1DP6A

Oxygen-binding complex of fixl heme domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp6A00
1OTDA 3A0VA 2KX6A 1VB6A 3H9WA 4WL9A 5HZHA 3F1PB 5F68A 4F3LA 3HJIA 3IS2B 5KIZA 4HI4A 1ODVA 5HWWA 4LPZA 2QHKA 2KDKA 1OTIA 2J80A 3ZQ5A 2P7JA 3HJKA 3LI8A 3LYXA 4HJ6A 3UB9A 1UWPX 3E4OA 5HWTA 2HV1A 1T19A 5DKKA 1F98A 2YKFA 3H82A 4WUJA 1TS8A 1UWNX 2L1MA 3ICYA 2VV8A 2L4RA 3GECA 4MN6A 2QJ5A 3RTYA 2A24B 1OTAA 2H28A 3E4PA 3H7WA 4DJ2A 1DP9A 3C2WA 1D06A 4EEPA 1Y28A 2W0NA 3MR0A 1S66L 3CWFA 3PYPA 1BYWA 4I3JA 3SW1A 5HWVA 2ZOIA 4L9GA 5J4EA 1N9LA 4DJ3A 2K7SA 2V0UA 2CMNA 1GSXA 3D72A 4JGRA 5EFWA 4LLOB 3F1NB 1JNUA 4I39A 4JGQA 1LSXA 3CLOA 3MQQA 4NXGA 2PDRA 4I3AA 2OWHA 1S1ZA 1KOUA 3P7NA 3UB8A 3LI9A 5A8BA 1LSWA 1EW0A 1V9YA 3LIFA 2OWJA 1S4SA 2OOLA 5I5LA 2D02A 4I5SA 1GSWA 4GCZA 5F69A 1WA9A 5HDDA 5HSQA 1T18A 5HDSA 4H6JB 2JHEA 3VE3A 2PHYA 3MQOA 4PKYA 2R78A 3NOTC 1XJ3A 4GS9B 4KQDA 4R6LA 5G4ZA 3E4QA 3IBRA 3OLOA 1OT9A 2L0WA 4HH2A 1OTEA 4R70A 4H6JA 1P97A 5AVEA 3A0SA 2W27A 4XT2B 3F1OA 4EQ1A 2Z6DA 1S1YA 4HIAA 5TBMB 3LIAA 2V9AA 3NHQA 2EA9A 3G6OA 4HQAA 4HHDA 3UMEA 2B02A 2PD7A 4YWZA 3UMDA 4EXOA 1T1AA 4R38A 4EW7A 1DRMA 3PHYA 2VLGA 1DP6A 1LT0A 1MZUA 1OJ5A 1S67L 3F1PA 4F3LB 2M1CA 5HD5A 4NXFA 4BBVA 1T1CA 3EEHA 3GDIA 1OJGA 5G4YA 3T50A 4HNBA 2D01A 2PYPA 3K3CA 3B33A 4XT2A 2VV6A 5DJUA 4HP4A 1GSVA 3BWLA 4E04A 4HJ4A 2GJ3A 4GW9A 4NXEA 3ULFA 2V1BA 2YKHA 3UB7A 1OT6A 1DP8A 3LIBA 4GHIA 1X0OA 4WN5A 1N9OA 3LIDA 2PD8A 3VE4A 1D7EA 1P0ZA 2INWA 2PR6A 3K3DA 4GHIB 4L9FA 4KUOA 1OTBA 4EEUA 1LL8A 1TS6A 2QKPA 4LRYC 2JN7A 5J7EA 5HDCA 1V9ZA 4HJ3A 1T1BA 4B9OA 4HH3A 1XJ4A 3NOPC 5F6AA 4KUKA 5HD3A 3VOLA 4NXBA 2WKRA 3F1OB 4JGOA 5F5YA 5AVFA 1S4RA 2BASA 4BBUA 2A24A 4K08A 3F1NA 4LRXC 3MFXA 4I38A 2ZOHA 3CAXA 1XJ2A 2WKPA 4R3AA 4GS9A 3RH8B 5IS1A 3BY9A 2QWSA 3KX0X 4WF0A 2I9VA 2Z6CA 1LSVA 1XFNA 3LUQA 2PR5A 2VEAA 3C8CA 3LICA 4I3IA 4PKYG 3UB6A 4BBTA 2ZBBA 1NWZA 4RQ9A 4EESA 3MXQA 3NOUC 3H7WB 2PYRA 3EWKA 1TS7A 2WKQA 4JGPA 3FG8A 1TS0A 1G28A 3IS2A 3H82B 4HOIA 4HP9A 2VV7A 5DKLA 5DJTA 4EETB 3UE6A 4LRZE 3FC7A 3A0RA 4EERA 2QJ7A 3NJAA 4HY8A 4L9EA 3MJQA 1XJ6A 1UGUA 4MN5A 5IU1A 3LIEA 1N9NA 2V1AA 4WLAA 5TBMA 2V0WA 1XFQA 1F9IA 3BY8A 5J3WA 4M4XA
chains in the Genus database with same CATH superfamily
4WL9A 1G68A 2EXAA 4KG6A 3VP4A 3JVUA 2ZMVA 3V3SA 5JYPA 1Z6FA 2JKFA 4N92A 4HJ6A 2L1MA 3FV7A 3AGDA 3D4FA 2H28A 2MJ6A 2C6WB 2XFTA 1DJAA 2H0YA 2V0UA 3WRTA 4JGRA 5AQBA 1S0WA 2VJWA 3P7NA 3BECA 3ISGA 1WA9A 3LR4A 3ZG5A 2ZL1B 5CTNA 4CJNA 1ES5A 3O88A 3LEQA 1P97A 2AVXA 3UMEA 4YWZA 4EXOA 4IUHA 3PBOA 3MQ0A 4IBRA 4DXCA 2EX2A 3K3CA 2O9CA 4U3TA 3S1YA 3UB5P 1P0ZA 1MWTA 4GKUA 2VKSA 5F1GA 1M6KA 2JKRM 3CPTB 4K08A 2P9VA 3CAXA 3CPTA 4GS9A 4O7DA 3BRMA 1ZTUA 4S2NC 4IJGA 1EWZA 1TS7A 3QP8A 4HOIA 1NLYA 2QJ7A 1IOUA 3FWLA 2J3WA 2Q9NA 2V1AA 4MN5A 5EM1A 1YMSA 1HTZA 3N8SA 2XLNA 1OTIA 1PWCA 1O7EA 4DMZA 2HV1A 3H82A 4KQOA 1D06A 4IVIA 1C3BA 1KVMA 3JYIA 3R4KA 3PYPA 3S7QA 3MKFA 4UQIS 4HESA 3D72A 5AQ7A 2E8IA 3DAVA 2OWHA 5FDHA 1SCWA 1I2SA 4KZBA 1TDLA 4RYEA 2M7VA 2W1RA 1KGEA 3CG5A 2HDRA 3VE3A 3MQOA 4FH4A 4R70A 3Q1FA 4JF5A 3CUEC 3UDXA 1P9RA 3W4PA 4FOFA 1NJ4A 1MWUA 1E25A 2WUQA 2Y2GA 4B88A 1WYBA 1RP5A 5G4YA 4P87A 4CLCC 5FAOA 2Y59A 3NULA 4E3IA 3KSFA 2PD8A 1D7EA 3LFVA 4DXBA 3IF6A 3PAEA 1IKIA 3BFCA 4GN2A 2ZOHA 1L0EA 4OPYA 3RH8B 2WGWA 3PTEA 1JTDA 2Y2MA 5KMWA 3Q07A 4WZ5A 4RA7A 1YSQA 5TR7A 4LFUA 5F1FA 3SH8A 4KZ5A 4MCWA 3AGEA 5GLBA 2P74A 3F1PB 1W8YA 3TW8A 5HW3A 4HBTA 4R3BA 3QNCA 1HZOA 3PBSA 3HJKA 3LI8A 1EROA 5EE8A 1T19A 2XA7M 1KDWA 4BMWA 3C4PA 1FQGA 3MR0A 4I3JA 3GVBA 4XXRA 5HWVA 2HDSA 4S2MA 1GSXA 5GLCA 5CEBA 2PDRA 2O9AA 1VQQA 5A91A 3IWQA 2XR0A 5L2FA 1JWVA 4R6LA 2M7UA 1BLPA 1P9WA 3O86A 1K54C 2GX5A 1MXOA 3V67A 1PYYA 2LB9A 3I7JA 5CTMA 5CERA 2PD7A 4X53A 3CI6A 1Q2QA 2ZC4B 3OOVA 2Y2IA 3PHYA 1Q2PA 3IQAA 3T50A 3MMHA 1K56D 2WKHA 3HLCA 3EEAA 2V8FA 4G3KA 2PR6A 2ZQ8A 1LL8A 2PBYA 4QB8A 1ACFA 4DKIA 4DE3A 4Y0TA 1S4RA 3M6HA 4BQMA 3MFXA 4EV4A 4DDSA 3A3EA 2A2LA 5A92A 2PR5A 4I3IA 1XA7A 3C30A 2RL3A 3VP1A 2VV7A 5DKLA 3G30A 4OPZA 3G32A 3A0RA 4DDYA 4C3QA 1W63Q 5KSHA 2KX6A 4MLLA 4RX2A 2HP5A 2HZ5A 3HUNA 4M3KA 5KIZA 4X25A 5EM0A 5HWWA 3A3DA 3CJMA 3UB9A 2J8YA 4S2OA 3HLDA 2W0NA 3CWFA 3UDIA 4JGQA 3SZTA 1LI0A 4ETXA 5A8BA 2GDNA 4OH0A 1OPXA 1GSWA 3IHBA 2R78A 3BW6A 1L0GA 3QP4A 3OCLA 3DBAA 4Z9QA 1H3QA 2ZMFA 2B02A 2Z2LB 3BM6A 5F83A 2VLGA 4X6TA 1S67L 2M1CA 4GDBA 4Q0IA 4GOGA 1K4FA 1LLBA 2K2NA 1CK3A 2GJ3A 4OPRA 3Q7VB 1NYYA 3HREA 1MWSA 2DNSA 4JF4A 3VFFA 1BLSA 5GHYA 4X1MA 5FQJA 1IELA 1FIKA 5FI7A 5FA7A 3QHYA 3S7OA 4Q8IA 3OZHA 4RQ9A 1RCJA 4ZTKA 3UPOA 4JGPA 1PWGA 2Y2NA 1FR6A 1RGZA 3BFEA 4HY8A 3LR0A 1DJCA 3IF6B 2WAFA 3N6IA 4P0MA 5F68A 1YLPA 4K0XA 5M18A 5K5BA 4HI4A 5FQ9A 1AXBA 3QP6A 4WMCD 3PBTA 2WGWB 3E4OA 3IWOA 1F98A 2WZXA 4MN7A 1DP9A 2DRWA 4DF6A 3TOIA 1F5MA 4OQIA 3PAGA 3BFFA 4MNRA 5CGSA 1VETB 3MXSA 1DY6A 3VSKA 2ZQCA 3LI9A 3R7WB 2VGLS 3KSHA 2OOLA 1E3UD 1BUEA 1KE3A 2C5WB 4GLQA 1OTEA 4EQ1A 3K2NA 3LIAA 2ZMAA 3UN7A 1FR1A 1PZOA 3PBQA 1GHIA 5HD5A 4ARZA 4E3MA 2V1ZA 2R9XA 5TGFA 3UB7A 3HLWA 4YINA 4ZRRA 1ES4A 2Y2QA 2Y79A 1CI9A 3HUMA 2FZ0A 3LCEA 3UPNA 3NI9A 5F6AA 4B9OA 2W1TB 3GR2A 2WZZA 4WELA 5E2GA 2G7UA 3VFHA 4N1HA 3FG8A 4S2IA 3T1RA 3P09A 4GJ4A 2XQZA 4S2LA 2VZWA 1ZKJA 4L9EA 3G2ZA 4PM8A 4Y7PA 2XD1A 3CUEA 3MSHA 3N8LA 1N9NA 4KENB 3ZGAB 4QPRA 2V0WA 1OMEA 3A0VA 2IWCA 1ONGA 1L0DA 4FH2A 1K56A 4UA6A 5HWTA 5E2EA 3C2WA 1L3LA 1BYWA 3SW1A 4GD8A 1N9LA 3LR5A 5U47A 3LR3A 2ZD8A 3CLOA 4NXGA 4Y5FA 1JVJA 4JF6A 5I5LA 3T1QB 4I5SA 2Q0OA 3VP2A 5HSQA 2V8CA 1XA1A 2ZQ7A 1OT9A 4HH2A 3ZVTA 3A0SA 4U0XA 4XT2B 3NHQA 2IA2A 4R38A 2ZM8A 4NXFA 3EEHA 5EUAA 4LCMA 4KZAA 4X68A 4HEFA 4Y0UA 1NRJA 5DJUA 3JPUA 3LIBA 1X0OA 3VE4A 1LI9A 4KUOA 3VP3A 4PMAA 4BL2A 2XDMA 5HD3A 3BFGA 3F1OB 4DN0A 1K0KA 1ALQA 4E6XA 5BOHA 5GHZA 3EQUA 4WF0A 1N4OA 1VEUB 3IXGA 2ZBBA 3V39A 1J9MA 1ERQA 1CEFA 4IVKA 4X1LA 5CGWA 1PWDA 1PRQA 2GNXA 2OAQ1 1UGUA 5IU1A 2JBFA 5TBMA 2WGVA 5J3WA 1VB6A 4ZJ1A 2ZQ9A 3G35A 3MS6A 1ERMA 2J80A 3MFDA 5L09A 1F2KA 2VA0A 1GA9A 4ZDXA 4P6ZM 5HL1A 3N4IA 1KDSA 4QU3A 2NUPC 4OQ0A 4UA7A 4PM6A 3IX3A 1BLHA 1PZPA 4DE2A 1GA0A 5J8XA 1SKOB 3IF5A 4YNRA 3NECA 1SZVA 3D9YA 3OPHA 3LIFA 1H8ZA 3WS2A 5F69A 5HFOA 2W3GA 4YFMA 3IXDA 5EVLA 5J7EA 2XGNA 3E4QA 2L0WA 4H8RA 5AVEA 4DE0A 3U4LP 1YLWA 4P6BA 1DRMA 5FL3A 1YLJA 1T1CA 3FKVA 3GDIA 3T4TA 2UWXA 3TRCA 3UE1A 4HNBA 2A3UA 1MKIA 3W2ZA 3SS5A 4L9FA 5DFYA 2VGKA 5FAQA 3L9KA 3TSGA 2PT7A 1RGYA 1CEGA 5CGXA 2HP6A 1TD5A 4R3AA 2LB5A 4EBPA 2I9VA 2XD5A 3T4LA 3LGOA 1FILA 4EUVA 3MXQA 4LV0A 1G6AA 3DTMA 5FQIA 3L7HA 3EGDC 4KG5A 4UAAA 4KZ9A 4WLAA 3LEZA 3S7NA 3H9WA 4XUZA 4S2KA 5AJGA 2WADA 3PBRA 2JKTM 4R3JA 4D60A 4EWFA 1XGIA 5E2HA 1AWIA 1NXYA 4MN6A 2P08A 2A24B 3OPLA 4EEPA 1G5UA 3UO9A 3U2AA 1PW8A 1CF0A 4DJ3A 3A3FA 4LLOB 2OSUA 3ZG0A 1S1ZA 3FYZA 1N9BA 5FQMA 3PXPA 3ITAA 4H6JA 3AGFA 4OP8A 4G3VA 2EX6A 2Y2HA 5EVIB 1I5QA 2XSSA 2Z2MB 4F3LB 1VM1A 1OJGA 3MKEA 3IX4A 3BEBA 1IEMA 5FEFA 3MZDA 4PAUA 4WYYA 2OV5A 4BJPA 3TG9A 4ETZA 1OTBA 1O07A 5L07A 4C6YA 2JN7A 1BLCA 1GCEA 2ZLYA 1XJ4A 4KQRA 4P6ZS 2WKRA 2PBDP 5L10A 4N9KA 4OQHA 3B47A 1W8QA 3UB6A 4EESA 1NWZA 1YLTA 4QY6A 3IH8A 1TS0A 5DTSA 5CHJA 4EETB 3WRZA 2RCXA 3KO6A 2QPNA 3BY8A 4PPRA 1YPRA 4LV1A 1QMFA 2WGIA 1IKGA 5EVEA 4D2OA 4Y17A 1QMEA 2J3TD 1KE4A 4WUJA 4WZ5C 2O0YA 3RTYA 2QJ5A 1MY8A 3E2LA 4MBKA 5AQAA 2WK0A 2W3HA 2K7SA 5M19A 2WYXA 4IHQA 3IT9A 1JNUA 3OC2A 1YKDA 2Y91A 4X55A 3VOZA 1V9YA 1VEUA 1S4SA 1NYMA 1SHVA 3BFDA 5EVID 1K25A 3HLBA 3SOIA 3CZDA 2G2WA 5DFXA 1NRFA 2Y2LA 3RXWA 2FFFB 3GTCA 4QWOA 4JXVA 5HPFA 1DP6A 1IYSA 2XROA 4NKPA 1FCOA 4FCFA 4DRTA 2PYPA 2JE5A 2X71A 3ZG8B 1DP8A 3LY4A 1GHPA 3PR6A 1JWZA 4S2NA 4OOMA 2XH9A 3WS0A 1T1BA 3VOLA 2W3EA 2WKEA 1PI5A 3IHAA 3Q7ZA 3SS3A 3WWXA 4MMNA 3MBZA 5HL6A 3E98A 2VEAA 3C8CA 1W5DA 3H7WB 5DF7A 2WKQA 5CRFA 4F94A 5CX7A 3M6BA 1K6RA 1A0KA 1MWRA 2IWDA 2VGJA 1OTDA 3IXBA 4UHUA 1FSWA 3LO7A 4O01A 4OOLA 5DTTA 1FCNA 2G2UA 3ZQ5A 4NETA 3HUOA 4R4SA 5EECA 3UDFA 4ZAMA 5FQQA 4Y13A 4O8GA 4L0LA 1VETA 5EFWA 5HAQA 2EWVA 4E3LA 5CHMA 2XA7S 3C38A 3IX8A 4ME4A 1K57A 2ZM0A 3ZVWA 4BBUA 1XJ3A 4GS9B 5DF9A 1NY0A 3F1OA 3HBRA 1YAXA 5KZHA 4NEED 3DWZA 4EW7A 1MZUA 1HVBA 3SS4A 4R4RA 1ES3A 4WMCA 1U60A 2D01A 3CMZA 3OPPA 4ARZB 4GW9A 4ZBEA 1BULA 1K57C 4GHIA 4MDZA 3S22A 4S2PA 1SDEA 2INWA 4Y2FA 3SH7A 4EEUA 3NDEA 4G3WA 3WS1A 3NOPC 5EPHA 5F5YA 3CHWP 1W63M 2A24A 4I38A 4OLDA 3BJNA 3HVFA 1H8MA 3LUQA 4CLCB 2EWWA 5CXWA 2PYRA 1LL5A 1ESIA 2W3DA 1NLZA 1NZOA 4Q0HA 3NJAA 1NZUA 1BZAA 3LIEA 3T4OA 4E3NA 1XFQA 3UY6A 1JTGA 4OOYA 2P7JA 3GQZA 5FEGA 3KSGA 5HARA 1UWNX 2XRNA 3RFBA 1M40A 1TVFA 3MZFA 4XUXA 2CMNA 4ID4A 4N1XA 3BLSA 4Y0OA 1I2WA 2K31A 3O87A 5DTKA 1YT4A 1VHMA 3EQVA 3VV4A 2D02A 1ESUA 5LBRA 5HDDA 3FKWA 1K54A 4KQDA 3Q82A 4P85A 2ZC5B 4MEZA 2ZC7A 2W27A 3NBLA 4FTXA 4Q0JA 2EA9A 4B4XA 4OLGA 4NG2A 1OJ5A 5DVAA 2EXBA 3IH9A 3GMWA 5DF8A 2Y4AA 4MBFA 4E04A 4NXEA 3M2JA 2HDQA 2YKHA 3ITBA 4CPKA 1YM1A 3WS5A 3NDGA 2QKPA 4LRYC 4E3OA 4HJ3A 4HH3A 4KUKA 4LV2A 4II7A 1ZG6A 2WKPA 2PU4A 4BWIA 1XFNA 4UQIM 5FASA 1HLUP 4R23A 4KZ3A 1E4DA 4X56A 4BLMA 5MC7A 1Z09A 3WS4A 1JWPA 4U0TA 5FQKA 3HJIA 3GRJA 4PHTA 4LPZA 2QHKA 5TJJA 1STZA 3OPRA 5EV0A 4QHCA 4FUWA 5A90A 1UWPX 2A49A 4KZ4A 3T1SA 3ICYA 4OVDA 3B42A 3H7WA 4KZ7A 3IF6C 3IXHA 3EGXC 2FFYA 4L9GA 1ONHA 3ZCZA 2WAEA 3G4PA 3UB8A 1GHMA 2XEPA 5HDSA 1LL9A 5FI2A 3O5YA 4DE1A 2ZL1A 3ZNYA 5AQ9A 4BD1A 3ZDJA 4WEJA 3DTIA 3ZFZA 5EOOA 3C4OA 3MXRA 3W8KA 4JXWA 4BD0A 1LHYA 4XT2A 2JKTI 5TFQA 1GSVA 3C5AA 4HJ4A 2V1BA 1KE0A 4WN5A 3QP1A 3BLMA 1N9OA 4S2JA 1J3WA 1TS6A 2JKRI 1KVLA 5HDCA 3R7WA 3DW0A 5C5KA 5AVFA 1XKZA 2VK3A 3V50A 2O9BA 4Y3IA 2HJEA 1XJ2A 4KG2A 4BBTA 5HX9A 3NOUC 1ZC2A 1G28A 2BLSA 3B3XA 3GV9A 4WEKA 4EERA 2W1TA 2HGVA 3KYEA 4IBXA 3FZCA 4EBNA 4QJGA 4RVAA 3A3IA 5EOEA 3MF0A 3W4OA 2Y8HA 2YKFA 2KOIA 1CI8A 2X01A 2Y2JA 3DWKA 1ZG4A 4IEDA 2I72A 2ZOIA 1YMXA 2DMWA 2XFSA 3ZG7B 2P04A 4LGWA 1LSXA 3C7VA 2H0TA 1SKOA 3G34A 4I3AA 5GHXA 3RJUA 2EFXA 5E43A 1L2SA 1W79A 1T18A 4H6JB 4PKYA 4EUZA 5CEDA 3HL9A 3T12B 4O0PA 4KZ8A 2NUTC 3UPPA 1S1YA 1T1AA 2W3FA 1FOFA 3DTEA 2E8JA 1TF1A 5GLAA 5EVIA 2OLVA 3P98A 3UNWA 3OCNA 1OT6A 4B93A 4EBLA 1K4EA 3K3DA 5FDSA 2WKIA 4UA9A 3QNBA 4KZ6A 1YLZA 4WM9A 2BASA 3N8RA 5IT5A 4BL3A 3F1NA 5IS1A 1K55A 1CJFA 3BY9A 4UEYA 1BTLA 1LSVA 3LICA 2H10A 5FSRA 3UE0A 3W4QA 1IFQA 4CLCE 1FSYA 3T4KA 2ZC6B 1F9IA 1DJBA 4M4XA 2X02A 3KYZA 4N9LA 1W7FA 1S6RA 5E2FA 1ODVA 2KDKA 1YQSA 4CQHA 5M1AA 2B5RA 3TE8A 3SH9A 2EFUA 2L4RA 3KYQA 2J3TC 3FPVA 2ZJ9A 2OLUA 4KQQA 5KSCA 4FSFA 2EX9A 3S4XA 4Z1WA 4I39A 4LCLA 5I94A 4GNUA 1WE4A 4GCZA 4A5RA 2HF6A 2JHEA 2PHYA 3A3JA 3HLEA 3IBRA 4OP5A 2V20A 2Z6DA 5CECA 4HIAA 4PM7A 1K38A 5FATA 1MPLA 3UMDA 1BT5A 3VP0A 2JCHA 1MKMA 4JKTA 5D3OA 1H5XA 1E3UA 4CLCD 3B33A 3P01A 1ES2A 4HP4A 5L8MA 3TJZC 3Q7VA 2FH5A 3T4SA 4Y15A 2BG1A 1HD8A 4HBUA 4NXBA 4JGOA 4X69A 2Q9MA 1BSGA 1MBLA 3G31A 4JPMA 4LRXC 4E6WA 2QZ6A 2Y2OA 2ZM2A 2QWSA 3KX0X 3NC8A 2Z6CA 2J9OA 4JLFA 4PKYG 4BENA 1IYQA 4AFIA 3C7UA 4QD4A 4GDNA 5DJTA 2OAP1 3FC7A 4ESPA 3V5MA 1MC0A 2VGLM 4QY5A 1XJ6A 3HLGA 4K91A 2EX8A 5HAIA 2O99A 5FAPA 1IYPA 2ZC3B 3LYXA 4EQIA 4R0QA 3T4QA 3GECA 1OTAA 3E4PA 3E0YA 4OPQA 3UE3A 3E2KA 1H8YA 3HLFA 4WZ4A 1ZHHB 1IYOA 2Y2PA 5J4EA 3G2YA 1XXMA 2JC7A 1L0FA 4PM5A 3MQQA 3BQAA 1KOUA 1K6SA 1LSWA 1EW0A 4E3KA 5G18A 2HDUA 3OBFA 3CITA 5A93A 2ZQDA 5G4ZA 3IWIA 4JXSA 5TBMB 4K0WA 2BTFP 4HQAA 3G6OA 3D3OA 1XP4A 4ZJ2A 2JKGA 2H5SA 1LT0A 1SKFA 4OQGA 3NY4A 4YOFA 3ZYTA 5HPIA 4CLCA 4ZJ3A 3BWLA 2QMIA 3ULFA 4LV3A 2XK1A 4GD6A 3LIDA 1TEMA 2PAVP 3JVVA 3N7WA 1V9ZA 4NK3A 4JBFA 1EI5A 4MBHA 5F82A 1FCMA 3DTKA 3NCKA 1XX2A 3GSGA 3IS2A 3BYDA 2UV0E 1D1JA 4LRZE 2J9PA 4R1GA 4WBGA 3MJQA 2ZQAA 3QP5A 3ZHHA 3ZNTA 2QYBA 2B95A 3T1XA 5GLDA 5HZHA 2KLIA 4PM9A 4F3LA 1PFLA 3IS2B 1K55C 2XF3A 3HCYA 2R9WA 2CC1A 2VX8A 4IUKA 3ZG9B 5FI6A 1YLYA 2PU2A 1PI4A 1XPBA 3VMAA 5DKKA 1TS8A 3IBJA 2GZAA 2VV8A 1Y54A 3EOIA 4DJ2A 4C75A 3VOYA 3BQ8A 1Y28A 1S66L 4RX3A 3FPWA 4JXGA 5IHVA 3F1NB 1SDNA 5EVIC 1Y4OA 3VSLA 4B4ZA 5GL9A 3LY3A 2OWJA 3V3RA 2J7VA 1PIOA 2HJ9C 1XGJA 5CHUA 1TDGA 1KGGA 3NOTC 3KSIA 1PNEA 4EU0A 3OLOA 3Q81A 5JYOA 2PRFA 2V9AA 1YSPA 4OONA 4HHDA 2Y2KA 4GB7A 3F1PA 3QP2A 2P9VB 3O3VA 4BBVA 5HAPA 2B18A 1CQAA 4LENA 1H0MA 3PBNA 4OKPA 3T4JA 2VV6A 1KGFA 3S7PA 3M2KA 3MZEA 4GHIB 4E3JA 2DCFA 2Y55A 1G6OA 2ACGA 2V2FF 2HP9A 2IWBA 2HPBA 3EWKA 1WYCA 1PW1A 3RXXA 3H82B 4HP9A 3NIAA 3UE6A 4FD8A 4GZBA
chains in the Genus database with same CATH topology
4WL9A 5F68A 2J3TD 3JVUA 5K5BA 2ZMVA 4HI4A 3MF0A 4HJ6A 3PBTA 3E4OA 2Y8HA 1F98A 2YKFA 4WUJA 2KOIA 2L1MA 2O0YA 4MN7A 3RTYA 2QJ5A 2H28A 2MJ6A 1DP9A 2ZOIA 2W3HA 2K7SA 2V0UA 1F5MA 2DMWA 4JGRA 4IHQA 1JNUA 2P04A 3OC2A 1LSXA 1YKDA 4I3AA 2VJWA 3P7NA 3LI9A 1V9YA 3R7WB 2VGLS 3KSHA 1S4SA 2OOLA 1WA9A 1T18A 3LR4A 4H6JB 4PKYA 4GLQA 1OTEA 1P97A 5DFXA 4EQ1A 4O0PA 3K2NA 2NUTC 1S1YA 3LIAA 3UMEA 4YWZA 4EXOA 1T1AA 2W3FA 5HPFA 1DP6A 3PBQA 2XROA 4NKPA 5HD5A 4IUHA 1TF1A 4ARZA 3PBOA 3MQ0A 2PYPA 3K3CA 2O9CA 3OCNA 3UB7A 1OT6A 1DP8A 3PR6A 4B93A 4ZRRA 2Y79A 1P0ZA 3K3DA 4OOMA 2FZ0A 2VKSA 1T1BA 4B9OA 5F6AA 3VOLA 2W1TB 2W3EA 2JKRM 2BASA 5IT5A 4K08A 3F1NA 5IS1A 3CAXA 4GS9A 4WELA 3BY9A 4MMNA 4UEYA 2G7UA 1ZTUA 5HL6A 3E98A 1LSVA 2VEAA 3C8CA 3LICA 4IJGA 3H7WB 1TS7A 2WKQA 3FG8A 1IFQA 4HOIA 1NLYA 4CLCE 4GJ4A 2QJ7A 1IOUA 5CX7A 2VZWA 3T4KA 2J3WA 4L9EA 3CUEA 1N9NA 2V1AA 4QPRA 2V0WA 1F9IA 4MN5A 4M4XA 1OTDA 3A0VA 3KYZA 1ODVA 4O01A 4OOLA 2KDKA 1OTIA 4CQHA 3ZQ5A 4DMZA 5HWTA 2HV1A 3H82A 3TE8A 3KYQA 2L4RA 2J3TC 3FPVA 3C2WA 4KQOA 1D06A 3R4KA 3PYPA 1BYWA 3S7QA 3SW1A 4O8GA 4L0LA 1N9LA 4FSFA 4UQIS 4Z1WA 3LR5A 3D72A 5EFWA 4I39A 3LR3A 3CLOA 4NXGA 2EWVA 4Y5FA 2OWHA 2XA7S 3C38A 4ME4A 5I5LA 2M7VA 4I5SA 2W1RA 4GCZA 5HSQA 2HF6A 2JHEA 3VE3A 2PHYA 3MQOA 4BBUA 1XJ3A 4GS9B 3IBRA 1OT9A 4HH2A 5DF9A 4R70A 3A0SA 4XT2B 3CUEC 3F1OA 2Z6DA 4HIAA 1P9RA 1YAXA 3NHQA 4NEED 4FOFA 3UMDA 2IA2A 4R38A 4EW7A 1MKMA 1MZUA 4NXFA 3EEHA 5G4YA 4CLCD 2D01A 3B33A 3P01A 1NRJA 5DJUA 4HP4A 4ARZB 5L8MA 3TJZC 4GW9A 4CLCC 4MDZA 3LIBA 4GHIA 1X0OA 3KSFA 2FH5A 2PD8A 3T4SA 3VE4A 1D7EA 2INWA 3LFVA 4Y2FA 4EEUA 4KUOA 4G3WA 5HD3A 3NOPC 4NXBA 3F1OB 4JGOA 5F5YA 4DN0A 1W63M 2A24A 4LRXC 4I38A 2ZOHA 3RH8B 3BJNA 3EQUA 2QWSA 3KX0X 4WF0A 2Z6CA 1H8MA 3LUQA 4PKYG 4CLCB 4AFIA 2EWWA 2ZBBA 2PYRA 5DJTA 1YSQA 2W3DA 1NLZA 2OAP1 3FC7A 4Q0HA 3NJAA 1MC0A 2VGLM 2GNXA 2OAQ1 1XJ6A 1UGUA 5IU1A 3LIEA 5TBMA 3T4OA 1XFQA 4MCWA 5J3WA 1VB6A 3F1PB 2O99A 3TW8A 2J80A 3PBSA 2P7JA 3HJKA 3LI8A 3LYXA 3KSGA 1T19A 2VA0A 3T4QA 1UWNX 2XA7M 4P6ZM 3GECA 2XRNA 2NUPC 1OTAA 3E4PA 4BMWA 3RFBA 3E0YA 3MR0A 3UE3A 4I3JA 5HWVA 1ZHHB 5J4EA 2CMNA 1GSXA 4YNRA 3MQQA 2PDRA 2O9AA 3BQAA 1KOUA 2K31A 1LSWA 1EW0A 3LIFA 1VHMA 3EQVA 3VV4A 2D02A 3OBFA 5F69A 5LBRA 3CITA 5HDDA 2W3GA 5G4ZA 4KQDA 4R6LA 5J7EA 3E4QA 2L0WA 2M7UA 1P9WA 5AVEA 2W27A 2GX5A 5TBMB 3V67A 4Q0JA 2LB9A 2EA9A 3G6OA 3D3OA 4HQAA 2PD7A 3CI6A 1DRMA 3OOVA 3PHYA 1LT0A 1OJ5A 5FL3A 1T1CA 4YOFA 3GDIA 3T4TA 3T50A 3MMHA 3TRCA 4HNBA 3ZYTA 5HPIA 4CLCA 4E04A 3BWLA 3EEAA 4NXEA 3ULFA 2YKHA 4G3KA 3W2ZA 3LIDA 2PR6A 4L9FA 1LL8A 2QKPA 4LRYC 3JVVA 5DFYA 1V9ZA 4HJ3A 4HH3A 2PT7A 4KUKA 1S4RA 4II7A 3MFXA 1TD5A 2WKPA 4R3AA 2LB5A 2I9VA 2A2LA 4BWIA 1XFNA 2PR5A 4I3IA 3T4LA 3C30A 4UQIM 4EUVA 3MXQA 3IS2A 2VV7A 5DKLA 3EGDC 4LRZE 3A0RA 3MJQA 5MC7A 1W63Q 4WLAA 2QYBA 5KSHA 3S7NA 2KX6A 3H9WA 5HZHA 2KLIA 4F3LA 3HJIA 5AJGA 3PBRA 2JKTM 3IS2B 4PHTA 5KIZA 3HCYA 5HWWA 4LPZA 2QHKA 5TJJA 4IUKA 2VX8A 1STZA 3UB9A 1UWPX 5DKKA 3ICYA 1TS8A 2P08A 2GZAA 2VV8A 3IBJA 4MN6A 3EOIA 2A24B 3B42A 3H7WA 4DJ2A 4EEPA 3BQ8A 1Y28A 2W0NA 1S66L 3CWFA 3U2AA 3EGXC 4L9GA 3FPWA 4DJ3A 4LLOB 3F1NB 4JGQA 1S1ZA 4ETXA 3UB8A 5A8BA 2OWJA 1OPXA 1GSWA 2HJ9C 5HDSA 3PXPA 2R78A 3KSIA 3NOTC 4EU0A 3O5YA 3BW6A 3OLOA 3OCLA 3DBAA 4H6JA 1H3QA 2ZMFA 4G3VA 2V9AA 1YSPA 4WEJA 4HHDA 2B02A 2XSSA 2VLGA 4F3LB 1S67L 3F1PA 2M1CA 4BBVA 2B18A 1OJGA 4Q0IA 3PBNA 4XT2A 3T4JA 2VV6A 2JKTI 1GSVA 2K2NA 4HJ4A 2GJ3A 3S7PA 2V1BA 4PAUA 4WN5A 4BJPA 1N9OA 4GHIB 4ETZA 1OTBA 1TS6A 2JN7A 2JKRI 5HDCA 3R7WA 1XJ4A 4P6ZS 1G6OA 2WKRA 5C5KA 5AVFA 2O9BA 4Y3IA 2HJEA 1XJ2A 3B47A 3S7OA 3UB6A 4BBTA 4EESA 1NWZA 4RQ9A 3NOUC 3EWKA 4JGPA 1TS0A 1G28A 3H82B 4HP9A 4EETB 3UE6A 4WEKA 4EERA 4HY8A 2W1TA 3KO6A 3LR0A 2HGVA 3BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  3A0V A;  2KX6 A;  1VB6 A;  3H9W A;  4WL9 A;  5HZH A;  3F1P B;  5F68 A;  4F3L A;  3HJI A;  3IS2 B;  5KIZ A;  4HI4 A;  1ODV A;  5HWW A;  4LPZ A;  2QHK A;  2KDK A;  1OTI A;  2J80 A;  3ZQ5 A;  2P7J A;  3HJK A;  3LI8 A;  3LYX A;  4HJ6 A;  3UB9 A;  1UWP X;  3E4O A;  5HWT A;  2HV1 A;  1T19 A;  5DKK A;  1F98 A;  2YKF A;  3H82 A;  4WUJ A;  1TS8 A;  1UWN X;  2L1M A;  3ICY A;  2VV8 A;  2L4R A;  3GEC A;  4MN6 A;  2QJ5 A;  3RTY A;  2A24 B;  1OTA A;  2H28 A;  3E4P A;  3H7W A;  4DJ2 A;  1DP9 A;  3C2W A;  1D06 A;  4EEP A;  1Y28 A;  2W0N A;  3MR0 A;  1S66 L;  3CWF A;  3PYP A;  1BYW A;  4I3J A;  3SW1 A;  5HWV A;  2ZOI A;  4L9G A;  5J4E A;  1N9L A;  4DJ3 A;  2K7S A;  2V0U A;  2CMN A;  1GSX A;  3D72 A;  4JGR A;  5EFW A;  4LLO B;  3F1N B;  1JNU A;  4I39 A;  4JGQ A;  1LSX A;  3CLO A;  3MQQ A;  4NXG A;  2PDR A;  4I3A A;  2OWH A;  1S1Z A;  1KOU A;  3P7N A;  3UB8 A;  3LI9 A;  5A8B A;  1LSW A;  1EW0 A;  1V9Y A;  3LIF A;  2OWJ A;  1S4S A;  2OOL A;  5I5L A;  2D02 A;  4I5S A;  1GSW A;  4GCZ A;  5F69 A;  1WA9 A;  5HDD A;  5HSQ A;  1T18 A;  5HDS A;  4H6J B;  2JHE A;  3VE3 A;  2PHY A;  3MQO A;  4PKY A;  2R78 A;  3NOT C;  1XJ3 A;  4GS9 B;  4KQD A;  4R6L A;  5G4Z A;  3E4Q A;  3IBR A;  3OLO A;  1OT9 A;  2L0W A;  4HH2 A;  1OTE A;  4R70 A;  4H6J A;  1P97 A;  5AVE A;  3A0S A;  2W27 A;  4XT2 B;  3F1O A;  4EQ1 A;  2Z6D A;  1S1Y A;  4HIA A;  5TBM B;  3LIA A;  2V9A A;  3NHQ A;  2EA9 A;  3G6O A;  4HQA A;  4HHD A;  3UME A;  2B02 A;  2PD7 A;  4YWZ A;  3UMD A;  4EXO A;  1T1A A;  4R38 A;  4EW7 A;  1DRM A;  3PHY A;  2VLG A;  1DP6 A;  1LT0 A;  1MZU A;  1OJ5 A;  1S67 L;  3F1P A;  4F3L B;  2M1C A;  5HD5 A;  4NXF A;  4BBV A;  1T1C A;  3EEH A;  3GDI A;  1OJG A;  5G4Y A;  3T50 A;  4HNB A;  2D01 A;  2PYP A;  3K3C A;  3B33 A;  4XT2 A;  2VV6 A;  5DJU A;  4HP4 A;  1GSV A;  3BWL A;  4E04 A;  4HJ4 A;  2GJ3 A;  4GW9 A;  4NXE A;  3ULF A;  2V1B A;  2YKH A;  3UB7 A;  1OT6 A;  1DP8 A;  3LIB A;  4GHI A;  1X0O A;  4WN5 A;  1N9O A;  3LID A;  2PD8 A;  3VE4 A;  1D7E A;  1P0Z A;  2INW A;  2PR6 A;  3K3D A;  4GHI B;  4L9F A;  4KUO A;  1OTB A;  4EEU A;  1LL8 A;  1TS6 A;  2QKP A;  4LRY C;  2JN7 A;  5J7E A;  5HDC A;  1V9Z A;  4HJ3 A;  1T1B A;  4B9O A;  4HH3 A;  1XJ4 A;  3NOP C;  5F6A A;  4KUK A;  5HD3 A;  3VOL A;  4NXB A;  2WKR A;  3F1O B;  4JGO A;  5F5Y A;  5AVF A;  1S4R A;  2BAS A;  4BBU A;  2A24 A;  4K08 A;  3F1N A;  4LRX C;  3MFX A;  4I38 A;  2ZOH A;  3CAX A;  1XJ2 A;  2WKP A;  4R3A A;  4GS9 A;  3RH8 B;  5IS1 A;  3BY9 A;  2QWS A;  3KX0 X;  4WF0 A;  2I9V A;  2Z6C A;  1LSV A;  1XFN A;  3LUQ A;  2PR5 A;  2VEA A;  3C8C A;  3LIC A;  4I3I A;  4PKY G;  3UB6 A;  4BBT A;  2ZBB A;  1NWZ A;  4RQ9 A;  4EES A;  3MXQ A;  3NOU C;  3H7W B;  2PYR A;  3EWK A;  1TS7 A;  2WKQ A;  4JGP A;  3FG8 A;  1TS0 A;  1G28 A;  3IS2 A;  3H82 B;  4HOI A;  4HP9 A;  2VV7 A;  5DKL A;  5DJT A;  4EET B;  3UE6 A;  4LRZ E;  3FC7 A;  3A0R A;  4EER A;  2QJ7 A;  3NJA A;  4HY8 A;  4L9E A;  3MJQ A;  1XJ6 A;  1UGU A;  4MN5 A;  5IU1 A;  3LIE A;  1N9N A;  2V1A A;  4WLA A;  5TBM A;  2V0W A;  1XFQ A;  1F9I A;  3BY8 A;  5J3W A;  4M4X A; 
#chains in the Genus database with same CATH topology
 4WL9 A;  1G68 A;  2EXA A;  4KG6 A;  3VP4 A;  3JVU A;  2ZMV A;  3V3S A;  5JYP A;  1Z6F A;  2JKF A;  4N92 A;  4HJ6 A;  2L1M A;  3FV7 A;  3AGD A;  3D4F A;  2H28 A;  2MJ6 A;  2C6W B;  2XFT A;  1DJA A;  2H0Y A;  2V0U A;  3WRT A;  4JGR A;  5AQB A;  1S0W A;  2VJW A;  3P7N A;  3BEC A;  3ISG A;  1WA9 A;  3LR4 A;  3ZG5 A;  2ZL1 B;  5CTN A;  4CJN A;  1ES5 A;  3O88 A;  3LEQ A;  1P97 A;  2AVX A;  3UME A;  4YWZ A;  4EXO A;  4IUH A;  3PBO A;  3MQ0 A;  4IBR A;  4DXC A;  2EX2 A;  3K3C A;  2O9C A;  4U3T A;  3S1Y A;  3UB5 P;  1P0Z A;  1MWT A;  4GKU A;  2VKS A;  5F1G A;  1M6K A;  2JKR M;  3CPT B;  4K08 A;  2P9V A;  3CAX A;  3CPT A;  4GS9 A;  4O7D A;  3BRM A;  1ZTU A;  4S2N C;  4IJG A;  1EWZ A;  1TS7 A;  3QP8 A;  4HOI A;  1NLY A;  2QJ7 A;  1IOU A;  3FWL A;  2J3W A;  2Q9N A;  2V1A A;  4MN5 A;  5EM1 A;  1YMS A;  1HTZ A;  3N8S A;  2XLN A;  1OTI A;  1PWC A;  1O7E A;  4DMZ A;  2HV1 A;  3H82 A;  4KQO A;  1D06 A;  4IVI A;  1C3B A;  1KVM A;  3JYI A;  3R4K A;  3PYP A;  3S7Q A;  3MKF A;  4UQI S;  4HES A;  3D72 A;  5AQ7 A;  2E8I A;  3DAV A;  2OWH A;  5FDH A;  1SCW A;  1I2S A;  4KZB A;  1TDL A;  4RYE A;  2M7V A;  2W1R A;  1KGE A;  3CG5 A;  2HDR A;  3VE3 A;  3MQO A;  4FH4 A;  4R70 A;  3Q1F A;  4JF5 A;  3CUE C;  3UDX A;  1P9R A;  3W4P A;  4FOF A;  1NJ4 A;  1MWU A;  1E25 A;  2WUQ A;  2Y2G A;  4B88 A;  1WYB A;  1RP5 A;  5G4Y A;  4P87 A;  4CLC C;  5FAO A;  2Y59 A;  3NUL A;  4E3I A;  3KSF A;  2PD8 A;  1D7E A;  3LFV A;  4DXB A;  3IF6 A;  3PAE A;  1IKI A;  3BFC A;  4GN2 A;  2ZOH A;  1L0E A;  4OPY A;  3RH8 B;  2WGW A;  3PTE A;  1JTD A;  2Y2M A;  5KMW A;  3Q07 A;  4WZ5 A;  4RA7 A;  1YSQ A;  5TR7 A;  4LFU A;  5F1F A;  3SH8 A;  4KZ5 A;  4MCW A;  3AGE A;  5GLB A;  2P74 A;  3F1P B;  1W8Y A;  3TW8 A;  5HW3 A;  4HBT A;  4R3B A;  3QNC A;  1HZO A;  3PBS A;  3HJK A;  3LI8 A;  1ERO A;  5EE8 A;  1T19 A;  2XA7 M;  1KDW A;  4BMW A;  3C4P A;  1FQG A;  3MR0 A;  4I3J A;  3GVB A;  4XXR A;  5HWV A;  2HDS A;  4S2M A;  1GSX A;  5GLC A;  5CEB A;  2PDR A;  2O9A A;  1VQQ A;  5A91 A;  3IWQ A;  2XR0 A;  5L2F A;  1JWV A;  4R6L A;  2M7U A;  1BLP A;  1P9W A;  3O86 A;  1K54 C;  2GX5 A;  1MXO A;  3V67 A;  1PYY A;  2LB9 A;  3I7J A;  5CTM A;  5CER A;  2PD7 A;  4X53 A;  3CI6 A;  1Q2Q A;  2ZC4 B;  3OOV A;  2Y2I A;  3PHY A;  1Q2P A;  3IQA A;  3T50 A;  3MMH A;  1K56 D;  2WKH A;  3HLC A;  3EEA A;  2V8F A;  4G3K A;  2PR6 A;  2ZQ8 A;  1LL8 A;  2PBY A;  4QB8 A;  1ACF A;  4DKI A;  4DE3 A;  4Y0T A;  1S4R A;  3M6H A;  4BQM A;  3MFX A;  4EV4 A;  4DDS A;  3A3E A;  2A2L A;  5A92 A;  2PR5 A;  4I3I A;  1XA7 A;  3C30 A;  2RL3 A;  3VP1 A;  2VV7 A;  5DKL A;  3G30 A;  4OPZ A;  3G32 A;  3A0R A;  4DDY A;  4C3Q A;  1W63 Q;  5KSH A;  2KX6 A;  4MLL A;  4RX2 A;  2HP5 A;  2HZ5 A;  3HUN A;  4M3K A;  5KIZ A;  4X25 A;  5EM0 A;  5HWW A;  3A3D A;  3CJM A;  3UB9 A;  2J8Y A;  4S2O A;  3HLD A;  2W0N A;  3CWF A;  3UDI A;  4JGQ A;  3SZT A;  1LI0 A;  4ETX A;  5A8B A;  2GDN A;  4OH0 A;  1OPX A;  1GSW A;  3IHB A;  2R78 A;  3BW6 A;  1L0G A;  3QP4 A;  3OCL A;  3DBA A;  4Z9Q A;  1H3Q A;  2ZMF A;  2B02 A;  2Z2L B;  3BM6 A;  5F83 A;  2VLG A;  4X6T A;  1S67 L;  2M1C A;  4GDB A;  4Q0I A;  4GOG A;  1K4F A;  1LLB A;  2K2N A;  1CK3 A;  2GJ3 A;  4OPR A;  3Q7V B;  1NYY A;  3HRE A;  1MWS A;  2DNS A;  4JF4 A;  3VFF A;  1BLS A;  5GHY A;  4X1M A;  5FQJ A;  1IEL A;  1FIK A;  5FI7 A;  5FA7 A;  3QHY A;  3S7O A;  4Q8I A;  3OZH A;  4RQ9 A;  1RCJ A;  4ZTK A;  3UPO A;  4JGP A;  1PWG A;  2Y2N A;  1FR6 A;  1RGZ A;  3BFE A;  4HY8 A;  3LR0 A;  1DJC A;  3IF6 B;  2WAF A;  3N6I A;  4P0M A;  5F68 A;  1YLP A;  4K0X A;  5M18 A;  5K5B A;  4HI4 A;  5FQ9 A;  1AXB A;  3QP6 A;  4WMC D;  3PBT A;  2WGW B;  3E4O A;  3IWO A;  1F98 A;  2WZX A;  4MN7 A;  1DP9 A;  2DRW A;  4DF6 A;  3TOI A;  1F5M A;  4OQI A;  3PAG A;  3BFF A;  4MNR A;  5CGS A;  1VET B;  3MXS A;  1DY6 A;  3VSK A;  2ZQC A;  3LI9 A;  3R7W B;  2VGL S;  3KSH A;  2OOL A;  1E3U D;  1BUE A;  1KE3 A;  2C5W B;  4GLQ A;  1OTE A;  4EQ1 A;  3K2N A;  3LIA A;  2ZMA A;  3UN7 A;  1FR1 A;  1PZO A;  3PBQ A;  1GHI A;  5HD5 A;  4ARZ A;  4E3M A;  2V1Z A;  2R9X A;  5TGF A;  3UB7 A;  3HLW A;  4YIN A;  4ZRR A;  1ES4 A;  2Y2Q A;  2Y79 A;  1CI9 A;  3HUM A;  2FZ0 A;  3LCE A;  3UPN A;  3NI9 A;  5F6A A;  4B9O A;  2W1T B;  3GR2 A;  2WZZ A;  4WEL A;  5E2G A;  2G7U A;  3VFH A;  4N1H A;  3FG8 A;  4S2I A;  3T1R A;  3P09 A;  4GJ4 A;  2XQZ A;  4S2L A;  2VZW A;  1ZKJ A;  4L9E A;  3G2Z A;  4PM8 A;  4Y7P A;  2XD1 A;  3CUE A;  3MSH A;  3N8L A;  1N9N A;  4KEN B;  3ZGA B;  4QPR A;  2V0W A;  1OME A;  3A0V A;  2IWC A;  1ONG A;  1L0D A;  4FH2 A;  1K56 A;  4UA6 A;  5HWT A;  5E2E A;  3C2W A;  1L3L A;  1BYW A;  3SW1 A;  4GD8 A;  1N9L A;  3LR5 A;  5U47 A;  3LR3 A;  2ZD8 A;  3CLO A;  4NXG A;  4Y5F A;  1JVJ A;  4JF6 A;  5I5L A;  3T1Q B;  4I5S A;  2Q0O A;  3VP2 A;  5HSQ A;  2V8C A;  1XA1 A;  2ZQ7 A;  1OT9 A;  4HH2 A;  3ZVT A;  3A0S A;  4U0X A;  4XT2 B;  3NHQ A;  2IA2 A;  4R38 A;  2ZM8 A;  4NXF A;  3EEH A;  5EUA A;  4LCM A;  4KZA A;  4X68 A;  4HEF A;  4Y0U A;  1NRJ A;  5DJU A;  3JPU A;  3LIB A;  1X0O A;  3VE4 A;  1LI9 A;  4KUO A;  3VP3 A;  4PMA A;  4BL2 A;  2XDM A;  5HD3 A;  3BFG A;  3F1O B;  4DN0 A;  1K0K A;  1ALQ A;  4E6X A;  5BOH A;  5GHZ A;  3EQU A;  4WF0 A;  1N4O A;  1VEU B;  3IXG A;  2ZBB A;  3V39 A;  1J9M A;  1ERQ A;  1CEF A;  4IVK A;  4X1L A;  5CGW A;  1PWD A;  1PRQ A;  2GNX A;  2OAQ 1;  1UGU A;  5IU1 A;  2JBF A;  5TBM A;  2WGV A;  5J3W A;  1VB6 A;  4ZJ1 A;  2ZQ9 A;  3G35 A;  3MS6 A;  1ERM A;  2J80 A;  3MFD A;  5L09 A;  1F2K A;  2VA0 A;  1GA9 A;  4ZDX A;  4P6Z M;  5HL1 A;  3N4I A;  1KDS A;  4QU3 A;  2NUP C;  4OQ0 A;  4UA7 A;  4PM6 A;  3IX3 A;  1BLH A;  1PZP A;  4DE2 A;  1GA0 A;  5J8X A;  1SKO B;  3IF5 A;  4YNR A;  3NEC A;  1SZV A;  3D9Y A;  3OPH A;  3LIF A;  1H8Z A;  3WS2 A;  5F69 A;  5HFO A;  2W3G A;  4YFM A;  3IXD A;  5EVL A;  5J7E A;  2XGN A;  3E4Q A;  2L0W A;  4H8R A;  5AVE A;  4DE0 A;  3U4L P;  1YLW A;  4P6B A;  1DRM A;  5FL3 A;  1YLJ A;  1T1C A;  3FKV A;  3GDI A;  3T4T A;  2UWX A;  3TRC A;  3UE1 A;  4HNB A;  2A3U A;  1MKI A;  3W2Z A;  3SS5 A;  4L9F A;  5DFY A;  2VGK A;  5FAQ A;  3L9K A;  3TSG A;  2PT7 A;  1RGY A;  1CEG A;  5CGX A;  2HP6 A;  1TD5 A;  4R3A A;  2LB5 A;  4EBP A;  2I9V A;  2XD5 A;  3T4L A;  3LGO A;  1FIL A;  4EUV A;  3MXQ A;  4LV0 A;  1G6A A;  3DTM A;  5FQI A;  3L7H A;  3EGD C;  4KG5 A;  4UAA A;  4KZ9 A;  4WLA A;  3LEZ A;  3S7N A;  3H9W A;  4XUZ A;  4S2K A;  5AJG A;  2WAD A;  3PBR A;  2JKT M;  4R3J A;  4D60 A;  4EWF A;  1XGI A;  5E2H A;  1AWI A;  1NXY A;  4MN6 A;  2P08 A;  2A24 B;  3OPL A;  4EEP A;  1G5U A;  3UO9 A;  3U2A A;  1PW8 A;  1CF0 A;  4DJ3 A;  3A3F A;  4LLO B;  2OSU A;  3ZG0 A;  1S1Z A;  3FYZ A;  1N9B A;  5FQM A;  3PXP A;  3ITA A;  4H6J A;  3AGF A;  4OP8 A;  4G3V A;  2EX6 A;  2Y2H A;  5EVI B;  1I5Q A;  2XSS A;  2Z2M B;  4F3L B;  1VM1 A;  1OJG A;  3MKE A;  3IX4 A;  3BEB A;  1IEM A;  5FEF A;  3MZD A;  4PAU A;  4WYY A;  2OV5 A;  4BJP A;  3TG9 A;  4ETZ A;  1OTB A;  1O07 A;  5L07 A;  4C6Y A;  2JN7 A;  1BLC A;  1GCE A;  2ZLY A;  1XJ4 A;  4KQR A;  4P6Z S;  2WKR A;  2PBD P;  5L10 A;  4N9K A;  4OQH A;  3B47 A;  1W8Q A;  3UB6 A;  4EES A;  1NWZ A;  1YLT A;  4QY6 A;  3IH8 A;  1TS0 A;  5DTS A;  5CHJ A;  4EET B;  3WRZ A;  2RCX A;  3KO6 A;  2QPN A;  3BY8 A;  4PPR A;  1YPR A;  4LV1 A;  1QMF A;  2WGI A;  1IKG A;  5EVE A;  4D2O A;  4Y17 A;  1QME A;  2J3T D;  1KE4 A;  4WUJ A;  4WZ5 C;  2O0Y A;  3RTY A;  2QJ5 A;  1MY8 A;  3E2L A;  4MBK A;  5AQA A;  2WK0 A;  2W3H A;  2K7S A;  5M19 A;  2WYX A;  4IHQ A;  3IT9 A;  1JNU A;  3OC2 A;  1YKD A;  2Y91 A;  4X55 A;  3VOZ A;  1V9Y A;  1VEU A;  1S4S A;  1NYM A;  1SHV A;  3BFD A;  5EVI D;  1K25 A;  3HLB A;  3SOI A;  3CZD A;  2G2W A;  5DFX A;  1NRF A;  2Y2L A;  3RXW A;  2FFF B;  3GTC A;  4QWO A;  4JXV A;  5HPF A;  1DP6 A;  1IYS A;  2XRO A;  4NKP A;  1FCO A;  4FCF A;  4DRT A;  2PYP A;  2JE5 A;  2X71 A;  3ZG8 B;  1DP8 A;  3LY4 A;  1GHP A;  3PR6 A;  1JWZ A;  4S2N A;  4OOM A;  2XH9 A;  3WS0 A;  1T1B A;  3VOL A;  2W3E A;  2WKE A;  1PI5 A;  3IHA A;  3Q7Z A;  3SS3 A;  3WWX A;  4MMN A;  3MBZ A;  5HL6 A;  3E98 A;  2VEA A;  3C8C A;  1W5D A;  3H7W B;  5DF7 A;  2WKQ A;  5CRF A;  4F94 A;  5CX7 A;  3M6B A;  1K6R A;  1A0K A;  1MWR A;  2IWD A;  2VGJ A;  1OTD A;  3IXB A;  4UHU A;  1FSW A;  3LO7 A;  4O01 A;  4OOL A;  5DTT A;  1FCN A;  2G2U A;  3ZQ5 A;  4NET A;  3HUO A;  4R4S A;  5EEC A;  3UDF A;  4ZAM A;  5FQQ A;  4Y13 A;  4O8G A;  4L0L A;  1VET A;  5EFW A;  5HAQ A;  2EWV A;  4E3L A;  5CHM A;  2XA7 S;  3C38 A;  3IX8 A;  4ME4 A;  1K57 A;  2ZM0 A;  3ZVW A;  4BBU A;  1XJ3 A;  4GS9 B;  5DF9 A;  1NY0 A;  3F1O A;  3HBR A;  1YAX A;  5KZH A;  4NEE D;  3DWZ A;  4EW7 A;  1MZU A;  1HVB A;  3SS4 A;  4R4R A;  1ES3 A;  4WMC A;  1U60 A;  2D01 A;  3CMZ A;  3OPP A;  4ARZ B;  4GW9 A;  4ZBE A;  1BUL A;  1K57 C;  4GHI A;  4MDZ A;  3S22 A;  4S2P A;  1SDE A;  2INW A;  4Y2F A;  3SH7 A;  4EEU A;  3NDE A;  4G3W A;  3WS1 A;  3NOP C;  5EPH A;  5F5Y A;  3CHW P;  1W63 M;  2A24 A;  4I38 A;  4OLD A;  3BJN A;  3HVF A;  1H8M A;  3LUQ A;  4CLC B;  2EWW A;  5CXW A;  2PYR A;  1LL5 A;  1ESI A;  2W3D A;  1NLZ A;  1NZO A;  4Q0H A;  3NJA A;  1NZU A;  1BZA A;  3LIE A;  3T4O A;  4E3N A;  1XFQ A;  3UY6 A;  1JTG A;  4OOY A;  2P7J A;  3GQZ A;  5FEG A;  3KSG A;  5HAR A;  1UWN X;  2XRN A;  3RFB A;  1M40 A;  1TVF A;  3MZF A;  4XUX A;  2CMN A;  4ID4 A;  4N1X A;  3BLS A;  4Y0O A;  1I2W A;  2K31 A;  3O87 A;  5DTK A;  1YT4 A;  1VHM A;  3EQV A;  3VV4 A;  2D02 A;  1ESU A;  5LBR A;  5HDD A;  3FKW A;  1K54 A;  4KQD A;  3Q82 A;  4P85 A;  2ZC5 B;  4MEZ A;  2ZC7 A;  2W27 A;  3NBL A;  4FTX A;  4Q0J A;  2EA9 A;  4B4X A;  4OLG A;  4NG2 A;  1OJ5 A;  5DVA A;  2EXB A;  3IH9 A;  3GMW A;  5DF8 A;  2Y4A A;  4MBF A;  4E04 A;  4NXE A;  3M2J A;  2HDQ A;  2YKH A;  3ITB A;  4CPK A;  1YM1 A;  3WS5 A;  3NDG A;  2QKP A;  4LRY C;  4E3O A;  4HJ3 A;  4HH3 A;  4KUK A;  4LV2 A;  4II7 A;  1ZG6 A;  2WKP A;  2PU4 A;  4BWI A;  1XFN A;  4UQI M;  5FAS A;  1HLU P;  4R23 A;  4KZ3 A;  1E4D A;  4X56 A;  4BLM A;  5MC7 A;  1Z09 A;  3WS4 A;  1JWP A;  4U0T A;  5FQK A;  3HJI A;  3GRJ A;  4PHT A;  4LPZ A;  2QHK A;  5TJJ A;  1STZ A;  3OPR A;  5EV0 A;  4QHC A;  4FUW A;  5A90 A;  1UWP X;  2A49 A;  4KZ4 A;  3T1S A;  3ICY A;  4OVD A;  3B42 A;  3H7W A;  4KZ7 A;  3IF6 C;  3IXH A;  3EGX C;  2FFY A;  4L9G A;  1ONH A;  3ZCZ A;  2WAE A;  3G4P A;  3UB8 A;  1GHM A;  2XEP A;  5HDS A;  1LL9 A;  5FI2 A;  3O5Y A;  4DE1 A;  2ZL1 A;  3ZNY A;  5AQ9 A;  4BD1 A;  3ZDJ A;  4WEJ A;  3DTI A;  3ZFZ A;  5EOO A;  3C4O A;  3MXR A;  3W8K A;  4JXW A;  4BD0 A;  1LHY A;  4XT2 A;  2JKT I;  5TFQ A;  1GSV A;  3C5A A;  4HJ4 A;  2V1B A;  1KE0 A;  4WN5 A;  3QP1 A;  3BLM A;  1N9O A;  4S2J A;  1J3W A;  1TS6 A;  2JKR I;  1KVL A;  5HDC A;  3R7W A;  3DW0 A;  5C5K A;  5AVF A;  1XKZ A;  2VK3 A;  3V50 A;  2O9B A;  4Y3I A;  2HJE A;  1XJ2 A;  4KG2 A;  4BBT A;  5HX9 A;  3NOU C;  1ZC2 A;  1G28 A;  2BLS A;  3B3X A;  3GV9 A;  4WEK A;  4EER A;  2W1T A;  2HGV A;  3KYE A;  4IBX A;  3FZC A;  4EBN A;  4QJG A;  4RVA A;  3A3I A;  5EOE A;  3MF0 A;  3W4O A;  2Y8H A;  2YKF A;  2KOI A;  1CI8 A;  2X01 A;  2Y2J A;  3DWK A;  1ZG4 A;  4IED A;  2I72 A;  2ZOI A;  1YMX A;  2DMW A;  2XFS A;  3ZG7 B;  2P04 A;  4LGW A;  1LSX A;  3C7V A;  2H0T A;  1SKO A;  3G34 A;  4I3A A;  5GHX A;  3RJU A;  2EFX A;  5E43 A;  1L2S A;  1W79 A;  1T18 A;  4H6J B;  4PKY A;  4EUZ A;  5CED A;  3HL9 A;  3T12 B;  4O0P A;  4KZ8 A;  2NUT C;  3UPP A;  1S1Y A;  1T1A A;  2W3F A;  1FOF A;  3DTE A;  2E8J A;  1TF1 A;  5GLA A;  5EVI A;  2OLV A;  3P98 A;  3UNW A;  3OCN A;  1OT6 A;  4B93 A;  4EBL A;  1K4E A;  3K3D A;  5FDS A;  2WKI A;  4UA9 A;  3QNB A;  4KZ6 A;  1YLZ A;  4WM9 A;  2BAS A;  3N8R A;  5IT5 A;  4BL3 A;  3F1N A;  5IS1 A;  1K55 A;  1CJF A;  3BY9 A;  4UEY A;  1BTL A;  1LSV A;  3LIC A;  2H10 A;  5FSR A;  3UE0 A;  3W4Q A;  1IFQ A;  4CLC E;  1FSY A;  3T4K A;  2ZC6 B;  1F9I A;  1DJB A;  4M4X A;  2X02 A;  3KYZ A;  4N9L A;  1W7F A;  1S6R A;  5E2F A;  1ODV A;  2KDK A;  1YQS A;  4CQH A;  5M1A A;  2B5R A;  3TE8 A;  3SH9 A;  2EFU A;  2L4R A;  3KYQ A;  2J3T C;  3FPV A;  2ZJ9 A;  2OLU A;  4KQQ A;  5KSC A;  4FSF A;  2EX9 A;  3S4X A;  4Z1W A;  4I39 A;  4LCL A;  5I94 A;  4GNU A;  1WE4 A;  4GCZ A;  4A5R A;  2HF6 A;  2JHE A;  2PHY A;  3A3J A;  3HLE A;  3IBR A;  4OP5 A;  2V20 A;  2Z6D A;  5CEC A;  4HIA A;  4PM7 A;  1K38 A;  5FAT A;  1MPL A;  3UMD A;  1BT5 A;  3VP0 A;  2JCH A;  1MKM A;  4JKT A;  5D3O A;  1H5X A;  1E3U A;  4CLC D;  3B33 A;  3P01 A;  1ES2 A;  4HP4 A;  5L8M A;  3TJZ C;  3Q7V A;  2FH5 A;  3T4S A;  4Y15 A;  2BG1 A;  1HD8 A;  4HBU A;  4NXB A;  4JGO A;  4X69 A;  2Q9M A;  1BSG A;  1MBL A;  3G31 A;  4JPM A;  4LRX C;  4E6W A;  2QZ6 A;  2Y2O A;  2ZM2 A;  2QWS A;  3KX0 X;  3NC8 A;  2Z6C A;  2J9O A;  4JLF A;  4PKY G;  4BEN A;  1IYQ A;  4AFI A;  3C7U A;  4QD4 A;  4GDN A;  5DJT A;  2OAP 1;  3FC7 A;  4ESP A;  3V5M A;  1MC0 A;  2VGL M;  4QY5 A;  1XJ6 A;  3HLG A;  4K91 A;  2EX8 A;  5HAI A;  2O99 A;  5FAP A;  1IYP A;  2ZC3 B;  3LYX A;  4EQI A;  4R0Q A;  3T4Q A;  3GEC A;  1OTA A;  3E4P A;  3E0Y A;  4OPQ A;  3UE3 A;  3E2K A;  1H8Y A;  3HLF A;  4WZ4 A;  1ZHH B;  1IYO A;  2Y2P A;  5J4E A;  3G2Y A;  1XXM A;  2JC7 A;  1L0F A;  4PM5 A;  3MQQ A;  3BQA A;  1KOU A;  1K6S A;  1LSW A;  1EW0 A;  4E3K A;  5G18 A;  2HDU A;  3OBF A;  3CIT A;  5A93 A;  2ZQD A;  5G4Z A;  3IWI A;  4JXS A;  5TBM B;  4K0W A;  2BTF P;  4HQA A;  3G6O A;  3D3O A;  1XP4 A;  4ZJ2 A;  2JKG A;  2H5S A;  1LT0 A;  1SKF A;  4OQG A;  3NY4 A;  4YOF A;  3ZYT A;  5HPI A;  4CLC A;  4ZJ3 A;  3BWL A;  2QMI A;  3ULF A;  4LV3 A;  2XK1 A;  4GD6 A;  3LID A;  1TEM A;  2PAV P;  3JVV A;  3N7W A;  1V9Z A;  4NK3 A;  4JBF A;  1EI5 A;  4MBH A;  5F82 A;  1FCM A;  3DTK A;  3NCK A;  1XX2 A;  3GSG A;  3IS2 A;  3BYD A;  2UV0 E;  1D1J A;  4LRZ E;  2J9P A;  4R1G A;  4WBG A;  3MJQ A;  2ZQA A;  3QP5 A;  3ZHH A;  3ZNT A;  2QYB A;  2B95 A;  3T1X A;  5GLD A;  5HZH A;  2KLI A;  4PM9 A;  4F3L A;  1PFL A;  3IS2 B;  1K55 C;  2XF3 A;  3HCY A;  2R9W A;  2CC1 A;  2VX8 A;  4IUK A;  3ZG9 B;  5FI6 A;  1YLY A;  2PU2 A;  1PI4 A;  1XPB A;  3VMA A;  5DKK A;  1TS8 A;  3IBJ A;  2GZA A;  2VV8 A;  1Y54 A;  3EOI A;  4DJ2 A;  4C75 A;  3VOY A;  3BQ8 A;  1Y28 A;  1S66 L;  4RX3 A;  3FPW A;  4JXG A;  5IHV A;  3F1N B;  1SDN A;  5EVI C;  1Y4O A;  3VSL A;  4B4Z A;  5GL9 A;  3LY3 A;  2OWJ A;  3V3R A;  2J7V A;  1PIO A;  2HJ9 C;  1XGJ A;  5CHU A;  1TDG A;  1KGG A;  3NOT C;  3KSI A;  1PNE A;  4EU0 A;  3OLO A;  3Q81 A;  5JYO A;  2PRF A;  2V9A A;  1YSP A;  4OON A;  4HHD A;  2Y2K A;  4GB7 A;  3F1P A;  3QP2 A;  2P9V B;  3O3V A;  4BBV A;  5HAP A;  2B18 A;  1CQA A;  4LEN A;  1H0M A;  3PBN A;  4OKP A;  3T4J A;  2VV6 A;  1KGF A;  3S7P A;  3M2K A;  3MZE A;  4GHI B;  4E3J A;  2DCF A;  2Y55 A;  1G6O A;  2ACG A;  2V2F F;  2HP9 A;  2IWB A;  2HPB A;  3EWK A;  1WYC A;  1PW1 A;  3RXX A;  3H82 B;  4HP9 A;  3NIA A;  3UE6 A;  4FD8 A;  4GZB A; 
#chains in the Genus database with same CATH homology
 4WL9 A;  5F68 A;  2J3T D;  3JVU A;  5K5B A;  2ZMV A;  4HI4 A;  3MF0 A;  4HJ6 A;  3PBT A;  3E4O A;  2Y8H A;  1F98 A;  2YKF A;  4WUJ A;  2KOI A;  2L1M A;  2O0Y A;  4MN7 A;  3RTY A;  2QJ5 A;  2H28 A;  2MJ6 A;  1DP9 A;  2ZOI A;  2W3H A;  2K7S A;  2V0U A;  1F5M A;  2DMW A;  4JGR A;  4IHQ A;  1JNU A;  2P04 A;  3OC2 A;  1LSX A;  1YKD A;  4I3A A;  2VJW A;  3P7N A;  3LI9 A;  1V9Y A;  3R7W B;  2VGL S;  3KSH A;  1S4S A;  2OOL A;  1WA9 A;  1T18 A;  3LR4 A;  4H6J B;  4PKY A;  4GLQ A;  1OTE A;  1P97 A;  5DFX A;  4EQ1 A;  4O0P A;  3K2N A;  2NUT C;  1S1Y A;  3LIA A;  3UME A;  4YWZ A;  4EXO A;  1T1A A;  2W3F A;  5HPF A;  1DP6 A;  3PBQ A;  2XRO A;  4NKP A;  5HD5 A;  4IUH A;  1TF1 A;  4ARZ A;  3PBO A;  3MQ0 A;  2PYP A;  3K3C A;  2O9C A;  3OCN A;  3UB7 A;  1OT6 A;  1DP8 A;  3PR6 A;  4B93 A;  4ZRR A;  2Y79 A;  1P0Z A;  3K3D A;  4OOM A;  2FZ0 A;  2VKS A;  1T1B A;  4B9O A;  5F6A A;  3VOL A;  2W1T B;  2W3E A;  2JKR M;  2BAS A;  5IT5 A;  4K08 A;  3F1N A;  5IS1 A;  3CAX A;  4GS9 A;  4WEL A;  3BY9 A;  4MMN A;  4UEY A;  2G7U A;  1ZTU A;  5HL6 A;  3E98 A;  1LSV A;  2VEA A;  3C8C A;  3LIC A;  4IJG A;  3H7W B;  1TS7 A;  2WKQ A;  3FG8 A;  1IFQ A;  4HOI A;  1NLY A;  4CLC E;  4GJ4 A;  2QJ7 A;  1IOU A;  5CX7 A;  2VZW A;  3T4K A;  2J3W A;  4L9E A;  3CUE A;  1N9N A;  2V1A A;  4QPR A;  2V0W A;  1F9I A;  4MN5 A;  4M4X A;  1OTD A;  3A0V A;  3KYZ A;  1ODV A;  4O01 A;  4OOL A;  2KDK A;  1OTI A;  4CQH A;  3ZQ5 A;  4DMZ A;  5HWT A;  2HV1 A;  3H82 A;  3TE8 A;  3KYQ A;  2L4R A;  2J3T C;  3FPV A;  3C2W A;  4KQO A;  1D06 A;  3R4K A;  3PYP A;  1BYW A;  3S7Q A;  3SW1 A;  4O8G A;  4L0L A;  1N9L A;  4FSF A;  4UQI S;  4Z1W A;  3LR5 A;  3D72 A;  5EFW A;  4I39 A;  3LR3 A;  3CLO A;  4NXG A;  2EWV A;  4Y5F A;  2OWH A;  2XA7 S;  3C38 A;  4ME4 A;  5I5L A;  2M7V A;  4I5S A;  2W1R A;  4GCZ A;  5HSQ A;  2HF6 A;  2JHE A;  3VE3 A;  2PHY A;  3MQO A;  4BBU A;  1XJ3 A;  4GS9 B;  3IBR A;  1OT9 A;  4HH2 A;  5DF9 A;  4R70 A;  3A0S A;  4XT2 B;  3CUE C;  3F1O A;  2Z6D A;  4HIA A;  1P9R A;  1YAX A;  3NHQ A;  4NEE D;  4FOF A;  3UMD A;  2IA2 A;  4R38 A;  4EW7 A;  1MKM A;  1MZU A;  4NXF A;  3EEH A;  5G4Y A;  4CLC D;  2D01 A;  3B33 A;  3P01 A;  1NRJ A;  5DJU A;  4HP4 A;  4ARZ B;  5L8M A;  3TJZ C;  4GW9 A;  4CLC C;  4MDZ A;  3LIB A;  4GHI A;  1X0O A;  3KSF A;  2FH5 A;  2PD8 A;  3T4S A;  3VE4 A;  1D7E A;  2INW A;  3LFV A;  4Y2F A;  4EEU A;  4KUO A;  4G3W A;  5HD3 A;  3NOP C;  4NXB A;  3F1O B;  4JGO A;  5F5Y A;  4DN0 A;  1W63 M;  2A24 A;  4LRX C;  4I38 A;  2ZOH A;  3RH8 B;  3BJN A;  3EQU A;  2QWS A;  3KX0 X;  4WF0 A;  2Z6C A;  1H8M A;  3LUQ A;  4PKY G;  4CLC B;  4AFI A;  2EWW A;  2ZBB A;  2PYR A;  5DJT A;  1YSQ A;  2W3D A;  1NLZ A;  2OAP 1;  3FC7 A;  4Q0H A;  3NJA A;  1MC0 A;  2VGL M;  2GNX A;  2OAQ 1;  1XJ6 A;  1UGU A;  5IU1 A;  3LIE A;  5TBM A;  3T4O A;  1XFQ A;  4MCW A;  5J3W A;  1VB6 A;  3F1P B;  2O99 A;  3TW8 A;  2J80 A;  3PBS A;  2P7J A;  3HJK A;  3LI8 A;  3LYX A;  3KSG A;  1T19 A;  2VA0 A;  3T4Q A;  1UWN X;  2XA7 M;  4P6Z M;  3GEC A;  2XRN A;  2NUP C;  1OTA A;  3E4P A;  4BMW A;  3RFB A;  3E0Y A;  3MR0 A;  3UE3 A;  4I3J A;  5HWV A;  1ZHH B;  5J4E A;  2CMN A;  1GSX A;  4YNR A;  3MQQ A;  2PDR A;  2O9A A;  3BQA A;  1KOU A;  2K31 A;  1LSW A;  1EW0 A;  3LIF A;  1VHM A;  3EQV A;  3VV4 A;  2D02 A;  3OBF A;  5F69 A;  5LBR A;  3CIT A;  5HDD A;  2W3G A;  5G4Z A;  4KQD A;  4R6L A;  5J7E A;  3E4Q A;  2L0W A;  2M7U A;  1P9W A;  5AVE A;  2W27 A;  2GX5 A;  5TBM B;  3V67 A;  4Q0J A;  2LB9 A;  2EA9 A;  3G6O A;  3D3O A;  4HQA A;  2PD7 A;  3CI6 A;  1DRM A;  3OOV A;  3PHY A;  1LT0 A;  1OJ5 A;  5FL3 A;  1T1C A;  4YOF A;  3GDI A;  3T4T A;  3T50 A;  3MMH A;  3TRC A;  4HNB A;  3ZYT A;  5HPI A;  4CLC A;  4E04 A;  3BWL A;  3EEA A;  4NXE A;  3ULF A;  2YKH A;  4G3K A;  3W2Z A;  3LID A;  2PR6 A;  4L9F A;  1LL8 A;  2QKP A;  4LRY C;  3JVV A;  5DFY A;  1V9Z A;  4HJ3 A;  4HH3 A;  2PT7 A;  4KUK A;  1S4R A;  4II7 A;  3MFX A;  1TD5 A;  2WKP A;  4R3A A;  2LB5 A;  2I9V A;  2A2L A;  4BWI A;  1XFN A;  2PR5 A;  4I3I A;  3T4L A;  3C30 A;  4UQI M;  4EUV A;  3MXQ A;  3IS2 A;  2VV7 A;  5DKL A;  3EGD C;  4LRZ E;  3A0R A;  3MJQ A;  5MC7 A;  1W63 Q;  4WLA A;  2QYB A;  5KSH A;  3S7N A;  2KX6 A;  3H9W A;  5HZH A;  2KLI A;  4F3L A;  3HJI A;  5AJG A;  3PBR A;  2JKT M;  3IS2 B;  4PHT A;  5KIZ A;  3HCY A;  5HWW A;  4LPZ A;  2QHK A;  5TJJ A;  4IUK A;  2VX8 A;  1STZ A;  3UB9 A;  1UWP X;  5DKK A;  3ICY A;  1TS8 A;  2P08 A;  2GZA A;  2VV8 A;  3IBJ A;  4MN6 A;  3EOI A;  2A24 B;  3B42 A;  3H7W A;  4DJ2 A;  4EEP A;  3BQ8 A;  1Y28 A;  2W0N A;  1S66 L;  3CWF A;  3U2A A;  3EGX C;  4L9G A;  3FPW A;  4DJ3 A;  4LLO B;  3F1N B;  4JGQ A;  1S1Z A;  4ETX A;  3UB8 A;  5A8B A;  2OWJ A;  1OPX A;  1GSW A;  2HJ9 C;  5HDS A;  3PXP A;  2R78 A;  3KSI A;  3NOT C;  4EU0 A;  3O5Y A;  3BW6 A;  3OLO A;  3OCL A;  3DBA A;  4H6J A;  1H3Q A;  2ZMF A;  4G3V A;  2V9A A;  1YSP A;  4WEJ A;  4HHD A;  2B02 A;  2XSS A;  2VLG A;  4F3L B;  1S67 L;  3F1P A;  2M1C A;  4BBV A;  2B18 A;  1OJG A;  4Q0I A;  3PBN A;  4XT2 A;  3T4J A;  2VV6 A;  2JKT I;  1GSV A;  2K2N A;  4HJ4 A;  2GJ3 A;  3S7P A;  2V1B A;  4PAU A;  4WN5 A;  4BJP A;  1N9O A;  4GHI B;  4ETZ A;  1OTB A;  1TS6 A;  2JN7 A;  2JKR I;  5HDC A;  3R7W A;  1XJ4 A;  4P6Z S;  1G6O A;  2WKR A;  5C5K A;  5AVF A;  2O9B A;  4Y3I A;  2HJE A;  1XJ2 A;  3B47 A;  3S7O A;  3UB6 A;  4BBT A;  4EES A;  1NWZ A;  4RQ9 A;  3NOU C;  3EWK A;  4JGP A;  1TS0 A;  1G28 A;  3H82 B;  4HP9 A;  4EET B;  3UE6 A;  4WEK A;  4EER A;  4HY8 A;  2W1T A;  3KO6 A;  3LR0 A;  2HGV A;  3BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...