 3R3JA 1MABA 5TF0A 3OSUA 2H57A 5FHQA 3SBOA 1KU6A 3H2HA 3ZWYA 1LLFA 3VISA 1QVVA 1MG5A 4KPGA 2WJYA 3WIOA 1LW7A 2F3PA 1IUKA 3CLSC 3V8QA 4AN4A 3IP6A 3DA8A 3A04A 2VJDA 4G0WA 4DWWA 3A4TA 3Q7IA 3AFMA 4TKVA 4Q15A 1GKUB 4UD6A 1F8UA 3RBXA 1C1DB 3AL3A 3PGJA 2LCIA 4D80A 2IPMA 1G2IA 3DHYA 3PWSA 2RKWA 4HN4B 4M0MA 1ABFA 2IXDA 3EODA 3UHPA 3L8MA 3N53A 4F3NA 3M3DA 2V9CA 5DWQA 3GPCA 4JNCA 1CJBA 3D6VA 2LV8A 3ED5A 1ADCA 4RD6A 5EUCA 5TPZA 5DHAA 2BTEA 2IZ0A 2OXIA 3TOZA 1R6UA 3AB7A 1ONBA 3EVGA 1SU6A 1XUOA 4F2DA 5KVAA 5K6AA 1EVLA 3MUFA 1LWNA 3KB2A 3TOCA 5CA0F 2OCBA 3UGJA 5K99A 4BV3A 4N65A 3AEQA 4KG7A 5JS8A 5FWDA 1XMQB 4MUJA 2GBLA 1W94A 1QRRA 3DONA 4RZIA 2C5BA 2DHQA 4Y6OA 4FFBA 3TNLA 1BMFD 2GCEA 1TEVA 4TYPA 4PNEA 5DBFA 5HM8A 2PTGA 4MV6A 3UC5A 1JPUA 3QUQA 4DAOA 1N5JA 2AJDA 1UOQA 3KJNA 3N59A 3O8DA 4HVAA 2YYAA 1FX1A 2R4TA 1IWBB 3W2HA 2GILA 2XUIA 4DANA 1PZEA 2PRZA 1FRNA 1Y7IA 1E32A 2C3UA 2HFJA 3OEHA 1A7UA 5DCUA 5ALSA 5H70A 3SX2A 3ETCA 1MG0A 2I6XA 3KYBA 1NW4A 4LJ8A 4GPAA 4MZDA 5DISB 3HVKA 1KGDA 1K6MA 1GNQA 3PL5A 3ODPA 3K9LA 1B3RA 1U3CA 5HF5A 1RLIA 4NCKA 3STYA 1KVRA 1N6PA 1NZFA 1P1FA 3D6TB 4H6XA 3MA0A 1FDOA 3C5HA 3QLJA 3DCNA 2BT4A 3RUHA 3R0ZA 4P86A 5EZ5A 3ZXIA 1IL0A 5E4TA 4KRGA 4AZTA 3A05A 4N3CA 3CG0A 3MK31 3THSA 3ZJ4A 1KFJB 3NC4A 2BFAA 4AJ1A 1ISIA 4G1VA 4J90A 5LKRA 1YS4A 3SR3A 1V37A 4EHLA 4E12A 4QYXA 2GFHA 4KXYA 3VPSA 3RSSA 5A6SB 4QOJA 4ZEXA 1AOXA 2VUIB 3W7VA 5JWOA 3TW8B 3HXQA 1VJGA 1EFRD 1PZNA 2EKBA 1XDWA 1XCLA 1UXJA 2JGFA 2P9QA 3D3EA 5GJCA 4HQNA 4LXYA 4B3CA 4Z8YA 4CL2A 1U2RA 2Q5JA 1ZPDA 3UJCA 4HTFA 1E9FA 2I2CA 2BP7A 1E7RA 5AMXA 3K6SA 2BFPA 1G8JA 2P3OA 3SJAA 2Z4SA 1XYYA 1DIAA 2V65A 1KARA 3KT6A 3R7BA 3ITKA 1Z7GA 1AC5A 1YQGA 3PD1A 5EIFA 2X8JA 5IVIA 2BEWB 4MQ4A 4UBIA 2UUOA 3UGTA 3RYTC 3GD5A 4PS0A 4Q1FA 2HJHA 1IEWA 1KIAA 1KR2A 1Q0PA 2VNAA 2ZJ4A 2ZSKA 3C3MA 3DFFA 3GF4A 4NF2A 3EGDB 3B38A 4YAOA 1Y4ZA 4PQRA 3FCXA 4J0JA 2PKQO 2O8FA 4I50B 2B5VA 1L1RA 3OMLA 1G20E 3AUAA 3A4NA 4C5AA 3AEZA 3I72A 4UE6A 3JD1A 1Q0TA 2V03A 3GEIA 3AWDA 1G3IA 1QHIA 1SBZA 2WSLA 3JX9A 4V39A 1V16B 2UV8A 3G7UA 5H3LA 2D54A 1O5OA 1WB6A 1WQ3A 4E5VA 5IK2A 1FVHA 4EW1A 5CLHA 1N75A 2BGLA 2G5PA 1R4NA 2NTNA 3AQ4A 1BD4A 1I7DA 4JHXA 4YAJA 4KI0A 3GT0A 1LNQA 1OI3A 3NHMA 3PHCA 2YQ4A 4DJAA 1LNSA 4ER5A 1S4QA 2FWRA 1W9MA 2ACWA 2YVKA 2HQSA 3HR7A 4IHKA 1LCIA 4LJRA 5BN3B 1RYZA 2BH9A 1QZZA 3TSAA 4PPNA 3V33A 5KNDA 3Q88A 2BBOA 4QDTA 1I2MA 3DE2X 1BD3A 1PRYA 2BR3A 5AH0A 2WAXA 4YAWA 4A03A 4BFSA 3EMVA 4BB9A 3BCRA 1VSTA 4FE3A 4YMHA 2IHUA 2KWIA 1LQUA 2RB5A 3PFWO 3W34A 3SQMA 1WXHA 3IL2A 3FNRA 1HT1E 4B7CA 1AQJA 5KNCD 4IDCA 1OOEA 5JO0A 3ANNA 2BFNA 2RHWA 1XZPA 2W2NA 3NVAA 4X1IB 4CLRB 4E09A 3U7EB 2HBQA 4Q47A 3V00A 3ZY5A 2PVSA 3PPVA 1USUA 5IZCA 5K8JB 1DCKA 1MO6A 4RQUA 5FBHA 1NF8A 5LMUB 3JATB 4IHJF 3WIBA 3U5TA 2J32A 1GZHB 2W22A 3NBFA 3UJPA 2FPUA 3BX1A 1QLWA 4RQAA 3V7WA 5FYQA 4J43A 2IDMA 8ADHA 3O6VA 1YS7A 4C20A 1F2UA 1W85B 1ZISA 2XCUA 3P9QA 2ZK7A 2QYOA 3OFKA 5EHXA 2D00A 2YMMA 2A57A 2PSDA 5KVVA 1P91A 3KVRA 1KRWA 4X66B 3FDZA 1BHQ1 1WG8A 2XYRA 1A76A 1BS9A 2ZBVA 3AHIA 3CNEA 3QVGB 4DPMA 3QBTA 4NAHA 1ZM2A 2PZBA 5HTKA 1DUSA 2EAUA 3LLCA 2N1BA 1LB1B 5TX7A 1GSOA 2VSXA 3RJMA 1BTOA 1DLJA 1N8SA 1J8QA 1GFZA 3D1LA 3ET5A 2JK0A 3HRHA 2J9YB 3PZRA 4UEWA 4FNOA 3PNKA 2NVUB 4OYLA 3PL1A 3SMVA 1DTWB 2VUTA 4IY1A 3QF7A 2C82A 1MQ9A 2CLKB 4OHPA 4NATA 2BEKA 4ND8B 4BNGA 4F9EA 5B5SA 1SCBA 2CJXA 3FMIA 3L43A 3G0IA 3FNBA 4PYMA 4URFA 2O4UX 3G5AA 1UMBA 1ZWLA 1Q5PA 3PHHA 4YYZA 2WR8A 3A4LA 1X7DA 3Q7PA 4MB0A 3UBMA 1CQZA 4GD3Q 3OFNA 1A5AB 3TMAA 1KO7A 2H7CA 2HNBA 5C5CA 3H5WA 3E2PA 1A77A 3NJ4A 3QVJA 4KIGA 5IEJA 4COOA 2HJSA 4FFSA 1ISFA 2UUBB 2AS0A 4A0FA 5BR4A 4IV8A 4DR3B 1E3EA 4GNRA 2AXNA 1SCAA 3N0WA 5D5QA 1IE3A 4LHYA 4EJ0A 4O4HA 1V5WA 5B3KA 1QQAA 1WMBA 2WF6A 3LO5A 5LLSA 2FGJA 2XNHA 4FNMA 3EC2A 3D8NA 2WUGA 4UTVA 1C7IA 3EGEA 1OI7A 2BR4A 1LBIA 3G1WA 5JAQA 4JI3B 2VSOA 3PVCA 2ETXA 2XVXA 4TRJA 1E1QA 5M29A 1Y34E 3TD9A 1JZTA 1OWNA 1PT9A 3ELUA 4LYGA 3RUPA 2R751 2P90A 3N75A 2BGIA 4FOPA 1V5FA 4A7PA 1JHYA 3GNSA 4BGUA 3HYLA 3PNVA 1QGAA 1YUBA 2H4WA 3Q3IA 5DX1A 4B31A 3AILA 3BUSA 1ZUD1 3LSTA 4DDKA 2VHXA 2ID8A 1NVBA 4KQFA 4WGGA 3RLFA 2HC9A 1MJFA 2DHDA 3RIHA 4UU8A 1I80A 1RXCA 2C4TA 3CCBA 5FTLA 3ETLA 3D8RA 3FRJA 1JLLB 3HP7A 2LKCA 4LOKA 5J5VA 1V1RA 1D0VA 5DTRA 4HXFB 1CUVA 1FFAA 1R18A 2GYUA 2OFPA 2G70A 4CIBA 5EWLB 2V3VA 1C0KA 2QPOA 1WF3A 1SZJG 2FPWA 3PQ2A 3OIVA 2H3EA 2VRCA 5EVCA 3FKSA 1IMOA 1W4AA 5BN4A 1WHTA 1TO6A 3GCXA 3OEED 3TW4A 3ZIAD 4OJMX 5JOQA 4JI2B 2AOWA 4QGGA 3SQNA 3AVTA 1QC5A 4BQOA 1O89A 4C5CA 1GKLA 4Y9SA 2FLVA 4WCFA 3TIGA 1I30A 5LQUA 1DOZA 2J87A 3M6WA 2GAIA 4J7XA 1NATA 3AYXB 4FP9A 2GXAA 3X44A 3BSYA 3W2TA 2JJ8A 3LUCA 4OATA 2E5LB 1GPBA 1EVYA 3CIFA 3H2SA 1JAZA 4LRWA 3X1DA 1YNOA 2JFXA 1T3SA 5AOAA 1EHYA 1ZINA 3VGJA 1T3ZA 1JLLA 2NZ8A 2TYSB 3I6IA 3IQZA 4TSKA 5EHNA 1DEKA 5AM5A 3L9XA 3THWA 2Q4TA 3GP3A 5JJCA 1EP1B 3CEMA 4C87A 1C2YA 1T4BA 1UJCA 4TWZA 5D8DA 5HG0A 1XLWA 1YO6A 2JVJA 2V6BA 4EX6A 4AO6A 2HTFA 3EZNA 4WFQA 2ZXEA 1NDUA 4D0GA 4E30A 4K05A 5A62A 4D3FA 3H2JA 1F0PA 2VCEA 4NWIA 3EXEA 4U7GA 4AKTA 4UU7A 1UJ5A 4J2OA 4DTIA 1XP5A 3B13B 2ZUWA 5TT1A 3RSGA 3UKDA 4LC0A 4AWAA 3MOGA 2YV3A 3USZA 1CEXA 2YWHA 3DZBA 3F97A 3IEIA 1IY0A 5AR1A 1QH8A 5KNBD 4B3HA 1WX1A 3VYUB 3ZXYA 4BO1A 2VXCA 4CM1A 3GUVA 4F2WA 3AUKA 1D4ZA 4LZWA 4FFMA 1QE5A 3VKGA 5BUSA 1SG0A 1XMIA 5AK6A 1OZFA 2C03A 2ZJAA 6YASA 2E4YA 2PT5A 4M21A 3U09A 3Q8MA 4CTMA 1IVSA 1TGVA 2WSBA 2P4UA 3T7RA 2IS1A 2PRKA 3SPXA 1RNLA 4EF5A 4H0FA 5AK0A 3L4BA 4UHFA 1C4KA 4R3UC 4R41A 2G6BA 4ZJPA 2PA0A 4WSOA 1SU8A 1MMFB 2FMUA 3MQFA 4RJKA 2R1TA 2IHBA 4TXNA 4Q9LA 4B73A 1EAYA 1MJ5A 1NNSA 2O50A 4ZJZA 5THXA 4BBJA 3L3BA 3BICA 3ZY4A 4F8EA 2JA1A 2UYYA 3I01A 3B60A 2P1DA 2BYTA 3KOUA 4JUAA 2QTMA 5CNMA 4R0MA 3MWEB 3U7JA 5JSFA 3T5PA 1JSLA 3BQNB 4LV5B 4BQEA 2GF9A 1RAEA 4LYYA 1TYBE 1E2PA 1AQUA 2OLEA 1KGSA 1G9SA 2JHPA 4HNSA 4PO1A 3S5UA 5C46F 1LVUA 3SZGA 3CVWA 3BB3A 3UQZA 3CISA 1NBMA 2V7PA 1XTQA 2CZGA 5LDDC 2QAGC 4BECA 4FCWA 3HB9A 4FGUA 1K97A 3QOFA 5K0BA 1JR3E 1QPGA 2YW2A 3NVDA 4WZBB 4KX5A 3QNUA 3D0KA 1J2EA 3LLVA 1RQPA 4B7XA 3FY4A 5ALKA 2EJVA 4EABA 5TY0A 1YL6A 4HR7A 4EVIA 2WHPB 1RMTA 4OHVA 1XQVA 3L0DA 1IN4A 4G09A 4L27A 3NKFA 1ZMXA 4HZGA 1FXUA 3VH3A 3K2BA 5M04A 1C1DA 2O7SA 2DFNA 3HUEA 2CEKA 3NV9A 5KNCA 1U8TA 1J23A 1H8EA 1HL3A 4PZLA 2B98A 3DEJA 3ADKA 4KREA 4IXTA 1XMVA 5JROA 4MVJD 2GSDA 2OV3A 5ECGC 1XDZA 3ZWVA 4DR7B 1O3YA 3FNIA 4HGYA 2QP4A 4P5PA 1IM8A 3F6YA 3EPJA 2ZYSA 5HVNA 3I0NA 3W5VA 2CXQA 1Y3FE 3DTYA 3F8WA 4HRVA 2CHUA 3B1VA 2AOTA 2Y2UA 4FFNA 3I6BA 4M99A 5AHWA 4H4CA 4DFDA 3I37X 4NP6A 4ZOCA 3B7PA 4D4IA 4II3A 2W90A 3MNFA 2X8JB 3A6ZA 3OP4A 121PA 2C0PA 2GPTA 2ZE6A 1V7QA 3DQQA 4D26A 5GV8A 3RT9A 1K8QA 4OY3A 1N5LA 5FR1A 4EQ6A 1RQRA 5IJ9B 3QWHA 4G1FA 4I1YA 3OQIA 1ORVA 2APJA 5AOBA 5TR9A 3G8YA 3ZU5A 1DZIA 5GOZA 2QTHA 2YJGA 1UXHA 1G5PA 2D1SA 1EJ2A 2HU8A 9LDBA 2BHLA 5DN9A 4C06A 4YRMA 4M55A 4IIJF 3PNYA 1Z9BA 3FSEA 5CK5A 5SZKB 1Y48E 2KQUA 4F3KA 1EFHA 3U4QA 3M9WA 4B5KA 3FUWA 3HJUA 4E2XA 2ES4A 3CUEF 2ASEA 1N4AA 1ULBA 2XKKA 5ISMA 4PAGA 1B1CA 1ZVJA 5F5NA 1UQTA 3FNFA 2IIVA 5CVCA 4AY4A 1NGSA 4XWTA 4PLZA 2BGTA 3T1TA 2ISQA 3KPUA 1EFCA 3EVNA 4MW2A 3JZFA 4DLXA 1MIHA 2VI5A 4OG2A 4PXSA 1GG5A 3DEAA 1RE1A 1NNUA 4I4CA 1TCAA 4IJUA 4L0DA 3FPEA 4U7PB 2C00A 3LWBA 3LLUA 4IQ8A 1HDIA 1E3JA 1XKTA 3V1TC 1GPNA 3QVUA 4FR5A 4G8DA 2DT5A 4J1SA 4RVUA 2D7CA 5B53A 3VSAA 3IPCA 1PJ3A 1H4SA 3AKZA 2I2AA 5IVDA 2CXHA 4EUKA 1L7QA 2EU8A 2Q28A 2WA2A 2A0YA 3MTQA 4J0KA 4UHCA 5DNAA 5T4BA 2O3QA 3VR0A 3HVIA 2OMEA 3H18A 4YBZA 3RANA 4P34A 3MWEA 5E6RB 4BVKA 1CB0A 4CQLA 2C9OA 2SKEA 5AM4A 5C31A 3RARA 3DLAA 1F4PA 4MKGA 2FG6C 3OWOA 5ECYA 3TLCA 2R85A 1GPUA 1PJRA 5MN5A 2VUUA 4ASUD 4DKJA 3WK4A 4HNHA 2JI7A 3E0QA 2QPLA 3CUKA 3TEJA 3V4VB 1H6BA 4DL9A 4I9NA 4TX1A 4XCQA 2PZ8A 3EG9A 1BDBA 1F2VA 5IVPA 2Q5LA 4CV1A 3T4PA 1M5TA 3A1CA 4YMTA 1QRDA 4IKEA 1PZMA 4MVJM 1FY2A 3G2LA 5EJAA 1M74A 5K05A 3EXIB 4AECA 1OLUB 3JYNA 4ZC8A 3F5FA 3OSZA 5EUBA 3AR3A 2GNAA 3P0JA 1M6EX 2XQJA 4K8RB 3BJRA 2VWPA 2ZR0A 3LWDA 3DFUA 1P2BA 3M6FA 4MX8A 3QXCA 3ZE0B 1MB0A 1TU0A 5DHPA 5GIPE 2C7VA 4YRRA 3QFTA 1RI5A 3UJDA 3E9ZA 1AK9A 5T41A 3OEYA 4YJ2B 1JHPA 1Y3IA 1BDIA 3KOOA 3UKOA 2ZS7A 4KQMA 1KSGA 3GWZA 4KO4S 4Z86A 1BFDA 1YJAA 3ZW8A 3DL7A 1ZVQA 4FB4A 4UTRA 1JLMA 3D1VA 5LLDA 4A26A 5C8VA 4CKZA 1N1MA 2OG2A 5DGHA 2ZU0C 3SR4A 4EQ6B 4F8JA 4AB1A 1EDBA 3DEKA 4JJ6A 1KQNA 2XUPA 3ZQJA 1X1RA 4HXGA 5FUWA 4HUQA 4KXXA 1CE8B 7YASA 1BCRB 2EZUA 4AFNA 1C81A 3DDUA 5H9VA 3SHOA 5DYNA 2V3WA 1NYRA 3L7LA 4M9CA 2WJGA 3W8RA 1KI2A 2YWBA 4PRYA 3TQCA 2GTHA 3CGWA 2F1JA 1B8OA 1Z0DA 2YJ3A 2GLXA 3GFFA 1JILA 2WU0A 1TC1A 5B2FA 2FEWB 1CKEA 3UV3A 1SXQA 1SQ0A 1SRQA 1Q57A 3TJRA 4QTTB 1A3CA 3IPAA 3QRWA 3AEKB 1SUAA 4MYDA 2QZJA 5COAA 4S1NA 5EJ9A 2X5NA 3DE7X 2XTNA 4C01A 2J59A 3U62A 2M9MA 5LP6B 2F00A 1U3DA 5I7UA 3I45A 3P9RA 5FOUA 1U1CA 3TIIA 1L5YA 2EGUA 1EFUA 1SN7A 4RK6A 3UZUA 1X6VA 1L5QA 1YBMA 1N77A 1NVTA 8LDHA 3JVVA 5E0KB 3K31A 2IHYA 1GQRA 2O2SA 1GA6A 5GGYA 3U1TA 3H2BA 4LISA 2EV9A 2QIPA 1WR8A 1MTOA 4NARA 3BZBA 3EXG2 5EYPA 2EW2A 1S5PA 3E0XA 1XX6A 2XYGA 1KY3A 2JGEA 3FTDA 3DOHA 2BMVA 3H13A 3A9SA 3DGFC 1BZYA 1DVRA 3G2NA 4CL8A 2K7FA 3QU2A 1ZIDA 2G25A 1K08A 4NV3A 4LYJA 4FIDA 3ZHTA 5ALDA 2B3DA 4BE4A 4N5MA 4EPVA 4KK4A 1UEJA 4JFRA 2ZTMA 1PJQA 1TNDA 2PXHA 1SG6A 3KCQA 3AKDA 4EW6A 5DI3A 3OTIA 3EMBA 3L8HA 3D8TA 1P0QA 5I01A 5K0GA 4AG6A 1FJ2A 1XG5A 3P4XA 1N3YA 2OVBA 2PDAA 2OB1A 4BMNA 2G40A 1XD9A 3O8NA 1JFLA 1Z3CA 2WKWA 5IT4A 5JXHA 1SBYA 3RI3A 1UOOA 2X40A 3OURA 4FYXA 4C4XA 4ZARA 5A71A 1VLJA 2X7XA 2XV1A 4IHJA 5YASA 1Q1QA 3WVNA 2V6GA 1L7MA 2N1MA 5DHUA 4YV0A 1U28A 4HFRA 2BV3A 4R98A 2IOQA 2DKOA 4UJ5A 4EECA 3D6MA 3R4VA 1R0LA 2JG3A 1WP4A 1CY4A 3VKUA 5B6PA 3M3PA 4EA7A 3OA0A 1GCIA 1UMBB 2QSUA 3TXAA 1PJ2A 2NPIA 2GZDA 1XRSB 5EZ6B 1XRPA 3KB8A 3WR5A 4B3MB 1ZHHA 4L9RA 4NE9A 4GOMD 5KB3A 4JI7B 3BXGA 3FHLA 1X92A 3SOPA 3TTSA 1UDXA 2JZOA 3UA3A 1HETA 2FFBA 4LI0A 1I0LA 1MV5A 3QV1A 4GP9A 1WU8A 4EI2A 1J5EB 4NU5A 1E3MA 4NS4A 1L5VA 1W4LA 4TVBA 1ZCJA 2BMWA 3BAFA 4G6ZA 4PSAA 5B58T 1IBLB 3KVYA 4DY6A 1YS6A 2J5KA 4FZJA 2I66A 3RYHA 4FW9A 4II2A 3AGPA 4FCCA 3WGOA 2VDMB 3GDOA 2A3NA 1R10A 3EZLA 5FPPA 4JJFA 5TIIA 1ML4A 3ZCQA 3O1IC 4BVGA 1R0YA 2R8YA 4YXWD 1ZRMA 1J9EA 2E4XA 3L84A 4BJHB 4BCCA 1HFKA 4YMVA 3G49A 3C3XA 3VC3A 5EJ8A 4XQ9A 5KINB 1Q3HA 2PMBA 1ZK3A 2CW5A 1I3NA 2ZWIA 1G66A 1S9DA 3AUJB 4I9GA 3ICQB 1QU2A 1RLJA 3JRNA 3DBLB 5J4YA 4R5HA 2JF0A 3REGA 1RAAA 2RHOA 2QT1A 1QIEA 1L5ZA 1VHWA 1B6RA 1M1YB 4MP8A 3T3NA 4JR1A 1XKLA 4ATNA 1VFPA 2MT9A 3NKLA 2IPLA 3PGXA 2CMKA 1NOKA 4NPHA 2VJCA 4GWLA 2IEZA 4AUKA 1J33A 3AB8A 4NMWA 2D1YA 4RY0A 5C34B 2BGRA 1RZ3A 1SIBE 4J91A 1VYTA 2R79A 4R9SA 2KI5A 4DIFA 4IIHA 3ZUGA 3HDGA 2HAEA 3QA9A 2FWAA 1NC3A 4BO5A 4CKEB 4D4JA 4D9HA 2YQZA 4UASA 1P7VA 2VJOA 3TQFA 3DP9A 4W99A 4P36A 2OYSA 3A6DA 2WY2D 3V55A 4QFCA 1ECPA 5BW8A 4G86A 4ZCLA 5F51A 3LDAA 1KZ1A 3EQZA 3LUDA 4RKQA 3WLJA 5LU9A 3CVUA 1QV7A 5KYUB 3B20A 3K92A 3KB1A 4P9NA 1GUYA 4V38A 4G5FA 4P3PA 1U11A 5JO9A 4TUYB 1RVDA 1QNFA 1U7XA 2PZMA 1CYDA 2YFKA 4PSVA 4A1OA 1EIWA 3ZHOA 5L3VA 3C7KA 2XB4A 2F43B 1R6TA 3ADPA 5JECA 4LFAB 2V8OA 3QEBZ 4C0JA 4JJEA 2GWRA 1M6VA 1PR0A 4I66A 2Q8NA 3SZ3A 3BH6A 2VG8A 3GI1A 2RH5A 2VJNA 1V11A 4Y3UA 2QUBA 4ZN6A 3MRXA 1N0IA 1XHEA 2XWPA 1XDBA 1JF8A 3C5WP 3HKCA 2W6QA 5EJMA 2A9PA 1BXGA 1VKNA 3MTJA 3Q4GA 3OCZA 4S35A 5C8DA 2Y05A 1K5PA 4FGSA 5BUQA 1RZUA 3IT3A 4BPBA 4M7RA 1KY4A 3UMSA 3CQ9A 4FYHA 3I62A 3RAFC 4IAOA 1U0JA 3D7KA 2JH8A 3U4IA 4ZAFA 2QAJA 3EVEA 4OGKA 4PANA 1W2WB 2J4DA 1GD1O 1L4NA 1GFIA 1MU0A 2IE8A 1YQXA 3PIDA 1CFZA 2QD2A 3ANTA 1CU1A 1ID1A 1QZUA 3K0AA 4QDUA 2ACVA 2XH8A 3KWLA 4YAEA 1PYGA 2NIPA 3S68A 4DV7B 2GS9A 4EARA 1BEZA 1XP8A 2YFQA 3P19A 2PMFA 2HDNB 1U5BA 3PNMA 3OFJA 3W5IA 1N7GA 1VE1A 2VP9A 2EIHA 3NIFB 4N7RA 1K5GA 4OQFA 2PGXA 5BVHB 4DBLE 4IZIA 4TKUA 4ESHA 4DG9A 1XNQB 5CLJA 2RGRA 4DV3B 1OB2A 4JQSA 2ZI6A 5KTRA 4IEFB 3DL2A 1I4DD 4LI3X 3C4JA 1CJTC 2B4TO 2Z9BA 5BRJA 2IELA 4G85A 1V4VA 1WUYA 1G8GA 3WJ2A 2AT1A 1K0FA 1Z5OA 3RPEA 1SU7A 1GFSA 1YRLA 2VF4X 3QEAZ 2JAHA 3EVZA 1ZD3A 3U7FB 3PEYA 3LKVA 5HILA 3VV2A 5JD3A 5A06A 2YMQA 3OJWA 5K0SA 5T67A 2O7QA 3AINA 5ALNA 3GU3A 3QIAA 3NU1A 1VL1A 2Z2YA 1EA5A 5EESA 1ZM9A 2Y1GA 3BRWD 3LUKA 5IJ9A 4J75A 4MIOA 4JHLA 2WZBA 3SZRA 3TBHA 3WLPA 2I2WA 2CJPA 2WF9A 1U8YA 2WW8A 2FK7A 3DZHA 3H04A 5J2TA 1T5SA 1T5TA 2AZ4A 2NSLA 5DIFA 4CETA 1C7EA 3IMKA 2GD6A 4LXIA 3RYIA 1KJ8A 2AMVA 2BC9A 1M1YE 4ITRC 1W5TA 5E0OA 1ZK2A 4KL8S 1YCFA 4JUFA 4MW1A 1BXRA 1R0SA 1YK1A 2JKYA 2NYAA 2QN2A 3GN2A 3HBMA 3LBIA 5FWAA 2BFBA 3AETB 4IH9A 4Q7KA 2G4VA 3H2ZA 3N5CA 3PGMA 5ABPA 1V16A 3U3DA 1TTHA 4AIRA 3NVMB 1ZL2A 3WJ1A 5C5EA 1R00A 4DLBA 2VQ3A 1HM5A 3HKEA 4EKDA 3FFTA 1QRAA 3BHIA 5DSTA 3IUSA 1XPJA 4P35A 5I5GA 5AW7A 5B57C 3P45A 3A6PC 1DNPA 2J3LA 1CF9A 1CUDA 1IHOA 2JCXA 2YWFA 5CJJA 3HWX1 4KPEC 2BDEA 4Q3EA 2PS3A 1Y3CE 3B5IA 4XVHA 3UW3A 4NQRA 5CHEA 2OQVA 1D6JA 3PQFA 2GLUA 3KSMA 1SHTX 4IX9A 5HKKA 3CONA 3VA7A 3LT5A 5F9FA 2RC5A 3GJ5A 4L85A 2WYIA 2WF5A 4R9NA 3IP3A 1JL3A 3GCWA 3MHTA 2R8EA 1AZTA 3AESA 3HN2A 3ZHYA 1H9BA 5JW6A 1T2AA 1O54A 4MRRA 3ZVNA 5JNSA 2PANA 1RXIA 3TW8A 1OE0A 1JQKA 3FOAA 4KFUA 2VWQA 4DXDA 3GEBA 1O1YA 4M7WA 5J2UF 2PGDA 1QYVA 4R71A 1D2AA 2VVTA 3H1TA 1DQPA 1TLFA 4ZEMA 5JRJA 5DXFA 2HQRA 1JHDA 4MKRA 4MUMA 4OGWA 4P58A 5FRDA 4A82A 1CZNA 1R88A 2ZKLA 1V47A 2ATIA 4C4YA 1T2DA 5AD1A 1VCIA 1WXWA 2GDJA 2V58A 3FTEA 2NQTA 4R0NA 2XB9A 1OWOA 1TC2A 3KAQA 2O07A 4QZVA 1R9MA 4TKLA 3SFZA 4Y1RA 3KKNA 4OJYA 3BMOB 4QOFA 3I9OA 5AXBA 1EXVA 3B36A 2R6FA 4R1MA 5J40A 1RPZA 4XGKA 1N6KA 1WXGA 1BX3A 3EFEA 4FGLA 3OWXA 3N0VA 3FTPA 1ENOA 3R0IA 4LQDA 3BIFA 1W0JD 4QC2A 3WTCA 2JANA 4YIHA 1EFRA 3MBKA 4DF3A 3ZD6A 1K6IA 4HLUC 4NNJA 4C1NA 4JYZA 1CZLA 3IERA 3LC7O 1XJ0A 4WXYB 1M2NA 3OZXA 1G7CA 1P6QA 3C8DA 3QFFA 4B3XA 4C03A 4ZI5A 4ZDIA 5IAKA 2O0KA 3KR9A 521PA 3VHXA 2PIDA 2IEGA 2PAAA 3C8ZA 4IMIB 4ZZ0A 1QKKA 1QO0D 2NSYA 2YBEA 1PWYE 4JWKA 4Z9BA 4A8HA 1Q1ZA 2EGHA 4FNAA 3GRFA 4ERXA 3WIUA 2CXUA 1E3WA 4IP0A 2BGKA 1TW3A 2C2YA 2H29A 3BL8A 5H7XA 1Y4SA 2QTCA 3M5CA 5K51A 3UA4A 1LPNA 1UMKA 2ZYVX 5B3JA 3R44A 4TT3D 2V7QA 2R8OA 2ZIGA 1OBFO 1Q2UA 3KJIA 3HZRA 3NWBA 4RH3A 1JVBA 5TARA 2BW0A 3DPIA 4IDGA 2P6NA 4HAYA 3WLHA 1UJNA 1J09A 4PTYA 2QMOA 1GQOA 1U5AA 1B8UA 3QX8A 4FHFA 3DZFA 3NRJA 2QV0A 3E9YA 5AVQA 1V9SA 1X70A 4GFDA 1L3BA 5IJ0B 1L3IA 4LZAA 3O4JA 3PVZA 1P31A 4XGRA 2HMYB 4YCJA 4HDCA 3VZPA 4MDFA 2B30A 5JH7B 2CD7A 4EYKA 2CLLB 1L5NA 1M7HA 4LNHA 1OKKD 4B44A 4CQLB 4FMDB 3IULA 3OX2A 3K9FC 3LOQA 4KO1S 4DA7A 1IUOA 1HE2A 3O26A 1K98A 1GL7A 2AOUB 2B5OA 1K6JA 3NOQA 3OFND 4MRAA 1Z25A 4PM4A 4WOBA 3QA3E 1G21B 4E5PA 3GLIA 1PI3A 4LA4A 2WBLC 2GEUA 3OQVA 3OIYA 1MENA 1BOFA 3I4FA 4C78A 2ZU6A 4LF9B 4ZU6X 4PO3X 4LNAA 2CDAA 2HWXA 2LR0A 3LS2A 2YJ4A 1LVGA 3OD1A 4WXPA 4YRIA 1Z6PA 3SXUB 5KYTA 1F17A 4LRQA 1US8A 4BNVA 4EKGA 1L4GA 2ONCA 2QN8A 2Q4EA 3C3YA 3DOUA 3O21A 3WK9A 1XZGA 3EDCA 1UBKS 3V2HA 3OQ6A 1GRCA 4S0XA 2D8MA 4LK3A 1XNJA 7REQB 3RW9A 4OOEA 4HY3A 4BVFA 1EJBA 1U7ZA 3K9HA 4Z4FA 5BOSA 5A0VA 2XJ4A 2XKJE 2WWFA 3FLEA 3K5PA 2EJUA 1HLGA 3GX1A 3QYFA 1DXYA 2BFFA 3CCFA 3F6PA 1ZH0A 3QLTA 5ALUA 3S6JA 4CKCA 2O5CA 2YC4C 3RTEA 2O8VA 2PBLA 3IJRA 4L16A 3W06A 4BTLA 3C1OA 1JQ5A 4KE6A 2QLJA 2RGCA 4KXLA 5A05A 1G63A 3STVA 3ZCTA 2GT1A 2ODWA 4OI0A 5HDBB 4OHCA 5KWIA 4JD5A 1H6DA 4DMLA 3ICCA 4Q4CA 1YOVB 2ARKA 2HJWA 5CURA 3DB2A 1I0ZA 1WSBA 3D2BA 4W7IA 3GR6A 4Z0NA 5JG7A 2FPPA 1R8SA 1I51A 2DUMA 4EJSC 1ZA2A 3BXZA 3R0JA 4F56A 1T2CA 3ESRA 1KZGB 3RVDA 4M1TA 3H4VA 4PQGA 4G9BA 3QU5A 1QTIA 3PT9A 4Q3CA 2HXGA 1T9KA 5CAEB 2D0DA 4HV4A 2EZ9A 4NBSA 2AUMA 4ZVLA 3VR2A 3LT4A 3OM1A 3A1DA 2K5UA 3PJRA 1KFCB 4BYGA 1FU7A 2J6CA 3OF5A 1EQ2A 2HBRA 3V4SA 4BUJA 2AHOA 3UW1A 4RO0A 1YZHA 5F4BA 4UHDA 2YINC 1PFWA 3A31A 3PEUA 4WESB 3M6IA 3EVTA 5T8KA 2R86A 4JMPA 3H9EO 1VCMA 3VO8A 1LI5A 1FP2A 1SXGA 3QUCA 4A0RA 1RP7A 1Q14A 1X0VA 2X7HA 2POQX 2G17A 4W5JA 3K9GA 3QFRA 5CIQA 3Q9UA 1ZFNA 2CYBA 2F48A 3M8KA 4OSOA 4BVEA 3L4KA 4ZIRB 3UPUA 3SXJA 1GCUA 3BFXA 3E9RA 5KQSA 4B3RB 4BMVA 5K3SA 1GNLA 1WVIA 3RAGA 3SYTA 2I7DA 3EEBA 1RZVA 2DMRA 2Y1XA 3BWXA 5LYYA 3URMA 4EAAA 2IYWA 4EMBA 2HIMA 2JI4A 4TV9B 4YJ3B 3MEQA 1R6DA 1V7ZA 5KYYA 3LUFA 1PR5A 1QVRA 2SICE 3HI4A 3QP9A 4U5XA 2I3BA 3I2YX 3T0FA 4EG3A 5ICEA 1BN7A 2BFOA 3BIWA 3LQ4A 2YDXA 4LXUA 1MO3A 2QJTA 1W46A 4ZVKA 4PLGA 3PDIB 1HMPA 2NXEA 3AUTA 2ZPUA 3KYIB 2H2HA 1OYWA 3FCEA 5CFLA 1FNNA 5FL7A 4OHOA 4WN9B 4B0PA 2Z8ZA 1TZBA 3GEDA 2V54A 4CEIA 1VI5A 4K9OA 3AO0B 3ND7A 5L7TA 3T1YB 3H1PA 2E4VA 4PYKA 2FG5A 1VQ1A 1KY2A 3I04M 4H3KB 4NLLA 3WBKA 4I6JA 2VYVA 4H3VA 1GY8A 2IK8A 3L02A 3OZEA 4R1PA 2JGJA 4OP2A 4TLAA 5COBA 1JI3A 4KEAA 1S0UA 5DGDA 2RJNA 4IO1A 4ZVRA 1E2EA 2B20A 4MAAA 2VNIA 3FVVA 4G5GA 1P2SA 2BKXA 2F7SA 1SY7A 3DEYX 4Q4AA 2OESA 3BD7A 2O14A 2YL2A 3UV6A 2OP1A 4P7FA 5E2BA 5LA6A 3CYFA 3ZPXA 1P7ZA 1G3RA 2C7QA 1OZGA 3SS7X 4AF7A 1GPLA 2CUZA 2XMPA 1NRJB 1W581 3PYMA 3CA8A 2FW8A 1VLZA 3LH5A 2PZKA 3NT5A 4I19A 3ZGOA 3AONB 2VP4A 2I71A 3OZFA 1WMFA 3V1NA 4S05A 1NRXA 5DU2A 3NIDB 2ECQA 4O8CA 2XYVA 1BHO1 4AYXA 2CVQA 2NACA 3JQ8A 4UNNA 4HMPA 5CH5A 3ID6C 4JCOA 3OF3A 4BGIA 5JCJD 4LSMA 1WTAA 1V11B 4BNNA 4TN5A 3AEQB 3FN4A 4P4LA 5ER6A 3SYLA 1YR7A 4JOBA 3G79A 1DKMA 4ER0A 2VEOA 2ZRBA 4IXDA 3AFOA 3IBSA 2H2WA 5TGZA 4B74A 3SQLA 4MIYA 4CKEA 1EGMB 3WA7A 3LVRE 1F51E 4BBZA 4OMUA 2C0CA 4ZICA 1LS1A 1ZH8A 3WFIA 4AJ9A 2GAJA 5IANA 3MXTA 5ARCA 2Y1OA 4MW0A 4TZTA 1L4EA 4PZ9A 4MV4A 4RLHA 5K5EA 3WIDA 4E11A 1QF9A 3TSWA 4RTPA 1U9IA 5KJEA 3COWA 2Z2KA 1XLTC 3GAFA 3IR5A 1DG1G 2BEVB 4Z7QB 2F62A 3G8AA 4BNDA 4ZVQA 1DELA 1CUEA 1B8VA 3IV6A 2XNCA 3EIHA 2I4TA 1EMDA 1Z7WA 3L49A 4FN4A 4W9MC 4OHBA 4WZBA 3ZDQA 3ZLJA 2I7TA 1H66A 421PA 1WW3A 4P7JA 3OFVA 1QP7A 3G9QA 2IOFA 5HFJA 3TJMA 4BRWA 4D92A 5JR3A 1IZYA 2Q7XA 1LLUA <