1DOZA

Crystal structure of ferrochelatase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
309
structure length
309
Chain Sequence
b'SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROCHELATASE
molecule tags Lyase
source organism Bacillus subtilis
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
total genus 118
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA02
1LD3A 2QD5A 3LYHA 4KLCA 3W1WA 4KMMA 3HCPA 1L8XA 2XVYA 2AC2A 1AK1A 2AC4A 2PO7A 2QD1A 2XVZA 2C8JA 3HCNA 2Q3JA 3GOQA 3AQIA 2Q2OA 2HRCA 1LBQA 1HRKA 3M4ZA 1DOZA 2H1VA 1C9EA 2QD3A 4F4DA 1QGOA 1N0IA 3HCOA 2QD2A 2Q2NA 2QD4A 4KLAA 4KLRA 1TJNA 1C1HA 4CCSA 2HK6A 2XVXA 2XWQA 2JH3A 2HREA 2PO5A 3HCRA 2DJ5A 4MK4A 2XWPA 2XWSA 2PNJA 2H1WA
chains in the Genus database with same CATH superfamily
1ESZA 4LBYA 1H0HA 3N8GA 1SXGA 3M6LA 5EUQB 2RSLA 3S2GA 4DJFC 4G1CA 5T8KA 4QYWA 3K8YA 3MBIA 4CYMA 4XLTA 5M34A 3G5LA 3PHCA 3VO8A 5KU1A 2G4CA 4IDNA 4MA0A 4IINA 4ODIA 1EUYA 2IZ5A 4Y1GA 1JS1X 3A1DA 4UHDA 1A8PA 3H83A 5K8IA 4TQGA 3ZIAD 4LECA 1VMAA 2XRMA 3KX2A 5JAPA 3LY7A 2WTEA 3GQBA 3OTHA 1JHYA 4LVCA 3SZGA 2Y71A 4PO9A 3RUCA 1A8IA 3DWEX 1UOQA 4XXHA 1GEGA 1SWVA 3ZD6A 1D2EA 1I4OA 4RTKA 3SZLA 5ALOA 4AJ1A 4LHSA 1LWOA 2ADOA 3C98A 3D81A 4DQXA 1FVOA 3IL2A 2ZB4A 1AMUA 4V1CA 2PBRA 5ANRB 2OBBA 1QOQB 3BKWA 4LCBA 3AYXB 4BMOB 1ORIA 4WOPA 1U8AA 3UMYA 2O50A 5HWSA 2O6LA 1GKYA 1RT9A 2CVFA 1TCBA 2Q3JA 2D7DA 1XCJA 3FSRA 3CLTD 1C8KA 1Z8HA 4D6PA 4EFDA 3K71B 1XXHE 4U8HA 5G4KA 2HLDA 3HA2A 3KUXA 3ND7A 4JOSA 4GM4A 5H68A 1OVMA 3PBKA 5FORA 4Q4HB 3WB1A 3A0UA 1E5LA 3VPCA 1JKIA 3GYBA 3BMOA 4HPWA 5ALRA 4NCBA 4YT5A 5B37A 1GRVA 4FFMA 3IEUA 2GYYA 3WRYA 1KMIY 2ODTX 4QHTA 1KGDA 3HCFA 4D81A 1ULZA 1HT2E 2IYNA 5TV2A 1Z36A 1N57A 1T3LA 2H48A 1XCOA 3E81A 3TMAA 2C82A 3WK7A 1U8FO 5AUOB 1CNEA 2HO5A 1G21E 1USVA 1QRUA 1CZNA 4AROA 3PRYA 1ISJA 4BHTA 2CYBA 4PZPA 4N7BA 4ER7A 5JANA 4LZAA 4OI0A 1NW4A 5AW3A 1F5NA 1O6GA 2NXNA 3EXAA 1O0BA 3HB4X 5JVDA 1OC4A 5DWDA 3Q8XB 1LLDA 1P8AA 1K63A 2RHMA 2R6HA 4MUJA 5EJ2A 3OQBA 3CB2A 3PFFA 5GV7A 1J56A 2W90A 1Z0KA 4PSUA 3K30A 1KNXA 1Y48E 1ZU4A 1DXQA 4RVCA 3DL7A 3KNZA 1PQWA 4I99A 1UIMA 5AOAA 3ZU4A 1Z4KA 3W7VA 1JLLB 1I0IA 3NHZA 4DLRA 5AI5A 4EYKA 1NTOA 3NUZA 2UXBB 1XIVA 2AX3A 3X43A 1IM8A 3D8RA 4RCYA 1WZUA 3KKZA 4TVKA 5LZ9A 5JLJA 2IF0A 2C31A 3GY0A 4RUKA 3E7DA 3G8CA 3VR3A 4RACA 4BNIA 4OQXA 4PCLA 4BUJA 3UTCA 1MBZA 2P65A 3GUUA 4K9RA 3QFRA 2E89A 2X9LA 4K9MA 2JFVA 1TUGA 4B46A 1XD2A 3A06A 3SQXA 5FTJA 4OTZA 1VPWA 1B0AA 2IGBA 3K8OE 2IHNA 4OXYA 3NG1A 3T9CA 5CCXA 1FYWA 2IV2X 1KH1A 2DP4E 2QN1A 3N5CA 1U8TA 4Y2VA 4YTEA 4KEAA 3P0EA 3O8CA 3PPVA 4MQ4A 2GAFA 2CBXA 2FX3A 2ISCA 3H8SA 4ID3A 4PANA 5DXJA 1LQTA 2ZWOA 3BMNA 5F5NA 4A23A 4YO8A 5IP5A 3SEFA 3T38A 4DUGD 3FMGA 1M76A 3IEKA 2VNAA 1PEAA 3AV3A 2OV1A 4PLTA 2ZUTA 4V02A 3UK1A 3ZW8A 4WT7A 2ZSHA 3KR0A 4RD4A 4BX8A 1YI0A 4RM2A 2DU8A 4Z8XA 2R1TA 5BN3B 3BAZA 4KFCA 4BATA 3B9BA 4CV1A 2PS9A 5J4KA 1O2DA 5COBA 5JBIA 1ZINA 2XTMA 4RY9A 5GGYA 4ZCMA 1IEVA 4ABYA 3ZZNA 3KOYA 2BFMA 4BOYA 3U1VA 2HJSA 5KCZA 3ICCA 5FNVB 4K2AA 2HTEA 1PJZA 5K8VA 3V3KA 1CYDA 4ZJPA 3I34X 1C7EA 4B5KA 1ZVVA 5LQNA 2UAGA 4LWOA 5SY4A 1V3TA 1P9NA 4FCCA 1ESDA 2NPIA 4NZNA 3HDTA 1GVHA 4K28A 5AJHA 1TCVA 1OXKB 3F7OA 4DN6A 2YJ3A 5ALEA 1UDBA 2CCJA 5MN6A 2J5KA 3C0KA 3GDFA 5IBRA 4EKDA 4TYMA 5BXQC 5CA1F 1RKVA 1V4BA 2FSPA 4MUBA 5CM2Z 2UZ4A 3VAYA 1XLVA 4U7JA 5DP1A 3U4QB 3D2BA 1R37A 4CKZA 5IWAB 2CXQA 2G77B 3AILA 3SNHA 1XWIA 5G4KB 1YQXA 5IJZA 1L5MA 3HCRA 3MRVA 2I66A 4XJSA 5LQSA 3OOEA 4JUDX 3DE0X 3P19A 1N8TA 2Q50A 3G9ZA 4ND3A 1TJYA 4QRDA 1PFVA 4KSYA 5JH7A 3FCCA 1L5HB 1E0SA 2UDPA 3KEQA 3OJOA 3R2JA 1NVKA 3A6FA 2WY2D 4C7XA 5A06A 3KZCA 3B82A 2ZFUA 3PGJA 5LP6A 4L0CA 1M2OA 6ADHA 2NP6A 5B1HA 3V97A 2GEJA 3INRA 3T54A 3PEVA 3V1NA 4TROA 3AP3A 1CRWG 3HYTA 3UK6A 1T9GS 1UDRA 4X8LA 4ZTZB 2ONZA 4N0PA 4P7BA 1TQ6A 1ZD2P 1A82A 3LQYA 5EY5B 3K2BA 4F3YA 4I55A 3WLRA 4MVXA 1V7PC 4BFWA 3FOCA 5JZBA 4YRCA 2NU9A 2WWHA 3UMRA 3CR7A 2AKEA 1H8HA 3TVDA 1C1YA 4O4HF 3ZX4A 1JFTA 1S3FA 2X8BA 3CN7A 4IJMA 3D2CA 1E3MA 3NIDB 5EIWA 1ODIA 1Q20A 3C5CA 2B6HA 1YACA 2R8EA 4RFVA 2O6HA 2WHQA 2GKOA 3DLPX 5EINA 3RS0A 4H7PA 2G08A 5BPFA 3GLFB 5E2AA 2BMDA 2GD1O 1XEWX 3MQ4A 2XCOA 5ALPA 3A04A 2Z6QA 5JPDA 4CL0A 1JPUA 1KAHA 4MCHA 5F98A 3E82A 3V2HA 2AG6A 4S3MA 1YULA 3KT3A 3MUFA 5IYZA 2YCBA 4QGBA 4G1FA 2AEJA 4AZTA 3RB8A 3ASYA 4RIHA 3CU5A 4C7MA 4IH4A 3UIEA 3FGOA 4LV8B 5ICEA 2DC1A 1Q12A 5DI9A 4CM5A 4G4SP 3H2YA 3RVMA 1F4VA 3GLFA 3REFA 5L7YA 2WIDA 3I5UA 2VIIA 1Z18A 2YWBA 3HLYA 1U99A 4LK3A 3RROA 3T3EA 2EDAA 2AG5A 1KTVA 2PZEA 4JZKA 3QLEA 4HSEA 1FP7A 4LZWA 4KXMA 1RTTA 1HE1C 1QCDA 3BHMA 3LDHA 3X2FA 2Z1MA 4DA8A 1FTGA 4V0QA 1NYQA 3C3MA 3T3DA 2PA3A 1LI7A 1Z6YA 2LGJA 4C88A 2C07A 2O2EA 1Z6TA 1RYEA 1H22A 1VYHA 4H0FA 1D1QA 4JV5B 2QAGB 4PO3X 3ITDA 5KC8A 3H4TA 3DC2A 1G18A 2JGDB 2Q2NA 3DMTC 4U3JB 3C41J 4KAJA 2NYAA 1PAUA 3IQWA 3KG2A 2AUMA 3OIYA 3LQQA 4AX4A 3VNVA 2GHRA 4KI7A 1M1XB 4RDIA 4ZCRA 2ZDQA 1WP9A 2CBGA 2LE0A 2ZYSA 3AI7A 2G1AA 4E2XA 3IT1A 2PUWA 3ZZUA 2CYAA 3ZYZA 4YR9A 5ISMA 4WKNA 1M6NA 1FSFA 4OM8A 1R2QA 2GK6A 3EGOA 3QEKA 3REQA 3EXFB 4J6FA 1B73A 3DDSA 3AEXA 3N70A 1BU5A 2N3ZA 2QTGA 2EHDA 2GH1A 2I8LA 3E9CA 1S8FA 4MLCA 3Q4GA 2WA2A 3IIJA 1MMFB 2ZBFA 3UXMA 3D64A 3SKXA 1T5TA 3BT7A 4WN3A 4NJMA 2O06A 4TRMA 4IJQA 1PWHA 3CKLA 1ZH4A 3D3KA 5HMMA 1RJEA 3BCUA 4RE6A 1IY8A 3PICA 3A31A 3EDCA 5EESA 3LCMA 2JBAB 3S2UA 4NZYA 2CFOA 1YS1X 3CLKA 2I87A 2ZTUA 1UK8A 1UOEA 3NRJA 1MENA 4F4UA 2WJIA 1I9CA 4QT0A 3K6SA 1W0JA 5KYGA 4PHGA 1GCIA 1JGTA 3FIJA 2JJ1D 2BC9A 1HT1E 3M6MD 4MZXA 1AB6A 4R8MA 5DB4A 3VYUB 5A3RA 3Q12A 1T4CA 1AQLA 5GVSA 4XUEA 3TN7A 1UUFA 1ZD4A 4DR4B 2HHLA 3O2QB 5JMOA 2AOXA 1FX0B 4XWOA 4A8JA 4PFQA 4TYPA 4XW2A 2WU3A 1SO8A 3G68A 3OF2A 2J3JA 1TFRA 3ST7A 3ND6A 5DNWA 3RIXA 1VIAA 3FGNA 3SF8B 2PFGA 4QJ4A 1FPQA 4WPGA 2V59A 4RGVA 5FL7D 2WTAA 3IJEB 4XJXA 5TQ2B 3SR4A 1AXEA 1AKYA 1IUNA 1I7PA 2HBRA 3A4VA 3HEAA 4D9BA 5AQ1A 2AFHA 3CZ4A 2GARA 2CUZA 1Z38A 2AFIA 1DBQA 2X0NA 3MJ4A 2PWPA 2QY9A 4QGFA 1KK2A 2X5KO 3LA6A 5J1TB 5DM60 4TVBA 4P3XA 5G40A 1UBMS 3JQGA 3QUQA 4JNCA 2H9IA 4OGFA 4ENQA 1MAUA 4PW0A 3NDJA 3MT7A 1O7JA 4G4SO 2Q6TA 1DJNA 1ZD3A 2JVIA 3GB9A 4NYJQ 1E1RD 4AYXA 3OTOB 1ZIPA 2WM9B 1DAHA 5AVWA 1P77A 1E98A 1KQFA 3LFHA 5DSXA 5CA0B 1Q50A 3K0BA 2Q62A 1V11B 4QOJA 3OIDA 2ZRNA 1KY2A 3HZOA 5K8UA 1DJQA 2ZIXA 3C4JA 1KQNA 2GN1A 4D9HA 4M83A 1IHYA 1KY4A 3VTFA 5KUTA 3GZNB 2EKLA 3DEHA 1PJ3A 4I9NA 4J3NA 3Q15C 4HYYA 4DAEA 1JSZA 3RV4A 2QXTA 1CEYA 2G0TA 2IXTA 1GAJA 1F9AA 2AG1A 4I1OA 3ABOB 2O59A 1KE1A 3LUCA 1ZONA 2GM3A 3HBMA 5LQDA 2HHCA 2EBHX 2A58A 1Z37A 2AG0A 2Z3ZA 1IN6A 3DB1A 1IAQA 3NX4A 1WHSB 4HLDA 4JGIA 5LP1A 4W5RA 4EB0A 4JP3A 4EKEA 4NV0A 3T3MB 3MT0A 4E1BA 4QFCA 2F9LA 2CXOA 3PC3A 4OSOA 4Q3CA 1W88B 2PNFA 5EE9A 1DMRA 3A70A 3BTUA 3OX1A 4QOIA 1H2HA 1Q6ZA 3QMMA 3ZXSA 2XLBA 1RAGA 1USUA 2DPYA 2Q3HA 2WNIA 4XLZA 1RLJA 5CIWA 1CP3A 5TGZA 1I3CA 4Y6LA 3RFCA 1DTEA 2NU9B 4YO7A 1N34B 2X0DA 1JZQA 1E2EA 1KFEB 4BMPB 3QOYA 4QUKA 4RD0A 1N0UA 4ZDIA 1PNOA 2QK4A 3QTTA 3BGVA 1G3MA 1FXWA 4Y9TA 4F2DA 2O05A 2PWZA 2Z43A 3KQYA 4B87A 2PD6A 1NRJB 3OICA 4MVJD 4D4JA 3K3PA 5A6SA 3DAGA 1M6YA 3DH0A 1KORA 3TTUA 2PGIA 2VZ0A 4FC7A 1IZYA 1KAMA 3HY4A 4YQEA 2HWYA 4KQ6A 3SLKA 3H9BA 3QI7A 2X22A 3IQHX 1WPQA 3QX8A 1AS3A 1ENPA 3VPXA 2HIMA 1X86B 4OJKA 4FOPA 1BEZA 1KHHA 3QQ5A 3GVPA 2PZAA 3OOJA 4S1VA 2AFVA 3O8NA 1N5KA 1ND6A 4D0LB 2BZGA 2C3YA 4DZTA 1D6MA 3REGA 1H2AS 3TB6A 5IZ4A 2EX0A 2ATXA 3D8BA 3FUWA 3R4VA 2HBQA 3IULA 1G5PA 4YP1A 5JIBA 3OM0A 2P6NA 3TW4A 1U28C 2ZETA 4B80A 1SOMA 4GUDA 1E5DA 4OBWA 4CLXA 4TKVB 3H6HA 4DTIA 4BLWA 3DWFA 2QJWA 2EHJA 4OXNA 4HDSB 1ZH2A 2A0XA 1DBRA 2CVZA 2VNJA 2EGUA 2YXLA 3NH9A 5H5JA 2J9YB 3TQTA 3N7TA 1J9EA 4ZYLA 2VPYA 1MQSA 4MB2A 3PKJA 4NRDA 5IK2A 1MV8A 2W0SA 4I1UA 5JQGF 5JCPA 3UMMA 4I8DA 3HYLA 1KP9A 1KE2A 4S0ZA 2GJ9A 1X7DA 3FAZA 3NHWA 3PCXA 4Q3OA 4X7PA 1JFVA 2ZJFA 5T7BA 1Y4ZA 1T4CB 2JIRA 2MMGA 2A0YA 5I8WA 3AF3A 2Z2YA 3EUFA 5KWSA 1WMBA 1GYPA 1YJBA 1ZJ5A 1B6GA 1UBCA 2VSQA 2YX1A 5LM3A 5FFFA 4O2AF 1Z6AA 3QE2A 5K3FB 1E5QA 3L6BA 4OQFA 3ZI4A 3ESDA 3AKCA 1DG3A 2D1YA 1L7MA 3H2GA 3HFJA 4WFKA 3VU9A 5JO9A 5TIIA 3EJWA 3IEVA 3ZHCA 1VBFA 1P2VA 1QHNA 2V96A 4C22A 2J31A 4UEQA 1I4TD 1NHWA 3RSCA 4YJ2A 3MCZA 1VB3A 5IX8A 2DKNA 2HIAA 3U4CA 2P41A 1PL0A 4UNSA 2QQFA 1P2UA 4IDOA 5FUXA 2HU8A 2RH8A 1DJOA 1NONA 1BDMA 1ODCA 2R6GA 4GW3A 4J16A 1CQPA 3N6RA 1J22A 5JADA 4D57A 2GXSA 3KHSA 3T7CA 1GPWB 5FPSA 4EJ0A 5C18A 3WRYC 2W22A 3HEMA 5DM70 2QLFA 3EMVA 3PX2A 3KVYA 4UVGA 1ISRA 5B4UA 3L0YA 4MLDA 4HBGA 4RPCA 4W5HA 2I2XB 4QDTA 2P6MA 4QBKA 4COOA 2ZOSA 1CDOA 1F0KA 2VEOA 3TL6A 3L7OA 2QMEA 5I9BA 2H16A 4D9MA 1JIIA 2V7TA 3AWIA 4XQ0A 5TNXA 3PNBA 1JJBA 1B0UA 2X7JA 3IOMA 4GMDA 5FPYA 2ID9A 3ZVLA 1X15A 1RQ7A 1BVUA 4PZDA 3WYAA 1ADCA 5DISB 3BSWA 4G25A 1AKNA 2KSQA 3RFUA 3DMPA 2IU6A 3BCHA 1AGXA 3RSGA 3AH8A 4WUVA 2WTNA 1EK1A 3A3PA 2Y0PA 4NMXB 4CV0A 3ADCA 1KEZA 4JOQA 3OKPA 5F64A 4BDTA 4LY0A 1F6BA 5K5EA 1ITZA 1ZVKA 4X7RA 4RKYA 1MC8A 4RVSA 1Y3HA 3HV0A 1UFRA 4LG1A 5EHGA 1OX4A 4S05A 4LNUB 3CNEA 1WPRA 1S8AA 3FJYA 1M1ZA 3PP8A 5IULC 5KNCD 1HX7A 4CM3A 1E6EA 1B6TA 2WUGA 2ONYA 1FCJA 2PX4A 2X4LA 3PTZA 4U2BA 2DG2A 3KJHA 4GS5A 5DTEA 1F6WA 4YP0A 4W4TA 4BUZA 2VPXA 5AUQA 1WKBA 4ZT5A 3JQBA 1XBTA 2IDJA 3RG2A 4Q16A 4BV8A 3VUFA 4EMTA 5JAMA 2RH5A 2O7NA 3FRJA 1IUPA 1BS1A 1U1IA 4KFTA 3VC3A 1W1IA 2ZUFA 4X92A 3ZD7A 4YUXA 3AJRA 3ZVNA 3N3BC 5E8JA 2X5NA 3U31A 2QUKA 2RHWA 2GSWA 3QH4A 4K3UA 2XODA 4QJBA 1SC9A 3OIVA 3PQDA 5K3BA 3ZZ0A 5E6SB 2V6MA 1LF0A 1JA1A 1W1WA 4CMEA 4V24A 4X20A 3O1JC 1EG2A 3FA2A 3DZ8A 1S2GA 3TLGB 5MGBA 3ITNA 3L8MA 4EJ2A 1T36A 16PKA 1TYAE 1OBFO 1EA7A 1A7AA 2VQ6A 4ND6A 4TZKA 1OAOA 4UXJA 4FSDA 4Q18A 2IS4A 2O8NA 2BMWA 3NVKI 3DDZX 3VNUA 1S4MA 1RCTE 4YRAA 1JR6A 3I2YX 3H2IA 2ZJYA 4S1PA 4Y8VA 2PTGA 2YXPX 2B99A 3BXEA 2KX7A 4O0LA 2FWBA 3BRWD 5CUQA 3EFEA 4FEYA 2OCLA 1NBAA 5FI5A 3JR7A 1G7CA 1ZH8A 2FUKA 1KGSA 4QG7A 3T5AA 5FRDA 3PC2A 1L4EA 3JD0A 3OF5A 3TAUA 5F3WB 4IDEA 2OXTA 2ZUWA 3U19A 1I3NA 2Q5FA 1CU1A 5CVJA 4ZI7B 5KHLB 4RBNA 2IZ7A 1PG2A 2WFAA 2I1QA 2ZCVA 3HWWA 1LJLA 2B4AA 1PTKA 2ODPA 4OHXA 4R3WA 3G2NA 5TQ0B 2ONJA 5YASA 4A6DA 3RASA 4JLJA 4FGJA 4L5YA 1TW3A 4H1HA 2G5GX 2VOEA 3HWRA 1X0VA 3FBTA 4CHTA 2VHJA 3ZCSA 1P91A 4YJHA 1RS0A 1YNOA 1JHAA 3GRZA 3OE5A 4R9RA 3EZ6A 2LWIA 4FHGA 4YROA 3RHSA 1AC5A 2Y1EA 1SUWA 3BCSA 1L7BA 1M1YB 1U3CA 4LNHA 5HIJA 3I9V1 4ZI7A 4MWBA 1L5YA 4JQOA 5E6RA 2APJA 2AXNA 5CYOA 1A97A 1D7AA 3KS9A 1FDRA 3KOUA 1NPDA 3E4CA 2F9MA 2AOVA 4J0JA 3Q6IA 3L3BA 1B8UA 4NH0A 3CVOA 3P0FA 4DQVA 4PAWA 1W4ZA 2A33A 2FN3A 3ACDA 3GRVA 3OSUA 4L22A 4F6RB 4OU5A 3EYAA 1E96A 3WX0A 5FR2A 3CX8A 3INYA 3V8EA 3KTAA 2H5JA 3GFFA 4ZVSA 2HDOA 4Z99A 4LXQA 4TUYA 3QENA 4C6RA 4WLFA 1Y8ZA 1G9TA 3W8NA 1FX0A 1KS9A 1X39A 1Q0TA 4HLQB 1A4IA 1AO0A 3KSBC 3QYJA 3DPSA 1HYBA 1TL7C 4M4SA 4WFQA 5JSYA 3WFJA 3MBKA 4YB8A 1AZTA 1D3AA 3BEDA 1VPVA 4WK0B 4BMCA 4P0QB 4MDEA 4OSEA 3TCNA 2XCTB 1MW8X 1KJ9A 3GGGA 3FN4A 3AY3A 4XDGA 3EEBA 3QE4A 3NAQA 4Z0HO 4I5DA 1GLVA 5DM0A 3R3YA 1XZBA 2PD3A 4OQMA 5A1TA 4N7RA 2ZUUA 5HUJA 2YWGA 1EDBA 1NMEA 3OIFA 3WBKA 1GU1A 3ZDZB 4OHWA 5K3FA 2IQ5A 1AO3A 4YEDA 1PJAA 3JQ7A 4IG4A 2Q6OA 4ZK6A 4KNWA 1E7SA 1DP4A 3WOVA 3OUUA 1F38A 3TLKA 3VSAA 5HHTA 4DT1B 5KKNB 4D0GA 5GQSA 4KHZA 2ILVA 4BNLA 4MNTA 4RGQA 4LKRA 1QZZA 4UDXX 1K97A 1QQ5A 3CRVA 4YRQA 5CVCA 4DLVA 4L8YA 2E87A 4J3JA 3VH4A 2PX3A 4TWZA 2C8LA 1PT8A 2P30A 3C6QA 5T6BA 4CF5A 2BD0A 2ENWA 1XK6A 3MS4A 4QBIA 4CTKA 4DANA 5I4CA 1NLMA 4QX6A 3AF5A 1HFEL 1PTJC 2D1QA 4Y0AA 4HNHA 1W5EA 2IHYA 3FCEA 5A03A 3FMVA 1JXOA 4NBNA 3C5HA 1VLVA 3LECA 3QFFA 1WTAA 1ZN9A 2ZTSA 1XP8A 3WA6A 3N86A 2YR0A 1JQEA 1VYUA 4CMHA 521PA 1U90A 1FRQA 3KRTA 1HZZC 5ALNA 5ETJA 5JV5A 5K6RA 4XSGA 2W4MA 3G2KA 5U4QA 2E9SA 1M2VB 4MDHA 5K45A 1EZ1A 3G7UA 3OQPA 4IXDA 1A9RA 3N2LA 3ONNA 3AOGA 3AL0C 2NVOA 1Q91A 2HJWA 4M1QA 5I01A 3NTLA 4YJFB 2I2FA 2JJ2A 1K5HA 2WILA 4HJRA 3V2GA 2IDMA 3RRXA 4U2EA 5A5VA 1PFGA 3L8ZA 5KQRA 3OEHA 2JS7A 3LRPA 4D3ZA 4DG8A 3A1VA 1QZUA 2PQ0A 4WZ6A 1YR9A 1WETA 1ZNXA 2PJZA 2QOEA 3QXHA 3IQZA 1SU7A 3TOVA 3L7YA 3HUTA 2BHLA 1W5FA 3EMBA 4M38A 3B6IA 4XIGS 1NYLA 1YU9A 1ISMA 1ZNZA 2MJLA 2IVFA 5EXEA 3ZH2A 4XOUA 3U7EB 4F4CA 2EF0A 5F1YA 3UMVA 4BE4A 1WHTB 1U1CA 1I0ZA 2L18A 3KUCA 1TM3E 4FFSA 1XZGA 2OYCA 3TNFA 3LX4A 4FUTA 3SOZA 4BB5A 4F1WA 5BNWA 3W7AA 3R5JA 5JDCA 3WZ2A 2P7HA 3T3PB 4F5YA 4C1NA 4BE7B 1JH8A 1I51A 2ZYTX 4XIFA 4GXNA 3RSZA 4R8SA 4R4JA 1W47A 3RF6A 2HSEA 3C39A 4DR1B 2XUQA 4G1MB 4GRIA 4HLUA 2PZMA 4GBED 3B6EA 1QDEA 1QRDA 3GXBA 4JUAA 5C8XA 4EEKA 1JR3D 1QMPA 3L6DA 1ZJ6A 1IZ7A 1Z08A 1Y6QA 5DGDA 5AVSA 5EIFA 5KIAA 2WR8A 5KVSA 4EFKA 1ZK0A 3S1AA 3G8BA 3SQLA 1K7SN 4HN4B 4A1OA 3CZCA 4CL3A 5JH7B 2C2BA 2VN8A 2OGWA 4LGCA 3RAEC 3EG9A 3HXLA 3JASA 2HCTA 1DIHA 4KLNA 2VHYA 4DCJA 2WSLA 2P68A 4KN9S 4NBVA 4EHKA 3VUEA 4QOFA 2QMHA 3U2QA 3RYFB 4BUCA 1QMGA 2H2HA 2IV3A 5CXQA 5IUJC 3KYBA 3FHJA 4EY3A 1E61A 1SQ6A 2BGRA 2Y3IA 4FI3F 1PL6A 3L7CA 3VR2A 4C5AA 4Z53A 1TM7E 2ZIGA 1OIWA 3LGSA 1UXKA 2WFZA 2VPZA 1J90A 2VRWA 3GCDA 3SJZA 5IKMA 3JD1A 5BNIA 1U2RA 3GLTA 3ONFA 1M2FA 3C6BA 4Z7OB 4DE5A 2OLJA 2FPSA 3RHTA 3ROEA 2V0CA 2AN1A 2ZI5A 3UOAB 2VDLB 3TIXB 3W6ZA 1NNI1 3JAKB 2R5NA 3DD1A 1VDMA 5L3SB 1EEXB 1W2GA 3USCS 3CTPA 1YV9A 3DOCA 2VAPA 1ZQ1A 3N8KA 4FYVA 2M2IA 3ELDA 1KXJA 3F5MA 1GTRA 5EZ5A 2BGIA 3UFBA 4GMGA 3SDZA 1C9JA 2PR2A 3TLCA 2G5CA 4EEXA 2F3SA 5CVUA 3WK5A 4DJAA 1XDWA 2HA3A 2H2WA 3ORQA 3C87A 4D98A 1T1IA 2GD2A 2JGEA 5U4XA 1K98A 3AVOA 3E1SA 1RXCA 3CURA 5TARA 2EZ4A 1JFSA 3H0CA 5KJEA 2JLBA 3QU4A 4Q3KA 3OPYB 4LJ6A 5KSOA 3DTNA 1UFKA 2NQ8A 2PEZA 2RG1A 4X8MA 5EP4A 3L18A 3ZWXA 4GP7A 3UMBA 1QVWA 1MIOB 2ST1A 4B40A 3QU5A 1CUIA 3PUZA 1ZRMA 3RVBA 1B74A 1FZQA 1RZVA 1X0XA 4QPZA 1QTRA 1JU9A 1HE3A 3D7NA 2G0AA 3TOSA 2DKFA 2JI4A 4NCXA 4EABA 3NBKA 1NW9B 4X71A 1YMQA 2Q6IA 4HDOB 2DUUA 2IA5A 4K9DA 3IPAA 1HYEA 1GLNA 3HLKA 1SXJD 3RU2A 2RGDA 4PLWA 1I7SB 3CNNA 3MN1A 1FSZA 1EJ0A 2D5AA 2ZRCA 3DZBA 4MKZA 2P62A 1U1FA 4NPHA 4ZA2A 1T5DX 4OYLA 2I99A 1GGFA 2VKQA 2W11A 1KZ1A 5A3VA 2XAAA 5CAEA 2KJQA 2YFKA 3GGDA 4UEOA 3EXIA 4QGGA 1FMJA 4BNMA 1SKMA 3SMQA 2D1RA 4GP9A 4PM4A 3NC0C 2G04A 3GZ4A 4DADA 5C5EA 1N6IA 4H7IA 5AI4A 4TT8A 5FOQA 5AJXA 3DLBA 2NADA 4HXFB 5J4VA 1SCDA 1QO9A 2HO4A 3COSA 3IFSA 5FJIA 1G3IA 3NR2A 2V55B 2YY6A 1C8VB 1B8VA 1XC7A 4YNBA 1ODJA 3QJ5A 1BXZA 3CCCA 1XKQA 2JD1A 1JE0A 1VXRA 5IMSA 4KE6A 1DS6A 4KQJA 5IXJA 5LIRA 5J2UA 3UKDA 3L6UA 2ASVA 1R8XA 5ALSA 1SCUA 1H9CA 1NMXA 1P7YA 3JRXA 4HVTA 5C4IA 3BRSA 2GJAA 2HWKA 4ZXFA 1C7IA 2CCKA 3NHUA 4WGFA 3DCNA 2A59A 1ZD8A 4ZU3A 4ZJZA 3LHDA 2XUJA 1QRSA 1RFGE 4P22A 1XRJA 4ICIA 4MCAA 2IBMA 4QDXA 4S04A 1XHLA 4UD6A 3PVCA 1KJIA 1HNWB 5EE1A 2J5XA 1CEEA 1CUFA 1QLWA 3W34A 1EWTA 1YR8A 3KM0A 5KYYB 3NUQA 3SDSA 2FCAA 4EX7A 1JG2A 2ECQA 2EJVA 4TGLA 5IH7A 2YJZA 4PQYA 4QJIA 3UG7A 3O8OB 3RFXA 4KQ1A 3AR8A 3SN6A 3IDFA 3ZE2B 3SYRA 3ZQ4A 3PHIA 1JQDA 2JFYA 3SYTA 4PN7A 3B38A 1Z7YA 4CFYA 2ZREA 4MQLA 3BE5A 2B92A 3LPAA 2HLDD 2J8ZA 2PFSA 5AKIA 2CZQA 3ITEA 5ER6A 4EUEA 2JIZD 1VKNA 1XTJA 1PUIA 2VC2B 1I0LA 3OI7A 4JI3B 3PRKE 3UJDA 3F4BA 4K6HA 4YMHA 2E5LB 1U3TA 3QEOA 3PVSA 2YYAA 2B1RA 1II8B 1U2GA 2HQOA 4PTZA 1YFJA 2BFEB 3GT0A 1MGOA 3LUPA 2G9NA 1YQEA 3K05A 2E4ZA 3EXHC 4D41A 5TMPA 3NETA 2A5JA 3HCCA 3SXJA 5KU7A 2JIOA 4XLLA 2ZI7A 3FYHA 3QPCA 4D45A 3Q8LA 3G5MA 1W59A 2G9RA 3KBBA 1JKJA 1SU4A 4ESOA 2XT0A 4RANA 3O74A 4UTVA 2B5OA 4HX2A 1GPKA 1QYWA 4ALMA 1E77A 1OE0A 3KCQA 4DJJA 4BO0A 5CLQA 4B3MB 2ICAA 1YVPA 1Y7TA 3W2IA 3RFVA 3D7LA 5IFLA 1IC6A 2OHHA 3DSRA 1KI3A 1XJCA 4QUAA 3N9IA 2HRDA 5HVNA 2PT9A 2R4QA 4H1WA 4IIVA 1UKCA 1WCIB 1A4XA 3AETA 1N0WA 3EG9B 3JASB 4FNMA 5E9QA 3FNQA 1EUQA 2ZT6A 4ZOLA 5KNDD 3EW9A 4LI3X 3OBBA 3BOSA 3E1KA 3ZCTA 2NZJA 2Z5FA 1SUPA 3CUTA 3PPXA 3RC2A 3G9QA 4BMZA 1V41E 1AQNA 1VJ0A 2FPGA 2QUIA 2XGOA 3ZWYA 3OJLA 2BEVB 3QPBA 3OJEA 1YZ3A 4OLFA 3FFTA 3WB2A 2IHVA 3S3TA 3K7EA 4MYRA 2QZ9A 1AZSC 5TPZA 2ZWPA 4ZHQB 4KR0A 1YFLA 1BDHA 5BQ3A 1O57A 3PTLA 2RKBA 3K9FC 1SMKA 2ZKIA 1K92A 2QMYA 4HLCA 1VLHA 1PFYA 4YXFA 3KQSA 2GFQA 1XJQA 1Y0BA 1MX1A 2FW1A 2O14A 3H2JA 1N5MA 5J5CA 3W2FA 7ADHA 3G2HA 4UUBA 13PKA 3NAMA 4EKNB 5CGQB 2CL5A 4IXWA 3AP1A 3QVKA 4ZVRA 1UPCA 2PMFA 3W2GA 2L42A 2HA4A 5EQTA 1NATA 2YY7A 5AXAA 1F5SA 1L7DA 3I9OA 1DADA 5HFAA 2ADFA 3C45A 2GX6A 3UPUA 1QGUB 3C8DA 4W7IA 3V9PA 3IUNA 1IJFA 2DH6A 3OLVA 1SA0B 1YQ9A 3QXJA 4M21A 2B3DA 1P6QA 3H9JA 4W7SA 4Y98A 1YJQA 3OX2A 1T2CA 4GZMA 4XD2A 2REBA 3ELBA 2FZLA 4GGMX 3EN0A 3RREA 4BQOA 2VUHB 4C1BA 4DLWA 1E1QA 4XGNA 1JEOA 4Y9SA 4YRRA 6NULA 1QHEA 3M6IA 4OGGA 3J7AC 1GN9A 3DB2A 2QLMA 4II2A 2OR3A 2ZBRA 1CB0A 2ZSKA 5EEGA 4C0HA 5I4IA 1DQPA 4KH0A 3ZTTA 1OTYA 2ZRIA 4DZZA 1ZVQA 5KVAA 5TMBA 5JY1A 5KYYA 1MEOA 1AKMA 3IDAA 3O4FA 4M8SA 1J0DA 3T9FA 1XALA 4AUMA 4LJYA 4F9EA 5JSHA 1XZIA 1QGZA 1XQVA 2JJ2D 3KFXA 5EHIA 1KNQA 2JEZA 3SS7X 3EULA 3MINA 3ZIDA 1UBLS 3CNLA 5D86A 4F46A 2J3HA 1M2OB 2JFQA 1SD5A 4TMZA 4DEXA 1LTQA 2NNLD 1ZP6A 2QD2A 1OXMA 1PNTA 4R1PA 4RF3A 4CLEA 1CEXA 5EXPA 3DXYA 4P4UA 1M2JA 1JPNA 2JW5A 3DE2X 2NUTA 1S3IA 3QVLA 3F9RA 2OEPA 5AW9A 5GOZA 2JCGA 2C99A 3ETGA 1NVVR 3PPWA 2K87A 4I9GA 5IBPA 4F85A 3HO1A 3R1IA 1HDCA 3GRCA 3I1IA 1LVGA 1TRHA 1J0EA 1Z12A 3D6FA 2NUPB 1NXVA 1OXSC 1V6AA 3MWJA 1V5IA 4K05A 4OA5A 2IHUA 4MJXA 4Q6WA 3I28A 1RLMA 3B6MA 2FDRA 1NVDA 5CGZA 3LTEA 3EOZA 4LRYA 2F6RA 3VOTA 1J09A 3D3WA 5FQNA 4BCBA 4ZI2A 3ET5A 3V6MA 4PYIA 3ED5A 5TMDA 1D4ZA 3UJ8A 2FWMX 5ESWA 2WF8A 4EW3A 2YJTD 4GPEA 4E51A 3C43A 2AFIB 1AUXA 2GYWA 4NG4A 4F4HA 3NHAA 3CX6A 4TYQA 3FNIA 1RAFA 3D3JA 3KJIA 1O77A 4MRRA 2GERA 3AFMA 5DLYA 5M7EA 4WBNA 2ENUA 4H15A 2N1MA 3EEQA 3E27A 2B8TA 1Z17A 1ODFA 2OWEA 3DE7X 4MR7A 1TGYA 5EWMA 3ZN2A 2WWGA 4DBVO 3K9QO 5JZOA 3VKGA 5B6JA 4HNTA 4DRYA 1LKZA 1VL1A 1MJ5A 1ORHA 2ZRHA 3KEGA 1ZU5A 1OFUX 4L8LA 3AP2A 3CKYA 3L4SO 3GLFE 2WHPA 2VNKA 1ZNQO 4G8JA 5SY9A 4OMUA 1D2HA 1MA3A 3ANSA 3AUYA 1BWQA 2AYXA 4UDYX 1XNGA 4UCFA 3EEOA 2VQDA 2GN2A 2I6UA 1NJ2A 1IN5A 5T4BA 1Z5UA 5FUWA 1GV1A 3CPJB 1IXRC 2X19A 4FYYA 1DINA 4KRXA 5LBIA 4DV5B 4G65A 5DCUA 1Y9ZA 2F2TA 3DHEA 4CMKA 3B1WA 5KX5A 3U7RA 1G8SA 4GMKA 1VJCA 3KVNA 5HA5A 5ILGA 3ZWMA 4C0XA 5B55A 1O97C 3L0CA 4JAVC 3QKTA 4RDCA 4UBNA 5IN5A 2PUCA 3U6BA 4A4DA 2WAAA 3LIPA 3LDGA 4WIAA 2EKDA 4HMOA 2HKIA 3T0GA 3D2LA 3KHUA 3T61A 1TE2A 1AV7A 1CUEA 2J67A 2LCFA 4L2IA 1Y1QA 4BE9A 3DT8A 4PG4A 2LBPA 4QL3A 1V3UA 1PV2A 2HLNA 4J3FA 4MV5A 5JZMA 1T24A 1TC1A 5AYVA 1LW6E 2UZ0A 2PUVA 3T95A 5FPKA 4HWOA 3TRJA 2ZI4A 3MVEA 4WLUA 3UCXA 4BMYA 3KUDA 3S8YA 1M74A 1MP0A 3CWQA 4EELA 1C14A 3IP8A 4DFDA 4P08A 2DPHA 3CNOA 1RWMA 4TWJA 4O5OA 1BSVA 4RESA 1UXOA 4HAYA 4Y1RB 4YV2A 1RXWA 1Q21A 3NT5A 1UMBA 1OAKA 3KOOA 1E9BA 2BFCB 4FGSA 1VFPA 5CK5A 1NV9A 1M9NA 1UBHS 3JATA 4FT4A 4AJPA 1RRPA 1MB4A 4QDJA 4GKAA 3HB7A 3L9XA 4H17A 1JEJA 1Y3AA 1SXJA 1DKPA 2G0NA 3HFRA 3KYJB 2FWPA 4HDQB 4ZICA 1KRXA 4YMSA 1NNUA 2AQKA 3V7NA 5A6VA 3IIMA 4G85A 2MYTA 3IOCA 2FPWA 1MF7A 3CKKA 4KNVA 1XLUA 1MPXA 2FV8A 2GK7A 3CLSD 3PVZA 4IR7A 3SHWA 3H1EA 5PGMA 2DHCA 3QHQA 5IFKA 1IN1A 1G8JA 1UJ6A 2AVNA 4R51A 1WXEA 2EWMA 1CY6A 1RHUA 1GG2A 3GPCA 3I4CA 1OXUA 3LLMA 4Y18A 5CM9C 1BD3A 4BFXA 4LJAA 2ORIA 3KSMA 4XDZA 1URPA 3R74A 5BVGB 1Y9EA 2OD9A 1V47A 3PUKA 4G0XA 1AMNA 4ZZIA 4ENRA 3A4MA 3KVVA 1JIVA 1GQ2A 1I32A 3NALA 1IM5A 3OJWA 1BVRA 4WESB 1J1UA 5JS1A 1FL9A 1EA5A 5EPUA 2N0SA 2J45A 1Q17A 1C0KA 3H5VA 1W44A 2KW5A 3LY9A 3Q1LA 2EL9A 4GVXA 3W05A 3C97A 3EVCA 4ZVUA 1J9ZA 4WJLA 1X1BA 4PLVA 2HREA 4NOLA 4EI7A 4MYTA 4JVMA 5HGJA 2ZPTX 3CH4B 3L02A 1BD4A 1WW8A 4DV2B 1G7TA 5GZ6A 4E03A 5BSMA 4MYHA 4QWMA 4QUJA 4GSYA 4OMDA 3QNUA 1I3MA 4FNAA 3G0OA 3JS5A 1M2GA 2OL4A 5DK6A 1KXZA 1UBEA 3F49S 2QE7D 5KTSA 2O23A 1OLSB 1QH1A 3AEKA 2AEFA 4ZN6A 1Y9DA 1YVUA 1AQJA 1NVTA 1A9SA 3VPGA 1EK0A 4ATNA 3WGIA 2WJGA 3DFKA 4DRXB 1XTZA 3X1ZA 4I9FA 3L06A 5KJ6A 4OJTA 4P4GA 3O8DA 4B76A 4ZIRB 5CB8A 5JD6A 4Z4QA 1N5OX 1NR1A 3O6VA 4EF4A 1YS6A 3GDHA 1QQTA 3L79A 5JYDA 4PPQA 1MRNA 1NW5A 1WU7A 5L3QA 3UKOA 1A2OA 3FPCA 4WLNA 1ENZA 2WRZA 2GUGA 4BMNA 2GR9A 4EQ6A 4DDMA 1H2BA 1DKUA 1VJ5A 3EIHA 2EYUA 1TAUA 2DPLA 3QG5A 2YWFA 5AH0A 3GZNA 1AXRA 4RMHA 4INJA 1Q7CA 2Z56A 5KQLA 4GMXA 4AS2A 3AQ4A 4IHJF 3O3CA 4K2HA 2CWDA 1WV0A 2CC2A 3JQGB 1V39A 4HGPA 3OZVA 2EG9A 3NNSA 1QLHA 1MW9X 4TRJA 4XZ3A 2AI2A 1GSAA 3B2QA 3WIOA 1ZN7A 3UUFA 1Z15A 2BE9A 3PNSA 4YMIA 1ZC4A 3UB3A 2OXEA 3DFIA 4K9SA 3VH3A 6REQA 1BGXT 1MT0A 1U7HA 4I9UA 4FCVA 4TLDA 3LXRA 5E4TA 2AI3A 4OXXA 3S1SA 1E18A 1QH8A 3DNPA 3MUNA 1G3UA 3I9JA 5H3LA 5KOIA 3EF3A 5JAUA 3QJYA 4FLEA 1RPAA 4R1OA 3H5NA 4OB8A 5LBUA 3V4PB 5DV9A 2J9GA 1OV6A 2HQ1A 2VJNA 3G0CA 4GVLA 5AM0A 4MVJI 3ID6C 3CJQA 3P94A 1TPYA 2AW5A 2CJXA 1TKBA 3RYIA 3ZK9A 4HXEB 1PR1A 2J9ZB 2NSLA 4KRGA 5BOSA 2XBLA 1P5HA 2EXXA 3KVRA 4FS8A 3VFDA 2ZB3A 3KYIB 2H31A 4U2DA 1X3LA 1G8FA 1RPNA 2EZ9A 2O5RA 2WIGA 3F8WA 3MM4A 4AYWA 4RPIA 4E5PA 2A5YB 5IM4F 4K6MA 4BV2A 1QH8B 4ZEXA 1FFHA 4W9NA 2XLCA 2VZEA 3UZUA 2GN0A 4LDPA 1JWBB 1B0ZA 1L2TA 2RGEA 4LEIA 4TV9A 1DC6A 2OZKA 4W5JA 5AD1A 1K7CA 3VVMA 1SU8A 3ZGNA 2JA2A 3VBCA 1AA6A 3KDAA 3DL2A 3RK1A 2HSDA 1MU0A 1Q1NA 3JD3A 5LJLA 3A1FA 5BW4A 3MS7A 2WT8A 2ZRAA 2CGEA 1T6ZA 4JMPA 2GRUA 3KB8A 3QLTA 1LS6A 4R0MA 4MRVA 2A78A 2W6QA 2PAAA 4EI2A 1AM4D 1VSBA 2FPXA 1ORWA 2BFFA 4D92A 3JCZA 2R6JA 1U7ZA 5BNFA 2IODA 1DDGA 3BREA 4O2BA 1RYNA 1PT7A 1G6HA 1JB9A 2J3DA 1F14A 4JSTA 3DKPA 1OI2A 3QWBA 1W5BA 1G3QA 1EGHA 4KRFA 2XRYA 4HNRA 4XGRA 1X7WA 3M6WA 3QU9A 3E2IA 3OZUA 2FWNA 4OJQA 4DA9A 4YUAA 5CCBA 2C96A 3RUAA 1G1MA 2HOQA 4MV6A 1WCWA 1KJZA 4U7GA 4NQRA 4ACAA 4ZZ1A 3QXGA 4K8OA 1WUYA 1SUSA 1VMKA 3HDHA 3F71A 4U9IS 2OCDA 5FLKA 3NP7A 1BGWA 1G21A 4O5AA 5CT9A 4GBJA 1PRYA 1OA1A 3KUKA 3OFVA 1NU8A 5ALWA 1U02A 3JWHA 5SZKB 3TH5A 5J59A 3QYAA 3SAJA 4CN9A 1ML4A 4QYTA 1L6RA 1HQYE 4O4HB 3N7AA 3I52A 4JXZA 3AERB 4B71A 2HMSA 1U4OA 1U8YA 3AY6A 3GEGA 3IHLA 1EVLA 3PQCA 4A9AA 1GDHA 1P0PA 1TLTA 1NUPA 3QXSA 4MGHA 2PUGA 1IMJA 1SVMA 1Q0RA 1ZJWA 2XQVA 4IZHA 4IJUA 3I6ZA 3GAZA 3MMZA 2C4KA 3VO1A 2PSDA 2Z08A 3E1GA 4GR4A 2L17A 1XFDA 3LO5A 4WDRA 1SBTA 3UMCA 3IV9A 3JWPA 4PIPA 2ORWA 3FMIA 3H16A 3SF0A 3T12A 1LV8A 3KDSE 5DN9A 2H4JA 4E46A 3CVYA 2F3PA 3GLKA 1E2KA 1SUIA 3GT4A 4H18A 3PIDA 1JH9A 1GTSA 2O2XA 4P2BA 1OB2A 2R8BA 2R47A 2VNIA 1YMUA 2CNNA 2VJDA 4QUBA 2AUNA 2CF5A 4KGDA 5LKAA 3IIKA 2XZDA 3CLSC 3DMYA 3N59A 1ZAYA 2XGMA 1TLFA 4OA8A 4L8FA 3SSAA 2MR6A 4J90A 4Q3BA 3RRZA 4WK6A 6AT1A 3F8SA 4A0HA 5JJIA 1GTG1 3NUGA 1X9GA 3E9DA 1EH5A 2OV6A 3OD5A 4Y6SA 5G1NA 1MFZA 3ZJ5A 1RXSA 2IZ0A 2XF2A 3C3YA 5C9ZA 2JBWA 1GL7A 1OYYA 1YZVA 2QORA 2V5AA 2WHEA 1L7AA 4WXHA 3AL3A 4D8UA 1W94A 5KB3A 3EC1A 1U8EA 2OBXA 3HE3A 4GRAA 4LVOA 1SVLA 2W48A 1OFIA 3JAKA 1AY0A 4JROA 5TDHA 4BYMA 5FBRB 1L8AA 1E2IA 5K05A 1S3GA 3RTBA 2ZSFA 2QMZA 1N2BA 2A1UB 3G9TA 3X2SA 3VR0A 3BH0A 1N7JA 3L6OO 1FJGB 1SC4A 4C5CA 4U02A 3OURA 2P8SA 5EL0A 5CBPA 3GGCA 3WLJA 2FQYA 4D4GA 4QEKA 4V0KA 1IN7A 1J8FA 1Z45A 1W52X 2CXSA 1NUAA 1OX5A 3IAXA 1L3BA 3DL0A 4RV9A 4B9EA 4DABA 1Y5LA 4C3OB 2C2YA 2ZE5A 4CQNA 5F4ZA 3NMUF 2ZJ0A 3GPBA 3PENA 4X00A 1KU6A 5DXFA 2DF8A 3TDKA 3GMIA 4OX9B 1GN8A 3WRXC 2V5VA 3CT6A 3AEYA 3KL2A 3BM5A 5LLSA 3AB7A 2ZJAA 1AKUA 3A4IA 4KQXA 1U2DC 1FNNA 3L0OA 5TY0A 2QVGA 2W8ZA 3FHOA 3K0CA 1TGVA 3KWMA 1H1DA 1JFFB 1P4HA 3PFBA 4QXRA 5IAEA 1WXGA 2WF5A 1QKKA 2ZULA 4AP9A 1SQ0A 1JHOA 1GZ4A 1Y7IA 2X8JB 3ENNA 3HJGA 4M86A 3MT9A 4I4NA 4Y9DA 5HF6A 4BFTA 1USGA 4BN0A 3PEFA 3TMKA 3QA9A 2RHLA 3O47A 4AP6A 4HX5A 2HXSA 3VKUA 5BPHA 2NZ2A 4KO8A 1ICEA 4ZKEA 3ABIA 1T0IA 5MN4A 2OHVA 2VEDA 3R7WB 5J4YA 2Y1LA 4F5EA 4XUCA 3DFMA 1WB4A 3U5ZB 1EGQA 1EK6A 2QLJA 4DDHA 1XTKA 3ROXA 3K9CA 4BO7A 2HK7A 1SZDA 4ND8B 2H1LA 1Y89A 2WKRA 4HNUA 3B48A 1LQ2A 3A36A 5GPBA 1P60A 4QT4A 5B3KA 3T5PA 1LBEA 2BR5A 3UNXA 4NFSA 3OKFA 3QY9A 1N0HA 4J6EA 4ARVA 4DJEC 2I4IA 3AUFA 3FKSD 1P2TA 5NLLA 5HIAA 2WHRA 4M1KA 1TVCA 1BMQA 2FOLA 4L7QA 3I4FA 2DQ4A 2GEFA 4HGOA 4IKOA 4QDOA 5JJBA 3UJCA 4FR5A 2UXCB 1LRKA 2VTKA 2RGBA 1JIQA 5DBFA 3P9YA 1IHOA 5FOVA 4AG3A 2FFBA 4HVLA 1JT9A 4TWIA 5CDFA 2GKSA 2Q8QA 3D6UA 4BWFB 1O5OA 1SQ5A 1CJBA 2ORVA 1A7UA 2VATA 3CE6A 3OE7D 2Z4TA 4IIJF 4M1YA 5DHPA 3WY9A 4AQ7A 10MHA 3K1AB 2HX1A 2PKEA 2UVQA 1K6MA 1J8DA 3DGFC 4R3NA 3VHLB 4F7WA 2CJWB 4FKMA 2FRVA 5FBKA 4EHAA 2D5BA 3M6UA 1EHIA 4CUKA 5EIHA 1L5QA 4N5LA 3W6PA 1PYOA 4WOJA 1IHPA 1Q3KA 3BXZA 4AXXA 4D97A 5CA0F 5JECA 1TO1E 1TMKA 4G24A 5DM1A 4WKCA 4ZRNA 1Y3BE 3OUZA 5CYGA 1K89A 4BVGA 4NBLA 5BV7A 2ZZMA 4HJXA 4GL4A 2OCKA 5A9TA 1NVVQ 3RVSA 1I13A 2IIBA 2VP4A 3I0NA 4O4LB 1NVBA 3FPEA 3M6FA 5DEOA 3RVNA 2P5SA 3H0EA 5D01A 5CDSA 4K9QA 4CIVA 2XKAA 1S5PA 1T9DA 4XGKA 1QIEA 2I3AA 3BFKA 4GGOA 4E13A 1G8AA 2O0JA 4GX2A 5KOHA 2GDZA 1J0BA 5L8VA 3ZE1B 3BEOA 1J2RA 3HJRA 3SDBA 4YT4A 4G0QA 1G8YA 5AWFC 2YVUA 1ZGJA 3N2IA 4Q82A 3LP5A 3R8CA 3ZLVA 3GLHB 3BTVA 2QD3A 4ZIRA 5CTJA 3HVKA 4X90A 4GPAA 4JT2A 1NQWA 1L5FA 2I22A 2OQIA 5DO9A 5A7GA 4L8WB 1JL3A 1RI3A 4W9NC 4EJSB 3PJEA 3GRYA 4AS3A 4RD3A 1CR1A 4YJHB 1VBMA 4ZYYA 5AO9A 5C3MA 2C2WA 2R5WA 1UODA 2QGFA 3BERA 3OQ1A 4TMFA 4JCCA 1O4VA 4U7PB 4RVUA 5T41A 2VJPA 4FLFA 3MJEA 1NM5A 3RS9A 4GLLA 1NPYA 1Y7HA 1W5TA 1JFLA 2LVBA 2DTEA 1PZFA 4NFYA 4GI1A 1GR1A 1QV6A 1Q22A 3P0IA 1QONA 2YN0A 3FF4A 4WBXC 4BAUA 2X0RA 3SZMA 2X2PA 4PLGA 4PINA 3L0BA 1J25A 5AKLA 4F71A 3ISVA 4KG7A 5CURA 3FTCA 1UWKA 2Q3DA 1QFZA 4HB0A 3CRW1 5HTOA 3IBFA 2X3YA 2VA8A 5LQJA 3HU5A 2WIKA 2YVAA 4URFA 1H5NA 5DJ5A 2C1EA 5KSZA 1C4KA 2P9HA 4M9SA 5J5AA 1L1FA 2F3RA 2FUCA 4CIDA 4Z4HA 1IH8A 4TRRA 4OGKA 3JD4A 2W93A 4YHBA 4UXHA 1N7HA 3IRUA 3WYBA 1WUKS 5C1BA 3EC2A 3Q9UA 1GPMA 2AQ8A 3SCZA 1J0CA 1Y37A 2GFIA 2HYIC 3KQQA 4DLZA 2H0QA 4Q1AA 4G0YA 3U3XA 3HVHA 3OESA 3RRNA 3KUUA 3JVUA 3RWOA 3MTIA 3HXMA 4A91A 4H3HB 2YJGA 1A72A 5G3YA 4LX8A 1Q3HA 3BMXA 1S2MA 3K15A 1JR2A 1JE1A 4YI3A 2Z98A 3QW4B 2YZ2A 3I9FA 2W6NA 3IIIA 5JFTA 3LBIA 1CQZA 4MS4A 2IXFA 3E15A 1JIXA 4JWKA 1Z7EA 3ROMA 1A1VA 3C6MA 1OLUB 2E3JA 4U6QA 1COWA 1P1RA 1GARA 5EMMA 3QVJA 2B82A 2TMYA 3CLRD 3R77A 4E22A 3D8TA 1XA4A 3WWOA 4EA6A 5A9SB 3HR8A 2XXAA 1UH5A 3PE3A 1FUYB 4CL8A 2FETA 3AR6A 3I76A 5T3YA 4UCWA 4DF3A 1OWOA 4HTAA 4DXHA 3NS7A 1QHIA 3H11B 5TJ9A 1POXA 1DV1A 1ZUHA 1UQUA 5FPPA 5CDFE 4US1R 2IUYA 1E9FA 3B85A 3HJTA 2D7JA 1C9KA 1W8DA 1UK9A 3CB4A 1PVOA 1QIKA 1NJ6A 3HBAA 5EE5B 5C8YF 1WY7A 3O0DA 4QOGA 5GZ3A 4NXNB 5AW7A 4MVWA 1SNYA 3K1YA 2IZOA 1SCKA 1BFKA 1U7TA 2VP5A 4U9UA 3U3JA 4HSGA 3WI7A 4ER5A 4QREA 1ZOIA 2UXDB 1P61B 2B8JA 3QOXA 1E63A 1EK5A 2GRAA 2PKXA 5FLXA 3LL7A 1L8XA 1KMCA 4IX1A 1DXHA 1G4AE 3U3RA 3L40A 4BQSA 3R0XA 1J2EA 4AG6A 4FEAA 4DEYA 1TJ4A 1JDPA 1GGJA 2WWXA 2WZCA 5GY7A 5T8KC 4DLLA 5B4VA 1JI0A 1YA8A 3L41A 4B32A 4ZDKA 5TQ2A 1AKTA 2XYRA 3BXOA 1G7SA 1FSSA 1NVFA 2UYGA 3J80A 1U6KA 4B6EA 4X7MA 1N5DA 2CL0X 2HEGA 2ZT5A 1UKBA 3LC1O 5CT5A 2CHQA 4B48A 4RA9A 2OESA 4IOJA 1MB3A 3FIUA 1E1KA 3P4XA 1XCLA 2WQZA 1M6WA 4DA0A 1H4SA 4YAWA 2H0RA 4BTEA 4MQEB 4PSDA 4L08A 1SULA 2B1QA 3ORYA 3LT4A 3EH1A 5AMXA 3JD2A 1JSRA 4H77A 1MOPA 3IR5A 3Q11A 1HWYA 3ZX5A 4N76A 2RGYA 4ALIA 2XZOA 3F2VA 4KXLA 3ZK7A 3G88A 3G3EA 1ILWA 2W37A 2FEPA 3I58A 1VJGA 2FEWB 3RSOA 3X0DA 3GROA 2IXGA 2Q0XA 1V8FA 4MTLA 2QSUA 3FVRA 5AVVA 1CIJA 1MRSA 3MTEA 7AT1A 2C94A 1PG5A 1X7GA 2DHQA 5BSUA 4IRUB 1JJFA 5H16A 1XMOB 4Z7NB 5BYJA 2H51A 2B36A 1XQ6A 1B8NA 3L7MA 3WVNA 1XG5A 1DAGA 2OAQ1 1T8PA 3UTDA 2OGZA 1Y3DE 2AEEA 4KGXA 4MK4A 2IWRA 1H6CA 1JALA 3MYRA 2LCIA 1GTVA 4EQZA 1IHDA 5T4HA 1HGXA 4L6IA 4Q4HA 1FTQA 4FFOA 3AL2A 1AHNA 3OWOA 4KLZA 4DMCA 5JSZB 3CRZA 2VJYA 4K87A 1CY1A 4HGYA 3BWMA 3OM1A 3R9WA 1ZWLA 4AKSA 1NG1A 1DCFA 1VI5A 1GKKA 1Q7GA 4XIJA 5IEBA 3W90A 1B1CA 3C3DA 2TMGA 2GXQA 3M4ZA 5AKYA 3R0QA 2QHXA 4MGEA 2HGZA 3AB8A 1RQ2A 1N9GB 4G5RA 2BI8A 3NP9A 1T3ZA 4EF6A 1H94A 1MGPA 1Q0ZA 3FYUA 1EGMB 1WDKA 4RELA 2QG9A 4HTFA 2IZ6A 3ENQA 4DV7B 2ZSJA 3ADPA 1XVVA 2VF7A 3N2ZB 3ZH9B 3QV2A 4PHHA 3AFIA 2EL7A 1K3TA 2OXFA 3UHAA 2P0YA 3KQOA 2M9MA 3GZTB 1EUDB 1OJLA 2BAGA 4HQ0A 3L4BC 1OPRA 1E3LA 5IVHA 2IDZA 2AZDA 3GXOA 2WAOA 3PD0A 4KOAA 4L50A 5G0UA 2PKRA 2HYDA 4G0MA 4H6WA 4R16A 1U8ZA 1ULHA 1X7ZB 1T2VA 2I6SA 1X3SA 3L7IA 4QSMA 4AY5A 4JDUA 1RRKA 4WOKA 3CX7A 3HKBA 1UMBB 1BN6A 2PANA 5GJCA 3MIIA 4L5JA 4V0LA 3ZV6A 4RADA 1JLHA 1R6DA 3K09A 5ITVA 4QGSA 4L76A 3IBSA 3RIHA 2QLBA 4BVFA 1VSVA 4E6PA 5HILA 3OHMA 4RWEA 3SZRA 2ODNA 1LWNA 4YP9A 5A5EA 1HE8B 3CISA 4RVNA 2GAJA 1Z47A 1GAEO 4NU5A 5G2OA 2Z6AA 2ORYA 2ZUEA 3A58B 3QW2A 4OG2A 1VG8A 3IT3A 1LI4A 2P11A 4M53A 3SBXA 2XI4A 3MWGA 4MWEA 1DWPA 4KWTA 1VHLA 1YE8A 2FHPA 2QRVB 3WK9A 4BX0A 3GFRA 3OBIA 1WCXA 2SNIE 1ADFA 3QLJA 3G8YA 4KO1S 4KQHA 5ITZB 5AXCA 2Q28A 5EGSA 3DA8A 4JI5B 4C6TA 1CUCA 1DIRA 2G1UA 4D9CA 3SI7A 4IUYA 4QPJC 1SG9A 1W46A 4PFSA 1YR6A 2B37A 4UCQA 3H8JA 2JL1A 5IZCC 5C0OE 4REMA 1EK2A 2A0FA 1K75A 3E18A 5TSDA 3DE5X 1T6XA 1WU8A 4Z51A 1TAQA 2P9YA 3L05A 4KK4A 5IAGA 3VKFA 3BWDD 4ZYWA 1L7EA 3CSSA 1BH6A 4MWOA 5A62A 1ZX1A 4ND4A 4RLSA 1P19A 3SKVA 4IUBS 2P78A 1PO7A 3WHKA 4NE9A 1HE5A 1TEHA 2JIZA 4NR0A 4H60A 2JPDA 4LCEA 3SLGA 3GJSA 3E9YA 1EXDA 1NLFA 2DT8A 1FDIA 3VHXB 2EOAA 1H8ED 2WDZA 2J0UA 4BFSA 3RYCA 4GNRA 3W1VA 5BN4A 1Z2OX 1M0SA 3UJHA 1AE1A 2QTTA 1Z13A 3DTYA 3JQAD 1K2WA 4EYOA 4F96A 5J43A 1U0HC 5JNWA 1YTUA 4F1KA 3LV8A 4HPXB 5BXYA 3WDLA 3D1LA 4HNAB 2NU8B 4N18A 1D6SA 1EINA 1GQYA 3T1HB 5BURA 1TYEB 2QJRA 4FS3A 1RYMA 2IYAA 2OBMA 4YFYA 3D4PA 2QENA 3RSSA 4MKRA 1A77A 3SOPA 2X8JA 4OQDA 2MSCB 5IASA 5DNUA 1JQ3A 1T8YA 3M1IA 4KKVA 5EUBA 1I2AA 2FSFA 2YWJA 3IHKA 4DGQA 2Y6UA 2FPIB 4XPIB 2ZAIA 3ENKA 4MI3A 1EJBA 2JI9A 1MD9A 3OO1A 3VZCA 4EPTA 1WDLA 2OK8A 1YD7A 2VDJA 3VOBA 4FYHA 4NP6A 5B6IA 2X7XA 2DFDA 2QMUA 2IHBA 1CEQA 1E60A 4EW2A 2A0WA 4AWBA 3AF4A 2YRXA 5ADHA 2QRUA 1F2TA 1ZNYA 4DCUA 3DUWA 1FNSA 2YWCA 3IP3A 2AWOA 3HDYA 2C5BA 2H06A 3KJZA 4TZTA 5COAA 3W8DA 2B8NA 2CV0A 1M54A 4JQZA 1K8RA 1JWAB 3F5SA 3KXDA 1IVYA 1RAIA 4FMDF 4G23A 3S99A 5J5VA 1OTXA 3U0VA 4GNKA 5TGDA 1KOJA 1OXTA 2G72A 4NJMB 3S2EA 4DCVA 3FMPB 2C57A 4P98A 1NVAA 3LK6A 2QX4A 3IBCA 4WA7A 3P9RA 1BCSB 5F3RA 5ECWA 2GTIA 5DBEX 1Y8QA 4DLXA 3OU2A 1RC8A 3TSOA 1P4GA 2P5YA 4RD6A 4WOBA 5H83A 5IJ0B 3E8SA 3A9VA 3IHWA 4MV1A 4YCJA 4DGSA 3BRWA 2RAUA 4J0FA 1JHQA 5TX7A 5AIBA 3PDIA 1SVIA 2ROQA 4DDTA 5AJYA 2ZEJA 5KYKA 3HDQA 5HBGA 1G0OA 3OPYA 2DUWA 2XUIA 4TTQA 1NC3A 2R60A 1OYOA 4N3NA 1U9ZA 1NU6A 1YCHA 1ZESA 1JHUA 1HO3A 3A1SA 2OYRA 4JI8B 3MFQA 5HMLA 2HADA 2UZAA 5FBHA 1TAGA 4Q39A 1F8XA 2BOVA 1O94A 2F1IA 4QAJA 3K96A 3DBHB 3PXEA 3IKLA 1XTVA 2BGKA 5ELLA 5DN6D 2CDBA 3P9ZA 1ONSA 3EC7A 4R1SA 1AKWA 3ROZA 1FW6A 2YJ6A 3BQMB 3HXPA 4H4DA 2I1WA 2BI7A 4N3AA 4K6KA 2R9VA 2VNHA 5EIAA 4ON9A 1E92A 1VGQA 3OZXA 5AKHA 1D6JA 1G8GA 4Q7MB 4TLMB 3FGZA 3OE4A 2OFOA 3W5IA 3BE4A 2JLRA 1RYDA 3LP8A 1QBGA 1KKLA 4NK5A 4R2XA 5B58C 3DPIA 3QE9Y 5K6AA 3MCUA 2XRZA 2R00A 3COWA 3NOQA 1NRWA 4M9XA 5BWMA 1UL1X 3AKYA 2IOQA 1HDXA 1WBBA 1JLMA 1JHPA 1H3NA 3G2OA 5EKSA 1A7JA 1XROA 4X3CA 5B3LA 1E6LA 4UNQA 1F17A 4HWPA 1YB4A 3WGLA 1U6JA 1TO6A 3QGMA 2YOHA 3FTQA 3VAAA 2QP3A 3W2HA 4J94A 4UZEA 3SX4A 4GHWA 1UEXC 4DZRA 5J1SB 4LF4B 3LZCA 2INGX 3NDRA 5HQ3A 1M33A 1T6BY 4ME6A 4BGEA 5BNTA 2WWVD 2Q5QA 2IS6A 1P2SA 3V4OA 4WVLA 3VZRA 2RGNA 1E3WB 4YMWA 2R85A 4YA6A 2X1MA 3AUTA 4D9FA 4TWRA 2NXCA 4GBGA 1DIAA 2JNWA 3QV1A 3L01A 4IRXA 4RK0A 3ZS8A 2A1UA 3R3UA 2IRWA 3K4HA 2CE7A 2HMYB 4EJSC 4O8ZA 4EB3A 3HDVA 1SVNA 3E84A 1O6FA 1OUMA 5C4GB 1L7OA 2ZB8A 1G41A 1HETA 4XCQA 4I3HA 1SKYE 3R8FA 1VMIA 3F5FA 2P9BA 1OF1A 3VPFA 1GT6A 1IYZA 1CJMA 2Z58A 1NMQA 1KSGA 5CR9A 1SM4A 1O3YA 1P7CA 2V4MA 2SHKA 3BBPA 3DMTA 3FDJA 2EFGA 3KKMA 3JPYA 4IYJA 3CUSA 3AFGA 1D4AA 2OBFA 2EFCB 3TW8B 4CKEA 4BO1A 3GGPA 1J8QA 3HCBA 4FD3A 1M8FA 4BLTA 1W48A 4TMVA 1Y6RA 3HKEA 4Z0NA 3SFTA 3WQBA 3UEOA 2VJCA 1YL7A 2J4DA 3WE7A 4D42A 3AXSA 1E3WA 3AHCA 3U3KA 3HBFA 5JU6A 3BHNA 3RG8A 1RZUA 1A9XB 1Z3CA 3WL3A 1X8KA 1A96A 1KRHA 1ORRA 2IPOA 1A4UA 2SKDA 4TTIA 4LGYA 4FB4A 5EP1A 2P40A 2VHQA 2EFEB 5MDHA 3AOEC 4FHEA 3ZZMA 1KAEA 5H02A 2FR1A 2VAMA 4FFBB 3G5TA 2FQWA 4KFSA 1CJSA 2PVSA 5ADVA 2P2ZA 3LHIA 1ZMBA 3GX1A 4C6HA 4NI5A 4B2LA 5JSZA 3JSAA 1VB5A 4Z3OA 3F4KA 1OBCA 3LX5A 1PZHA 4DCOA 1MABA 1BS9A 2FUG6 1TVKA 2J5RA 2OMEA 1CDEA 3DDCA 2H5LA 2PSFA 3BA1A 3NU1A 1E58A 4XB2A 5ALYA 3OOYA 3ABRB 2XGGA 4FOOA 3OQ6A 3B1KA 3SQWA 1CK4A 1Z0AA 1KYXA 2BM0A 3NBUA 4OBXA 1UR5A 3HB5X 3W04A 2GD6A 4KWCA 2QX9A 1XVTA 2FSGA 1Z4IA 4IV0A 5DU2A 1MPTA 3TE7A 4EO9A 1L5GB 3I8SA 1QIDA 2GLTA 4J03A 3GCGA 5EQDA 5IDYA 3SEAA 2FJPA 1OMOA 4H4CA 2N47A 1LDBA 2VYCA 3QVSA 2Q4OA 4MRSA 4EITA 1GVNB 3GLIA 3K73O 2RE8A 1DHTA 2PS0A 3DV2A 1CR4A 4REQA 1QZ3A 3ET4A 3VR6D 4IIHA 2JAWA 2DFVA 3GJQA 3NAGA 3LVQE 3GF4A 2ZZNA 1E7WA 4N5NA 4F5WA 4IIYA 5BUQA 3ER9A 3RO7A 4QU5A 5L3QB 4MVJE 4JYBA 3ESXA 2XZPA 3HU3A 5BT9A 4HWKA 4CRWB 1VKJA 2ZK7A 2NU7B 2XRFA 4P9NA 1ZK2A 4WH0A 4BKPA 4ES6A 5JBQA 5LPNA 4HZGA 4AW9A 4BMSA 4RZSA 2GZRA 1ZBDA 3PNYA 4IM7A 1E4EA 4FR0A 1GZSA 2WDPA 3W79A 1DZIA 3EBOA 5AKXA 1U11A 4YGYA 5TJHA 5F2NA 4BEJA 4OHFA 3LCCA 5B3JA 5IVDA 5AJZA 4B6PA 1Y1PA 3EPKA 4HF7A 3Q0EA 5AVXA 2Z04A 3ADKA 3O7MA 3GA5A 4MUNA 3BMQA 1SVWA 3BG5A 1NIJA 4TV9B 2UYQA 4JK3A 1PE0A 5G0WA 3V8VA 2Q5CA 3BGIA 3G7SA 4JX9A 1EESA 3ZVMA 3MJVA 2Y92A 4L15A 1YS7A 4YDRA 2BGMA 3ONVA 5J4HA 3K0CC 1XZDA 2HWWA 1OFVA 2ZYAA 1CZUA 4OAQA 4Y6GB 3QNMA 4JBXA 4FHFA 1T3TA 3K2QA 4FFDA 4RCVA 4B47A 1MHTA 1ADBA 1ULSA 1STOA 2G7ZA 3IVAA 2XA2A 2CXXA 4R69A 3T9EA 1MHPA 2H1SA 2QRMA 2XVAA 3KT8A 2ZJZA 3GRAA 4DR2B 4M7WA 1DSSG 4IVRA 3ZK8A 2VTBA 1KFKB 2BDEA 3WO0A 1GZUA 3I9LA 5ELMA 5B3JC 3A2KA 2ZJ1A 1KHTA 2CD7A 2X86A 1JILA 4BGIA 2ZVQX 3RFTA 1FDSA 3W77A 4MITA 1DKOA 1SVSA 2AXEA 2HTFA 4I8XA 4ARSA 2NVBA 3G5AA 4A15A 1QV9A 5IH3A 2B61A 1JQAA 2VYQA 2NXJA 2XCUA 2Y68A 4AZVA 4CWAA 2BW0A 3CRMA 4MB6A 1GQOA 5COQA 3AU9A 2XE6A 5EKDA 4BLUA 2C5HA 4JVLA 1Y5IA 3OZCA 3F6YA 3AVTA 1C80A 4ZMSA 5ITZA 1C1XB 5K0EA 1CUDA 1WCYA 4LF7B 3H3XA 4D99A 1NTRA 1IJEA 4CDGA 1K6JA 2J9XB 3JRWA 1JMKC 3LXUX 2OSVA 4FNOA 4X66B 3FJOA 2A7XA 2BISA 2RK6A 4GDFA 1Z8DA 4AXBA 2ZGVA 5KCMA 4JA2A 1T1RA 2R66A 1KC3A 3HPRA 4AN1A 4Z6KA 3PNQA 4K86A 1KQGA 3V4SA 2G40A 3MILA 2RHTA 1HQKA 2HIHA 1JDTA 4QTZA 4HFJA 4X6UA 1KI8A 4G5FA 4B3GA 1E62A 2EG5A 3HUUA 3F97A 5B6PA 3TTYA 1GGMA 2BSAA 3WB0A 4WECA 3WWZA 1GCGA 1Y4SA 2D8MA 3WDSA 2BT4A 4CZ2A 1JR4A 5K3DA 1NMSA 2BGUA 4ZHQA 3VR6H 4P58A 1GD1O 3GJ4A 3F6RA 4D8XA 1ULAA 4RORA 4YIKA 1H3FA 3Q5EA 2H92A 4GOJA 2FRXA 3JSXA 5KS2A 1JBQA 1RQXA 1BROA 2PPVA 2QE6A 3HWSA 4C7KA 3Q85A 1NR5A 3ZDFA 2ZSDA 2P2GA 4HI0E 3G7NA 5K2OA 1DKMA 4X20B 1N5LA 3LT0A 4JXKA 1UT8A 1QPBA 2C5AA 3MMXA 2NX2A 2GF9A 1DTWA 1SGWA 4WN9A 5EP2A 4IZOA 3TS1A 4BNKA 3EGCA 1WHSA 4IQ0A 3O4HA 2TMKA 1NVUQ 2XA9A 4JIGA 4F3RA 1NW6A 3B1FA 1QUEA 1AUPA 2EBFX 3H2SA 5BR7A 1A9XA 3KT6A 4KDRA 4OHVA 3AHJA 3L82B 3YASA 3Q3IA 3HJBA 3VC1A 4PYJA 2OG2A 1ESMA 4RY8A 2PPLA 4UQOA 4UVDA 1KYVA 3FI9A 2R87A 2YASA 2H63A 4YDSA 1QSGA 2GPNA 4MMXB 2WIFA 4WXYB 2O2GA 5B1EA 1MOQA 2QG4A 2Q41A 3ROKA 4GOLD 4EJSA 4OQNA 1MZVA 3JQAB 3BGWA 4U5XA 3PDCA 4I14A 1UXJA 3WRXA 3DAFA 4CEJA 3GRUA 2CEKA 1EBBA 5DGXA 4GQBA 1L4YA 1DOZA 2YH2A 3DBHA 2YNMC 5ES4B 5FOTA 1PK7A 3LD9A 1ZXBA 4Z0TA 3GO4A 2ZYWX 1CUSA 1J1IA 5IT9A 4DY6A 1N1MA 4HNVA 2A0KA 2OYSA 4XX0B 2FWIA 1JQKA 2CEAA 3RUEA 1XTQA 2PK3A 1SHLA 5DCWA 2C29D 4KWHA 3TL3A 3DBOB 1ORDA 5EJ9A 2I62A 3ULKA 3D0QA 2VTBB 2EV9A 5IN4A 3NEPX 5BYAA 5KDOA 5LJIA 4G26A 2H85A 5HZKA 4O2BB 4QZVA 4UEWA 1NYRA 5KYXB 4FILA 4KQIA 3EF0A 4KXNA 3UAWA 4QTYA 2Q6VA 5IXYA 4ZO7A 4DREA 3WLFA 3QUSA 1ZL0A 3QUAA 3AQIA 3UH0A 1Y1SA 1NZFA 1DEHA 2AUTA 3UJBA 3QOFA 2VF5X 3WNCA 2FR8C 4EAAA 2W2PA 1MRZA 3A28A 2GF2A 1Y6FA 3KTDA 3E2MA 2AE1A 4R05A 4OP2A 4XWAA 3WGJA 1P75A 3ES9A 3MYYA 5AK3A 4K9LA 1XAGA 5A0TA 2POCA 1HL7A 3GEIA 3R5FA 4QXQA 5FR1A 1KVTA 3K9GA 5J2UB 2C0PA 1IQ0A 3AJDA 2ZT7A 4EPRA 4ZJYA 6GPBA 5BSKA 1P2BA 4Q4JB 1OAAA 4G1VA 3IOEA 3LPNA 2BHRA 3PGMA 1BEUB 1DWQA 3IXQA 2DM6A 3HYRA 2RI1A 4FE3A 3RSHA 1J24A 2C98A 1TNDA 2CLSA 2NSDA 4V0ME 5FTMA 4LOJA 1WM1A 1GZ7A 4YRLA 4QODA 1GR0A 3OTGA 1E2LA 1I4LD 1P4AA 2BHSA 1LDNA 2ETXA 3GD7A 4PGHA 4UZFA 1CS0A 5E2BA 5HPYB 1ZLYA 3E4DA 1FTWA 1NDQA 3RS7A 1KYWA 2D2XA 2Q6KA 2RB4A 1NLYA 4FXOA 4CQMA 4DEVA 3W6OA 3ZDCA 5HYVA 2XXAB 1RQPA 3H9QA 3RRJA 1S01A 2WJHA 3B5JA 3WQHA 1DELA 1FLDA 1V8PA 3IDOA 3VDNB 2FTKE 3K5HA 2YJ5A 5B53A 5ALVA 4BNDB 2JGNA 1EQUA 2AOTA 1WJGA 3TNJA 3MWKA 4RK5A 1ZW6A 1HR0B 1YS4A 1N2SA 3WLKX 1GDTA 3CVUA 1JG6A 2ZQYA 2EIXA 4OHPA 5HGXA 1QP7A 1JW9B 2ACKA 2NZYA 4W8GA 4G01B 3JV7A 2JHGA 1OH5A 1OLSA 1QH1B 2QE7A 1GGKA 2XB4A 1UBUS 2Y9PB 1M3SA 4FXPA 4JJ4A 4UASA 3T99A 1G16A 3TZCA 4LQCA 3H5OA 2IK8A 2VHTA 3KZVA 1K06A 3KDPA 1CJVC 3BTSA 3CPSA 2YQ4A 2B3TA 2D5LA 2H2FA 3EGEA 1JQBA 5BUCA 2P1DA 4O1IA 1RIIA 2D8AA 4WKGA 4UU0A 4CIXA 2X5OA 1QWOA 2FPGB 3WKAA 2X9QA 5IU6A 1M8JA 5CD9A 2I6GA 2D3TA 4A36A 3NHLA 2CY0A 3LGXA 1YAJA 3DEJA 4HN2A 3UATA 1OZHA 3O84A 1N8KA 1R6UA 1RHJA 2F1KA 4KBYA 4LVNA 2FDCA 4IX9A 2W2MA 4R2JA 1R6VA 2P9QA 5EZYA 4A1FA 1C4WA 3SHTA 4BO5A 4BECA 4RHUA 4OSPA 3HZHA 4L4ZA 2FA9A 4Q3DA 3TOXA 3ZY4A 4LVUA 1S8OA 2O1SA 3HSYA 4MYDA 1FS4A 2MSDB 4NDNE 1AJEA 4IF4A 3IOYA 3ABQB 1MJGA 4FOSA 5E95A 3IILA 3QA3E 1JHXA 1E1DA 4PFKA 4BX2A 3JQPA 1LK7A 4YV1A 3GLGA 2GGSA 5KWVA 3ESAA 5BO5A 4OHZA 2ILTA 2C2MA 4EWLA 2DQSA 3W6UA 1D2CA 1P1BA 2XITA 1ZMRA 4JB8A 4K26A 4CNQA 5LFAA 1QYVA 2IIPA 4BXOB 5JCXA 5JRJA 5JXHA 3BDAA 1XU7A 4LOLA 3EBPA 3F5QA 5IXSA 4I1PA 2EAUA 3STWA 3HXOA 4HQ6A 4B3JA 4IDHA 1XT6A 2X15A 3OPQA 1ETUA 1NT2A 4LDJA 2FMKA 2QDXA 3VGPA 4EGAA 4DLYA 1XQ1A 2FLVA 2VXYA 5LYJF 5BSGA 2HRQA 1U3WA 1X2BA 3DBRA 2OHFA 4JEIA 1ATIA 3EDMA 4KIGA 4RIIA 4ENVA 1W49A 1YCFA 2NIPA 5IT4A 3C70A 4YPVA 4HG2A 2OFWA 3GJ0A 4ZAGA 3OQOA 4ZANA 2BYTA 5DYTA 2ZJ7A 2IX9A 4Q0MA 3VR4H 4DXAA 2F59A 3AVYA 4EVSA 5KYWB 2VF4X 1X6VA 2X0KA 3BTOA 3IBGA 5DZSA 2RJOA 3I3SR 1O9GA 5LXTB 1VC2A 3H6KA 3LDUA 5ESXA 5DM2A 4B6FA 2O5CA 1QOPB 1QHGA 3HXKA 4S1TA 3ORSA 2OFXA 3I5MA 1A8UA 3K0EA 3OP4A 1YRQA 3NLLA 1BRTA 2R25B 2VTDA 4QNNA 3KWFA 1HA3A 1AK1A 1OYWA 2C59A 3NRBA 2WZBA 5C8VA 2G1PA 3EAFA 3B70A 4WVFA 1P17A 3THXB 2H2GA 2VT2A 3UAYA 5IJ9B 2I33A 4LY9A 3M8KA 1ENYA 3PFGA 3Q98A 1LB1B 3HRKA 2P77A 3PR3A 3S28A 3ZZTA 4UNRA 4D56A 5CA1B 3ZTYA 3H99A 1ESEA 3JRNA 3NHRA 4DAOA 2NVWA 4GC5A 4JL8A 1P2GA 1ZS9A 2HA6A 3A4LA 1K5GA 1YASA 2FZGA 3KLPX 4NAUA 4X41A 2I7TA 3T1QA 5BWNA 2RG7A 4IJWA 3OO0A 2GI4A 1ZIYA 2H18A 4ITVA 4CHGA 2IBTA 4B35A 4YV7A 4U2FA 4A0SA 2VPIA 4QJ3A 2RC6A 4R83A 4D26A 1R74A 1XL1A 4HBZA 1K27A 2MYNA 1I2MA 4BNDA 1Q7RA 2NO6A 4CPDA 2FRDA 3OQVA 1W76A 1VCNA 4FMBB 5MFZA 3QG1A 2I9PA 2XMCA 1BKDR 2CMDA 5K3EA 5HCIA 1N1GA 3OPXA 2GZ2A 2IEZA 2DRIA 5FL3A 5T5QA 2O1XA 1DX6A 5KQMA 5AP9A 1N1EA 1FDOA 2EQ5A 4W1QA 3N2EA 3H2BA 1DZ3A 1XDDA 2PO5A 4TXHA 5HTKA 3KPYA 4NNJA 3OVMA 3RK0A 1F60A 4DBLE 1PR3A 3NRCA 4TOIA 4K8RB 2PIAA 2Q5JA 4LYEA 5BSFA 5L7TA 3V4RA 1ES9A 2JKVA 2W6ID 2WMNB 1BOOA 2X1LA 4M0CA 2QIPA 3UGTA 1LXCA 2GWRA 1Z5GA 3I23A 4DLUA 1L4HA 5CH5A 4NBUA 4KVFA 2DBRA 3KAJA 2RARA 2D74A 3KZXA 1E7RA 2FPPA 3HO6A 4PRZA 5C2JB 1APBA 3NKFA 4L6AA 1X9HA 3OT5A 3MSCA 4QASA 4Q7JB 1O54A 4ZMBA 3WWEA 4ZVNA 3EYWA 4X64B 3EEFA 1IU9A 1X80B 3FLMA 3NONA 4GPTA 4NNPA 5CVEA 2J0EA 3RYHB 4E3WA 4FCWA 1V8BA 5EWMB 3AUKA 3GUVA 5JC8A 1JG4A 1SOAA 3O3NB 1VKRA 3PNKA 4OBBA 2GJSA 4GLOA 1VHWA 1A95A 3Q2KA 4G0UA 1GSHA 1F6DA 4LXXA 1C8LA 2IUTA 1ZGCA 2OKGA 2EU8A 3D6MA 2PZKA 3LGAA 2FP4B 3E70C 4MYUA 1PJRA 3CSDA 4DC9A 3WLLA 4ZC8A 3GCXA 4W5NA 4YAKA 2RH4A 4ND2A 4BAGA 5JNUA 4U3JA 2GEBA 2P4SA 1ZY2A 4NU6A 4TV8A 3GW8A 5GM2A 1VG0B 5D7BA 1XZMA 2XPCA 2C00A 1GPYA 3PZBA 2X5JO 2XTJA 4JLWA 3C1AA 3C3KA 2IPNA 2JK1A 3E8XA 5D5QA 3TL2A 4CG3A 2GEDA 5JNSA 2PS3A 3K6RA 1V7CA 4PVCA 3SEQA 4P38A 4MPRA 1HPLA 1VIYA 3V8BA 5LD2B 1SKYB 3FM9A 4M8KA 2M6LA 4ZT2A 4Q00A 2W6IA 3RS4A 3SBOA 5HS4A 2DECA 4DR5B 4O3MA 2B2XA 3DXXA 3ZWQA 5KTYA 1QTQA 2X8AA 3I64A 1KS2A 4TL8A 4UU7A 1ECJA 1JLLA 1WB6A 4WEQA 3NDBB 3UC5A 3KSRA 4ZZ0A 3E2PA 1U65A 3IAFA 4PLHA 2C7OA 2MSWA 2C4TA 3DMDA 4MP8A 4QU9A 3K4QA 3RC9A 1M66A 1MT3A 1Y9JA 2DUNA 1QKJA 4C0QC 1SVKA 2CVQA 3HA7A 3QKSB 3KVOA 2XYVA 2XYQA 4TLAA 1JDBC 4PYQA 3CCFA 1QAMA 4EPWA 2VG8A 1BDJA 4MH0R 2ZIEA 1OT3A 1RXUA 1DXOA 2YDXA 1E2JA 4MOWA 1HV8A 1HEUA 4G84A 3HKDB 4P3YA 4P80A 4EDHA 3N2KB 3U40A 1FUIA 3PS9A 4MKGA 1SEPA 2XDYA 1NXPA 5HE8A 1IJKA 2O0KA 2D5IA 3K0HA 1INLA 1C1DA 1FTNA 1PGQA 2WJ3A 1QUFA 2PO7A 2Q4BA 3AF0A 4ZZ3A 2JAUA 2AIRA 2PKQP 3SSMA 1NNLA 2UZIR 4RY2A 3B3FA 1YKSA 2ZITA 1GUFA 3D8UA 5I7HA 3CWCA 2MIIA 3KB2A 5I4KA 5JAZA 1X1AA 1U8CB 4GDMA 3S4YA 2VQFB 4L0DA 2ZT8A 4PHFA 2Z83A 2P0EA 1HBJA 5DYNA 3PJRA 4B7ZA 3GEEA 3P2IA 3PNPA 4Q9LA 3PYMA 4DNXA 3FTEA 1WUJS 1K0UA 1K6XA 4GPZA 4J0KA 5KYXA 1JIKA 3HN2A 1E3TA 1PJ2A 2FDXA 3VQTA 1RFLA 4YAFA 2AJTA 1KI7A 1FTYA 1R6BX 3P4YA 3T3HA 4D8VA 1O6BA 5BV1A 2X2EA 3PZRA 4XSHA 2CB9A 1KSJA 1WF3A 1Z83A 1TZJA 2BHNA 2Z4RA 1XDGA 2ZLBA 4KAFA 4M0EA 5EYPA 2ZRQA 1WSBA 3M33A 4NOJA 3WK6A 3AI3A 4HAVA 3ZHBA 3VA7A 1I2CA 3EODA 2R7LA 2VJAA 4JA0A 3TW8A 3UH1A 4TTPA 1PV4A 1VP3A 2ZQ5A 1U0JA 2F1OA 1LNZA 3H84A 4KQEA 1ANKA 1SELA 2OZEA 5BT8A 5KTRA 1XDZA 3OZRA 4BJ3A 2XVMA 4JJIA 4QKQA