1DOZA

Crystal structure of ferrochelatase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords FERROCHELATASE
total genus 118
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dozA02
2QD3A 1AK1A 1N0IA 2H1VA 3HCRA 4KLRA 1TJNA 2HK6A 2HRCA 1C1HA 2XWQA 3AQIA 4KLAA 2Q3JA 2H1WA 2Q2OA 4CCSA 2QD2A 3GOQA 1L8XA 3HCNA 4KLCA 2XWSA 2JH3A 2XVZA 2AC4A 2XVYA 1HRKA 3M4ZA 2QD1A 2AC2A 2PNJA 2Q2NA 1LBQA 2XWPA 3HCOA 4KMMA 4MK4A 4F4DA 2QD4A 2DJ5A 2QD5A 3HCPA 3LYHA 1QGOA 2PO5A 3W1WA 2HREA 1LD3A 1C9EA 1DOZA 2PO7A 2C8JA 2XVXA
chains in the Genus database with same CATH superfamily
5LM3A 3VO9A 3QTTA 4DAOA 5AK5A 2Z0MA 4IOLA 3NM5A 4XSHA 5IYZB 2FMXA 4OJQA 3SS7X 4CLRB 2JA1A 3GGPA 4GXTA 5HCUA 1DKRA 3WBKA 4DLYA 1DEKA 3H8SA 1W1WA 4PAGA 3ZCPA 3PXCX 1QK5A 1L7EA 4OQYA 3B1YA 3RYCA 2BCGY 3ESDA 1GGHA 2JC3A 1ZNQO 4QDTA 2NQ2C 3TF5A 4CDGA 5LR6A 1JLLA 3ZHUA 4F93B 1GPLA 1X77A 2OSVA 1YUNA 3A1WA 1NT4A 3NRCA 3PPYA 4HDMB 4Q66C 3VYSB 4N39A 4ALNA 3TX2A 1OFTA 3FWNA 3N6RA 5LQKA 2PUFA 3Q12A 2VUHB 6LDHA 3OD1A 3HMKA 3MJRA 4I81A 2Z4TA 3AHGA 3OEHA 1P4GA 4P53A 4DNQA 2EKDA 2I6GA 2G63A 1DOAA 4AU1A 5I7UA 3QQPA 1E0SA 2OZLB 2WSSD 1N2JA 4LYAA 3GLFA 1SU8A 1BQ3A 1SG0A 1HTTA 1V9LA 2FGJA 2XUAA 2V8OA 2YS7A 3N5KA 5BYAA 1GDTA 2QGFA 2WE7A 4WOKA 2ZVDA 2PZMA 1RQGA 3HO8A 4GNRA 1JLLB 4ZYUA 5B6IA 5JNVA 1LV7A 2FEKA 4P0TA 4BQSA 4P0PB 4L9WA 2XEXA 1Z7BA 4D44A 2QLJA 4MTLA 4LXXA 1OI4A 4BCDA 4Z9AA 4WXRA 4PZ9A 1P0QA 1NXQA 1H8HA 3K1JA 2J5RA 3H0KA 2V6IA 3N2LA 3VZDA 2HPHA 2AOUB 3LQ4A 1M2WA 4A8JB 2QMYA 5ALZA 1XTIA 4C1NA 2XGGA 5LKAA 3ZTWA 2B1RA 4KQKA 1SVWA 2IBMA 3KZVA 3W6PA 2OZLA 1T1IA 3IJPA 2B1JA 2P40A 2DEUA 3FOBA 1EFRD 1KIMA 4EX7A 4HWGA 2A35A 1B14A 2DKOA 4RELA 5F1YA 5KQSA 1HE2A 3EPRA 1USWA 1EFVA 2XA2A 1QAOA 2ZBGA 3M9LA 1Z18A 2F8MA 2IHUA 3LZDA 1W5TA 4O4IA 2GZHA 2QIPA 3R6TA 3PRJA 1XDGA 5AW6A 4GOND 3BWCA 2VSQA 4BV2A 1OLXB 2GI4A 1HMPA 3KWFA 1X7ZB 3QX3A 4ESEA 3JQBA 4JGIA 3AHFA 2V59A 1JU3A 1W5FA 3RRZA 1TK9A 4IICA 1L5MA 3RG8A 3G2OA 2BBSA 5AI0A 2XLCA 1W1UA 3AVOA 3FMOB 3JQ6A 3ORFA 4G1VA 4UHFA 5J1TB 1QE3A 3AINA 4A73A 3OSUA 2PR7A 5DM60 3EHEA 4HK4A 1FFAA 2B82A 3HZRA 3H2GA 2Q6KA 3EZGA 3ZVNA 3M5DA 3BIXA 3P4YA 3P2MA 3BXEA 3GP5A 1N0HA 4YJDA 5FBQB 3ND6A 3WK4A 4IQ8A 5DW3A 3TQCA 4WH0A 2DPYA 4D8UA 1LQTA 2Q4OA 4YAFA 2G83A 1XA3A 4INAA 3L7AA 3V1NA 4UOEA 2WYHA 4YO7A 3PFHA 5G0WA 4D9NA 1WKCA 4HGRA 4LOIA 1GQ2A 3LKVA 3VPGA 4D0RA 4E51A 2ZIAA 3EXIA 3MBIA 1T25A 3FUWA 3BMCA 4UHCA 4QZVA 4KNVA 2WJIA 3B5EA 4YTEA 1W4BA 1JF8A 1Z8DA 1N5DA 1P0IA 1DQSA 1T24A 1XK6A 2DJIA 3EZLA 3E84A 1EFTA 4MULA 1L1RA 4ASUA 4BJ5A 3S1AA 3CW8X 3DNMA 1XOIA 2VAVA 4RTMA 1HBJA 3UK6A 3S8YA 1A7UA 4PZUA 1JA9A 1E1YA 5TMBA 4YP0A 1FA9A 2I3AA 3NH6A 4B47A 1Q44A 3UT5B 5J47A 2G82A 2C0CA 2XT9A 1OZ0A 2GN6A 2QE7D 2Y0EA 2RBEA 4MYHA 4JD5A 3CH5A 1A5BB 3TGWA 4C7MA 5BMVB 3GPBA 4IHJF 5LP6A 3LUDA 3ELYA 5K3SA 1PR2A 1DJNA 2FZGA 3OZXA 1G5TA 1ZK2A 4ASUD 1T1GA 3NDPA 4DNFA 4LHXA 1MB4A 5IJAA 3OEYA 4QXRA 1IATA 4POAA 2VBGA 3EXAA 3IDFA 5CB0A 1VTKA 5E6RB 1X8XA 3BTVA 1Y8CA 2FR8C 3BG5A 4V0OA 3AEQA 3KUXA 3PEEA 4Y2TA 4HUQA 4D97A 4FYIA 1NVUQ 3FOFC 1OV4A 3UT5A 4G8BA 1SUSA 2FSUA 3MAJA 4FX5A 3NFYA 2G4LA 4K9MA 1RXCA 1T3SA 3U4CA 1PL8A 3ELUA 5BMVA 1PG5A 2PK3A 1UINA 3GJYA 1SVOA 1YKSA 3ILXA 4EPWA 4CKZA 4NV1A 4RIFA 3BULA 5H8WA 2IS2A 1G291 4WY2A 3UMSA 3OU7A 2A9KA 1V8OA 3D3QA 1PJLA 1QV6A 1KZGB 4JIMA 1PBNA 3RSHA 1NM5A 3ZVMA 2R7NA 1I1NA 3NP7A 1DIAA 2H48A 3IQIX 4UREA 1LW6E 3KL2A 1YTLA 3SSOA 1RS0A 2OBFA 1ZUIA 3WQSB 1VRVA 2QYSA 1XNRB 2WY2D 3R09A 3EG9B 3JQAD 2GGSA 5A3RA 3E03A 3TZLA 1HDXA 2X40A 4H7JA 3DAYA 2JNWA 1YR1A 1Z8NA 3LO5A 3OOSA 4OGLA 3A1VA 1T0UA 4BO0A 2XKAA 1P3DA 4RENA 2FJPA 2WJVA 1U3CA 2W2VA 1OW3B 4PYLA 4ZN6A 4NV0A 1JDSA 4O0MA 3SX4A 3GA0A 3X1MA 4JEUA 4GD3Q 3TNJA 1T9BA 5HGJA 2C20A 4GLOA 5SY9A 4BNIA 4QX6A 5DCLA 4LF7B 4YJ2B 1L7QA 1F8GA 5A6SA 1LEHA 1SXJA 2IV7A 3OTQA 5KWJA 4UATA 1KH2A 5EVCA 3COPA 3DZHA 1XKTA 4U5XA 4B0PA 2E5LB 5ALIA 4MI9A 5HSGA 2Q5EA 3KOZA 2AI1A 4G25A 2GWRA 1DFHA 1FDWA 4LVUA 4XDHA 5BR1A 4A7PA 3C7KA 3JQ9A 4I55F 4EKEA 1E18A 1EK1A 1EHCA 2CVFA 1DVRA 2QIOA 3AKCA 3LC0A 3LQKA 4TWBA 5LD2C 4RGBA 5IHPA 1ZISA 2DHRA 5AOVA 4PY2A 4RKQA 3A9VA 3VDQA 2V45A 4L8LA 1V1RB 2PJDA 4D0SA 4QU8A 3EIFA 4PSUA 4YJ2A 1KI6B 2HDNB 3A05A 3FWYA 4C0AC 4E1VA 1AKEA 2PNFA 4ID3A 3PUYA 3PV0A 4BBAA 4URVR 3HBMA 1SY7A 4IIVA 4NULA 5BYJA 2QK4A 3KTAA 4ND8B 1HLGA 2TMYA 4L4XA 1E2QA 3ENNA 4R7ZA 2V7QD 1QIHA 3N2EA 1DV2A 1UM9B 1YKGA 4NH4A 3DG9A 4CKCB 4EQ6B 2IDMA 2BGIA 2XXAA 1I6WA 1RXIA 2G25A 4C3ZA 5KYWB 3R7SA 4MDHA 4N3GA 2X1MA 3OA2A 3JQBC 2QV0A 2P2CA 4N3BA 4B7ZA 2GCOA 4R41A 4IF6A 4PZ0A 1VB3A 3UJAA 3ST7A 4TWRA 1JW9B 2IY9A 3CPHA 3N1UA 2W0MA 2XRFA 4PLPA 4CQNA 4WY8A 4J9UE 4MNTA 2FW0A 4KQ2A 5JO9A 3HDGA 3C8ZA 1ZKMA 3P19A 4OKNA 5B53A 4ND8A 3X1KA 4MYUA 3K30A 3QVWA 4G81A 4X7PA 3S8EA 4A0QA 4KODA 3B20A 3SOZA 2AK2A 3R0VA 2EGGA 4RTJA 5KHOC 1U0FA 2Q1XA 4GP9A 3BIOA 3R40A 3QBVA 3SYNA 1EVEA 3PQ7A 3OPNA 4KITB 4A82A 4MUBA 2XVMA 5J63A 4MGHA 2DB3A 1HLPA 4HY3A 4E1BA 4LZPA 4BEBA 1V3UA 3BIFA 1YB6A 3STHA 4X7MA 3RAGA 4F56A 1G5IA 1X80A 2P9FA 2H51A 3Q7RA 3UHAA 1LLFA 4HXGA 4F3CA 4Y9DA 3A2MA 4BPBA 1JR3E 1XZPA 2P0AA 4N0MA 1VPWA 3E9RA 1IEWA 1WMDA 1DBPA 1ZIDA 1G6HA 2ZSDA 3LCJA 4UD2A 4XTRA 4WTOA 3ZV6A 5CDHA 2WQ7A 4H60A 3DFZA 2FWMX 5E4TA 4I19A 3P2KA 1J9EA 3EZFA 1NBHA 5IDQA 1Z0ZA 2V5UA 2YOFA 5JANA 2J9RA 1T1JA 2BI4A 2HWYA 2VF4X 3M4YA 5AW9A 2XMQA 1ATIA 2W6NA 5BQFA 2QM3A 4K0KB 2CXRA 2HWXA 1LPBB 1JKXA 3HLYA 2C58A 3HJBA 1Y33E 5I7EA 3PDCA 4ZOEA 4E5KA 2O2SA 4BBPA 2H85A 3M8KA 1RR6A 1UDRA 1VIVA 4PINA 5ALUA 3NKFA 2QN8A 4TYMA 3TTUA 1DQRA 5JIBA 1PYOA 2CDAA 1MRZA 1IHOA 1N1MA 1QGUB 2AFHA 3JYOA 4MUJA 3RARA 3EIWA 3TCXB 4DM7A 3CO5A 4UM9B 3IBCA 3SIXA 1NP3A 3EFBA 3O93A 3EYWA 3KWLA 3VU9B 3OC6A 4NCBA 5A3JA 2PEZA 2GBPA 4NMHA 1W85B 1N2SA 1Y3BE 2W2LA 3MT9A 1PFWA 2ZRIA 1QUEA 4FNAA 4RJKA 3S4YA 2HWKA 2ZRGA 2W90A 4R2IA 1T0BA 1E4YA 3M34A 3RSFA 3TLJA 2RH5A 3AU8A 2X3YA 4DMHA 2BM1A 5KYUA 4FBGA 4HATA 2D62A 1OC4A 2IF2A 3F97A 4K87A 2WJWA 3KKOA 1YNSA 4C6TB 4Y6GB 2VLIA 4Q93A 3VZBA 2V1UA 2XYGA 1KF0A 1OZFA 2GEBA 3D64A 3GPCA 3V97A 3W6OA 4LSMA 2JFYA 3I2GA 1I51A 5CW2A 4BVGA 1Z26A 3DOFA 3OJWA 2O07A 4YT8A 1H0KA 4ALMA 2OBBA 5A5FA 5L53A 1E3LA 1JYSA 2AXQA 4RVDA 4C7OB 2UUCB 3GGCA 4NBTA 2DP4E 3CMMA 1K06A 1W85A 1JJVA 1ZYUA 4QYSA 1U63A 2DXIA 1B7GO 1XZBA 2QSJA 3DO5A 3DDHA 3ETLA 2ZVPX 4L28A 3K6KA 4NJMB 4WZAB 4XDYA 5U4XA 2M6LA 5G4KA 4CG3A 4G0OA 1XD2B 3EMVA 1ONPA 3NDJA 1JEJA 5JAMA 1PSWA 2X0JA 3KVNA 5JARA 1SUFA 1NVMB 3D54D 2JIMA 1KZHA 3MTGA 2Z3ZA 4B7XA 5JDCA 5JNRA 4P22A 3I01A 3RPEA 1LPAB 3W9UA 4BO6A 2J5QA 4RQUA 1B74A 1CQWA 5JZOA 2Q6TA 4OREX 4D46A 5DTIA 4M87A 5BW8A 2PL3A 1UC9A 4BWYA 3SKVA 5GONB 1SK9A 4XCVA 4JYZA 1YE8A 3BQ9A 1VYHA 2QY9A 2LPMA 3TRFA 4GZ6A 2OXTA 4AMZA 5FAKA 2BR3A 1VBNA 3RKSA 2QUAA 3EBLA 1E9DA 1X19A 4KR2A 4N0EA 1XTKA 1A69A 2YBDA 3MILA 3GUVA 1CUCA 2NZJA 3W05A 5DK6A 2GARA 1QG4A 2X8AA 1KYYA 1R3DA 1G5RA 1RRFA 2Q1TA 3DKVA 2R97A 1TM3E 2PBRA 3GZJA 3OOWA 1ND5A 2WT4A 5F23A 3G2HA 3IE2A 1VL5A 4HGQA 2GNAA 2OM6A 1Z12A 4U0JA 3DL4A 3GFGA 3QYFA 1JR6A 2DWOA 1R8JA 4EA7A 4ZYXA 1OBFO 4MMZB 4YQEA 3TSOA 1GTL1 5JXJA 2GKOA 3BRSA 2BCJQ 1E0AA 1W4RA 4O02B 3O75A 3OZBA 1R9NA 4LN1A 5TDHA 1JIUA 5JD5A 1DB3A 3ZKWB 4BMSA 3C7AA 2QUBA 5JYEA 5FPTA 1S2GA 2P2ZA 3ANMA 4S12A 3ND7A 3J81A 1IC6A 3JARA 2RJNA 3KO8A 1VIDA 4JY7A 4KR7A 1AC5A 2C4VA 1H3EA 1CUUA 1I5EA 2GRJA 2Z9CA 1CS4C 1U2QA 4TZ0A 4RK0A 3N86A 1Y5LA 4ZO9A 1SQ5A 2D2FA 5I7AA 3RRXA 4L0DA 1IUOA 2ZAYA 4WV3A 5A6VA 4B4KA 3PE4A 3V8BA 3FNQA 3TFOA 4KDFA 1UK9A 1Y3AA 2R6R1 4MRNA 4X1YA 1RYEA 3ZI4A 3VO8A 4DLPA 1PS9A 1MW8X 5DLDA 1T6ZA 5TGZA 2CMDA 3MTIA 3OFVA 7GPBA 5HFAA 4EHJA 3CXRA 1XAGA 5H81A 5JH7A 2DBYA 2KPOA 2Z2IA 4HLQB 4MRPA 4YGYA 3TCKA 1UQUA 3LL7A 1M7HA 1XD8A 3NMUF 2G08A 3OZIA 3RODA 5HJEA 1V3VA 1XQXA 4J3JA 3DL0A 3HYCA 4UFOA 4G65A 1C7EA 4WFKA 5B1EA 1C4WA 5L7WA 3LH5A 5IT0A 3Q7QA 1ZZEA 3QSGA 3ML1A 2HQSA 4KE9A 1JI3A 1KWGA 3O4FA 1QCCA 2XTJA 1P2BA 2CWWA 3OKAA 1ECGA 3DJFA 2D7JA 2J59A 4I46A 2YJNA 2EFJA 5FBZA 1ISFA 2IKQA 1Z8FA 5DIZA 4LGYA 3L4KA 3QVKA 2GZ1A 5EUQB 2EL7A 2P35A 1KQFA 2OV3A 5JNUA 2EFDB 1QYDA 3UJ9A 1SR8A 1VSVA 2IZ1A 2ID9A 3L46A 1QVWA 4QTUB 4LZOA 3MBKA 4E88A 1Z29A 3ZOZA 3MD9A 4JI1B 1Z2AA 4AZSA 4OX9B 2EWMA 3N8HA 4EY8A 1BKYA 3AL3A 5HJ5A 5GIPE 5I4IA 1F4VA 2HA7A 3CUEF 3F7MA 4NU6A 4QTXA 4E14A 2OXEA 1IWOA 2PAFA 3EZNA 4NBRA 2AQIA 2XNSA 1WUJS 3EOBI 3VYUB 1IZ9A 4JL8A 1USVA 4AXBA 2P9ZA 2Z8YM 4EYQA 3L4BA 2G0NA 5FOSA 2DQSA 4XUDA 4NS1A 1WD7A 4I1YA 5HR5A 3ZJUA 3UAVA 3EX7C 1U7XA 4JP3A 2FAXA 1TJYA 2QVYX 3AESA 1W5BA 2JIDA 3H86A 3LQ1A 1GQSA 4HTFB 4A1OA 3HJGA 1W36D 5JJLA 2IWHA 1E1KA 1QC5B 4FFLA 3I05A 3ZCSA 5B3LA 3DEKA 5E7QA 1WOYA 4G0ZA 1XC7A 2FWIA 1GNPA 1GSAA 4Q19A 2R7LA 3CT6A 3QWIA 2PYZA 1DL5A 3IIKA 4WINA 5E6SA 3ZHZA 3ZWWA 2P5TB 5CYFA 5BSFA 2XRZA 2ZPUA 3K2QA 2CJWA 3NFRA 2I65A 4ZZ3A 3KD3A 2GHRA 4CIBA 3FUVA 4FGWA 3B6EA 1RRMA 1DAMA 4BYMA 4HWSA 1JYEA 3H9EO 3LHKA 2Y0PA 3ZXXA 5FTMA 1HR0B 3A6JA 2DHCA 4QLAA 3RHTA 5J2TB 3EHDA 4EFKA 1U7UA 2WSLA 2XUFA 3I1JA 2BH2A 4PC7A 2JDID 2GBLC 2ZJ1A 3A7EA 3GRPA 1THMA 2YWXA 3IEUA 3LKBA 3N53A 4RF2A 1H1TA 3GZTB 2MWMA 2WV9A 5CT8A 3UGTA 1QGDA 4B46A 1XYVA 4Z7NB 3OQNA 3QVXA 3LVRE 1CQZA 1N2OA 2YVKA 3D5TA 4J1TC 1X86B 2X1VA 3WLEA 4LF6B 3B8EA 4S04A 1ZIOA 4CLHA 4JA0A 1E6KA 2YWRA 2ZAIA 4I6GA 4MQ6A 4KQ9A 3HN2A 3N2NA 5AJTA 5ALGA 3AP2A 1V8DA 1BWPA 2OHVA 4MUMA 5JLJA 1BW9A 1P3JA 2G5GX 3BSFA 5D7BA 3DMGA 3NV7A 2QVLA 5F78A 4BVBA 5CDYA 1N0WA 2FSGA 5DCUA 1XQWA 3F78A 1CQXA 4XWWA 2W2PA 2YYSA 5BWCA 1XLUA 3QFCA 2FSVA 2FFQA 5EQJB 3PUKA 5TPZA 5LMNB 1C0EA 1HYHA 3EGDB 1ISRA 2JATA 3NOQA 1E9VA 5KNDH 3TTWA 3GLIE 3PYLA 4TMYA 2B6NA 3SIPA 2PBLA 3AZOA 4LHZA 4BP9A 2VA8A 2A0UA 3BX1A 4QECA 4Z8XA 4N9WA 1L7OA 4D4GA 2C9ZA 5BW4A 1UZLA 4U2EA 3QXHA 4JJAA 2WTUA 3VJLA 5CDTA 1A27A 3V48A 2EERA 4XARA 4RQAA 1CY8A 1NRWA 4AKHA 3A9RA 4CGZA 5EHGA 1NYTA 2JI8A 1U9ZA 3AQ4A 1W29A 3PJGA 4JOQA 3PWZA 1GUBA 3VSAA 3C3DA 4AUEA 1R0KA 1NJ1A 3P45A 4JJEA 2IZ7A 5EIAA 5H16A 3UEOA 1Z4NA 5KNCD 2CFOA 1OBHA 1HL3A 2EHDA 3NAQA 3TRIA 3AHCA 3ESXA 3T7CA 4RSGA 3VV2A 4CKEB 3I6BA 2C5HA 3S40A 3QPVA 5JQGF 2FWRA 4XLLA 1GPMA 2YV3A 4LWZA 3PGKA 5TEVA 2K7FA 1DG1G 2QRJA 2H54A 4X93A 1CFZA 4GMDA 2GO7A 2C1ZA 1NUQA 1E5DA 2HJSA 2V0CA 5KCMA 1OX6A 3VC1A 1QHNA 1SCKA 1YRLA 3SXUB 2Z58A 1GVNB 1T5IA 4XR4A 1UMKA 2OMKA 4Z4HA 2IHTA 2I4OA 1M72A 2RKBA 3BGVA 2XCRB 1KMCA 2AHOA 3K0AA 2J30A 3JZIA 1IL0A 1WMEA 5KNLA 1CNFA 2OXRA 2ZIXB 4HDRB 3SX2A 2J41A 2ZEJA 3MCTA 4G86A 2D0IA 5CPBA 1QLWA 3BQMB 3BPSA 1VLZA 2VDNB 4YWJA 3BTOA 1JMVA 3LBYA 1D6JA 5BURA 4KRXA 3HB5X 4BVLA 4W1SA 4ZHQF 1L5QA 5EMKA 1G4HA 3ZDFA 1Z4OA 3CX8A 2ZRQA 4H35A 1CUBA 4YJ3A 1EUZA 1Q1GA 2ID8A 3DFUA 2J3LA 3KOWA 4U39A 3UKJA 3A4VA 4EF5A 4MCHA 3SC3A 1AUPA 2A88A 3ZW8A 5K6AC 4TXNA 1ZEMA 4L16A 1S6YA 1H0SA 4BQNA 1ZJ6A 4GVLA 1V8FA 1CDDA 2QTBA 4IH1A 5LJIA 2G71A 1OJLA 2YY6A 4B7UA 2Y93A 5ALKA 4M7WA 4R3UC 3OICA 4TVSA 4FB4A 3D81A 1SOWA 4PAOA 4L5BA 2WG2A 2J48A 3EYAA 2PTGA 3EPPA 5KC9A 1KYTA 4UOQA 2FUNB 2YZKA 4G07A 4A16A 4GPAA 5EY5B 2VPTA 4BLWA 1H1LA 2R7MA 5BUSA 3PPXA 5JSZB 1IBLB 3QTLA 2PA0A 2GM3A 3D43A 1D2MA 1G6Q1 3CX7A 2PUCA 3U3KA 4D4LA 4RY8A 4QGFA 4U7PB 4RPJA 5AICA 1WVMA 3IBYA 4A0RA 4P31A 2BSQA 2X3UA 2QTGA 3LLSA 1CEXA 3AM5A 4ZVRA 5C1PA 3TIFA 2YXPX 5E3HA 8GPBA 1JDZA 1OBVA 2VNSA 1YAJA 1ULBA 4F8JA 4WXYB 1WBJB 1XEFA 1E20A 4REMA 5REQB 1XO1A 2MINB 2PBZA 2H4WA 4GSKA 2CLKB 5IKXA 2VPIA 3E7FA 4PHGA 1SBYA 2A0KA 1QYCA 3IIEA 5DSXA 1I14A 1BDMA 4ZZ1A 4X20B 1CW2B 2RB5A 5F12A 1QV7A 5LBTA 5JSZA 5B58C 4G0UA 1K7SN 1KDRA 2IYXA 1W2HA 3FJ1A 3EJ6A 3GF4A 3K1AB 3Q7PA 4FIDA 4MVJP 1J20A 4JNKA 2XJ4A 4F3RA 2I91A 1Y7TA 2B30A 2A58A 1DXOA 1R6UA 2FMTA 4LJ4A 4BNNA 5IKOA 2OESA 5T41A 4MIOA 4EI9A 4JVMA 4PAQA 4PC6A 1E2JA 4QATA 3A4MA 3HA2A 5JAQA 2GNOA 2ZYVX 5REQA 2ZZMA 3SDZA 4Z7QB 4KACA 4EB6B 5KKCA 1II8B 1XSEA 3O3MB 1HUQA 3MF4A 4KFSA 1XJ5A 3C7CB 3L7LA 3SS8A 4RJTA 4WLFA 4HX9A 2PRYA 3UW1A 3WYCA 2OBNA 2UYHA 2N75A 1JQDA 2NVBA 4IEIA 1HDRA 4NRDA 1NVFA 4CKBB 5CNKA 1IM5A 2G80A 2IYYA 4E3WA 4J2HA 2ZBFA 3E1GA 3UB3A 2ETXA 2IWRA 1SHKA 3CIFA 1GLVA 1LD3A 2A1IA 5DX1A 1WNTA 1QMGA 4LBYA 4A5OA 3TE6A 2CMHA 3MWLA 5ALLA 4C04A 1OFVA 1ECPA 2ERXA 2XDAA 4K28A 3OX1A 3ZHOA 1J2UA 3E15A 5ECDA 2ISCA 2ZRNA 3HB0A 3HG7A 4MR9B 4PHTA 1J4AA 4RYLA 2OPHA 4JQZA 1DQYA 4BJHB 1I6LA 4EB6A 1OLSA 1PO7A 2R1TA 1WXIA 2QPAA 1KMIY 1NVKA 2D00A 2QR3A 2A0FA 2XNHA 3F3YA 3W79A 4TXLA 4EHBA 1Q0HA 1Z4KA 2R6ZA 2IP2A 3OLYA 2HHLA 4GI3A 3DLIA 3GDHA 4HLNA 2HTFA 1IUPA 1NNLA 3AG6A 2BE7A 4YC7A 5CH5A 5DT9A 4G0WA 3JU3A 1OXKB 1LLCA 5KQRA 5ED4A 3T7EA 4DA7A 1LBSA 4MW1A 5DX8A 4NZ9A 2BD0A 4CU5A 3G1WA 4KYUA 2VQDA 2CUZA 1KIAA 3U7HB 2OFOA 3HM2A 4MTCA 1XR3A 2QTCA 5HJ2A 4DVGA 3H87A 3PJDA 4KR9A 4R6XA 4OX9Y 1VJTA 3DONA 5IVDA 1UIMA 1QH8B 3VO2A 5JRDS 3L0IB 1F20A 4XZ3A 4OXNA 1TT7A 2IOFK 3IAUA 1MJNA 1MV5A 1NU6A 3NHRA 1B2RA 3C8HA 3G0GA 1Y5IA 4ZCRA 5GVSA 3AI3A 2A1TR 4BLVA 2P1ZA 1SVNA 1L4NA 1BVUA 1K3TA 1GNSA 3PITA 1GV0A 2ZE5A 4B9EA 1O4WA 3AVVA 5LNK6 4FJ0A 4PQGA 1Z0IA 5DDIP 4UNQA 4D3YA 3KZCA 4CQJA 1M2KA 4YRKA 3DPSA 5EKUA 1ISSA 3RVSA 1SZPA 2D2VA 2XXJA 4C14A 4UVDA 1YA4A 1KH1A 1XK7A 3O3CA 1T2CA 3H5VA 4RFSA 5ESRA 3OTGA 3QI7A 3CUTA 3ZIAA 2WJZB 2UYGA 2IITA 3WX0A 1XTTA 1BA2A 1L7PA 3GJ4A 3KALA 4IEFB 4N6OA 3R3VA 4ZA2A 1QYVA 3UATA 1ISMA 2AT1A 1Z08A 2PJZA 3DLBA 2Z95A 2GWHA 1E3WB 4WBNF 1X15A 3VPBA 4CN8A 2GN1A 2IH2A 1BX0A 3I9V6 3OD5A 1YQEA 2Q2WA 1W35A 1CZNA 3M6AA 5KYXB 3IOMA 5TV2A 3DT8A 3Q2KA 1MF7A 1PT5A 4QJBA 5AO9A 1CG6A 2BHSA 1XU7A 2HXSA 3VVLA 4DREA 3LHIA 2GAIA 4ME6A 4YALA 1XT6A 4RTPA 2ZI3A 1ESCA 5F1PA 5KZMB 3SR0A 2FUKA 1M2JA 521PA 1A9SA 2WA2A 4QQNA 4G3XA 5AI9A 4EY7A 3ID6C 4DN6A 2L18A 5EA2A 1YCFA 2Q6VA 1N2EA 1CJCA 2CCGA 1PR5A 5CDUA 2VKQA 5ICEA 4U2BA 3R0ZA 3THYA 2ONYA 5B3JC 2F59A 2FV8A 2VDOB 3CZCA 4X1OA 5EGSA 5MGBA 4NXMB 4BMXA 1Z4PX 2HHAA 1IB6A 5HTKA 3RSQA 2E7ZA 1I1QB 3KHKA 5THXA 1RQNA 2PMWB 5J40A 4UEQA 1CEYA 2DPHA 4MVJI 3M4NA 4KXUA 1UPAA 3DL2A 1A2KC 1OV6A 1YS2X 2DFVA 2GBIA 2Z2KA 3W8RA 1Y4ZA 3GLFE 4BXOB 3IUBA 1R0RE 1K97A 1GYPA 1L1EA 2IK8A 1Q1AA 1W94A 3KSMA 2J9GA 5BN5A 1NQXA 2CLLB 2P27A 1RXEA 2JLXA 1EESA 5G1OA 1P9RA 1YOVB 4MUGA 1VG1A 5JMWA 4IDQA 2PSDA 4FILA 4NX2A 4B80A 1F0YA 3RSLA 3UHPA 4BLPA 2A9QA 2TRSB 1SO8A 1TZ2A 4DRYA 2C4HA 2NP7A 3HMQA 4MRAA 2O3QA 4Q3BA 4WX2B 1V5FA 1Q7GA 1TYAE 1SIWA 2WWHA 3PNQA 1ZGGA 4YNBA 2XF2A 4NYMQ 5FOQA 1OILA 1XZMA 1JDPA 2FSVC 2AI3A 2I2AA 3G8YA 1W4ZA 4AF6A 5F9FA 2H63A 1KERA 2FEPA 3IOBA 1E1CA 1NI4A 1X70A 2IP4A 2LCQA 1X1RA 2DTDA 4FFSA 4OH1A 2QU7A 1YZFA 3H19A 3N7UA 4KMSA 5ER6A 4M1WA 4RDXA 4LFAB 4UQLA 4RSRA 1T13A 4N5LA 4E2ZA 5IUJC 4IVRA 2BW0A 4YPFA 2QLFA 2IYVA 1KQNA 2UKDA 3UK2A 3VKUA 4PF1A 3FWZA 3MWDB 4F8EA 4W5JA 1R0WA 2P9TA 3KAKA 3EVTA 5EWLA 2QT1A 4JYMA 3MUFA 1LDYA 4YP1A 3GRYA 1N36B 5KU7A 2FPXA 4YRBA 4HXFB 1QZZA 4HQFA 2C7GA 4I4NA 4OSOA 4GQAA 3GPLA 3ZJYA 3BAZA 3WMEA 1BU5A 3SXJA 4J91A 1KO5A 3D7RA 2XA9A 3L9WA 2PRSA 2JLZA 2NX2A 2OGTA 3KSBC 3MQ4A 1U81A 3QY9A 5DYIA 3WZLA 3CZ9A 3NIDB 2G1UA 4JLPA 1OYWA 1KR5A 4O63O 4AF7A 2AZDA 3RC7A 5C7OO 1I7PA 1R6TA 1HKUA 3K5WA 2WJGA 5DLQC 4Q7EA 4DLVA 4TS9A 4CCYB 3B5JA 1WY7A 3UH1A 2X4LA 1ORHA 1MC5A 1NY6A 3M1LA 3QXCA 3QKTA 2CVOA 1I01A 3HP7A 4JKOA 4UULA 1WZUA 3LUGA 1OWOA 1CDEA 4DIKA 2CLMB 4Z4QA 1KZ6A 2HRQA 2RG1A 1UKYA 1GNVA 2WTMA 2YXEA 3EQ8A 5DTRA 2G76A 1ZGHA 1PCXA 5DB4A 3RVMA 3ZYCA 2DM6A 4WLOA 3Q3CA 4EMTA 4XWKA 1OC2A 3TYXA 1ARZA 3D2LA 2JLSA 2P11A 3E1KA 5A02A 2OG1A 1QIIA 4CKXA 3GRRA 5G0UA 5U1PA 2HK8A 3FDIA 3TFWA 3MHTA 5C1OA 1XKLA 2BMEA 4FDUA 1UJMA 3KKMA 4CCYA 2C4UA 2NAFA 3IUSA 4GNKA 1I4TD 4LX0A 3SLKA 1JGTA 1Y1QA 1DC8A 3OURA 3HL0A 2GNPA 1C0LA 3AUAA 4YQFA 3ECAA 1BS9A 1UDCA 1LI4A 1WRBA 4WY5A 4I9HA 1JLSA 4MWTA 3W5CA 1VMEA 3VTAA 1NFFA 5T8KA 1CJSA 1JB9A 2QLLA 2OZVA 5JLAA 2O7QA 3VC7A 2AVDA 4QO7A 2D0OB 1EHIA 4CM6A 3GLQA 4Z1MA 4JJ7A 1KTVA 4IG9A 4I14A 1I6MA 3G5UA 1H22A 2K6GA 4O4JA 1N6PA 2FA9A 2R6JA 4GKKB 4H7KA 5CJ2A 3RC8A 4TS1A 3MCZA 4C0XA 1TJ4A 4ZD6A 1CLUA 2ZBDA 4I1OA 4FZVA 4WLUA 5GAJA 1LK0A 3WMWA 3H6GA 4DQVA 1TZCA 2IJGX 2JGRA 4U4AA 1F51E 2JAXA 3L0SA 4LDZA 4PGMA 1E3EA 5DBFA 4EOGA 1GNQA 3IUPA 2F48A 5EXPA 2WE8A 3IQEA 1RWNA 5EE1A 3TEFA 4R9SA 4EFMA 2AYZA 1WG8A 2I66A 4ZOBA 4JT8A 2VRBA 5EWMB 3L82B 2Q7OE 3HDTA 5JAZA 4IAOA 4V2IA 4YAGA 4YP6A 4CIAA 3SQDA 3ISTA 3ZVRA 1E9AA 4Q3AA 4U7GA 1Z15A 1P0MA 2MCFA 4DM4A 1U4NA 1IN4A 3FI9A 2JCSA 3FNGA 3SMQA 5CBKA 1Q11A 2J1LA 3O8CA 3HJFA 2XCTB 3HCEA 1L4UA 4JL6A 1RAAA 3SYLA 5IAEA 2H5LA 5EQFA 3LOQA 2O8FB 1LTKA 3VPFA 1R0SA 4YRQA 3G5MA 3I9KA 1Z13A 1PI3A 1DI0A 3DA8A 4F3YA 3QEJA 1C7QA 1QGZA 1WPXA 3I0ZA 5EWMA 2FFJA 2AX4A 4E1AA 1YJXA 3BRWD 2XKJE 1JHRA 4CLOB 5L4SA 5TS2A 2A0WA 1LLQA 2AR9A 4HRAA 4KZPA 2RHGB 4PFKA 5SICE 4C89A 1QYWA 5IZCA 3CX4A 1HTWA 3UJNA 1GGJA 5CM8B 1QCYA 3OFKA 3SLGA 2O8FA 2VVTA 2H31A 1JA0A 2WJPA 4ETIA 1WZNA 2UU9B 2ZSAA 1BXGB 3SHOA 1UF9A 4UFPA 3IQHX 3DE6X 2HBYA 4MUFA 5BMOA 3IEVA 4BNZA 1SBIA 4OF4A 1VZ2A 2VEOA 1PJCA 2OR3A 3W8DA 3JTMA 4IHAA 4GIBA 1VQ1A 3LU1A 5CT4A 4EJSC 3BL5A 2CBGA 3MFQA 1JXQA 1OWLA 3N05A 5DH9A 4LRYA 1SKMA 2BP7B 2EIHA 1IIRA 3EMDA 4O2BA 4R0NA 3BSYA 1JHYA 1U0LA 3S2GA 4FC6A 4L1KA 1XRQA 5C52B 1Z16A 1CU1A 2RGXA 3WP0A 2LIVA 1XNJA 3DOIA 4XTCS 1TZMA 1ACLA 3L0DA 3FIJA 1BKDR 4KQXA 4LCBA 4MV5A 4PZYA 1FRFS 2B36A 2CNWD 3S29A 1B1AA 5KYGA 1BVHA 2NNWB 5L3QB 2A59A 4P4UA 4KPEC 1VCNA 2DWUA 2X22A 3ELWA 4CHGA 3M5CA 4F5ZA 2H8GA 2IIPA 3PIIA 1BH6A 3PUVA 3KZ1E 2I6TA 4QYTA 2BFDB 5A4KA 5DWDA 4TYYA 1EE1A 3DHVA 4AX4A 4ZJUA 2BFPA 4KXWA 5C3MA 4AUMA 2RE8A 1JS1X 2WSIA 4KUEA 5DBHX 5JU6A 4HQNA 3S28A 1XCJA 3ASUA 2ZZKA 3PDJA 2PIAA 2IHBA 3KQTA 3PQ4A 3GDGA 3KQHA 1NE7A 1OUMA 2BBWA 2C7OA 4RVGA 1T6BY 1R37A 2HZBA 2I76A 2BI7A 5KQMA 3ZDDA 2VP4A 5HBGA 3VR6H 2CFTA 2WMNB 4U7FA 5IHXA 4FQ8A 2GZSA 1YDEA 4QO8A 2OLKA 2R1UA 4G1CA 421PA 3L4JA 1VDMA 4X8MA 5ISMA 1C14A 2C8KA 1KVSA 2OM2A 4PANA 4KQWA 3ONVA 1O08A 4FYMA 1K2WA 4G4SP 2OAEA 3Q7IA 3QLVA 5KDLA 2ZXFA 2OY0A 3AHIA 4ZV4A 1MZPA 5JG7A 4EI2A 4V0ME 3ELDA 4BP1A 3WBBA 1XQ1A 4NMMA 2H1IA 3QHAA 1S1CA 4FLEA 4INOA 1JDBC 2BHRA 4TT3D 4UEOA 1GILA 4ZAXA 1R12A 5ELXA 2RHBA 4CLDA 1CIVA 3JASA 3ZQUA 3IAAA 1ZVJA 3KU4A 1KOFA 1OX4B 2WNSA 2CYCA 4Q3CA 3IOEA 4C5CA 1GRCA 4W7IA 1EVIA 1Y9DA 2O20A 1RJEA 5ALYA 1TD9A 1THZA 1DDIA 4O33A 5AHWA 4EHDA 1ETHA 3MJEA 4MAFA 1UAYA 1LPSA 4PZDA 2PUJA 4OGWA 3EAQA 3VDXA 3P0HA 1V5GA 4FIZA 1GKKA 3SKYA 3OZGA 1FW8A 1XRRA 3F5DA 3NB0A 4M22A 5IBPA 4P4NA 3B6MA 1FPQA 1YOBA 2QMUA 1U8XX 4GOMD 2WKWA 5YASA 1AMOA 4GMHA 1V16B 5JS2A 2WRZA 2PWAA 1BMFD 3QEMA 2BGJA 4QG3A 2ECPA 5DCWA 3JPWA 4KG7A 3JASB 5K0GA 1M9NA 1Z47A 1QHXA 2F1HA 5EJ7A 4Q7KA 2F4VB 1TEZA 4UTOA 1IG0A 2QT9A 4AI6A 1L4BA 3L9XA 3LC7O 3RABA 1W5SA 1R5BA 3W06A 2UYQA 5CJPA 3JZMA 2ZJBA 5EMLA 1CLEA 3M4ZA 4I2NA 2ZW9A 5E4FA 1CK4A 5F2OA 5I7FA 2Z2YA 2GZMA 3ETHA 3GMDA 4WZBB 2YIJA 3AUYA 3BJEA 3FCAA 3N7TA 3PXXA 3QQ5A 3GLGA 1J21A 1ZH8A 4FNOA 1QS0B 1R88A 1NZFA 1C30A 2PGLA 2E48A 1LGYA 1Y0BA 2PXAA 2P1RA 3QVLA 4BFUA 1QGED 1CB0A 1QSGA 1DPFA 2FFBA 1GDHA 3S7ZA 4IXMA 4EITA 2Q2VA 4RF4A 2PH1A 5BQOA 1ZK1A 5LP6C 1PKEA 4XIJA 2QN3A 4ZAFA 4LMBA 1MV8A 3HFGA 3LUBA 3DZKA 4LJ7A 5ES3A 1QP0A 1U7ZA 3OIYA 1MU0A 4KZKA 5CA1B 3EXHB 4K9LA 2VTBA 3A3PA 5DHSA 4BMDA 1WB9A 2YN4A 1RTTA 5BWNA 4WZBA 3DWEX 4RA6B 4G5SA 4AS3A 3LPLA 5AH0A 4O4JF 4B3DA 2WPDD 3QLJA 4FNMA 3UGQA 4CLRA 5HX7A 5HRUA 1A0OA 3OOEA 1U2EA 1SKQA 3JQAA 4LFCB 3QPWA 1K9SA 4AY3A 3TMYA 4B6EA 1E1MA 2PAAA 1Z6GA 3TDNA 1HDZA 3RSOA 2CB9A 1QTQA 3E2PA 2QW8A 3THRA 3M4XA 3GBVA 3VOSA 2VHQA 1GCOA 1AG9A 1TNDA 1BE0A 2JI4A 2W6ZA 4J0KA 3I8SA 4M0CA 1OZHA 3WLSA 1FLAA 1P39A 4IO1A 4R1LA 3GR6A 4RA6A 2XZOA 2VK2A 3EPKA 1OR8A 4L3WA 1GGVA 2PUHA 5BNFA 1W5AA 3IUQA 3HO6A 1HE8B 4JBGA 3V33A 1W46A 2VDJA 3LRXA 3GDOA 1IY9A 3ZWQA 4IH4A 1NF3A 1GPDG 4LJ6A 4HSGA 4Q82A 5J59A 3ER6A 1BMFA 1FFWA 1U8TA 3IE1A 5A0TA 1L0BA 2PJUA 3CPJB 4KP7A 4XGQA 3TZBA 1U1CA 2OGSA 2PKRA 5BOVA 3KXPA 2KSQA 3MMSA 3TDKA 2BFEA 5EZ6B 5I3ZA 1N2ZA 3NBQA 4KQMA 4FHGA 1N57A 5HOQA 4Y1RB 1LVHA 4ALIA 2EJCA 3HH8A 2L69A 3GGSA 3LDGA 5DNAA 1E3SA 1SXQA 1EA7A 2XDYA 1V5WA 3TLXA 1CDZA 1ZGAA 2DRIA 2JIRA 2HC9A 1X74A 3E58A 1K8YB 3AUUA 1L5YA 4QARA 4JR0A 3MG9A 1E2LA 3MYRA 4OMCA 3O74A 2ZXUA 2ZB8A 2O2GA 1G21E 4CE6A 1XZHA 4FS8A 1W1IA 4H59A 4DLTA 3DC2A 3Q9SA 4N6GA 5FNZA 1KAGA 3D7MA 3ZY6A 4O4IB 4OHMA 1O94A 1YMUA 2HH9A 2ZTHA 2OBMA 2ZRHA 3BXHA 4R8KA 3RS5A 3SCZA 2Q27A 1E2BA 3U4QA 5LNK1 5NULA 1G8JA 2D06A 5M29A 1PP4A 1WDLA 2YH2A 1LSJA 4NABA 2EQAA 1KFKB 1ZK4A 3D7SA 1S4QA 4XVRA 2Z4RA 3REQB 1GUZA 2GZRA 1EGHA 2SKDA 2WA1A 4KTTE 4M1OA 5K0CA 3ANXA 4CM7A 4NCHA 5FLEX 1XU4A 1YDHA 1XRNA 4RK4A 1D8TA 4UUAA 1R6BX 4ZO7A 2A9FA 2GAOA 4L2IA 4OQXA 4X24A 3HVRA 2ZRFA 2BJWA 3KM0A 4D6YA 3PQ5A 4KR3A 2PLWA 4LRUA 3MLAA 3TJRA 4X3PA 5KQLA 2O1EA 4X9XA 2DH6A 4AKTA 3D31A 4ZYWA 1SKBA 4NZPA 4Q9IA 1T5LA 5KSOA 2ZYUX 4NKRA 2ZLBA 2ACKA 4EHLA 1SQGA 1YQQA 3X2EA 4AMBA 2C7PA 3Q8LA 4JC0A 2XB4A 1IYZA 5TT1A 2FLWA 1IQPA 2CE7A 5LMCA 4ZYVA 3T5GA 3AYXB 5IAJA 1AVTA 4UXHA 4D98A 1N7JA 3I2JA 2WEKA 4F5DA 5IKMA 3WJ2A 1YQUA 5EIWA 2O1XA 3SI7A 4NXNB 1I3LA 1OXTA 2QL5A 3AUFA 3AB3A 4FU0A 4BATA 1EKXA 2BEJA 2EQBA 1FDIA 3RDPA 5KEIA 5FT9A 2X0FA 1U5BA 1Z83A 4TN1A 5G1NA 3VGJA 1GU7A 1GRVA 3IVXA 4MS4A 1JHVA 2JJMA 4GP7A 1F2UA 4BNXA 4CM8B 3I2FA 1Z5OA 4W8GA 4H7HA 2NPOA 3K1ZA 4A10A 5FWYA 3ZCQA 3RROA 5CXUA 3FZEA 1NBME 4L8VA 4Z6KA 3KRTA 4S05A 2EP5A 2H1VA 4B44A 3DHWC 2C59A 5HXAA 1OYOA 1N8TA 4IWXA 5CMLA 3II6X 4AULA 2C9DA 1GU0A 1BGWA 4C2TA 2ASVA 4L8WB 2DETA 4X1KB 1XCPA 3M6VA 1ZJ4A 5TGDA 2Z43A 4HCJA 1CHDA 2O2ZA 2ZYRA 3G2JA 4ITRC 4QUDA 3WRYC 1PJSA 1MB9A 2YJZA 1RXSA 5CVTA 1CY7A 1U0NA 3QV2A 4Z54A 1WIWA 3I73A 4JC8A 4AJJA 2DTEA 4HB4A 1ZSNA 5EC8A 5CTAA 1QMPA 4UZEA 4IDAA 4X00A 4LJAA 3UAOA 4D9EA 1VL1A 4E07A 1RJWA 1VE7A 4L8GA 3CINA 4DWVA 5LQRA 2FPKA 4RZXA 1FMJA 3KLNA 4AC9A 3RVDA 4J2OA 2CE2X 3G2IA 2VQSA 4YUAA 4X1KA 1TEVA 1XN1A 3LMKA 1AQ6A 1ZJZA 3AI7A 1KVTA 3H16A 3KPVA 2IV3A 3EIUA 3UWDA 2BJVA 5C5DA 1L7BA 1GR0A 1YDFA 3JS5A 3NBZC 3X1JA 2BMAA 4E12A 1CKEA 4OB8A 2JEZA 5LQNA 3HDYA 3BWYA 4F6LA 1S8AA 2H9YA 1B93A 3Q5EA 1XDWA 4EUEA 4F2HA 4IXTA 1RFGE 1N9GA 3OPVA 2AZMA 3CE6A 3S99A 1IBMB 3FKSA 1MFZA 2YWDA 4FSXA 1CZUA 2ZRCA 4QOJA 4B6QA 1MNQA 2WP0A 1RZRD 4DCSA 4JL5A 4DJFC 5J43A 3OLXA 4IDOA 3RIGA 1W96A 3KEOA 3UXEA 1GAXA 2ORVA 3L1VA 1LI7A 2B1QA 2EDCA 2X8LA 3PDIB 5KTRA 1X9HA 2GBFA 2I6SA 3FF4A 4DUPA 4DMMA 5IN5A 5KYXA 4LHYA 3BWDD 3IVGA 1Z2CA 3KQMA 1QO9A 3O7WA 2CLCX 4GZ5A 4YT5A 2RH8A 3HNPA 2B5OA 4W4TA 2AQ8A 3GCGA 3QKSA 1MZVA 2YDXA 3EW9A 1N9GB 3LCVB 4OL9A 4ZQEA 4OGFA 3ZHTA 3AIKA 1FRZA 1QG6A 2RSLA 3BKXA 3FBWA 1MJGA 4BFTA 3BJMA 5IRCD 3OLVA 1WULS 3WWDA 3KE9A 4KSYA 1QGOA 4D9HA 3M2TA 5EZSA 3F46A 5FUBA 1SHJA 3T9FA 3TD2A 1QAQA 5CK5A 4BKUA 3VA7A 2G09A 1KI6A 1H4SA 4DDUA 3C39A 1LX7A 1Z2NX 2ERCA 3PIRA 4LJ8A 3TNYA 4A2QA 1VCIA 1VHTA 2R86A 4ZQBA 1TYEB 4XWOA 1QP4A 1R0LA 3AKZA 3AMVA 1H5QA 1QXSA 5IFLA 1DX9A 1T2VA 2IIVA 1U0BB 2GSDA 3ELBA 2HLPA 3GH3A 4LRWA 5D00A 4CKCA 4EKYA 2O8CB 2YWBA 2V7WA 3K35A 3OLZA 4HNAB 3MHPA 2WIAA 3P96A 5HIAA 4YRTA 2DBZA 4IWYA 2DLDA 2YCLA 4COOA 4YIKA 4I1IA 1CY2A 4F4IA 3K6SB 4N48A 1AZSC 4X97A 4ZGBA 3FCXA 1V2GA 1YS7A 4JR1A 3WJAA 1A5TA 1YACA 3BFPA 1RWKA 4BMVA 1E2PA 5KSYA 4NYJQ 3THXA 1P17A 1SCBA 1V9CA 2C5BA 2C77A 1J8DA 1J99A 3CIOA 3CR7A 3CZAA 2ZRMA 2YRXA 4JB2A 2ZPTX 4ZQCB 3UB2A 4ICIA 2IX3A 4CDNA 1K9VF 3SEFA 2O8CA 2Q5FA 4JUIA 3T0GA 1NBMA 2KS6A 1JU4A 4JFRA 3AEXA 5DP1A 1IHYA 2FPIA 1O03A 3BGSA 4HDKA 4IEEA 3N0XA 1QKJA 2WINI 4RVNA 2EEZA 4KH1A 3T9AA 1XNQB 2JA2A 1N7HA 4J76A 2QYHA 3LGSA 3K2IA 1B43A 1L1QA 1V8ZA 1UBGA 1UCFA 3PHCA 4UHKA 3VYTB 4MARA 1DMSA 5HK9A 1J8MF 4EFDA 5JSFA 5KO2A 4JLUA 3JWPA 1X80B 3THXB 1UXJA 2WJYA 3T99A 1KJ8A 3KTDA 5ADUS 2ATEA 3R74A 3K09A 1JG4A 1DXHA 2QORA 4FCVA 3V2IA 2D1QA 4U6QA 2FPIB 4NONA 1JG3A 4W6ZA 1L5HA 2ONJA 5IVPA 4CKWA 5LD2B 3QKUA 4KE6A 1H2FA 1HG1A 4JH0A 1EIZA 1I30A 2PYDA 4KO4S 3PNKA 5B6PA 4UBIA 1I9CA 3JQ8B 3L4SO 4Q5IA 2UXCB 5DNUA 5IVKA 4DWWA 4RHXA 4DL9A 1PGOA 3FA2A 1ZI9A 4QYIA 1W6RA 4HADA 1N92A 4C7XA 3ESZA 2O9JA 3I0MA 4EUKA 1T5TA 1LTHR 3OX4A 1OROA 3H4VA 5CFPA 2N1MA 3O73A 1VLHA 5K4AA 3MGGA 4JSTA 3H9UA 5BWMA 3KKZA 1RVDA 4M6WB 2P9CA 1OFUA 1ZKDA 4XUEA 3KSAC 4YMUA 1F38A 1QGUA 1DUIA 2R1VB 2WU0A 1UL1X 2AHRA 3HU5A 3QF7A 1DG3A 4OHOA 1E9SA 1H2RS 2EFHB 1QFYA 2NSJA 2I8LA 4W82A 5H5JA 1Z6QA 1USGA 2FKNA 2VUUA 3GJTA 3MEQA 1U4OA 2LNDA 3NONA 1QQ6A 4PICA 4QAJA 4L9RA 5DOVA 3TIXB 3IPRA 4LYYA 5G0TA 1LNQA 4Q03A 4MIKA 1OA0A 3LWDA 4NNJA 4KC0A 4Z9XA 2XH8A 2ZUFA 2I2CA 3QVMA 2PU5A 1U11A 4PXYA 4MJ3A 3ZCRA 2YW2A 5K0TA 2DFNA 4UASA 4DVJA 3I6MA 1MC1A 2H7XA 4GO1A 2OC4A 1N8NA 1RYMA 1FFXA 2IYQA 3KS9A 4FD2A 1P2FA 4RAOA 2P2NA 1VMIA 2R1VA 1D4AA 3QJ5A 5FWYB 3RUCA 3TOVA 2P62A 3ZTYA 1IUKA 4ESVA 1UPTA 3TRKA 3AR6A 3IAS1 4FDMA 4X95A 2P8JA 5CK4A 4CDRA 5IK2A 3PUJA 1JEAA 1X7HA 1YO6A 4DLXA 3KQVA 1GL7A 3JYPA 2AFIB 1WX1A 2F67A 4BN4A 3GMTA 2AC4A 1Q0RA 3EH1A 1FEZA 3DDNA 3LLVA 2M6KA 1V35A 4G5RA 3ZWYA 2AN9A 2DT8A 2F3PA 2VTVA 2XYHA 3N8NA 1NUAA 4JJ6A 5FUWA 1UT6A 3TH5A 1XD2A 4FCWA 1M1ZA 3GRAA 1KA9H 2AMVA 1Q74A 3M4JA 3STWA 2W6IA 4GKBA 3I2YX 1PQ4A 4RIHA 2PVSA 1R9MA 2Z3WA 3OUZA 1OB2A 4YMWA 2DFTA 2ZUBA 3MMNA 5C2JB 1PLLA 4AZ0B 5SYNA 1WMBA 2YV2A 1RWPA 2B7LA 5B2FA 1FRVA 1KJIA 3GBSA 4S1VA 1YKFA 2WFMA 3KKEA 1H66A 3UMMA 1J33A 1E7RA 4L0QA 3QFRA 3FTPA 3JQGA 1QF7A 4XD7D 1DFIA 1JFFB 2PUWA 2Q07A 4FR2A 1P2VA 2HJRA 4OUDA 1BXRB 1QK4A 2VPXA 5C1BA 1CR1A 2H1SA 2QPTA 2VFAA 1TCCA 3N0VA 5B7NA 3L0BA 4IX1A 3RM3A 1UBJS 2BWJA 3VM6A 3MN1A 1TKCA 3GJRA 4MWBA 1Y7HA 4PAWA 4ENTA 2O2JA 4X8HA 2TMDA 3HI6A 4PO3X 3W5SA 2CV2A 5GM1A 3TCNA 3W77A 1FP6A 3CM0A 2NUPA 2NP6A 3PJRA 8ATCA 1UWKA 1C1HA 2AOTA 2B37A 1XRSB 2VJDA 3STYA 2AFHE 3ZKWA 2O8VA 3IT2A 4P3XA 4DOMA 1JXAA 2XMBA 1KU6A 3JQGB 1CUHA 1JFFA 1VFNA 4UMDA 2DYKA 3W2HA 4OQNA 2XUJA 3OTOB 5LZ7A 4YRFA 2EKZA 3PNBA 2IXEA 3C16C 3L07A 4P4LA 5COQA 1WTCA 1LRLA 5KSZA 2XCIA 4V02A 3JYNA 1KMNA 2XT0A 3F4KA 2JASA 4CFYA 3FMFA 4CMKA 5DNVA 3G79A 5AKKA 5J9FA 3I3OA 3CVVA 5I9NA 3D7NA 2DY0A 2IYLD 3Q98A 4LEIA 3JZFA 3TQFA 1ML3A 4OLAA 3CUWA 3DMTA 3HSKA 1UKCA 1EPUA 3GLRA 2CLIB 1RP1A 2R5NA 4OQMA 4ZEMA 1RXUA 2E9SA 2A8YA 1KKLA 2BKEA 4L72A 3T4XA 3O9VA 3O2QB 3QOXA 3R7AA 1NG9A 1QVAA 1NT2A 2YIVX 4LTDA 4Q1EA 4PYIA 3LF1A 3PZBA 5EMHA 2Y1LA 5JATA 4ND7A 3SQMA 1M34E 1G59A 4F84A 1AXRA 1UPUA 2H2DA 2D5CA 4GGPA 5HILA 1F3LA 4Q9DA 2KX7A 4BC1A 2IUTA 2RGBA 3DL7A 3GNTA 4EJSA 3WSTA 3QYAA 2ZJ6A 4MKIA 4LDAA 1U65A 5TQ0A 3ZWNA 5IM5A 4M0FA 4X90A 3A4IA 2QSZA 1QP8A 2XMRA 4GF5A 2QUJA 4WDQA 4R2JA 4AQYB 2O0KA 2X5JO 1JH9A 4TV8F 1P3Y1 3OPMA 3SSNA 3U4MA 3CV3A 4UM8B 2V7BA 3C45A 4MYCA 1A97A 4JHXA 1U80A 1PYDA 3PT5A 8MHTA 4NSNA 3SQLA 1Y9ZA 5L95A 1GEEA 1PUXA 4JN6B 1Q6ZA 3A37A 4QBIA 2BYTA 1GYRA 1MGOA 2WM2A 1D09A 2O5VA 2XDQB 1NQVA 2IW1A 3FWHA 5EPEA 1TUGA 1VSBA 3TNFA 4LF5B 4BX2A 4P7KA 4AFNA 1NSTA 5K2MA 1NOKA 2BEUB 3UT0A 1RJGA 4J29A 2C5EA 4YFYA 3WHKA 3FNBA 3NW9A 2AG8A 3ICWA 1YMVA 5AOAA 1FUIA 4HTFA 1ZZGA 3PR3A 4HLCA 4CU2A 1ZHHA 2PZAA 4J0EA 4E31A 5JOQA 4QQ8A 5DXJA 3FWKA 3CZRA 2XX3A 3JQDA 1PTJC 2XWQA 2QZ4A 3R24A 4H1VA 3UQZA 4DWJA 1LUAA 1V95A 4J8PA 3DXXA 4HVTA 1Y42X 1Z6TA 2HCFA 2W4MA 3FYDA 2XSZA 3B3FA 1KJWA 1YRYE 2QZJA 1T8WA 3X1YA 4WKNA 3WLAA 3I9OA 2IYWA 1U9JA 3M7IA 1V41E 2AC2A 3NHJA 4P7FA 1M75A 2HMSA 4UPVA 3EZYA 4YMSA 5IJ9A 4W9MC 3QSYA 2A5DA 5FI1B 1DJMA 1SPBS 3OCVA 1CUXA 5FV7A 4NPAA 4B3MB 3H1EA 3HEBA 4ETNA 4UCWA 1AV7A 5SY6A 5LU8A 4QICA 5EYPA 3IBSA 2FRDC 2JFHA 4W1PA 5KX5A 2WTEA 3TIGA 3IMCA 3CLHA 1A72A 1Z2EA 1EDOA 1Q1EA 4CL8A 3ZNQA 2VP6A 1G21A 3AI1A 3KTFA 3PGVA 4LYJA 4IGAA 4N1AA 5FBWB 4JVLA 3K3PA 5KTOA 4LYDA 2QG9A 5AM5A 5F3WB 3QX8A 1CVRA 1JTFA 3RQIA 1VE9A 4IRXA 3EF1A 5HRAA 1XD9A 4BS9A 1DV1A 1NSYA 4DV7B 1BW9B 3FHLA 2W11A 3C43A 4C7KA 5BXQC 3F8SA 2QJWA 2ECKA 5T7BA 4MK4A 1Z0FA 4KK4A 1ZR2A 4NMLA 4BJ3A 5B7GA 2SECE 3ERCA 5EG5A 2QZZA 5JEEA 3TXAA 1SGWA 4GZLA 2V9ZA 5CNMA 2QW1A 3IMFA 1DIBA 1JR4A 1BH2A 4M46A 1GWNA 2IYZA 2OB2A 2PN1A 4JELA 7AT1A 2Q45A 3W9BA 4KRFA 1U3UA 1MBZA 1GTJ1 1QFXA 1ZH2A 4XVUA 1M2NA 2WOJA 3KXKA 1WPRA 5C8XA 4JCOA 3Q15C 4IILA 4JX9A 3ADOA 1CS0A 2J67A 2BDEA 1DARA 4NQRA 4BFLA 5LYJF 2HOQA 2X1LA 1QH1B 3CU5A 5IARA 3TPFA 2AJLI 2RAPA 1MD9A 2WD9A 4ND4A 1H4TA 1Z2DA 5H7XA 1VCHA 1O6FA 2H59A 2VR1A 5BRAA 5U4QA 2RHMA 2ZCUA 2P9QA 4HBGA 4JBYA 4TSFD 5FLYA 5FO1A 3KYIB 1WU8A 3RUHA 3W7AA 4CQMB 2FPGB 3JWIA 3K0BA 3QRWA 2XGOA 1QCZA 5J23A 3VPAA 1G9XA 1GVHA 4HO1X 2I1WA 3K0EA 2PYIA 2NV6A 3KOXA 4OHVA 5CA0F 1FNBA 4L57A 5L3ZA 1G2IA 1O58A 4L7QA 5C35A 1LBEA 4JMPA 2IE8A 1DRUA 2RHJA 2XQKA 2GEKA 1M2VA 4N54A 2Y3IA 1L4KA 3THSA 1IK6A 4D6PA 3IT1A 4IVNA 1MMFB 1N2CA 3RADC 4A4DA 1JV2B 2OZPA 4GH5A 1JECA 4HNQA 1XMPA 3HC7A 4C4YA 3KYBA 3WKEA 1EH5A 2YOHA 5F7OA 3NS7A 3P2EA 1KH3A 2DWCA 3IA7A 2FPGA 3P9IA 3TPCA 5A3VA 3PD0A 4CEJB 1NJ6A 3EK2A 4NCJA 1H65A 4IMPA 1NI5A 1RKUA 2VYNA 3PGXA 4LG1A 1E9BA 3RNLA 3PDUA 3DB1A 4W8HA 2JHPA 4PU0A 1PL6A 4RV9A 1KDZA 1BDBA 1NW8A 4HDRA 3A1NA 3GT0A 3OWXA 4N5IX 3FB1A 5DYGA 2HNKA 1WCXA 2I2BA 1SWWA 4PR0A 3W5JA 4D9MA 1AKQA 1EG7A 2WABA 3WOVA 4YRCA 4B3IA 4EYOA 3FOWA 2G5CA 2WJ3A 1PUJA 2EKBA 1Y8ZA 4OYLA 1GYQA 1P0PA 5D87A 3J81k 3OT1B 3T94A 3RBVA 4RC9A 3AL0C 4IGIA 4QNNA 4JAVC 1NKVA 1U3FA 2C97A 2ZBQA 5T4FA 2FP4A 3R7LA 2QP3A 2PT6A 2JI7A 1E8DA 4TLLB 1K3UB 2A4KA 3IUNA 3VPCA 3VYVA 1W6UA 3WQRA 3DTTA 1FJHA 1RWWA 3ECCA 5K6RA 1Y6GA 3OZAA 1E4EA 4UZSA 2EAUA 3PL5A 1HYEA 3GLVA 1K6EA 2EBUA 2C42A 4MYRA 3K71B 1QAMA 3CX3A 4G6ZA 5J5CA 4EDFA 2PMBA 3EVGA 5HA5A 2IYOA 1G3RA 4HB2A 3ZEIA 3A06A 5HS6A 4A9AA 3NC4A 2CNLA 1RYNA 2FPLA 4XFDA 5DLEA 1GZ7A 1T6YA 3W2TA 1DAGA 1JPVA 2WYUA 4B3GA 1OAOA 3ZWBA 2RI1A 3FSJX 3KFVA 4V0QA 1G8AA 2YXNA 2WICA 5ALNA 3SEQA 1G3IA 3C8UA 1DCKA 1NUTA 3CVYA 3OIFA 3KR9A 2ZB2A 1W9MA 2MINA 3HCPA 2CYAA 1NBEA 1NMSA 3T9BA 5F73A 4REQB 3TSAA 1WF6A 3T5DA 5KOJA 3RFFA 1YHYA 2Z8ZA 1EM6A 2NGRA 1W36B 2FSFA 2VT7A 1E5XA 4J94A 4ETWA 1A1SA 4F85A 1F0KA 1NKTA 3DT9A 4F8YA 1T29A 1MB0A 4P80A 1AOXA 1FYVA 2QM0A 2LV8A 2PZKA 1KGSA 1AKUA 4ONEA 4PSDA 4LBZA 5ICMA 5AD1A 1TYZA 1FUYB 3GGDA 3ZCUA 1ULAA 4PGHA 3CVWA 2WJAA 5CCXA 2RK3A 1K4KA 2XB6A 1NQUA 3SF0A 1MABA 2P6UA 2VWQA 2LKCA 4PIVA 1II8A 2CLFB 2MIIA 4RY0A 5TF4A 5BN4B 3K72B 1FPMA 1AHPA 5KWVA 1NVBA 3REFA 4NOMA 1Y8QB 2F9LA 4I50F 3H0CA 1W93A 4OHPA 2IC5A 1Q17A 2G9VA 4UTZA 4M9ZA 4B43A 4CKBA 3GVIA 4Y9TA 1KPHA 3FAKA 3JALA 3EEYA 1JR3A 1EK6A 3WIEA 3E53A 2AW5A 4AM8A 3D4LA 3TR5A 3BHJA 5FDFA 5CFZA 3E5RA 3BE6A 1JHUA 2XAAA 5LFAA 3WYAA 2O8BA 3EGIA 4EHHA 4JS0A 3BB1A 4UMVA 4OM8A 1M6VB 2A2ZA 2R66A 4TMFA 4YJ2F 1MABB 4P36A 5F7ZA 1PJ2A 1XLWA 3GT7A 3M6UA 3OZ7A 1GT91 5BN4A 3FYSA 1S02A 4QEDA 4PG7A 3TQRA 4DV1B 4U3JB 3ZDAA 3FUTA 1G20E 1YJQA 3KYCA 4JT9A 1QRSA 5JS8A 4FZ5A 1P2SA 4ENSA 5KOYA 3JALB 4J16C 2EARA 3NU1A 4NYJR 4YONB 5JROA 1MCZA 3NYIA 3WLHA 4ZVQA 3AEUB 4YCCA 4YCMA 5AW4A 4PYQA 2ZSFA 3BFXA 5K4HA 4B4DA 1L8QA 4QUGA 5HZHA 1SJ9A 2HA0A 4FGLA 4GYWA 2FWPA 4JITA 1J0CA 2O3SA 4FDTA 4JLAA 5DHRA 1QR6A 3DPIA 5COBA 2BHLA 4XYLA 5I8WA 1IBSA 3ZJTA 1N3YA 2MR6A 3FLAA 3MPUA 3P9PA 4EFNA 2PWPA 1JHXA 1BN7A 2RONA 4XJXA 5JC8A 4QBFA 4MYSA 4L76A 2C07A 4YRRA 3SYMA 4UE3S 4DQ0A 4ZRNA 3IX7A 3VSDA 1ZIYA 5GJBA 3BJIC 3N2GB 1E2MA 2O59A 3MUEA 3LPAA 5AVYA 4NPHA 3UA4A 4HQ6A 5KJ6A 3U3OA 3WIOA 2FPOA 2P4EA 4HEQA 1BHO1 3L5OA 2ZUSA 5K3BA 4QRDA 2YNMC 1L5LA 3KKPA 4F0JA 2VOEA 4FI3F 3BDAA 1PWEA 5DYYA 3ZZUA 4J43A 1T2AA 1IWBB 5I51A 2H7YA 2ZWPA 2SNIE 1SBNE 1FS4A 2O4UX 3UAXA 3ZE7A 4AY6A 1L8XA 2Q0QA 4OG2A 1JE1A 3QVTA 3PNOA 2PE5A 5AQEA 2DBVO 4DJJA 1AZLA 3PCTA 4UTRA 3STVA 2Y68A 2I0FA 4I8IA 5IT9A 3IV7A 4I9FA 4RFSB 1K5PA 1ODIA 2V0NA 3GEIA 4P3NA 1WE2A 4HRVA 5DCYA 2CHGA 3VI4B 4HH0A 1AMNA 1Y1TA 2VP3A 2G9RA 4RV4A 1UODA 3R76A 3UXMA 4D0LB 1KYXA 5KDOA 2H11A 4WVLA 4QTTB 2NW6A 2UDPA 3OPYA 3QUSA 2YN2A 4E11A 1I0LA 4V1CI 4FX2A 1HEYA 1E64A 3DE5X 1LS1A 2QMZA 1ODLA 3L7NA 1VCMA 3UKDA 3PXBA 4HFNA 4TYWA 4KKVA 3RV3A 4EMBA 5FFNA 3A6FA 4L02A 5C4IA 1D1QA 3Q8WA 2QLNA 5E6UB 1KBQA 3R77A 2ZSEA 4QT0A 6CHYA 1RLTA 4MIEA 1E1RA 4Q15A 3HJAA 1F2VA 1N0UA 2NUAB 2GXUA 1DMRA 1K6MA 2XMPA 2L82A 3GQBB 1G3MA 4F2GA 3MOIA 3THYB 3Q40A 1X1QA 1G8HA 2WM3A 5K0FA 2VRCD 2DLNA 2Y0CA 3DE0X 1YZTA 4NCNA 2EYQA 1HE5A 2BBTA 2XD4A 1EXMA 1XYGA 3VR2A 1P9WA 2YMLA 3QP9A 4MJXA 5ERXA 2VHJA 4X8LA 4EGJA 4U6NA 3O4GA 3AVYA 4RETA 3X2SA 2RHWA 1MG0A 5E6UA 1EXVA 4JC5A 1IWPB 5EJ4A 3CXUA 1NP6A 3NEYA 4MMYB 4B3HA 2O3RA 4PSAA 3U7QB 4E5SA 4KK3A 4P33A 2QDXA 3HJCA 5FH9A 1XMVA 5K6AA 1LKZA 3QMVA 5JDCC 3GQBA 3FDZB 2DOKA 5ALRA 5JD6A 5JSQA 3KELA 4RZIA 1QHSA 2AFIE 4ZVTA 4PSVA 3VDMA 3UPUA 3JWHA 4I4IA 1L9KA 1LBTA 1FUEA 1XFAA 3KYDA 3O38A 5L6MB 5DBGA 5ERYA 5F33A 5IBRA 1UBEA 2XADA 5J2UF 1FK8A 4W9NA 2BOVA 1H6AA 1RRKA 2ORIA 1V7ZA 3G2NA 1T36A 3LIPA 1FDSA 4IIGA 4MB0A 1QVRA 5CH8A 4OHUA 4DQXA 5JNSA 3EPLA 5IJZA 3IP1A 3ZNPA 1MR3F 1XTPA 1YFLA 1KQGA 3K7EA 3UJ7A 2HUNA 1GA1A 1H0RA 4MA0A 5FL7A 5HQJA 5F2NA 4DV4B 3JD1A 5JC1A 3KEFA 1P5FA 3WL5A 4UU8A 5AK3A 3WV4A 4EMUA 2RI6A 3OE4A 1N77A 2SHKA 1UQRA 2HA5A 3MWDA 4Q21A 5KJFA 5IDVA 2QAIA 1GNTA 3ITEA 1FXWA 3QLUC 1WHTB 5EXSA 1C0KA 3TLGA 3H9JA 3FRIA 2Y27A 2AF3C 1KPGA 3PUZA 4YJ3F 3ROGA 5FCDA 4O4IF 3K8ZA 1YWGO 3NOOA 2FPSA 3VOBA 1RP7A 1XCGB 2FDCA 2FGKA 2V5AA 1ZLXA 3K31A 3OLWA 3ZR4B 5CDGA 3KXDA 4N7RA 4ZMSA 5KWSA 1I3OA 4Y9UA 3C6KA 2X6QA 2OHOA 2H1CA 3D0KA 4RW0A 3C4VA 1G3QA 3E7PA 3EA5A 4CTOA 3TZ6A 3PNYA 2JIZD 2W58A 4WJLA 3OLQA 3O8OA 4L3OA 2PX5A 4UQPA 5AHRA 4DR4B 2X19A 2VXBA 5EGNA 4RZUA 1G66A 1JLHA 3KJHA 4TTRA 4QPJC 3UOAB 1WHTA 5JADA 1JPNA 2UUBB 1NAHA 1EM8A 2J4CA 3ZV4A 8OHMA 4WNAA 4C7BA 4CEIA 2ZS9A 3K0FB 1KY4A 3K0CA 3QKRB 1A82A 2PPVA 5TB5A 3RUAA 2KM1A 1ZEJA 1U2SA 2GAFA 3WBJA 2R00A 2WU8A 3H3JA 5AVOA 5DTEA 3MWEA 2J6IA 1DRVA 2C2BA 4YAOA 3LQYA 3RRMA 4BVHA 3PVZA 3I4LA 2W6JD 4K9SA 4BNKA 2CC2A 1AGNA 4HAWA 2F1RA 4O5AA 2A67A 3FCSB 3T7SA 2ZAGA 5KNCA 2QXYA 1D0SA 4DSOA 2AGVA 4QKQA 1RRCA 2FSSA 1QKIA 4XX0A 4L6CA 5DM2A 4E5PA 2BMWA 1E6UA 4NENA 1T2NA 1WHSA 2ZB3A 4CEIB 3OIWA 2G1JA 3I6ZA 3WB2A 2OENG 4RHCA 3ODPA 1P0CA 1FCJA 2FRDA 2DQ4A 1HYQA 5IXYA 4PLZA 1N4AA 3MWEB 5JZVA 1JBEA 1JEQB 1W88A 3C6YA 5K9ZA 1H9AA 3CJTA 5IVHA 1GTSA 1Q12A 2IPXA 3KZMA 1M34B 4H16A 4ZOQI 5B2ZA 3WGIA 1CP3A 2QJRA 4O4JB 2X7XA 1JDBB 2VHEA 4E21A 1E3MA 1KZ4A 2ZJ4A 5HYVA 3TWOA 2YHUA 1VE3A 4GP6A 4BMNA 1WHSB 3HKCB 3PNSA 2QRVB 5IPFA 2VWHA 2WSMA 5EQDA 1K5GA 3LL4A 2JGFA 1VM6A 5K3OA 4JZYA 3VR1A 1EK2A 1GITA 4MGEA 2QE6A 2WU1A 1BOOA 1JSLA 3VUFA 4D7AA 1U1DA 1UADA 5PNTA 1M7GA 2JCYA 3LY9A 1IOZA 3FPKA 4RPHA 2PIDA 1KETA 1X94A 3M6WA 3Q7EA 4Q47A 4AIRA 1KP9A 1TIKA 1NLZA 1U7HA 2H08A 4AMUA 3GLHB 3M6IA 5K7SA 2H4FA 4LYHA 1W36C 2W4IA 4IJ5A 2QBYB 2VSFA 4HYEA 3RRFA 1FFBA 3HVJA 2JDIA 3R6DA 1A9XA 1T4BA 2OGUA 2HLNA 4KXYA 1FTQA 2C9BA 2GA9A 1O5IA 4GAEA 3NHLA 4IS3A 4ER6A 1VJDA 2QRVA 1M1NB 3EXG1 5DGTA 3A6PC 1XI2A 1RDFA 1YQDA 4COKA 4LF8B 1DAKA 2IXAA 2M6RA 4RORA 3V8PA 1U94A 4BU0A 4H31A 3TUIC 4BVAA 3QLUA 1EJ6A 4DWOA 2ENWA 5CB4F 4ZDWA 2ODPA 2R5WA 1DWPA 3LDUA 1KMHA 1XXLA 2E6UX 1D4OA 3A58B 2PFKA 3WKCA 2QW0X 2CHQA 1I32A 1OBCA 2XOXA 5K5EA 3KQPA 1BSVA 3SFVA 5JSYA 4F5YA 3LX6A 2QBYA 5JXIA 4EHIA 3GGJA 2XVXA 3DB2A 5HJ7A 3NXKA 3WRWA 1K8ZB 2JIBA 3O47A 3K9FC 3B85A 3A32A 2P2YA 4Y2VA 5KPDA 4KXLA 5IS2A 4XQCA 2GO1A 4DR6B 4AG5A 1AN9A 1BXGA 1WB4A 1GQYA 1NVVR 1GL9B 1FS6A 5CHYA 5I4CA 4Q1DA 4R6WA 3SGLA 4I36A 1HFWA 1UZMA 1YCGA 1KMHB 1THGA 4ERXA 1J97A 1LQ2A 3QX7A 3U56A 2VF8A 2FZKA 5EJ9A 3EASA 4GR9A 5GPBA 1RRPA 1S2MA 5FBKA 1DC7A 5CU7A 4AS1A 1M33A 1I5RA 5LQUA 1IUNA 3PFCA 2WG1A 4N9QA 1NPYA 2IUEA 3ZW7A 1KDVA 4LDJA 2IPAB 1H9CA 2IYUA 2NNLD 1V4VA 4I4TA 5TC4A 1DEXA 5L3QA 4QM7A 4NK4A 2YY5A 5JYDA 2Q5HA 2VWGA 4D02A 3R2JA 2W43A 1R27A 4HFRA 1UEJA 1YVEI 5C5IA 2YJ3A 2HL6A 4HYQA 1D8AA 5D3KA 1Q7EA 3TR0A 4EW1A 5TJ9A 5ES4B 1L5ZA 1G3UA 1XROA 3R3ZA 4LXTA 2H8KA 3IR7A 3TVTA 4H17A 4EZIA 3ZDRA 1SKUA 2KBFA 2WIKA 2Q8PA 2D59A 1FYFA 4IJQA 4EPRA 4M1ZA 2IU4A 3RKUA 4RVHA 4BNUA 4QYXA 1NXXA 1H94A 1O8BA 3OZDA 1JALA 2IEYA 3C4JA 3DFIA 1YGPA 3SU8A 2DR0A 2ZB7A 4QVGA 4Y2JA 3WL7A 2GCEA 3ZHBA 2BE9A 4KR0A 4P3PA 2D2XA 3CJRA 3Q6IA 2CUNA 3SHTA 4A91A 3RASA 1LPMA 4LWOA 1Y37A 1GM5A 2OP0A 3PHBE 1NVVQ 1RC0A 1W0KD 4G9GA 1VP9A 4O08A 1OZAA 4DA6A 4I4LA 4WHMA 4ZRMA 4DIBA 3ZDZB 2FSPA 4U2KA 4DMLA 5EJ5A 3MMPA 4L0CA 2VH2A 1PZFA 2FHSA 1JHZA 3AEKA 1UXIA 3D5EA 1Z4LA 3KE8A 5E7MA 5G3YA 5H02A 1JP7A 3Q5GA 4BUZA 2HMTA 2VJOA 3IUJA 1IHUA 3M6LA 5TNXA 1OX4A 1P4AA 3ENKA 1KQ3A 2WWGA 2AA3A 3UB4A 3HABA 3HUUA 4D9JA 3QE2A 1NHWA 3U1BA 3Q1LA 3AU9A 1G16A 4LIPD 1WBBA 1AMUA 3E22A 4OBWA 1H8HD 3FTNA 3LF2A 2Q3FA 4C88A 3ZY3A 3QYJA 5D01A 2FUCA 2NU7B 2E89A 1PG2A 4ZAZA 3JQFA 4ZVMA 3DXYA 4ARAA 4PBTA 2NO9A 4LFBB 4DIOA 1NNEA 1T2EA 1COWA 3HB7A 5BP7A 1ULZA 5FR2A 2D3WA 5LP6B 1SH7A 2AD1A 1FP4B 2GFQA 4E5MA 4KFUA 3W5VA 1U9IC 4YDHB 4HMPA 1W30A 3ORRA 1WNFA 1BJKA 1Z5PA 3ZLBA 4LQLA 1PGPA 5AW2A 4AZTA 1YFKA 1YB2A 3GNQA 2CSXA 1RAHA 4QM6A 3RTGA 1J8VA 1D2EA 1ZGZA 3IQGX 4BOYA 1QS0A 1RQ2A 3PQFA 3UWSA 2Y67A 1D9XA 2ATVA 4I8DA 4U7HA 3D2CA 4ZOLF 3DCYA 4QUBA 5JMPA 1GCAA 3AJEA 3NZEA 4B9AA 1L7MA 2Y1KA 4CTKA 2P5SA 4FE3A 2YDYA 1CX9B 1NWHA 2V0GA 1Q77A 2I4MA 2ACWA 1XTBA 2MU1A 3OKFA 3S5JA 1BS1A 4CVNA 3E23A 5JBNA 3QW2A 1KJZA 2TMKA 1RI5A 4RY2A 4PZAA 3ZK9A 4UPDA 3M9WA 3GVPA 1NI3A 2Q9AA 2WUFA 4CQMD 5FRDA 1D4FA 3BK7A 4XUCA 1ZMRA 4JU8A 4DQKA 4BE4A 3L6EA 2O7SA 4EGFA 4IV5A 5KDDA 1Z7YA 3C3PA 4UBOA 1IG3A 2V1XA 4RFLA 1ODCA 3W1WA 1KQOA 3D0RA 3L8FA 3MELA 1Y1LA 2PRIA 3GUCA 4BFYA 2Z56A 4Y6QA 1DUSA 1HO3A 2FW6A 2OAP1 3FHCB 4JHLA 1N5KA 1BCSA 2GM9A 3CZ4A 4EP1A 1MJHA 1IEXA 1JMYA 1QHGA 2UYYA 4C0WA 2R25B 4RWEA 3LLCA 2COKA 2Z6UA 1VL2A 1D2NA 2OGWA 3B9QA 2CXHA 5IJXA 5CLHA 2FR1A 3KJZA 4TRRA 1ZNYA 2XQIA 3FCCA 4MVJG 4WBSA 1PL0A 2W2LD 5CPFA 2GZ3A 1HT1E 2P6PA 5HF8A 1FX0A 2H6EA 4MR7B 1MP0A 2VKTA 3MJ4A 1V7QA 3AR3A 3BQNB 4NATA 4PYRA 1LJLA 1GGKA 2ZROA 3OBIA 1F1JA 4IOJA 3ZZTA 3OM0A 4K7JA 1ADJA 3DMDA 2XDWA 3KT8A 4NBWA 4OFBA 3WICA 3GUHA 3H2HA 4W7SA 5HUQA 3KB1A 5F98A 4CNQA 1F48A 1OHHA 4MO2A 4DMRA 1MUUA 1L8AA 5DTQA 2BFEB 4NE9A 2VJMA 3U3JA 4RIGA 3VUEA 2PT7A 5A5DA 4NJOA 5SV2A 2ZZNA 5KTNA 2C83A 2HNBA 1N3LA 2CFCA 1FP7A 3EIOA 3PG5A 2YQ5A 1ZD4A 1MKYA 3P27A 5TMEA 4KRYA 1Q0TA 4M86A 3ER8A 1TIPA 3T52A 1RJFA 1CJKC 1R18A 2UZ4A 3IXLA 1JHDA 1KYWA 1H8ED 2GLTA 2XNJA 3IT3A 4HDNB 3CB2A 5I9SA 3H1GA 3ZQJA 2FUEA 2C9OA 2ZM6B 4LHEA 1S8OA 2A7XA 3MNFA 4JLVA 1SCUA 2Q5OA 3GXOA 3M6FA 1AKWA 3MTQA 2CVHA 2WTXA 3BDVA 5CX1B 4AYWA 5A03A 4KREA 1K89A 2GAAA 4WWHA 1AGXA 1QR2A 2HPVA 4H9GA 3QJGA 2VHZA 3E7WA 4IGFA 1BQ4A 5E1DA 4HQKA 4PTLA 2C92A 3DLTA 2G88A 3GFVA 4A8JA 2IHNA 5AK0A 4L08A 1L7RA 3KAPA 1N9ZA 4HXEB 4Q9KA 2FN4A 1BC5A 3KSRA 5IF3A 3QELB 3DCJA 3G68A 4L2IB 4Y1FA 3QHQA 2IUFA 1A8SA 3W8FA 3FKSD 4KIGA 2GDJA 2N1BA 4M4SA 4G41A 5HCIA 2JAUA 2E4WA 2WHXA 1O0BA 3FFBA 2Q1YA 3FF1A 3OU2A 1U6KA 3DVQX 1NVTA 4YV7A 4DCPA 1SUCA 3AW8A 3NALA 4Z9YA 2OV8A 3PC7A 1JDNA 4FCCA 1Z28A 1NQAO 4I55A 3PQ8A 5AJXA 2JFWA 1VKHA 4JWKA 3TRHA 1WMSA 1JA1A 3STXA 1DWOA 1NFQA 2PGNA 2YICA 4I5DA 1U0SY 3P0IA 5FO0A 2DFDA 1VPTA 3REOA 3W2EA 1IJKA 1TF2A 2FW7A 1JEEA 2FN9A 2XZTA 3IBFA 3ZWPA 2NYAA 1AS3A 4LDRA 5CGQB 5DHFA 1HNZB 3L8ZA 3FMIA 3OCXA 1AHNA 4OXRA 4XJVA 5FA6A 3V42A 1UDXA 3DTYA 3NM6B 4P54A 4LSWA 1TCAA 4UQOA 4RK6A 2AOWA 3BMXA 2HCTA 1OBOA 4X1IA 4AZ3B 1TLFA 3HYNA 1P91A 2IQIA 1KDPA 2FE4A 2P6NA 1YMQA 2WOOA 4A23A 2WVAA 2IVFA 2LVBA 3PL1A 4XW2A 1LLUA 4BAZA 1UJ2A 1NNSA 1I7SB 2GVNA 4OAPA 7ADHA 5CLLA 4Q1BA 1T8RA 3AM1A 1P61B 2ANCA 2X15A 4BMPB 4J6EA 1J2RA 2KB0A 2O3JA 4H4EA 3E48A 3RK4A 4YUXA 2B34A 1ZN8A 3PF8A 1ZOSA 2QD4A 1GTVA 3LVQE 5B3AA 3UHFA 4GM1A 1TAGA 1QRRA 4KMRA 5AHKA 3AHHA 4EYSA 4G56A 1QHEA 3LNTA 5LBIA 3GNSA 1P75A 2B2XA 4FR0A 2H16A 1BEEA 1C3XA 3RRYA 4QUKA 2B35A 3CISA 4EVRA 5BYBA 4YMIA 2G7ZA 1FYEA 4LE1A 3TM5A 2B98A 2JI9A 2MOKA 1KBZA 3NTQA 3HRKA 5FPKA 5K20A 1QHHA 1W0KA 2NWQA 4IJMA 1YZLA 3DYVA 3OFJA 1M5RA 1AGRA 1YR3A 2G9QA 3AKEA 4LZAA 4UXIA 1N2IA 1OASA 3OCWA 2AW3A 1BJTA 1XKXA 3H75A 1RRGA 4G1MB 3D2BA 4M9CA 5F7XA 1YBVA 3BMOB 3MJHA 3OQHA 2FR8A 1Y5MA 4LJSA 1FDVA 1HWYA 4J0FA 4O1IA 5EP2A 3UENA 1C7JA 1F2TB 4KQEA 5ECWA 3LYHA 4EYGA 2CJXA 3VU3A 2CLSA 1W49A 4CKYA 1E3IA 4H77A 2W42A 1ATZA 4L6AA 4WRRA 4ZVKA 4R9UC 5ADVA 4M36A 2G1PA 2A5LA 3K8YA 4XFJA 3Q6NA 2WTNA 1ORTA 4IHJA 4LOLA 1YUMA 4M8SA 2GEUA 1QHHB 5AOCA 4DJTA 1G20B 3RVKA 4XVCA 3BREA 3UMGA 2IYNA 3COYA 4LJKA 1XVUA 3OQJA 4OLFA 1RBMA 3FWPA 4S0XA 4TMWA 1HPLA 3PEVA 1R00A 2ODWA 2JCBA 3PDIA 4M1KA 2WLTA 3ADKA 2F3SA 4MH0R 3VSEA 2I3GA 1QO0A 3EVEA 4QJIA 1MLDA 4CR7A 4YAUA 1T4DA 2MYPA 4TS3A 4BZZA 4F86A 2J09A 4B76A 2JLYA 3AB7A 1A8IA 2R00C 3B78A 1FTYA 4S35A 1UKAA 1Y1RA 5C37A 3CLTC 3LG2A 1D07A 4HNRA 3T41A 3QMMA 2D1RA 2X9GA 1NFRA 3RRNA 1EQUA 1G20A 2CFRA 3CMCO 4PG6A 4X0EA 4YACA 5B1HA 5JCJA 3BILA 1YZVA 3OIUA 5KVQA 5BW5A 1Z0SA 3QVUA 4Y2PA 3GJ3A 5LUBA 4DANA 1XQVA 5JISA 3HWWA 5A6SB 3V46A 2P65A 5ADHA 3GVHA 1NVXQ <