1DP6A

Oxygen-binding complex of fixl heme domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIXL PROTEIN
publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp6A00
3LIFA 3HJIA 3E4OA 4JGPA 2QHKA 3P7NA 4B9OA 3F1OB 4F3LB 3LYXA 3UMDA 3NOUC 4K08A 4KUOA 3H82B 3LIBA 1BYWA 4HH3A 3BY9A 1LL8A 4PKYG 3FC7A 2GJ3A 1OJGA 1TS0A 1N9LA 4I3JA 1F9IA 3T50A 1X0OA 2V9AA 1TS6A 5G4YA 1OTAA 4WF0A 4L9GA 5HD5A 2M1CA 4JGQA 5I5LA 2EA9A 3ICYA 1T1CA 4HH2A 3UB6A 4PKYA 1G28A 5DJUA 4KUKA 3VE3A 4RQ9A 5DKLA 1KOUA 3ULFA 4I3AA 3K3DA 2PDRA 1S4SA 2K7SA 5HSQA 3H7WA 5HD3A 3IS2A 5HZHA 4HIAA 1GSWA 3PHYA 2L4RA 4DJ3A 4I38A 2PD7A 3A0SA 5IU1A 1UWNX 2ZOIA 1TS8A 2V1BA 2ZBBA 3CAXA 2H28A 4YWZA 4R38A 3K3CA 1UGUA 1Y28A 2VEAA 4H6JA 2WKQA 3UB9A 2PD8A 2YKFA 3B33A 2VV8A 1VB6A 4XT2A 3NOTC 2OOLA 5F5YA 1DP9A 4GHIB 4HHDA 4HP9A 2B02A 3H7WB 3LI8A 1T18A 2OWHA 2VV7A 4WN5A 1GSXA 2OWJA 2A24A 4EXOA 3EEHA 1S1YA 2V0UA 1OT6A 2D02A 5HDDA 2I9VA 1S1ZA 4NXGA 4BBUA 5J7EA 1GSVA 1OTIA 1S66L 4EERA 3MFXA 5DKKA 2WKRA 2P7JA 2PHYA 1EW0A 3MQQA 4H6JB 2PYRA 5TBMA 2Z6DA 1DRMA 5KIZA 3CLOA 3ZQ5A 3UE6A 2L0WA 5AVEA 1OTEA 4HQAA 2V0WA 4LRYC 1MZUA 5F68A 2VV6A 1T1BA 2W27A 3GECA 4EEUA 4R6LA 2A24B 5G4ZA 1N9NA 2PR6A 3LIDA 5HDCA 4EESA 4LRZE 5HWTA 3IBRA 1T19A 4WLAA 1XJ4A 1XJ6A 2QKPA 4E04A 4I39A 3LIEA 1WA9A 4NXFA 4DJ2A 4WL9A 2R78A 1D06A 5TBMB 5HDSA 4GS9A 3F1NA 4JGOA 3EWKA 3F1OA 3VOLA 2QWSA 3F1PA 4HI4A 3MJQA 2D01A 3C2WA 3C8CA 3LICA 1TS7A 1OTDA 1V9YA 5EFWA 3PYPA 1JNUA 1S67L 1DP6A 3NJAA 3RH8B 4BBVA 4L9EA 4EW7A 2HV1A 1XFNA 3LUQA 3UB8A 3SW1A 4GW9A 5HWWA 1D7EA 4WUJA 5IS1A 5J4EA 2L1MA 3IS2B 4KQDA 4GS9B 1LSWA 3F1NB 1V9ZA 3BY8A 3H9WA 4GCZA 4EETB 4HOIA 1P97A 4LLOB 2QJ7A 3HJKA 2JHEA 2KDKA 4NXBA 2PYPA 2INWA 3F1PB 3UMEA 1LSXA 2CMNA 4R3AA 3LIAA 3G6OA 3FG8A 4M4XA 3NOPC 3MXQA 3CWFA 3E4QA 5AVFA 4XT2B 1T1AA 2V1AA 5F69A 2PR5A 2J80A 2JN7A 3E4PA 5J3WA 2VLGA 2ZOHA 3MQOA 1N9OA 4MN5A 3LI9A 4R70A 1XJ3A 2Z6CA 2BASA 4EEPA 2QJ5A 3VE4A 4NXEA 1F98A 5F6AA 1ODVA 3RTYA 4LRXC 2W0NA 1LT0A 4HNBA 4L9FA 4HJ3A 4HP4A 4LPZA 1LSVA 2YKHA 1OTBA 1UWPX 3KX0X 3OLOA 3A0VA 4HJ6A 4F3LA 4GHIA 1OJ5A 5A8BA 5HWVA 4JGRA 1DP8A 3A0RA 3BWLA 4HJ4A 3H82A 3GDIA 4I5SA 3D72A 4BBTA 3UB7A 1OT9A 1P0ZA 3MR0A 2WKPA 1S4RA 4EQ1A 1NWZA 1XFQA 4MN6A 4I3IA 5DJTA 2KX6A 4HY8A 3NHQA 1XJ2A
chains in the Genus database with same CATH superfamily
3E4OA 3W4PA 1HTZA 3QHYA 2QHKA 4F3LB 5FASA 3IH9A 2A2LA 2XD5A 1FCOA 4IUHA 4KUOA 1W8QA 2J3WA 2VKSA 3H82B 1XKZA 4B93A 3IH8A 4EV4A 3D4FA 3FC7A 1OJGA 5HL6A 1KGFA 3RFBA 1TS0A 1N9LA 3ZG8B 4S2OA 3NC8A 3LEQA 2J7VA 3W8KA 2MJ6A 1RCJA 3M2JA 2VGLS 2P74A 2VX8A 4G3KA 5EM0A 3UE3A 5IT5A 5L07A 4ZJ1A 4L9GA 5HD5A 4B88A 4JF5A 2R9WA 4JGQA 1T1CA 3FZCA 1DJAA 3PBSA 5DJUA 1E25A 5CXWA 1WYCA 3VP3A 4ME4A 1Z6FA 3D9YA 5G18A 4WEKA 5HFOA 3TG9A 5AQAA 3VMAA 2PDRA 4JF6A 2K7SA 5HSQA 4N1XA 4CLCA 5HD3A 2J9OA 3IS2A 4HIAA 3UDIA 2L4RA 1FR6A 2WZXA 1CEGA 5IU1A 1F5MA 3B47A 5FQ9A 3DTKA 3CAXA 4X53A 4G3VA 2HDUA 4YWZA 4R23A 4R38A 1UGUA 3BFDA 4H6JA 4OLDA 3NCKA 1SKOA 3UB9A 2PD8A 1L0DA 4BD1A 3EOIA 3HL9A 3B33A 5EVIB 3T1QB 3TOIA 1VB6A 4JXSA 3A3IA 2B18A 4MCWA 2DRWA 1ESIA 4HP9A 2XFSA 3H7WB 3BLMA 1RP5A 4IJGA 1TDLA 2CC1A 2ZM8A 4EXOA 2ZM2A 3HLEA 3G31A 3BEBA 2EFXA 1S1ZA 2EX8A 2KOIA 4EERA 3MFXA 3PAGA 4B4ZA 2WKRA 2ZM0A 2PHYA 3WWXA 4O7DA 4DDSA 1EW0A 3BFFA 2E8IA 3MQQA 4IEDA 3VP1A 1CI9A 5EVLA 4EU0A 3C30A 3DBAA 5KIZA 3G32A 5E43A 5HPFA 2QYBA 2UV0E 5EECA 1OTEA 5CGWA 2V0WA 1MZUA 5F68A 5HW3A 2DMWA 2A24B 3S7QA 3WS2A 1PIOA 3LIDA 4LRZE 2ZC7A 3UO9A 1KGGA 3K2NA 1NLYA 1Y4OA 4KZ5A 1I2SA 4LGWA 2H5SA 1ACFA 3O87A 3NULA 3IXGA 4S2PA 3LIEA 2EXAA 1GHMA 3IHAA 1D06A 2Y8HA 3UN7A 5HDSA 5EPHA 3F1NA 2WGWB 5C5KA 2J3TD 1W63Q 3UNWA 2G2UA 3VOLA 3TJZC 1MXOA 3F1PA 4HI4A 1NYYA 2EX2A 3WS5A 4Q0IA 1TS7A 3BW6A 1IELA 3G2ZA 1ERMA 2WYXA 3NJAA 4OPYA 5FI6A 4ZAMA 4BBVA 4L9EA 3IWOA 5FAOA 3FWLA 3VSLA 1D7EA 5TR7A 5GHXA 4Y17A 3UDFA 3T4QA 5FEFA 2EWVA 3IS2B 4MMNA 4WYYA 2Z2LB 1XA7A 1LSWA 3IWIA 3CHWP 3B3XA 3H9WA 4N9KA 4HOIA 4LLOB 1BLPA 2ZQ9A 3HJKA 1YM1A 2KDKA 4NXBA 4B4XA 3B42A 2IWCA 1OPXA 2XR0A 4NETA 2XH9A 4R3JA 3V5MA 5FEGA 1N9BA 3LIAA 5L8MA 3TSGA 4OONA 3G6OA 4O0PA 2WKHA 3NOPC 5GL9A 3CWFA 2Y4AA 1L2SA 5AVFA 3Q7VB 4GOGA 2V1AA 5F69A 3V39A 2HF6A 2ZJ9A 3UDXA 1I5QA 1YSPA 3UPPA 5A91A 2JN7A 2VLGA 4OPRA 1N9OA 3LI9A 5KZHA 2WGVA 1A0KA 3R7WA 1KE0A 4LV1A 1ALQA 1BLCA 5CHJA 3T4TA 1NXYA 4FH4A 4EBPA 4IBXA 1GA9A 5HX9A 4WZ4A 2WGIA 1NRJA 2HP6A 5TFQA 5CEDA 4OPZA 1NZOA 2W1RA 4FD8A 1MKIA 3QP6A 3MS6A 3U4LP 3TW8A 1PI4A 4F3LA 4DE3A 3HBRA 2ZMFA 1M6KA 3T12B 4JGRA 3A0RA 3BWLA 3O88A 4X6TA 4OOMA 3DTMA 2ZD8A 3G2YA 3H82A 4O8GA 4I5SA 5A90A 2XF3A 1H0MA 5DVAA 3MR0A 2E8JA 2C6WB 1XFQA 4Y2FA 3ZG7B 2KX6A 4Y0UA 4DXCA 3T1XA 1FIKA 1E3UA 3ZVTA 1Y54A 5CEBA 3SH9A 3LIFA 1PI5A 1KVLA 5L2FA 4BL2A 3P7NA 1IOUA 5D3OA 2OLVA 3PBQA 3RXXA 2BLSA 4GD6A 3NY4A 3PBRA 4K08A 4GNUA 3T1RA 1PNEA 4XUZA 4Y0TA 1L3LA 4MEZA 3LIBA 4OP8A 1BYWA 1NRFA 2IWDA 2V8FA 3VOZA 2Q9MA 1LL8A 1CK3A 3ZNTA 2KLIA 4IBRA 2GJ3A 1PZOA 1OMEA 4Z9QA 4KZBA 3FYZA 1VQQA 4I3JA 1X0OA 2W3DA 3QP2A 2XD1A 2EFUA 2Y2PA 2HPBA 3KO6A 3ITAA 2VK3A 4GZBA 1MC0A 1FCNA 2Z2MB 1PFLA 3C7UA 4WF0A 4P6BA 3VFHA 3M6HA 5FDHA 2H0YA 2M7VA 5I5LA 2EA9A 5DTKA 1TDGA 2FFYA 3N8LA 1ZHHB 4GLQA 5EV0A 5CTMA 3ISGA 2HZ5A 1IYSA 3OCLA 5MC7A 4X25A 4F94A 3CI6A 3KSHA 4CPKA 2OAQ1 4WMCD 4XXRA 3G34A 3VE3A 4BD0A 4X56A 1ONGA 3DTEA 3A3JA 5DKLA 1MY8A 4RA7A 2HJ9C 2GNXA 2ZMAA 4QY6A 1K54C 5DF9A 2WZZA 2Y2HA 4Q0JA 3LEZA 3H7WA 2OAP1 5FI2A 2Y2LA 5M19A 4MBHA 2H0TA 4FTXA 1GSWA 3NECA 5HAQA 3R7WB 2HP9A 2WUQA 2O9BA 2PD7A 1FR1A 2ZOIA 1ZKJA 1YQSA 1G6OA 2OV5A 1TS8A 1YLYA 4MBFA 2R9XA 3CG5A 3HREA 5FATA 5FAQA 4S2LA 1Y28A 2VEAA 4X68A 2JKTI 2XEPA 5CRFA 3TRCA 4ARZB 2VV8A 2JKGA 4IVIA 2LB5A 4P0MA 5FQMA 1FILA 3BJNA 4UA9A 2IWBA 1BULA 2Y2JA 3SOIA 3HVFA 2VV7A 2JKTM 2OWJA 5GLBA 3V50A 4S2KA 2A24A 2FH5A 5AQBA 5HL1A 5DTSA 4GB7A 1U60A 5HDDA 4NXGA 1GSVA 5EOEA 5DKKA 2P08A 4S2MA 3QNBA 1K55C 1S0WA 4EQIA 4FH2A 1DRMA 5F82A 3CLOA 1CJFA 2ACGA 3C4OA 3AGDA 1KVMA 2WGWA 4MBKA 5AVEA 3CMZA 3C38A 4HQAA 5CHUA 3T4JA 3NDGA 4LRYC 2VV6A 4OQGA 1T1BA 4E3LA 5GHZA 4KG6A 3UB5P 5G4ZA 2PR6A 4JKTA 5HDCA 3FKWA 5HWTA 5HAPA 3IBRA 4KQQA 1XJ4A 2XRNA 2Y2KA 1W7FA 3ZFZA 2QKPA 4E3IA 3KYEA 3NIAA 4I39A 3PBTA 1WA9A 1Q2PA 4OQ0A 4NXFA 5FL3A 3PR6A 1PW8A 1K57C 4JGOA 1PRQA 4RX2A 4LV0A 1PWCA 2W3FA 4ID4A 5IHVA 2QWSA 5CGXA 1L0EA 5FSRA 2AVXA 2RL3A 1PW1A 1FSYA 3C2WA 3C8CA 4GDNA 2W3GA 3LICA 3ZNYA 3N8RA 4WEJA 1XGJA 5EFWA 2O9AA 2ZQ8A 1S67L 2V20A 3RH8B 2LB9A 1YLZA 4EUZA 5FA7A 4E3OA 4RYEA 1W79A 3LR3A 3NI9A 1XFNA 3OCNA 3Q7VA 4R4SA 5IS1A 2PT7A 2P04A 3HUNA 4MDZA 3GTCA 5J4EA 1AWIA 4K0WA 1AXBA 3OOVA 4WM9A 1V9ZA 2Q9NA 4GCZA 3BQAA 4PM7A 1JWPA 3O3VA 1P97A 4KENB 1IYQA 2JHEA 5GLDA 3E2LA 4KZ8A 3ZVWA 4BENA 4EBNA 1XP4A 3OBFA 5HPIA 4R3AA 1J3WA 3TE8A 4CLCD 2UWXA 4CLCE 3FG8A 3P09A 4PM8A 3G4PA 3E4QA 3VP2A 1LI9A 2EWWA 2VZWA 3GVBA 2JKFA 3CZDA 4GKUA 2PR5A 2J80A 5L10A 4KG2A 3MQOA 4ESPA 3IT9A 1H8ZA 3MXRA 1LL9A 2Z6CA 2BASA 3QP5A 1ZC2A 2V2FF 4LV3A 3EQUA 3HLDA 5E2EA 1FQGA 1HD8A 1K38A 3RTYA 2ZLYA 4LRXC 2EX9A 1O7EA 3UPOA 1LLBA 3IBJA 2GX5A 1LT0A 4HNBA 5F1FA 4HP4A 2QMIA 1Q2QA 3GRJA 1YLWA 4OOYA 2VGJA 4KZAA 4LPZA 3KYQA 3LCEA 3S7NA 4LFUA 3KSGA 3Q1FA 2YKHA 5FDSA 1K54A 3RXWA 1K6RA 4HJ6A 5FQKA 2Y2IA 3AGEA 3HLBA 1PWGA 1D1JA 1DJCA 3GDIA 1KDWA 4BMWA 3VV4A 3VFFA 2OSUA 4RX3A 5CERA 4NEED 4EQ1A 1YKDA 2FZ0A 1VEUB 4UA7A 2JC7A 3MZDA 5DJTA 1TEMA 3E98A 4E3JA 2XDMA 3EQVA 3MZEA 4KZ4A 4EWFA 4CJNA 4DKIA 5AQ7A 4YOFA 1E4DA 3HUMA 4Y3IA 3HJIA 2XFTA 1YPRA 3M2KA 1NLZA 4B9OA 4QD4A 1QMEA 4R3BA 3UMDA 3P01A 1QMFA 4OQIA 4EUVA 1YSQA 4ETXA 1BSGA 1C3BA 3OC2A 1G5UA 4KQRA 2JKRI 2PU4A 4LENA 4DRTA 4BJPA 3P98A 3T4LA 3S1YA 4NKPA 5FAPA 5EUAA 5KSCA 4K0XA 4BQMA 4Y7PA 3ZDJA 1F9IA 3T50A 3MKEA 2V9AA 3U2AA 1FOFA 3BFCA 4II7A 1K56D 3Q07A 1TS6A 1K55A 2JKRM 1IFQA 2ZL1B 4YINA 5G4YA 4N92A 1P9RA 1NY0A 1H3QA 4MNRA 2J9PA 1ZTUA 2WKIA 5DF7A 1SZVA 1VM1A 1XGIA 4DN0A 3SS4A 3HLFA 4JXWA 3WRTA 2HJEA 4OKPA 3ICYA 5M18A 4HH2A 4C75A 3HLGA 4K91A 1YMSA 4WBGA 1G28A 3OPRA 2O9CA 4S2IA 2NUPC 1LHYA 1XXMA 1O07A 4RQ9A 4ARZA 4I3AA 3K3DA 1S4SA 1DJBA 1P9WA 2QZ6A 2G7UA 4WZ5C 5FQQA 3WRZA 3ITBA 3MSHA 5HZHA 3HCYA 2K31A 4JXGA 1K57A 2K2NA 3A0SA 4HBTA 3DWZA 2JE5A 2PRFA 5KMWA 3BRMA 1EROA 1LL5A 3QP8A 3Q81A 2ZC5B 3ZG5A 1CF0A 2I72A 3NDEA 3MFDA 2G2WA 3CPTA 3CUEC 1L0FA 3IWQA 3O5YA 2Q0OA 4HEFA 3NOTC 4FOFA 4XT2A 5F5YA 1KE3A 1MBLA 3IF6B 3BFEA 3VSKA 2B02A 3LI8A 4MN7A 4NK3A 1T18A 2OWHA 3KSFA 1GCEA 2V8CA 4WMCA 2XQZA 4NG2A 5F83A 4OOLA 2J3TC 3PBOA 3R4KA 2X02A 4X55A 2HDQA 4WELA 3MF0A 4BBUA 3MBZA 4G3WA 5J7EA 2X01A 4DMZA 2P7JA 3DW0A 1BUEA 1PYYA 3T4KA 4X1MA 1J9MA 3BFGA 3ZQ5A 3T4SA 3IF5A 4DE1A 5J8XA 3LY4A 2HDSA 1F2KA 2A3UA 3V3SA 3JYIA 4CQHA 4GD8A 3GR2A 3CJMA 4R6LA 4E3MA 2WADA 1E3UD 5EM1A 5AQ9A 1N9NA 3NBLA 2EX6A 2XK1A 5KSHA 4QWOA 4WLAA 3GV9A 2V1ZA 4D60A 1XJ6A 4YNRA 4GDBA 4JBFA 5A92A 3IXBA 3ZCZA 1ERQA 1KE4A 4EBLA 2WK0A 2PBYA 3D3OA 4OP5A 3BQ8A 3IF6C 4FCFA 2XSSA 1FCMA 2R78A 4WL9A 1FSWA 4LCMA 5CGSA 5TBMB 4U0TA 5GHYA 3OPHA 4ZJ3A 3C4PA 3DWKA 3Q82A 5HARA 3G35A 3F1OA 4YFMA 1PZPA 1MWSA 3MJQA 3ZYTA 4P85A 1I2WA 4IHQA 4R0QA 1OTDA 3ZGAB 3MMHA 2HGVA 3PYPA 4IUKA 1JNUA 4PM9A 1SCWA 4LCLA 4EW7A 3UPNA 2HV1A 2H10A 3LUQA 3UB8A 3SW1A 2GDNA 4PAUA 4P87A 3UY6A 4WUJA 3LR0A 3S22A 2XLNA 4AFIA 3W2ZA 2JBFA 4ZTKA 2ZQCA 4S2NC 4GS9B 4E3NA 4GN2A 4UA6A 4EETB 5FQJA 2QJ7A 1H5XA 3C7VA 2PYPA 3FPVA 3OZHA 1LSXA 2NUTC 3MKFA 3IQAA 5EVID 2Y2NA 3I7JA 2B95A 5I94A 1SDNA 3CPTB 4M4XA 4OVDA 2B5RA 4XT2B 3SZTA 3S7PA 5CECA 1N4OA 3E4PA 4ZRRA 2ZOHA 4Q0HA 1Z09A 4R70A 4BWIA 2WAEA 4ZBEA 3LR4A 4EEPA 1YLTA 2QJ5A 2IA2A 4NXEA 4BLMA 3O86A 5F6AA 1ODVA 3EGDC 1EI5A 1XA1A 2W0NA 1VEUA 5GLAA 3BECA 3SH7A 1VETA 1BZAA 4C3QA 5A93A 1LSVA 4Y13A 3LFVA 3UE1A 3IXDA 2OLUA 1ESUA 4MLLA 4Q8IA 1NZUA 5E2FA 3LY3A 4UAAA 4JPMA 2GZAA 1UWPX 1ES3A 3A0VA 1XPBA 2BG1A 5K5BA 5LBRA 4GHIA 3G30A 1OJ5A 4WZ5A 2M7UA 5HWVA 1DP8A 4UHUA 3LR5A 1WYBA 1YAXA 3C5AA 3WS0A 5FI7A 4BBTA 4PMAA 4X69A 1K25A 1IKIA 3LGOA 4HBUA 1W63M 1S4RA 4MN6A 4I3IA 2PAVP 5AJGA 3ZHHA 2BTFP 3S7OA 2EXBA 2Y2MA 2ZL1A 3NHQA 2ZQDA 3CUEA 2VGKA 4DF6A 4JGPA 2A49A 3F1OB 3LYXA 4JLFA 3KSIA 2FFFB 3NOUC 4KZ9A 4L0LA 3GMWA 1K4EA 4PM5A 2Y2OA 4HH3A 1GHPA 3BY9A 1KDSA 3N6IA 3PBNA 4PKYG 3PXPA 4QHCA 4KZ6A 4JF4A 4E6XA 2W1TA 3GQZA 2Y79A 3DTIA 2ZQAA 2PU2A 4BL3A 1OTAA 1JWVA 1K4FA 2ZMVA 2P9VA 4R1GA 3L9KA 4PHTA 3CITA 1SDEA 2M1CA 1ONHA 3IX4A 1HLUP 1MKMA 4KG5A 4H8RA 5EVEA 1EWZA 3UB6A 4PKYA 3VOYA 2ZC6B 4QPRA 5GLCA 3A3FA 3QNCA 3IX3A 4KUKA 1DY6A 3HLCA 2XGNA 3E2KA 2ZQ7A 1KOUA 1JTGA 3BLSA 5EVIC 3ULFA 1HVBA 3IF6A 1BT5A 4R4RA 2Y55A 3PHYA 4JXVA 2Y91A 4DJ3A 4FUWA 4I38A 2PBDP 4X1LA 4Y15A 1UWNX 4O01A 5EE8A 1BLHA 2V1BA 4U0XA 1ES5A 1K56A 2ZBBA 3FPWA 1VETB 5JYOA 1ZG4A 2H28A 4QU3A 3T4OA 1ES4A 3K3CA 1VHMA 4ZDXA 1JVJA 2WKQA 2YKFA 3T1SA 2JCHA 4DDYA 2OOLA 1DP9A 1TVFA 4GHIB 4HHDA 5EOOA 4N1HA 1YLPA 5DFYA 4CLCB 1SKFA 1ES2A 3L7HA 4S2NA 2VA0A 4WN5A 1GSXA 2ZC4B 4GJ4A 4P6ZM 1BTLA 1YLJA 4PPRA 4QB8A 3EEHA 1IYPA 1S1YA 4PM6A 4UQIM 2V0UA 1OT6A 2D02A 2I9VA 3OPLA 4LV2A 3SH8A 1OTIA 3QP1A 1S66L 3FV7A 4QY5A 4OPQA 1CI8A 2RCXA 5BOHA 1XX2A 4H6JB 2PYRA 5U47A 5TBMA 2Z6DA 1SKOB 3ZG9B 2DNSA 1CQAA 3UE6A 3Q7ZA 2L0WA 3W4OA 2Y2GA 1BLSA 1LI0A 5L09A 4OQHA 2WKEA 2W27A 3GECA 3M6BA 4EEUA 1M40A 1TD5A 4P6ZS 1W8YA 4EESA 5JYPA 4UQIS 1T19A 5FQIA 4KZ7A 4D2OA 2HP5A 2J8YA 4E04A 2W3EA 4Y5FA 1G68A 4DJ2A 1NJ4A 2W1TB 5F1GA 3RJUA 2VJWA 4E3KA 4CLCC 1G6AA 3QP4A 2C5WB 5TGFA 4GS9A 2Y2QA 4ETZA 3IX8A 4KQOA 3E0YA 3EWKA 1GHIA 3S4XA 2P9VB 3KYZA 1WE4A 2W3HA 3MQ0A 3JPUA 2D01A 2WAFA 1V9YA 4IVKA 3JVUA 1L0GA 1DP6A 1SHVA 2O99A 5DTTA 3UE0A 3VP0A 3HUOA 3HLWA 1JTDA 3PTEA 1JWZA 4E6WA 5E2GA 4GW9A 5HWWA 1K0KA 4U3TA 3V67A 1GA0A 2L1MA 2XROA 1IKGA 4KQDA 3F1NB 1PWDA 3BY8A 5CTNA 1NYMA 1MWUA 3GSGA 5DFXA 1H8YA 2INWA 2X71A 3F1PB 3UMEA 2CMNA 5DF8A 1MWRA 4Z1WA 3OPPA 1STZA 2XA7M 1TF1A 1W5DA 3SS3A 3DAVA 3MXQA 3PAEA 3IXHA 2HDRA 1T1AA 3IHBA 3WS1A 1K6SA 5HAIA 4OLGA 4N9LA 5J3WA 4C6YA 5M1AA 4S2JA 4M3KA 4MN5A 1IEMA 1XJ3A 3MXSA 4UEYA 4OH0A 3VE4A 1F98A 1YMXA 4Y0OA 3BYDA 3FKVA 1IYOA 4A5RA 4L9FA 3N7WA 4HJ3A 1MWTA 1MPLA 1H8MA 2XA7S 3A3EA 4QJGA 4HESA 4KZ3A 3LO7A 1ZG6A 1OTBA 3EGXC 1RGYA 3KX0X 3OLOA 3EEAA 1RGZA 2Y59A 5EVIA 5TJJA 2QPNA 3MZFA 3A3DA 4DE2A 5A8BA 4RVAA 3ZG0A 5CX7A 4HJ4A 3V3RA 2O0YA 3N8SA 3W4QA 1HZOA 3BM6A 4DXBA 3SS5A 3D72A 1YT4A 3UB7A 4XUXA 1OT9A 1P0ZA 4DE0A 2WKPA 3AGFA 5E2HA 3WS4A 1NWZA 3N4IA 2ZC3B 4FSFA 5CHMA 4ZJ2A 2DCFA 4HY8A 1KGEA 3JVVA 1CEFA 1S6RA 3VP4A 2VGLM 1XJ2A
chains in the Genus database with same CATH topology
3LIFA 4YOFA 3CUEA 4Y3IA 3HJIA 3E4OA 1NLZA 4JGPA 2QHKA 3P7NA 1IOUA 4B9OA 3F1OB 4F3LB 3LYXA 3UMDA 3PBQA 3KSIA 3P01A 3NOUC 2A2LA 3PBRA 4K08A 1YSQA 4EUVA 4L0LA 4IUHA 4KUOA 2J3WA 2VKSA 3H82B 4ETXA 3LIBA 3OC2A 2JKRI 1BYWA 4B93A 4HH3A 4BJPA 3BY9A 1LL8A 3T4LA 4NKPA 2KLIA 3PBNA 4PKYG 3FC7A 2GJ3A 1OJGA 3PXPA 5HL6A 3RFBA 1TS0A 1N9LA 4I3JA 1F9IA 3T50A 1X0OA 2V9AA 2W3DA 3U2AA 4II7A 2MJ6A 1TS6A 2W1TA 2JKRM 1IFQA 3KO6A 2VGLS 2VX8A 5G4YA 2Y79A 4G3KA 1P9RA 3UE3A 1H3QA 1MC0A 5IT5A 1OTAA 1ZTUA 4WF0A 2ZMVA 4DN0A 4L9GA 4PHTA 5HD5A 3CITA 2M7VA 2HJEA 2M1CA 4JGQA 5I5LA 2EA9A 3ICYA 1T1CA 1MKMA 4HH2A 3UB6A 4PKYA 4QPRA 1ZHHB 4GLQA 3OCLA 1G28A 3PBSA 5DJUA 2O9CA 2NUPC 3CI6A 3KSHA 5MC7A 2OAQ1 4KUKA 3VE3A 4RQ9A 5DKLA 1KOUA 4ME4A 2HJ9C 2GNXA 4ARZA 4WEKA 3ULFA 4I3AA 3K3DA 5DF9A 2PDRA 1S4SA 1P9WA 2G7UA 4Q0JA 2K7SA 5HSQA 3H7WA 4CLCA 5HD3A 2OAP1 3IS2A 5HZHA 3HCYA 2K31A 4HIAA 2K2NA 1GSWA 3R7WB 3PHYA 2L4RA 4DJ3A 4I38A 2O9BA 2PD7A 3A0SA 5IU1A 1UWNX 2ZOIA 4O01A 1G6OA 1TS8A 1F5MA 2V1BA 3B47A 2ZBBA 3FPWA 3CAXA 2H28A 4G3VA 4YWZA 4R38A 3T4OA 3K3CA 1UGUA 1Y28A 1VHMA 2VEAA 4H6JA 2JKTI 2WKQA 3CUEC 3UB9A 2PD8A 2YKFA 3EOIA 3TRCA 3B33A 4ARZB 3O5YA 2VV8A 1VB6A 4XT2A 3NOTC 2OOLA 4FOFA 5F5YA 2B18A 2LB5A 1DP9A 4MCWA 4GHIB 4HHDA 3BJNA 4HP9A 2B02A 3H7WB 3LI8A 5DFYA 4MN7A 4CLCB 1T18A 2OWHA 2VA0A 4IJGA 2VV7A 4WN5A 1GSXA 2JKTM 2OWJA 3KSFA 2A24A 4GJ4A 2FH5A 4P6ZM 4EXOA 3EEHA 1S1YA 4UQIM 4OOLA 2J3TC 3PBOA 3R4KA 2V0UA 1OT6A 2D02A 5HDDA 2I9VA 4WELA 3MF0A 1S1ZA 4NXGA 4BBUA 4G3WA 5J7EA 1GSVA 2KOIA 1OTIA 1S66L 4EERA 3MFXA 5DKKA 4DMZA 2P08A 2WKRA 2P7JA 2PHYA 1EW0A 3T4KA 3MQQA 4H6JB 2PYRA 5TBMA 2Z6DA 3C30A 4EU0A 1DRMA 3DBAA 5KIZA 3CLOA 3ZQ5A 3UE6A 3T4SA 5HPFA 2L0WA 2QYBA 5AVEA 3C38A 3NHQA 1OTEA 4HQAA 2V0WA 3T4JA 4LRYC 1MZUA 5F68A 2VV6A 4CQHA 1T1BA 2W27A 3GECA 2DMWA 4EEUA 1TD5A 2A24B 4R6LA 3S7QA 4P6ZS 5G4ZA 1N9NA 2PR6A 3LIDA 5HDCA 4EESA 4LRZE 5HWTA 5KSHA 3IBRA 4UQIS 1T19A 3K2NA 1NLYA 4WLAA 1XJ4A 2XRNA 1XJ6A 4YNRA 2QKPA 4E04A 4I39A 2W3EA 3PBTA 4Y5FA 3LIEA 3D3OA 1WA9A 3BQ8A 4NXFA 4DJ2A 2W1TB 2XSSA 4WL9A 2R78A 5FL3A 2VJWA 1D06A 3PR6A 4CLCC 5TBMB 2Y8HA 5HDSA 4GS9A 3F1NA 4JGOA 4ETZA 4KQOA 5C5KA 3E0YA 3EWKA 2J3TD 1W63Q 2W3FA 3KYZA 3F1OA 3VOLA 3TJZC 2QWSA 3F1PA 4HI4A 2W3HA 3MQ0A 3MJQA 3ZYTA 2D01A 3C2WA 3C8CA 3LICA 2W3GA 4IHQA 1TS7A 4Q0IA 1OTDA 3MMHA 2HGVA 3BW6A 1V9YA 4WEJA 3JVUA 5EFWA 3PYPA 4IUKA 1JNUA 2O9AA 1S67L 1DP6A 3NJAA 2LB9A 3RH8B 2O99A 4BBVA 4L9EA 4EW7A 2HV1A 3LR3A 1XFNA 3LUQA 3UB8A 3OCNA 3SW1A 4GW9A 4PAUA 5HWWA 1D7EA 4WUJA 3LR0A 5IS1A 2PT7A 2P04A 3V67A 4MDZA 5J4EA 3T4QA 2EWVA 2L1MA 3W2ZA 4AFIA 3IS2B 4MMNA 2XROA 4KQDA 4GS9B 1LSWA 3F1NB 3OOVA 1V9ZA 3BY8A 3H9WA 3BQAA 4GCZA 4EETB 4HOIA 1P97A 4LLOB 2QJ7A 3HJKA 2JHEA 5DFXA 2KDKA 4NXBA 2PYPA 3FPVA 3B42A 2INWA 1OPXA 3F1PB 3UMEA 1LSXA 2NUTC 2CMNA 3OBFA 4Z1WA 5HPIA 4R3AA 1STZA 2XA7M 1TF1A 3LIAA 5L8MA 3TE8A 4CLCD 4CLCE 3G6OA 4O0PA 3FG8A 4M4XA 3NOPC 3MXQA 3CWFA 3E4QA 5AVFA 4XT2B 1T1AA 2EWWA 2V1AA 2VZWA 5F69A 2HF6A 1YSPA 2PR5A 2J80A 3S7PA 2JN7A 3E4PA 4ZRRA 2VLGA 5J3WA 2ZOHA 3MQOA 1N9OA 4MN5A 4Q0HA 3LI9A 4R70A 4BWIA 1XJ3A 2Z6CA 3LR4A 2BASA 4EEPA 4UEYA 2QJ5A 3EQUA 3VE4A 3R7WA 2IA2A 4NXEA 1F98A 5F6AA 1ODVA 3RTYA 3T4TA 3EGDC 4LRXC 2W0NA 3IBJA 2GX5A 1LT0A 4HNBA 4L9FA 4HJ3A 4HP4A 1H8MA 2XA7S 4LPZA 3KYQA 1NRJA 1LSVA 3LFVA 3S7NA 3KSGA 2W1RA 2YKHA 1OTBA 3EGXC 2GZAA 1UWPX 3KX0X 3OLOA 3EEAA 3A0VA 5TJJA 4HJ6A 3TW8A 4F3LA 5K5BA 5LBRA 4GHIA 2ZMFA 1OJ5A 5A8BA 2M7UA 5HWVA 4JGRA 1DP8A 3A0RA 3BWLA 5CX7A 3LR5A 4HJ4A 1YAXA 4OOMA 2O0YA 3H82A 3GDIA 4O8GA 4I5SA 4BMWA 3D72A 4BBTA 3UB7A 1OT9A 1P0ZA 3MR0A 2WKPA 3VV4A 1W63M 1S4RA 4NEED 4EQ1A 1YKDA 1NWZA 2FZ0A 1XFQA 4FSFA 4MN6A 4I3IA 5AJGA 5DJTA 4Y2FA 2KX6A 3E98A 4HY8A 3EQVA 3S7OA 3JVVA 2VGLM 1XJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIF A;  3HJI A;  3E4O A;  4JGP A;  2QHK A;  3P7N A;  4B9O A;  3F1O B;  4F3L B;  3LYX A;  3UMD A;  3NOU C;  4K08 A;  4KUO A;  3H82 B;  3LIB A;  1BYW A;  4HH3 A;  3BY9 A;  1LL8 A;  4PKY G;  3FC7 A;  2GJ3 A;  1OJG A;  1TS0 A;  1N9L A;  4I3J A;  1F9I A;  3T50 A;  1X0O A;  2V9A A;  1TS6 A;  5G4Y A;  1OTA A;  4WF0 A;  4L9G A;  5HD5 A;  2M1C A;  4JGQ A;  5I5L A;  2EA9 A;  3ICY A;  1T1C A;  4HH2 A;  3UB6 A;  4PKY A;  1G28 A;  5DJU A;  4KUK A;  3VE3 A;  4RQ9 A;  5DKL A;  1KOU A;  3ULF A;  4I3A A;  3K3D A;  2PDR A;  1S4S A;  2K7S A;  5HSQ A;  3H7W A;  5HD3 A;  3IS2 A;  5HZH A;  4HIA A;  1GSW A;  3PHY A;  2L4R A;  4DJ3 A;  4I38 A;  2PD7 A;  3A0S A;  5IU1 A;  1UWN X;  2ZOI A;  1TS8 A;  2V1B A;  2ZBB A;  3CAX A;  2H28 A;  4YWZ A;  4R38 A;  3K3C A;  1UGU A;  1Y28 A;  2VEA A;  4H6J A;  2WKQ A;  3UB9 A;  2PD8 A;  2YKF A;  3B33 A;  2VV8 A;  1VB6 A;  4XT2 A;  3NOT C;  2OOL A;  5F5Y A;  1DP9 A;  4GHI B;  4HHD A;  4HP9 A;  2B02 A;  3H7W B;  3LI8 A;  1T18 A;  2OWH A;  2VV7 A;  4WN5 A;  1GSX A;  2OWJ A;  2A24 A;  4EXO A;  3EEH A;  1S1Y A;  2V0U A;  1OT6 A;  2D02 A;  5HDD A;  2I9V A;  1S1Z A;  4NXG A;  4BBU A;  5J7E A;  1GSV A;  1OTI A;  1S66 L;  4EER A;  3MFX A;  5DKK A;  2WKR A;  2P7J A;  2PHY A;  1EW0 A;  3MQQ A;  4H6J B;  2PYR A;  5TBM A;  2Z6D A;  1DRM A;  5KIZ A;  3CLO A;  3ZQ5 A;  3UE6 A;  2L0W A;  5AVE A;  1OTE A;  4HQA A;  2V0W A;  4LRY C;  1MZU A;  5F68 A;  2VV6 A;  1T1B A;  2W27 A;  3GEC A;  4EEU A;  4R6L A;  2A24 B;  5G4Z A;  1N9N A;  2PR6 A;  3LID A;  5HDC A;  4EES A;  4LRZ E;  5HWT A;  3IBR A;  1T19 A;  4WLA A;  1XJ4 A;  1XJ6 A;  2QKP A;  4E04 A;  4I39 A;  3LIE A;  1WA9 A;  4NXF A;  4DJ2 A;  4WL9 A;  2R78 A;  1D06 A;  5TBM B;  5HDS A;  4GS9 A;  3F1N A;  4JGO A;  3EWK A;  3F1O A;  3VOL A;  2QWS A;  3F1P A;  4HI4 A;  3MJQ A;  2D01 A;  3C2W A;  3C8C A;  3LIC A;  1TS7 A;  1OTD A;  1V9Y A;  5EFW A;  3PYP A;  1JNU A;  1S67 L;  1DP6 A;  3NJA A;  3RH8 B;  4BBV A;  4L9E A;  4EW7 A;  2HV1 A;  1XFN A;  3LUQ A;  3UB8 A;  3SW1 A;  4GW9 A;  5HWW A;  1D7E A;  4WUJ A;  5IS1 A;  5J4E A;  2L1M A;  3IS2 B;  4KQD A;  4GS9 B;  1LSW A;  3F1N B;  1V9Z A;  3BY8 A;  3H9W A;  4GCZ A;  4EET B;  4HOI A;  1P97 A;  4LLO B;  2QJ7 A;  3HJK A;  2JHE A;  2KDK A;  4NXB A;  2PYP A;  2INW A;  3F1P B;  3UME A;  1LSX A;  2CMN A;  4R3A A;  3LIA A;  3G6O A;  3FG8 A;  4M4X A;  3NOP C;  3MXQ A;  3CWF A;  3E4Q A;  5AVF A;  4XT2 B;  1T1A A;  2V1A A;  5F69 A;  2PR5 A;  2J80 A;  2JN7 A;  3E4P A;  5J3W A;  2VLG A;  2ZOH A;  3MQO A;  1N9O A;  4MN5 A;  3LI9 A;  4R70 A;  1XJ3 A;  2Z6C A;  2BAS A;  4EEP A;  2QJ5 A;  3VE4 A;  4NXE A;  1F98 A;  5F6A A;  1ODV A;  3RTY A;  4LRX C;  2W0N A;  1LT0 A;  4HNB A;  4L9F A;  4HJ3 A;  4HP4 A;  4LPZ A;  1LSV A;  2YKH A;  1OTB A;  1UWP X;  3KX0 X;  3OLO A;  3A0V A;  4HJ6 A;  4F3L A;  4GHI A;  1OJ5 A;  5A8B A;  5HWV A;  4JGR A;  1DP8 A;  3A0R A;  3BWL A;  4HJ4 A;  3H82 A;  3GDI A;  4I5S A;  3D72 A;  4BBT A;  3UB7 A;  1OT9 A;  1P0Z A;  3MR0 A;  2WKP A;  1S4R A;  4EQ1 A;  1NWZ A;  1XFQ A;  4MN6 A;  4I3I A;  5DJT A;  2KX6 A;  4HY8 A;  3NHQ A;  1XJ2 A; 
#chains in the Genus database with same CATH topology
 3E4O A;  3W4P A;  1HTZ A;  3QHY A;  2QHK A;  4F3L B;  5FAS A;  3IH9 A;  2A2L A;  2XD5 A;  1FCO A;  4IUH A;  4KUO A;  1W8Q A;  2J3W A;  2VKS A;  3H82 B;  1XKZ A;  4B93 A;  3IH8 A;  4EV4 A;  3D4F A;  3FC7 A;  1OJG A;  5HL6 A;  1KGF A;  3RFB A;  1TS0 A;  1N9L A;  3ZG8 B;  4S2O A;  3NC8 A;  3LEQ A;  2J7V A;  3W8K A;  2MJ6 A;  1RCJ A;  3M2J A;  2VGL S;  2P74 A;  2VX8 A;  4G3K A;  5EM0 A;  3UE3 A;  5IT5 A;  5L07 A;  4ZJ1 A;  4L9G A;  5HD5 A;  4B88 A;  4JF5 A;  2R9W A;  4JGQ A;  1T1C A;  3FZC A;  1DJA A;  3PBS A;  5DJU A;  1E25 A;  5CXW A;  1WYC A;  3VP3 A;  4ME4 A;  1Z6F A;  3D9Y A;  5G18 A;  4WEK A;  5HFO A;  3TG9 A;  5AQA A;  3VMA A;  2PDR A;  4JF6 A;  2K7S A;  5HSQ A;  4N1X A;  4CLC A;  5HD3 A;  2J9O A;  3IS2 A;  4HIA A;  3UDI A;  2L4R A;  1FR6 A;  2WZX A;  1CEG A;  5IU1 A;  1F5M A;  3B47 A;  5FQ9 A;  3DTK A;  3CAX A;  4X53 A;  4G3V A;  2HDU A;  4YWZ A;  4R23 A;  4R38 A;  1UGU A;  3BFD A;  4H6J A;  4OLD A;  3NCK A;  1SKO A;  3UB9 A;  2PD8 A;  1L0D A;  4BD1 A;  3EOI A;  3HL9 A;  3B33 A;  5EVI B;  3T1Q B;  3TOI A;  1VB6 A;  4JXS A;  3A3I A;  2B18 A;  4MCW A;  2DRW A;  1ESI A;  4HP9 A;  2XFS A;  3H7W B;  3BLM A;  1RP5 A;  4IJG A;  1TDL A;  2CC1 A;  2ZM8 A;  4EXO A;  2ZM2 A;  3HLE A;  3G31 A;  3BEB A;  2EFX A;  1S1Z A;  2EX8 A;  2KOI A;  4EER A;  3MFX A;  3PAG A;  4B4Z A;  2WKR A;  2ZM0 A;  2PHY A;  3WWX A;  4O7D A;  4DDS A;  1EW0 A;  3BFF A;  2E8I A;  3MQQ A;  4IED A;  3VP1 A;  1CI9 A;  5EVL A;  4EU0 A;  3C30 A;  3DBA A;  5KIZ A;  3G32 A;  5E43 A;  5HPF A;  2QYB A;  2UV0 E;  5EEC A;  1OTE A;  5CGW A;  2V0W A;  1MZU A;  5F68 A;  5HW3 A;  2DMW A;  2A24 B;  3S7Q A;  3WS2 A;  1PIO A;  3LID A;  4LRZ E;  2ZC7 A;  3UO9 A;  1KGG A;  3K2N A;  1NLY A;  1Y4O A;  4KZ5 A;  1I2S A;  4LGW A;  2H5S A;  1ACF A;  3O87 A;  3NUL A;  3IXG A;  4S2P A;  3LIE A;  2EXA A;  1GHM A;  3IHA A;  1D06 A;  2Y8H A;  3UN7 A;  5HDS A;  5EPH A;  3F1N A;  2WGW B;  5C5K A;  2J3T D;  1W63 Q;  3UNW A;  2G2U A;  3VOL A;  3TJZ C;  1MXO A;  3F1P A;  4HI4 A;  1NYY A;  2EX2 A;  3WS5 A;  4Q0I A;  1TS7 A;  3BW6 A;  1IEL A;  3G2Z A;  1ERM A;  2WYX A;  3NJA A;  4OPY A;  5FI6 A;  4ZAM A;  4BBV A;  4L9E A;  3IWO A;  5FAO A;  3FWL A;  3VSL A;  1D7E A;  5TR7 A;  5GHX A;  4Y17 A;  3UDF A;  3T4Q A;  5FEF A;  2EWV A;  3IS2 B;  4MMN A;  4WYY A;  2Z2L B;  1XA7 A;  1LSW A;  3IWI A;  3CHW P;  3B3X A;  3H9W A;  4N9K A;  4HOI A;  4LLO B;  1BLP A;  2ZQ9 A;  3HJK A;  1YM1 A;  2KDK A;  4NXB A;  4B4X A;  3B42 A;  2IWC A;  1OPX A;  2XR0 A;  4NET A;  2XH9 A;  4R3J A;  3V5M A;  5FEG A;  1N9B A;  3LIA A;  5L8M A;  3TSG A;  4OON A;  3G6O A;  4O0P A;  2WKH A;  3NOP C;  5GL9 A;  3CWF A;  2Y4A A;  1L2S A;  5AVF A;  3Q7V B;  4GOG A;  2V1A A;  5F69 A;  3V39 A;  2HF6 A;  2ZJ9 A;  3UDX A;  1I5Q A;  1YSP A;  3UPP A;  5A91 A;  2JN7 A;  2VLG A;  4OPR A;  1N9O A;  3LI9 A;  5KZH A;  2WGV A;  1A0K A;  3R7W A;  1KE0 A;  4LV1 A;  1ALQ A;  1BLC A;  5CHJ A;  3T4T A;  1NXY A;  4FH4 A;  4EBP A;  4IBX A;  1GA9 A;  5HX9 A;  4WZ4 A;  2WGI A;  1NRJ A;  2HP6 A;  5TFQ A;  5CED A;  4OPZ A;  1NZO A;  2W1R A;  4FD8 A;  1MKI A;  3QP6 A;  3MS6 A;  3U4L P;  3TW8 A;  1PI4 A;  4F3L A;  4DE3 A;  3HBR A;  2ZMF A;  1M6K A;  3T12 B;  4JGR A;  3A0R A;  3BWL A;  3O88 A;  4X6T A;  4OOM A;  3DTM A;  2ZD8 A;  3G2Y A;  3H82 A;  4O8G A;  4I5S A;  5A90 A;  2XF3 A;  1H0M A;  5DVA A;  3MR0 A;  2E8J A;  2C6W B;  1XFQ A;  4Y2F A;  3ZG7 B;  2KX6 A;  4Y0U A;  4DXC A;  3T1X A;  1FIK A;  1E3U A;  3ZVT A;  1Y54 A;  5CEB A;  3SH9 A;  3LIF A;  1PI5 A;  1KVL A;  5L2F A;  4BL2 A;  3P7N A;  1IOU A;  5D3O A;  2OLV A;  3PBQ A;  3RXX A;  2BLS A;  4GD6 A;  3NY4 A;  3PBR A;  4K08 A;  4GNU A;  3T1R A;  1PNE A;  4XUZ A;  4Y0T A;  1L3L A;  4MEZ A;  3LIB A;  4OP8 A;  1BYW A;  1NRF A;  2IWD A;  2V8F A;  3VOZ A;  2Q9M A;  1LL8 A;  1CK3 A;  3ZNT A;  2KLI A;  4IBR A;  2GJ3 A;  1PZO A;  1OME A;  4Z9Q A;  4KZB A;  3FYZ A;  1VQQ A;  4I3J A;  1X0O A;  2W3D A;  3QP2 A;  2XD1 A;  2EFU A;  2Y2P A;  2HPB A;  3KO6 A;  3ITA A;  2VK3 A;  4GZB A;  1MC0 A;  1FCN A;  2Z2M B;  1PFL A;  3C7U A;  4WF0 A;  4P6B A;  3VFH A;  3M6H A;  5FDH A;  2H0Y A;  2M7V A;  5I5L A;  2EA9 A;  5DTK A;  1TDG A;  2FFY A;  3N8L A;  1ZHH B;  4GLQ A;  5EV0 A;  5CTM A;  3ISG A;  2HZ5 A;  1IYS A;  3OCL A;  5MC7 A;  4X25 A;  4F94 A;  3CI6 A;  3KSH A;  4CPK A;  2OAQ 1;  4WMC D;  4XXR A;  3G34 A;  3VE3 A;  4BD0 A;  4X56 A;  1ONG A;  3DTE A;  3A3J A;  5DKL A;  1MY8 A;  4RA7 A;  2HJ9 C;  2GNX A;  2ZMA A;  4QY6 A;  1K54 C;  5DF9 A;  2WZZ A;  2Y2H A;  4Q0J A;  3LEZ A;  3H7W A;  2OAP 1;  5FI2 A;  2Y2L A;  5M19 A;  4MBH A;  2H0T A;  4FTX A;  1GSW A;  3NEC A;  5HAQ A;  3R7W B;  2HP9 A;  2WUQ A;  2O9B A;  2PD7 A;  1FR1 A;  2ZOI A;  1ZKJ A;  1YQS A;  1G6O A;  2OV5 A;  1TS8 A;  1YLY A;  4MBF A;  2R9X A;  3CG5 A;  3HRE A;  5FAT A;  5FAQ A;  4S2L A;  1Y28 A;  2VEA A;  4X68 A;  2JKT I;  2XEP A;  5CRF A;  3TRC A;  4ARZ B;  2VV8 A;  2JKG A;  4IVI A;  2LB5 A;  4P0M A;  5FQM A;  1FIL A;  3BJN A;  4UA9 A;  2IWB A;  1BUL A;  2Y2J A;  3SOI A;  3HVF A;  2VV7 A;  2JKT M;  2OWJ A;  5GLB A;  3V50 A;  4S2K A;  2A24 A;  2FH5 A;  5AQB A;  5HL1 A;  5DTS A;  4GB7 A;  1U60 A;  5HDD A;  4NXG A;  1GSV A;  5EOE A;  5DKK A;  2P08 A;  4S2M A;  3QNB A;  1K55 C;  1S0W A;  4EQI A;  4FH2 A;  1DRM A;  5F82 A;  3CLO A;  1CJF A;  2ACG A;  3C4O A;  3AGD A;  1KVM A;  2WGW A;  4MBK A;  5AVE A;  3CMZ A;  3C38 A;  4HQA A;  5CHU A;  3T4J A;  3NDG A;  4LRY C;  2VV6 A;  4OQG A;  1T1B A;  4E3L A;  5GHZ A;  4KG6 A;  3UB5 P;  5G4Z A;  2PR6 A;  4JKT A;  5HDC A;  3FKW A;  5HWT A;  5HAP A;  3IBR A;  4KQQ A;  1XJ4 A;  2XRN A;  2Y2K A;  1W7F A;  3ZFZ A;  2QKP A;  4E3I A;  3KYE A;  3NIA A;  4I39 A;  3PBT A;  1WA9 A;  1Q2P A;  4OQ0 A;  4NXF A;  5FL3 A;  3PR6 A;  1PW8 A;  1K57 C;  4JGO A;  1PRQ A;  4RX2 A;  4LV0 A;  1PWC A;  2W3F A;  4ID4 A;  5IHV A;  2QWS A;  5CGX A;  1L0E A;  5FSR A;  2AVX A;  2RL3 A;  1PW1 A;  1FSY A;  3C2W A;  3C8C A;  4GDN A;  2W3G A;  3LIC A;  3ZNY A;  3N8R A;  4WEJ A;  1XGJ A;  5EFW A;  2O9A A;  2ZQ8 A;  1S67 L;  2V20 A;  3RH8 B;  2LB9 A;  1YLZ A;  4EUZ A;  5FA7 A;  4E3O A;  4RYE A;  1W79 A;  3LR3 A;  3NI9 A;  1XFN A;  3OCN A;  3Q7V A;  4R4S A;  5IS1 A;  2PT7 A;  2P04 A;  3HUN A;  4MDZ A;  3GTC A;  5J4E A;  1AWI A;  4K0W A;  1AXB A;  3OOV A;  4WM9 A;  1V9Z A;  2Q9N A;  4GCZ A;  3BQA A;  4PM7 A;  1JWP A;  3O3V A;  1P97 A;  4KEN B;  1IYQ A;  2JHE A;  5GLD A;  3E2L A;  4KZ8 A;  3ZVW A;  4BEN A;  4EBN A;  1XP4 A;  3OBF A;  5HPI A;  4R3A A;  1J3W A;  3TE8 A;  4CLC D;  2UWX A;  4CLC E;  3FG8 A;  3P09 A;  4PM8 A;  3G4P A;  3E4Q A;  3VP2 A;  1LI9 A;  2EWW A;  2VZW A;  3GVB A;  2JKF A;  3CZD A;  4GKU A;  2PR5 A;  2J80 A;  5L10 A;  4KG2 A;  3MQO A;  4ESP A;  3IT9 A;  1H8Z A;  3MXR A;  1LL9 A;  2Z6C A;  2BAS A;  3QP5 A;  1ZC2 A;  2V2F F;  4LV3 A;  3EQU A;  3HLD A;  5E2E A;  1FQG A;  1HD8 A;  1K38 A;  3RTY A;  2ZLY A;  4LRX C;  2EX9 A;  1O7E A;  3UPO A;  1LLB A;  3IBJ A;  2GX5 A;  1LT0 A;  4HNB A;  5F1F A;  4HP4 A;  2QMI A;  1Q2Q A;  3GRJ A;  1YLW A;  4OOY A;  2VGJ A;  4KZA A;  4LPZ A;  3KYQ A;  3LCE A;  3S7N A;  4LFU A;  3KSG A;  3Q1F A;  2YKH A;  5FDS A;  1K54 A;  3RXW A;  1K6R A;  4HJ6 A;  5FQK A;  2Y2I A;  3AGE A;  3HLB A;  1PWG A;  1D1J A;  1DJC A;  3GDI A;  1KDW A;  4BMW A;  3VV4 A;  3VFF A;  2OSU A;  4RX3 A;  5CER A;  4NEE D;  4EQ1 A;  1YKD A;  2FZ0 A;  1VEU B;  4UA7 A;  2JC7 A;  3MZD A;  5DJT A;  1TEM A;  3E98 A;  4E3J A;  2XDM A;  3EQV A;  3MZE A;  4KZ4 A;  4EWF A;  4CJN A;  4DKI A;  5AQ7 A;  4YOF A;  1E4D A;  3HUM A;  4Y3I A;  3HJI A;  2XFT A;  1YPR A;  3M2K A;  1NLZ A;  4B9O A;  4QD4 A;  1QME A;  4R3B A;  3UMD A;  3P01 A;  1QMF A;  4OQI A;  4EUV A;  1YSQ A;  4ETX A;  1BSG A;  1C3B A;  3OC2 A;  1G5U A;  4KQR A;  2JKR I;  2PU4 A;  4LEN A;  4DRT A;  4BJP A;  3P98 A;  3T4L A;  3S1Y A;  4NKP A;  5FAP A;  5EUA A;  5KSC A;  4K0X A;  4BQM A;  4Y7P A;  3ZDJ A;  1F9I A;  3T50 A;  3MKE A;  2V9A A;  3U2A A;  1FOF A;  3BFC A;  4II7 A;  1K56 D;  3Q07 A;  1TS6 A;  1K55 A;  2JKR M;  1IFQ A;  2ZL1 B;  4YIN A;  5G4Y A;  4N92 A;  1P9R A;  1NY0 A;  1H3Q A;  4MNR A;  2J9P A;  1ZTU A;  2WKI A;  5DF7 A;  1SZV A;  1VM1 A;  1XGI A;  4DN0 A;  3SS4 A;  3HLF A;  4JXW A;  3WRT A;  2HJE A;  4OKP A;  3ICY A;  5M18 A;  4HH2 A;  4C75 A;  3HLG A;  4K91 A;  1YMS A;  4WBG A;  1G28 A;  3OPR A;  2O9C A;  4S2I A;  2NUP C;  1LHY A;  1XXM A;  1O07 A;  4RQ9 A;  4ARZ A;  4I3A A;  3K3D A;  1S4S A;  1DJB A;  1P9W A;  2QZ6 A;  2G7U A;  4WZ5 C;  5FQQ A;  3WRZ A;  3ITB A;  3MSH A;  5HZH A;  3HCY A;  2K31 A;  4JXG A;  1K57 A;  2K2N A;  3A0S A;  4HBT A;  3DWZ A;  2JE5 A;  2PRF A;  5KMW A;  3BRM A;  1ERO A;  1LL5 A;  3QP8 A;  3Q81 A;  2ZC5 B;  3ZG5 A;  1CF0 A;  2I72 A;  3NDE A;  3MFD A;  2G2W A;  3CPT A;  3CUE C;  1L0F A;  3IWQ A;  3O5Y A;  2Q0O A;  4HEF A;  3NOT C;  4FOF A;  4XT2 A;  5F5Y A;  1KE3 A;  1MBL A;  3IF6 B;  3BFE A;  3VSK A;  2B02 A;  3LI8 A;  4MN7 A;  4NK3 A;  1T18 A;  2OWH A;  3KSF A;  1GCE A;  2V8C A;  4WMC A;  2XQZ A;  4NG2 A;  5F83 A;  4OOL A;  2J3T C;  3PBO A;  3R4K A;  2X02 A;  4X55 A;  2HDQ A;  4WEL A;  3MF0 A;  4BBU A;  3MBZ A;  4G3W A;  5J7E A;  2X01 A;  4DMZ A;  2P7J A;  3DW0 A;  1BUE A;  1PYY A;  3T4K A;  4X1M A;  1J9M A;  3BFG A;  3ZQ5 A;  3T4S A;  3IF5 A;  4DE1 A;  5J8X A;  3LY4 A;  2HDS A;  1F2K A;  2A3U A;  3V3S A;  3JYI A;  4CQH A;  4GD8 A;  3GR2 A;  3CJM A;  4R6L A;  4E3M A;  2WAD A;  1E3U D;  5EM1 A;  5AQ9 A;  1N9N A;  3NBL A;  2EX6 A;  2XK1 A;  5KSH A;  4QWO A;  4WLA A;  3GV9 A;  2V1Z A;  4D60 A;  1XJ6 A;  4YNR A;  4GDB A;  4JBF A;  5A92 A;  3IXB A;  3ZCZ A;  1ERQ A;  1KE4 A;  4EBL A;  2WK0 A;  2PBY A;  3D3O A;  4OP5 A;  3BQ8 A;  3IF6 C;  4FCF A;  2XSS A;  1FCM A;  2R78 A;  4WL9 A;  1FSW A;  4LCM A;  5CGS A;  5TBM B;  4U0T A;  5GHY A;  3OPH A;  4ZJ3 A;  3C4P A;  3DWK A;  3Q82 A;  5HAR A;  3G35 A;  3F1O A;  4YFM A;  1PZP A;  1MWS A;  3MJQ A;  3ZYT A;  4P85 A;  1I2W A;  4IHQ A;  4R0Q A;  1OTD A;  3ZGA B;  3MMH A;  2HGV A;  3PYP A;  4IUK A;  1JNU A;  4PM9 A;  1SCW A;  4LCL A;  4EW7 A;  3UPN A;  2HV1 A;  2H10 A;  3LUQ A;  3UB8 A;  3SW1 A;  2GDN A;  4PAU A;  4P87 A;  3UY6 A;  4WUJ A;  3LR0 A;  3S22 A;  2XLN A;  4AFI A;  3W2Z A;  2JBF A;  4ZTK A;  2ZQC A;  4S2N C;  4GS9 B;  4E3N A;  4GN2 A;  4UA6 A;  4EET B;  5FQJ A;  2QJ7 A;  1H5X A;  3C7V A;  2PYP A;  3FPV A;  3OZH A;  1LSX A;  2NUT C;  3MKF A;  3IQA A;  5EVI D;  2Y2N A;  3I7J A;  2B95 A;  5I94 A;  1SDN A;  3CPT B;  4M4X A;  4OVD A;  2B5R A;  4XT2 B;  3SZT A;  3S7P A;  5CEC A;  1N4O A;  3E4P A;  4ZRR A;  2ZOH A;  4Q0H A;  1Z09 A;  4R70 A;  4BWI A;  2WAE A;  4ZBE A;  3LR4 A;  4EEP A;  1YLT A;  2QJ5 A;  2IA2 A;  4NXE A;  4BLM A;  3O86 A;  5F6A A;  1ODV A;  3EGD C;  1EI5 A;  1XA1 A;  2W0N A;  1VEU A;  5GLA A;  3BEC A;  3SH7 A;  1VET A;  1BZA A;  4C3Q A;  5A93 A;  1LSV A;  4Y13 A;  3LFV A;  3UE1 A;  3IXD A;  2OLU A;  1ESU A;  4MLL A;  4Q8I A;  1NZU A;  5E2F A;  3LY3 A;  4UAA A;  4JPM A;  2GZA A;  1UWP X;  1ES3 A;  3A0V A;  1XPB A;  2BG1 A;  5K5B A;  5LBR A;  4GHI A;  3G30 A;  1OJ5 A;  4WZ5 A;  2M7U A;  5HWV A;  1DP8 A;  4UHU A;  3LR5 A;  1WYB A;  1YAX A;  3C5A A;  3WS0 A;  5FI7 A;  4BBT A;  4PMA A;  4X69 A;  1K25 A;  1IKI A;  3LGO A;  4HBU A;  1W63 M;  1S4R A;  4MN6 A;  4I3I A;  2PAV P;  5AJG A;  3ZHH A;  2BTF P;  3S7O A;  2EXB A;  2Y2M A;  2ZL1 A;  3NHQ A;  2ZQD A;  3CUE A;  2VGK A;  4DF6 A;  4JGP A;  2A49 A;  3F1O B;  3LYX A;  4JLF A;  3KSI A;  2FFF B;  3NOU C;  4KZ9 A;  4L0L A;  3GMW A;  1K4E A;  4PM5 A;  2Y2O A;  4HH3 A;  1GHP A;  3BY9 A;  1KDS A;  3N6I A;  3PBN A;  4PKY G;  3PXP A;  4QHC A;  4KZ6 A;  4JF4 A;  4E6X A;  2W1T A;  3GQZ A;  2Y79 A;  3DTI A;  2ZQA A;  2PU2 A;  4BL3 A;  1OTA A;  1JWV A;  1K4F A;  2ZMV A;  2P9V A;  4R1G A;  3L9K A;  4PHT A;  3CIT A;  1SDE A;  2M1C A;  1ONH A;  3IX4 A;  1HLU P;  1MKM A;  4KG5 A;  4H8R A;  5EVE A;  1EWZ A;  3UB6 A;  4PKY A;  3VOY A;  2ZC6 B;  4QPR A;  5GLC A;  3A3F A;  3QNC A;  3IX3 A;  4KUK A;  1DY6 A;  3HLC A;  2XGN A;  3E2K A;  2ZQ7 A;  1KOU A;  1JTG A;  3BLS A;  5EVI C;  3ULF A;  1HVB A;  3IF6 A;  1BT5 A;  4R4R A;  2Y55 A;  3PHY A;  4JXV A;  2Y91 A;  4DJ3 A;  4FUW A;  4I38 A;  2PBD P;  4X1L A;  4Y15 A;  1UWN X;  4O01 A;  5EE8 A;  1BLH A;  2V1B A;  4U0X A;  1ES5 A;  1K56 A;  2ZBB A;  3FPW A;  1VET B;  5JYO A;  1ZG4 A;  2H28 A;  4QU3 A;  3T4O A;  1ES4 A;  3K3C A;  1VHM A;  4ZDX A;  1JVJ A;  2WKQ A;  2YKF A;  3T1S A;  2JCH A;  4DDY A;  2OOL A;  1DP9 A;  1TVF A;  4GHI B;  4HHD A;  5EOO A;  4N1H A;  1YLP A;  5DFY A;  4CLC B;  1SKF A;  1ES2 A;  3L7H A;  4S2N A;  2VA0 A;  4WN5 A;  1GSX A;  2ZC4 B;  4GJ4 A;  4P6Z M;  1BTL A;  1YLJ A;  4PPR A;  4QB8 A;  3EEH A;  1IYP A;  1S1Y A;  4PM6 A;  4UQI M;  2V0U A;  1OT6 A;  2D02 A;  2I9V A;  3OPL A;  4LV2 A;  3SH8 A;  1OTI A;  3QP1 A;  1S66 L;  3FV7 A;  4QY5 A;  4OPQ A;  1CI8 A;  2RCX A;  5BOH A;  1XX2 A;  4H6J B;  2PYR A;  5U47 A;  5TBM A;  2Z6D A;  1SKO B;  3ZG9 B;  2DNS A;  1CQA A;  3UE6 A;  3Q7Z A;  2L0W A;  3W4O A;  2Y2G A;  1BLS A;  1LI0 A;  5L09 A;  4OQH A;  2WKE A;  2W27 A;  3GEC A;  3M6B A;  4EEU A;  1M40 A;  1TD5 A;  4P6Z S;  1W8Y A;  4EES A;  5JYP A;  4UQI S;  1T19 A;  5FQI A;  4KZ7 A;  4D2O A;  2HP5 A;  2J8Y A;  4E04 A;  2W3E A;  4Y5F A;  1G68 A;  4DJ2 A;  1NJ4 A;  2W1T B;  5F1G A;  3RJU A;  2VJW A;  4E3K A;  4CLC C;  1G6A A;  3QP4 A;  2C5W B;  5TGF A;  4GS9 A;  2Y2Q A;  4ETZ A;  3IX8 A;  4KQO A;  3E0Y A;  3EWK A;  1GHI A;  3S4X A;  2P9V B;  3KYZ A;  1WE4 A;  2W3H A;  3MQ0 A;  3JPU A;  2D01 A;  2WAF A;  1V9Y A;  4IVK A;  3JVU A;  1L0G A;  1DP6 A;  1SHV A;  2O99 A;  5DTT A;  3UE0 A;  3VP0 A;  3HUO A;  3HLW A;  1JTD A;  3PTE A;  1JWZ A;  4E6W A;  5E2G A;  4GW9 A;  5HWW A;  1K0K A;  4U3T A;  3V67 A;  1GA0 A;  2L1M A;  2XRO A;  1IKG A;  4KQD A;  3F1N B;  1PWD A;  3BY8 A;  5CTN A;  1NYM A;  1MWU A;  3GSG A;  5DFX A;  1H8Y A;  2INW A;  2X71 A;  3F1P B;  3UME A;  2CMN A;  5DF8 A;  1MWR A;  4Z1W A;  3OPP A;  1STZ A;  2XA7 M;  1TF1 A;  1W5D A;  3SS3 A;  3DAV A;  3MXQ A;  3PAE A;  3IXH A;  2HDR A;  1T1A A;  3IHB A;  3WS1 A;  1K6S A;  5HAI A;  4OLG A;  4N9L A;  5J3W A;  4C6Y A;  5M1A A;  4S2J A;  4M3K A;  4MN5 A;  1IEM A;  1XJ3 A;  3MXS A;  4UEY A;  4OH0 A;  3VE4 A;  1F98 A;  1YMX A;  4Y0O A;  3BYD A;  3FKV A;  1IYO A;  4A5R A;  4L9F A;  3N7W A;  4HJ3 A;  1MWT A;  1MPL A;  1H8M A;  2XA7 S;  3A3E A;  4QJG A;  4HES A;  4KZ3 A;  3LO7 A;  1ZG6 A;  1OTB A;  3EGX C;  1RGY A;  3KX0 X;  3OLO A;  3EEA A;  1RGZ A;  2Y59 A;  5EVI A;  5TJJ A;  2QPN A;  3MZF A;  3A3D A;  4DE2 A;  5A8B A;  4RVA A;  3ZG0 A;  5CX7 A;  4HJ4 A;  3V3R A;  2O0Y A;  3N8S A;  3W4Q A;  1HZO A;  3BM6 A;  4DXB A;  3SS5 A;  3D72 A;  1YT4 A;  3UB7 A;  4XUX A;  1OT9 A;  1P0Z A;  4DE0 A;  2WKP A;  3AGF A;  5E2H A;  3WS4 A;  1NWZ A;  3N4I A;  2ZC3 B;  4FSF A;  5CHM A;  4ZJ2 A;  2DCF A;  4HY8 A;  1KGE A;  3JVV A;  1CEF A;  1S6R A;  3VP4 A;  2VGL M;  1XJ2 A; 
#chains in the Genus database with same CATH homology
 3LIF A;  4YOF A;  3CUE A;  4Y3I A;  3HJI A;  3E4O A;  1NLZ A;  4JGP A;  2QHK A;  3P7N A;  1IOU A;  4B9O A;  3F1O B;  4F3L B;  3LYX A;  3UMD A;  3PBQ A;  3KSI A;  3P01 A;  3NOU C;  2A2L A;  3PBR A;  4K08 A;  1YSQ A;  4EUV A;  4L0L A;  4IUH A;  4KUO A;  2J3W A;  2VKS A;  3H82 B;  4ETX A;  3LIB A;  3OC2 A;  2JKR I;  1BYW A;  4B93 A;  4HH3 A;  4BJP A;  3BY9 A;  1LL8 A;  3T4L A;  4NKP A;  2KLI A;  3PBN A;  4PKY G;  3FC7 A;  2GJ3 A;  1OJG A;  3PXP A;  5HL6 A;  3RFB A;  1TS0 A;  1N9L A;  4I3J A;  1F9I A;  3T50 A;  1X0O A;  2V9A A;  2W3D A;  3U2A A;  4II7 A;  2MJ6 A;  1TS6 A;  2W1T A;  2JKR M;  1IFQ A;  3KO6 A;  2VGL S;  2VX8 A;  5G4Y A;  2Y79 A;  4G3K A;  1P9R A;  3UE3 A;  1H3Q A;  1MC0 A;  5IT5 A;  1OTA A;  1ZTU A;  4WF0 A;  2ZMV A;  4DN0 A;  4L9G A;  4PHT A;  5HD5 A;  3CIT A;  2M7V A;  2HJE A;  2M1C A;  4JGQ A;  5I5L A;  2EA9 A;  3ICY A;  1T1C A;  1MKM A;  4HH2 A;  3UB6 A;  4PKY A;  4QPR A;  1ZHH B;  4GLQ A;  3OCL A;  1G28 A;  3PBS A;  5DJU A;  2O9C A;  2NUP C;  3CI6 A;  3KSH A;  5MC7 A;  2OAQ 1;  4KUK A;  3VE3 A;  4RQ9 A;  5DKL A;  1KOU A;  4ME4 A;  2HJ9 C;  2GNX A;  4ARZ A;  4WEK A;  3ULF A;  4I3A A;  3K3D A;  5DF9 A;  2PDR A;  1S4S A;  1P9W A;  2G7U A;  4Q0J A;  2K7S A;  5HSQ A;  3H7W A;  4CLC A;  5HD3 A;  2OAP 1;  3IS2 A;  5HZH A;  3HCY A;  2K31 A;  4HIA A;  2K2N A;  1GSW A;  3R7W B;  3PHY A;  2L4R A;  4DJ3 A;  4I38 A;  2O9B A;  2PD7 A;  3A0S A;  5IU1 A;  1UWN X;  2ZOI A;  4O01 A;  1G6O A;  1TS8 A;  1F5M A;  2V1B A;  3B47 A;  2ZBB A;  3FPW A;  3CAX A;  2H28 A;  4G3V A;  4YWZ A;  4R38 A;  3T4O A;  3K3C A;  1UGU A;  1Y28 A;  1VHM A;  2VEA A;  4H6J A;  2JKT I;  2WKQ A;  3CUE C;  3UB9 A;  2PD8 A;  2YKF A;  3EOI A;  3TRC A;  3B33 A;  4ARZ B;  3O5Y A;  2VV8 A;  1VB6 A;  4XT2 A;  3NOT C;  2OOL A;  4FOF A;  5F5Y A;  2B18 A;  2LB5 A;  1DP9 A;  4MCW A;  4GHI B;  4HHD A;  3BJN A;  4HP9 A;  2B02 A;  3H7W B;  3LI8 A;  5DFY A;  4MN7 A;  4CLC B;  1T18 A;  2OWH A;  2VA0 A;  4IJG A;  2VV7 A;  4WN5 A;  1GSX A;  2JKT M;  2OWJ A;  3KSF A;  2A24 A;  4GJ4 A;  2FH5 A;  4P6Z M;  4EXO A;  3EEH A;  1S1Y A;  4UQI M;  4OOL A;  2J3T C;  3PBO A;  3R4K A;  2V0U A;  1OT6 A;  2D02 A;  5HDD A;  2I9V A;  4WEL A;  3MF0 A;  1S1Z A;  4NXG A;  4BBU A;  4G3W A;  5J7E A;  1GSV A;  2KOI A;  1OTI A;  1S66 L;  4EER A;  3MFX A;  5DKK A;  4DMZ A;  2P08 A;  2WKR A;  2P7J A;  2PHY A;  1EW0 A;  3T4K A;  3MQQ A;  4H6J B;  2PYR A;  5TBM A;  2Z6D A;  3C30 A;  4EU0 A;  1DRM A;  3DBA A;  5KIZ A;  3CLO A;  3ZQ5 A;  3UE6 A;  3T4S A;  5HPF A;  2L0W A;  2QYB A;  5AVE A;  3C38 A;  3NHQ A;  1OTE A;  4HQA A;  2V0W A;  3T4J A;  4LRY C;  1MZU A;  5F68 A;  2VV6 A;  4CQH A;  1T1B A;  2W27 A;  3GEC A;  2DMW A;  4EEU A;  1TD5 A;  2A24 B;  4R6L A;  3S7Q A;  4P6Z S;  5G4Z A;  1N9N A;  2PR6 A;  3LID A;  5HDC A;  4EES A;  4LRZ E;  5HWT A;  5KSH A;  3IBR A;  4UQI S;  1T19 A;  3K2N A;  1NLY A;  4WLA A;  1XJ4 A;  2XRN A;  1XJ6 A;  4YNR A;  2QKP A;  4E04 A;  4I39 A;  2W3E A;  3PBT A;  4Y5F A;  3LIE A;  3D3O A;  1WA9 A;  3BQ8 A;  4NXF A;  4DJ2 A;  2W1T B;  2XSS A;  4WL9 A;  2R78 A;  5FL3 A;  2VJW A;  1D06 A;  3PR6 A;  4CLC C;  5TBM B;  2Y8H A;  5HDS A;  4GS9 A;  3F1N A;  4JGO A;  4ETZ A;  4KQO A;  5C5K A;  3E0Y A;  3EWK A;  2J3T D;  1W63 Q;  2W3F A;  3KYZ A;  3F1O A;  3VOL A;  3TJZ C;  2QWS A;  3F1P A;  4HI4 A;  2W3H A;  3MQ0 A;  3MJQ A;  3ZYT A;  2D01 A;  3C2W A;  3C8C A;  3LIC A;  2W3G A;  4IHQ A;  1TS7 A;  4Q0I A;  1OTD A;  3MMH A;  2HGV A;  3BW6 A;  1V9Y A;  4WEJ A;  3JVU A;  5EFW A;  3PYP A;  4IUK A;  1JNU A;  2O9A A;  1S67 L;  1DP6 A;  3NJA A;  2LB9 A;  3RH8 B;  2O99 A;  4BBV A;  4L9E A;  4EW7 A;  2HV1 A;  3LR3 A;  1XFN A;  3LUQ A;  3UB8 A;  3OCN A;  3SW1 A;  4GW9 A;  4PAU A;  5HWW A;  1D7E A;  4WUJ A;  3LR0 A;  5IS1 A;  2PT7 A;  2P04 A;  3V67 A;  4MDZ A;  5J4E A;  3T4Q A;  2EWV A;  2L1M A;  3W2Z A;  4AFI A;  3IS2 B;  4MMN A;  2XRO A;  4KQD A;  4GS9 B;  1LSW A;  3F1N B;  3OOV A;  1V9Z A;  3BY8 A;  3H9W A;  3BQA A;  4GCZ A;  4EET B;  4HOI A;  1P97 A;  4LLO B;  2QJ7 A;  3HJK A;  2JHE A;  5DFX A;  2KDK A;  4NXB A;  2PYP A;  3FPV A;  3B42 A;  2INW A;  1OPX A;  3F1P B;  3UME A;  1LSX A;  2NUT C;  2CMN A;  3OBF A;  4Z1W A;  5HPI A;  4R3A A;  1STZ A;  2XA7 M;  1TF1 A;  3LIA A;  5L8M A;  3TE8 A;  4CLC D;  4CLC E;  3G6O A;  4O0P A;  3FG8 A;  4M4X A;  3NOP C;  3MXQ A;  3CWF A;  3E4Q A;  5AVF A;  4XT2 B;  1T1A A;  2EWW A;  2V1A A;  2VZW A;  5F69 A;  2HF6 A;  1YSP A;  2PR5 A;  2J80 A;  3S7P A;  2JN7 A;  3E4P A;  4ZRR A;  2VLG A;  5J3W A;  2ZOH A;  3MQO A;  1N9O A;  4MN5 A;  4Q0H A;  3LI9 A;  4R70 A;  4BWI A;  1XJ3 A;  2Z6C A;  3LR4 A;  2BAS A;  4EEP A;  4UEY A;  2QJ5 A;  3EQU A;  3VE4 A;  3R7W A;  2IA2 A;  4NXE A;  1F98 A;  5F6A A;  1ODV A;  3RTY A;  3T4T A;  3EGD C;  4LRX C;  2W0N A;  3IBJ A;  2GX5 A;  1LT0 A;  4HNB A;  4L9F A;  4HJ3 A;  4HP4 A;  1H8M A;  2XA7 S;  4LPZ A;  3KYQ A;  1NRJ A;  1LSV A;  3LFV A;  3S7N A;  3KSG A;  2W1R A;  2YKH A;  1OTB A;  3EGX C;  2GZA A;  1UWP X;  3KX0 X;  3OLO A;  3EEA A;  3A0V A;  5TJJ A;  4HJ6 A;  3TW8 A;  4F3L A;  5K5B A;  5LBR A;  4GHI A;  2ZMF A;  1OJ5 A;  5A8B A;  2M7U A;  5HWV A;  4JGR A;  1DP8 A;  3A0R A;  3BWL A;  5CX7 A;  3LR5 A;  4HJ4 A;  1YAX A;  4OOM A;  2O0Y A;  3H82 A;  3GDI A;  4O8G A;  4I5S A;  4BMW A;  3D72 A;  4BBT A;  3UB7 A;  1OT9 A;  1P0Z A;  3MR0 A;  2WKP A;  3VV4 A;  1W63 M;  1S4R A;  4NEE D;  4EQ1 A;  1YKD A;  1NWZ A;  2FZ0 A;  1XFQ A;  4FSF A;  4MN6 A;  4I3I A;  5AJG A;  5DJT A;  4Y2F A;  2KX6 A;  3E98 A;  4HY8 A;  3EQV A;  3S7O A;  3JVV A;  2VGL M;  1XJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...