1DP7P

Cocrystal structure of rfx-dbd in complex with its cognate x-box binding site
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*GP*(BRU)P*TP*AP*CP*CP*AP*(BRU)P*GP*GP*TP*AP*AP
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dp7P00
1Z1DA 4I98B 1LNWA 1YTYA 4KMFA 1FSEA 1L3LA 5BPDA 2PLYA 5FGMA 1F1ZA 1D8KA 4RGUA 1FYMA 3PQKA 2NYXA 4LLLA 1OYWA 3R0JA 4I7HA 2DK5A 4EGYA 5D4RA 2OQRA 2WV0A 1WKMA 4RB3C 4UNOA 2FRHA 4HDUA 3I64A 3F23A 3K1PA 3CDHA 3D5LA 3ZPLA 2D2WA 1FYKA 1YFHA 2XROA 4ZYGA 4KFCA 3LSTA 1ZLJA 5ICFA 3VEPA 5LHIA 4UXNA 1D3YA 1HQCA 4CO8A 4CYDA 2CG4A 4ZH4F 1PUEE 5E1XA 4YG2F 3F3XA 3HRUA 2JZYA 2XASA 1XSXA 5ICEA 2VOOA 3H92A 2L01A 1ON2A 4HX7A 3I71A 4RAZA 3GEZA 2CGPA 4FX0A 4G8XA 4Q4ZF 5ILVA 4HV5A 5D5WB 1O3RA 2QWWA 1J5YA 2LF7A 2PMHA 2LSOA 4GXOA 1U78A 4O5VA 3GF2A 2QYOA 1Z6RA 3HTSB 4BHCA 5DD8A 2EFPA 2P7CB 3DPLC 5IT9K 1PP7U 2G9WA 4RS8A 2NNNA 3KP4A 3F8FA 4ETSA 3L00A 1U8RA 5DEQA 4U0YA 3L7WA 3REOA 3J7AO 1J75A 2HFHA 3E6DA 2D45A 4EVIA 2EK5A 4LB5A 3I54A 1K6OA 4IVNA 2J5OA 4G9YA 3R60A 3IWZA 1XGSA 4IRGA 4P5OA 1T98A 2B0LA 5LGTA 1ZRDA 2QUFA 3EYYA 1G3YA 5HVQC 1BC7C 2ZMEA 5HLHA 1ZRCA 1HW2A 5HS8A 2XHKA 4M9SA 3GUDA 2H94A 3O3KA 1BI2A 2AXLA 3HHGA 1HKSA 1TQMA 4ESJA 2XUBA 5JFRA 3AAFA 3QU6A 1B9MA 2ELHA 2DT5A 4ZZLA 4RGXA 5HLIA 4Y13A 1G6NA 1W7PA 2NNYA 2STTA 4ENMA 3FHZA 2Q8KA 3I59B 4GYGA 3TO6A 4HF0A 4UVCA 2FXAA 3M8EA 4YFNF 1P4XA 4HQMA 4IJAA 2KIUA 3DFGA 3V7RA 1BIBA 5D6EA 4EJOA 1SD5A 2DI3A 4F7ZA 3GX4X 1QPMA 3MZYA 4G6QA 2VONA 1SD4A 4NB5A 3NQOA 2FA5A 5IT9Z 5JVTA 4LK1F 2ZBKA 1H9TA 1ZG1A 3ZMSA 3BP8A 1D5VA 3QPHA 2M8EA 2A6EF 2CFXA 1DPUA 2IA2A 4XLPF 1EH8A 2PJPA 3U1DA 4LG0B 5D5XB 1K7AA 2NRAC 4AIKA 2E1NA 4CICA 1J9IA 4I09A 4A0YA 2LDUA 4M9XA 4R1HA 2G7UA 1ZN2A 2V79A 4HQEA 1R23A 1FYLA 3SFZA 2UZKA 5A2QK 4ZYDA 2ISYA 3SXYA 3FZVA 1CF7A 4BHBA 2V6CA 1ULYA 4KIGA 5CVJA 3R4KA 1R36A 2QZ8A 1IW7F 1SMTA 4R79A 2HYFA 4A2UA 3KP2A 1TLHB 3KFWX 3TOBA 1MD0A 1BM9A 4EJUA 3V8LA 3L2CA 1XGOA 4A12A 5FFZA 3I53A 3DP7A 5ILUA 5EEGA 5JHUA 1LB2A 1JHHA 3QPTA 3T0YA 3ROUA 2K02A 4JK1X 3GFJA 2V9VA 4GGGA 3CLOA 1V3FA 2HR3A 3KZZA 1BN5A 1FX7A 1MDMB 2EWNA 5FB2A 1T6SA 1WWXA 5E20A 2VODA 2VBZA 2OD5A 2GXGA 1Z05A 2ZJ2A 2E7XA 2PMUA 1XMKA 3BJOA 1USSA 4UVAA 2P4WA 3VODA 1KU3A 4MEXF 2MLGA 1Z91A 2ETHA 1HW5A 3J81Z 1MGTA 2P5KA 4Q5SF 3FXQA 5D8LB 1RIOH 3J81K 1FC3A 2KJCA 2O8XA 3QP5A 3ZMDA 3EDPA 2CYYA 5HOOA 1MJBA 3M7GA 4A0ZA 1R7JA 3KLNA 4ASNA 2TDXA 2XAGA 2HZTA 4M74A 3IKVA 4L9VA 4L9NA 3K1MA 2MBFA 4WWCA 4U88A 3EYIA 1H9GA 1IF1A 1XDSA 1XDUA 4G7HF 2STWA 5CVVA 1IXSB 2ZXJA 5CLSA 4KDPA 4MTEA 3CUQB 3GW2A 5JR3A 3KP3A 4AWXB 2DPDA 4LLNA 4OIOF 1I6XA 2M30A 2YU3A 4M71A 3FX3A 5E1WA 3F72A 1R5HA 2RN7A 4XLNF 3IL2A 4E70A 3FMSA 1FLIA 1FP2A 3P9CA 3ML6A 2HS5A 4BXUA 4PCQA 3LA2A 1BIAA 5F1RA 2EJRA 4RGSA 2DTRA 2HKOA 2OAZA 1QBJA 4L0YB 2BGCA 4A0XA 4CXFA 4HBLA 2EV5A 1R5GA 3EQLF 1LEAA 3BWGA 3W6KB 3H3ZA 3F21A 1EH6A 3C7JA 2EFNA 1EV7A 4S05A 4IHSA 1MJAA 2M45A 3BZ6A 4IF4A 5E17F 3IRQA 3MQ0A 2UXNA 5DV5A 2CSOA 5D5UB 4BAYA 1X3UA 3J80Z 2W57A 2F5FA 1BI0A 2EFQA 3GZ5A 4IPAA 1QO0D 1FSHA 1O3QA 1O7LA 1ZGAA 4P9FA 3WE3A 1XCVA 4MQVA 1T39A 2QBYB 2XV4S 5H6RA 3BY6A 3ZP5A 4BQAA 2LKPA 1K79A 4EM0B 2QQAA 3WGIA 1AOYA 1DUXC 2FMLA 2GAUA 4GCVA 2IA0A 5E8IA 2F2EA 2F5DA 3JTGA 1DDNA 3V7SA 3N4MA 1C0WA 2BEOA 1I27A 2HWVA 2Z5UA 2DU9A 2H6BA 3E5XA 4L5IA 1ONVA 1XSVA 5D6FA 1BJAA 3ECHA 4KICA 3D0SA 3ECOA 4MHGA 4OMYA 2L02A 4MNUA 5EEHA 1K78A 2PBIA 5CVUA 3SHFA 5KK1A 1R58A 3KLOA 2P8TA 2VOPA 5FLXZ 1HKQA 4JQFA 5L3DA 5ICGA 1FBQA 2JT1A 2ZO4A 2A5YB 1P4WA 2E1CA 4HX8A 1SD6A 1U5TB 4HF1A 4EJVA 2RGVA 2HEOA 3PFIA 3F8NA 1XN7A 2HQRA 3C18A 3I59A 5LBQA 1K78B 2EFOA 2R7DA 2RKHA 4YFXF 3RKXA 2IRFG 5LEKA 4ENKA 1UHMA 2XGXA 5K1YA 3P7NA 1JE8A 3I58A 2QLZA 1ODDA 2ZNZA 3Q9VA 4Y15A 1ZREA 2XVCA 3NRVA 1FZPB 4GYIA 4YIFA 1VTNC 1SMYF 2HGCA 3LA7A 2ESNA 4I0BA 3GYHX 2JSCA 3P9IA 1GVJA 1T2KA 1RUOA 1I1SA 1B9NA 1REPC 2CWEA 1ZLKA 1S29A 1XGNA 1HKTA 3RKWA 2Z99A 3R6SA 4HLYA 2PFBA 3K0LA 4EM1A 5J6XA 4ENJA 2UXXA 5CJ9A 5DUIA 1OKRA 1IUYA 4O3MA 1T38A 4AIJA 1YS7A 2Y0MA 4G94A 3H3UA 3TQNA 1ZH5A 4P55A 3FWEA 2Z9OA 3G73A 3WG9A 5ICCA 3E6CC 1W5SA 5DCFA 3U2RA 2A68F 3PQJA 3N97A 2MA3A 3HYIA 2FSWA 4XRFA 3GXOA 2JPBA 5BPIA 1XCBA 1MDMA 4RAYA 3RI4A 3ZMZA 1WQ2A 2WC2A 4WX9A 4WF2A 4HDVA 1G4DA 4LJZF 3ZMTA 2ZCWA 3HSRA 2A6HF 2MH2A 3RYPA 1LDKB 2GXBA 2DK8A 3LQQA 4A5MA 2FU4A 1LVAA 4CHUA 5ED4A 3ZN0A 4ZYHA 4ZZDA 2D1VA 1W4MA 1IXCA 2Z3YA 3RYRA 1FBUA 1YO5C 4WXHA 1HSJA 1MJ9A 3SZPA 2K7LA 2EB7A 1U5TC 3WTSC 1FNNA 3WU1B 4EV0A 1TNSA 2W85A 4H0EA 1BOAA 3K9TA 4RGRA 4OIRF 4DNCA 5HLGA 1R00A 2ESHA 1BC8C 1SFUA 3V8JA 2O6GE 4A5NA 4EQQA 1YW7A 3MFKA 3RJPA 3F6OA 5K5QA 1JXSA 5HDNA 4KNYA 4WXCA 2HOEA 3TO9A 2DLLA 5FD6A 1HSTA 1IN8A 1KYWA 4KUMA 4S04A 1ZGJA 1FWZA 1UB9A 2GWRA 4YFKF 2FNAA 1ZRFA 5CVRA 1G3TA 2JTVA 1BI3A 4CZZA 4RB2C 2L4MA 3BJAA 1J2XA 5LLQA 4M9ZA 1FPQA 5JI6A 3C3WA 4L5JA 5AIPA 2FMYA 2HDCA 2FQ3A 3FM3A 4AIHA 3ABTA 4ESBA 2FF4A 3EUHA 5LHHA 3ELKA 4A6EA 1DPRA 1TW2A 2KIMA 1LJ9A 3KZYA 2C6YA 3SQNA 3HRTA 3RTRA 2ACJA 3JAMK 2ZMEB 1IN7A 3DV8A 2W25A 2EV0A 2RQPA 2UWMA 5AONA 3J80K 4UVBA 2VT3A 4N0BA 4OMZA 2ZFWA 3I0TA 2OQGA 5D4SA 1CGPA 1IZ1A 1QGPA 2XAHA 3B02A 3JTHA 5FFXA 1XGMA 4XSXF 1SFXA 3S2WA 2CQKA 2V1DA 2J5PA 1LDJA 4FHTA 3HOSA 1YW8A 2O61A 3E97A 2DAOA 2RVCA 4WK8F 4TV7A 1R22A 3F6VA 2PI0A 2R3SA 1CF7B 3K1NA 3BPXA 1UFMA 2M5WA 3GZ6A 1YW9A 1FT9A 4R8HA 1U6GA 4KN7X 5FD5A 2BYVE 2VBXA 2W24A 2YR2A 1O57A 4G7ZF 3R0AA 3ULQB 1P6RA 1G3WA 1ZG3A 2GZWA 5KVRA 1UCRA 2FE3A 5ILSA 3EETA 4JBAA 1TNTA 4HX4A 3E6MA 3IKTA 2FNPA 4B8XA 2H27A 1IRFA 4DQ2A 2OA4A 3DQVC 3FMRA 2KIFA 2VN2A 3FF5A 3WTWC 4RB0A 4NQWA 1J59A 1IN4A 3RDIA 3T1BA 3IC7A 4KIFA 2M87A 2RV8A 2CO5A 1W7PB 5H6QA 3OV8A 2NAZA 4LMYA 1J0RA 2MC3A 2FOKA 3WODF 3CTAA 2KJBA 3VOEA 2P7VB 3V4GA 2RDPA 2QBYA 1KQ8A 1DP7P 4ENNA 4IXAA 3P9KA 1Z7UA 4HZFA 2EFWA 1EH7A 1JHFA 4ON0A 4OIPF 1OYYA 4ESFA 3KP5A 5J8FA 1FBSA 1O3TA 1HBXG 4BYYA 2O03A 1F4KA 1IN6A 5DDGA 1R1VA 4CGZA 3M8FA 1P4AA 5DCMB 2F5EA 2K86A 3HUGA 2O0YA 2X0LA 5L3EA 2CW0F 3COAC 2L54A 5E18F 3B73A 1WSUA 2DFIA 2L4AA 2E7WA 3TDZC 3WTVC 2O3FA 3WTZA 3O2PE 5F64A 3CUQC 1FP1D 2A69F 4UUVA 3G3ZA 1NHAA 4FT8A 4AD9A 3NEUA 3RKYA 2GQQA 4U0WA 5LRSA 2MH9A 4L9TA 3V7CA 4ZYEA 3RPUA 1IN5A 1OR7A 2MD5A 3HSEA 2FBKA 4QWQA 1SAXA 2Z33A 1E17A 2K4BA 2RNJA 3HSFA 3JAMZ 2X4HA 3L09A 1E2XA 3VB2A 3KCCA 1GHCA 4EMSA 5A2QZ 4HLXA 2GA1A 2QENA 2XAFA 2MLKA 5IT3A 2K4JA 2EA4A 4BH9A 3TKYA 5CVIA 5HS9A 2GA2A 2HQNA 2YX4A 3HOTA 3WE2A 1KU7A 4PGHA 3KEOA 4N9IA 1B1BA 4HF2A 3T5XA 2P6TA 2K27A 4KT5C 3IWFA 3DXJF 1BBYA 5E8GA 4M72A 2BV6A 5CYVA 3QAHA 1F5TA 1Z9CA 1TBXA 1YQAA 4P96A 5AIQA 3HTUA 3LA3A 4HW0A 3TDUC 2RC4A 4EJTA 2IP2A 2QVOA 2LF8A 5HDKA 3LAJA 4EGZA 2H6CA 2Y48A 3KETA 3MCZA 4UV9A 1QNTA 1LEBA 2VT2A 1QQIA 3ABUA 2A07F 3DKWA 4IRIA 4RB1A 3F8BA 4I01A 3WTXC 1KU2A 2IA1A 2IJLA 2QQ9A 4LGWA 1ZARA 3DF8A 1B6AA 2OZ6A 4WXDA 3CUOA 2M1BA 2ZNYA 3MEXA 1A04A 1SFEA 3MAJA 2P6SA 4LD5A 1JGSA 1J7KA 2F5CA 1B4AA 1H0MA 1W7PD 3VFZA 4M6YA 1PP8F 1ZG5A 1Z6TA 4D0PA 1TW3A 3FM5A 1IAWA 2XAQA 3BJ6A 2DQLA 2VC0A 2WTEA 4OINF 2XAJA 1KQ0A 1U3EM 5H20A 2VBWA 2YPRA 3HRSA 3O6BB 1WI9A 3FXUA 2VE9A 4LB6B 1AWCA 1YIOA 3HHHA 2P5VA 1TTYA 2HYGD 4N9HA 3WGHA 4LLGF 4MTDA 4LK0F 1IXRC 3CJNA 2V1XA 2H09A 1HXDA 4HOBA 1GXPA 1ZAOA 4U7BA 3LAPA 2BE5F 2R7FA 1YLFA 3Q9SA 1V4RA 2BBYA 4OOIA 3FMQA 3GFMA 3WU0A 4FX4A 5E1ZB 3JW4A 4LFUA 1WRJA 4IRHA 3DEUA 4EJWA 1T0FA 5L3CA 3M1EA 3T8RA 2JRTA 3KP6A 5J8CA 3E5QA 2XKPA 2DW4A 3WTTC 3QRFF 2VE8A 1TQPA 5FLXK 2COMA 2OBPA 3GVAA 3WTYC 1Q1HA 2PQ8A 3E5UA 4KMUX 4Q47A 5LEJA 4B09A 4U0VA 1B59A 1GXQA 2OZUA 3E6BA 4KN4X 3U9GA 3IRRA 3LFKA 4AVPA 4K2EA 2AS5F 4Q48A 5BQTA 1D8JA 3TO7A 2DQRA 1QZYA 3DPTA 1PDNC 2VXZA 4G7OF 1U2WA 2D1HA 1S8NA 2VBYA 1LQ1A 3KE2A 4WCGA 5LGNA 3LQRA 2IVMA 1U5TA 3V8KA 5LHGA 1F9NA 3GFLA 4MEYF 4XBFA 1YYVA 2KKOA 5K5OA 4QLCU 4HAMA 2PEXA 3F8MA 1FOKA 4OIQF 3OOPA 1UHWA 1QZZA 5DD4A 4MGRA 3JSOA 6PAXA 4UHTA 5DCMA 2DPUA 5BOXA 2WWYA 2PG4A 3BROA 1S3JA 4U7DA 1KU9A 4L0ZB 3Q5FA 2PN6A 2YSRA 1KQ9A 4PZJA 2FEZA 3F22A 1O3SA 4YIIA 3ZMVA 2HTJA 1W5TA 1S7OA 4LG0A 2XIGA 2FBIA 1STZA 3RIRA 3KP7A 2XRNA 5ERIA 4I0AA 3WGGA 4UV8A 3RPQA 3HRMA 3CO6C 1LDDA 1P2FA 2FBHA 5HDGA 4L18B 4NHJA 1OMIA 2Q0OA 1SD7A 3MWMA 3BDDA 1USTA 4IHTA 3L9FA 2IPQX 5LRRA 3MZHA 5BMZA 1I1GA 5DUKA 2HKXA 5L3GA 1HW1A 3E3VA 2W84A 4P9UA 4Z2YA 5BS6A 5TJJA 4XSZF 3QOPA 2Y75A 3JSPA 2IT0A 4CDGA 3GO5A 2HTSA 2GIVA 2DO7A 1XD7A 3ERED 1RUNA 2A3SA 3TOAA 2QM3A 4MQ9F 2EA2A 4GO1A 1MZBA 3WTUC 1I5ZA 2Q2EA 5HS7A 5F6FA 4O6JA 5FO5A 1MKMA 5K5RA 2KRFA 2P5LC 4KIBA 5LGUA 3GLXA 3ZN1A 5TRDA 3F8CA 4BNCA 4I02A 2LNBA 3M9AA 1BI1A 3KEQA 3ZQ7A 4KYWA 3LWFA 2EV6A 1ZYRF 3CO7C 1R1TA 3ZMUA 2G7HA 4KA4A 1YG2A 3QP6A 3W6JB 2IW5A 1OYIA 4G6DA 2DBBA 2XKOA 1P92A 1ON1A 2YX7A 2JPCA 4HA8A 3I4PA 1RZ4A 1RNLA 1S6LA 3QU3A 1XB4A 3K69A 3CUQA 1RI7A 2ADUA 1L0OC 4PDKA 1YS6A 1KYZA 3TGNA 1KA8A 3GWZA 1KGSA 3T8TA 4M73A 4EM2A 1IRGA 2OU2A 5L3FA 2ISZA 4HV6A 4Y17A 1TQIA 2ZKZA 3BPVA 3SZTA 1G3SA 2VC1A 4A6DA 3R61A 1ZHFA 4OU0A 1XSDA 3FXRA 4I2OA 1XMAA 4HYEA 5L3BA 5DYMA 2QQBA 2L3DA 3HIFA 4BHPA 1O7FA 4L9JA 5D8KB 3ISPA 3C1DA 5D5VB 1S7AA 1OPCA 3IHUA 1Y0UA 3K2ZA 4M6XA 4PGGA 2V1UA 3I5UA 1FY7A 2A61A 3GFIA 1R1UA 2NS0A 3BOQA
chains in the Genus database with same CATH superfamily
2DA4A 3K10A 1Z1DA 4CCOA 1Y1WJ 4I98B 2E60A 1LNWA 1YTYA 4KMFA 4IKFA 1FSEA 1L3LA 2AXTC 2RAEA 5FKLA 5BPDA 2PLYA 1JUMA 5FGMA 1F1ZA 1D8KA 4RGUA 3PL8A 1FYMA 3A02A 3PQKA 2NYXA 4LLLA 1VQ9I 1QZEA 1OYWA 1EKEA 1RKWA 1D1BA 1NH3A 1SAUA 3R0JA 4I7HA 2DK5A 3ZQGA 1E0EA 4EGYA 3KEYA 5D4RA 2OQRA 4BU2A 2WV0A 1WKMA 4RA2A 4RB3C 2A6TA 4UNOA 2FRHA 4HDUA 3FBIB 3I64A 1JTXA 2HI3A 3F23A 1Z0XA 3K1PA 5IOZA 2TRTA 3CDHA 3JCUC 4RM3A 4DZPA 1I3QJ 3D5LA 3ZPLA 2R93J 3IAS2 3ZQLA 2D2WA 4CCJA 1FYKA 1YFHA 3PNTA 4IQJA 2XROA 3H9JA 2R0QC 4ZYGA 4KFCA 4ZDPA 3LSTA 1H88C 2KQRA 2R5YA 1ZLJA 5ICFA 4U87A 3A1YA 3VEPA 5LHIA 4UXNA 1D3YA 1HQCA 4CO8A 2V4JC 4CYDA 5IYDJ 2CG4A 4ZH4F 1PUEE 5E1XA 1HLVA 2XSJC 4YG2F 2R7XA 4DGWB 5CQEA 3F3XA 2HXOA 3HRUA 2JZYA 2XASA 1XSXA 5ICEA 4EEFG 3H92A 2VOOA 2L01A 2QSGX 1ON2A 3LMMA 9ANTA 1Z3XA 1XMXA 4HX7A 3BQZA 3I71A 4RAZA 1WJCA 5JHFA 3GEZA 4YIRX 3NWTA 2CGPA 3IH4A 1U9NA 4UB8C 1TZLA 4FX0A 2RQQA 4G8XA 4Q4ZF 5ILVA 1IV8A 3CC4I 1KONA 4HV5A 5D5WB 1O3RA 1G2HA 1MMDA 1R4NB 2QWWA 1J5YA 4BQOA 2LF7A 2PMHA 2LSOA 2VQCA 4GXOA 2DDAA 2BVLA 2HDWA 1RRJA 1U78A 1K83J 4KISA 4AIDA 1WCMJ 4O5VA 3GF2A 2QYOA 1Z6RA 3HTSB 2XPVA 4BHCA 1D1CA 5DD8A 2EFPA 4BACA 2X6YA 2E1OA 2P7CB 3DPLC 5IT9K 1PP7U 3TEDA 2G9WA 3WHCA 3LSKA 2JK3A 4RS8A 1NG6A 2V9PA 1X2MA 4OAZA 3OYEA 2NNNA 1WH5A 3KP4A 4J19A 1WH7A 3C2HA 3F8FA 3G1MA 4IOAF 3IAM2 2VIXA 4ETSA 3L00A 1P7JA 1U8RA 5DEQA 2IGOA 4U0YA 3L7WA 2HOAA 3REOA 4HSTA 1Z21A 3J7AO 1J75A 4PJ0C 1QHHD 2VJ5A 2HFHA 3E6DA 1DP3A 2D45A 4E7ZA 3BTCA 3SDBA 3J7ZI 5E3OA 4EVIA 2DCEA 1K4TA 2LYCA 2IGNA 2EZKA 1RESA 3ABLH 2VQGA 2EK5A 4LB5A 3I54A 1K6OA 3G2BA 4IVNA 3IP4B 2NVTJ 2J5OA 4FISA 4G9YA 3A01A 5IP9J 3IWZA 3R60A 1XGSA 1S7EA 4IRGA 4P5OA 1T98A 2B0LA 1BW6A 4DBRA 4NBQA 5LGTA 1F36A 2M4KA 2VB6A 3BR5A 1FJLA 1ZRDA 3GTPJ 2QUFA 2LKSA 3EYYA 4QIWN 3S17J 4IHVA 1Q1VA 1W0TA 1G3YA 5HVQC 2LKXA 1BC7C 2ZMEA 1PVEA 2XB5A 5GAGJ 5HLHA 1ZRCA 1R9TJ 1HW2A 1X1BA 5HS8A 1FOYA 2HYJA 2XHKA 4M9SA 3GUDA 2H94A 3O3KA 1BI2A 2AXLA 3D5SC 3HHGA 1HKSA 2ME0A 1TQMA 2HU9A 4ESJA 2XUBA 3OWTA 5JFRA 3AAFA 3QU6A 1B9MA 2ELKA 2ELHA 3S1MJ 2DT5A 5EYRA 4ZZLA 4XL9A 1A31A 3KZIC 4RGXA 2L7MP 3SYTA 5HLIA 4Y13A 3L1PA 1G6NA 2LY1A 1W7PA 4N4OB 2NNYA 3K4NA 2WV1A 2STTA 4ENMA 1XPXA 3FHZA 2Q8KA 3I59B 4GYGA 3TO6A 4HF0A 4UVCA 4B44A 4A3DJ 2FXAA 3M8EA 4YFNF 1E3OC 1Y0NA 1P4XA 4HQMA 2VKEA 4IJAA 4V2FA 2KIUA 3DFGA 4D5CA 1A5JA 3V7RA 1BIBA 3PUBA 3TP0A 3KYCB 1IRXA 5D6EA 4EJOA 1SD5A 2DI3A 3CZ6A 3OYDA 4F7ZA 3GX4X 1N78A 1QPMA 2QQ8A 2DA2A 3MZYA 1X4PA 2CS3A 4G6QA 2VONA 3DBRB 1SD4A 4NB5A 2L7FP 3NQOA 2FA5A 3CMMA 5IT9Z 5JVTA 3HKZA 3I4MJ 2NOJB 4LK1F 2COBA 1SVOA 2ZBKA 1FOWA 3G1LA 2MGQA 5DM7F 3OYAA 1TP4A 5EDNA 1H9TA 1ZG1A 3ZMSA 2HXIA 4M3GA 3BP8A 2HQAA 1T33A 1D5VA 4PK4A 5FRMA 3QPHA 3I3LA 2M8EA 2XSDC 2KMUA 2A6EF 2DT7B 1YX3A 1JGGA 4A3FJ 2CFXA 2MD0A 1DPUA 2IA2A 4XLPF 1EH8A 2L0KA 1ITYA 3I9V2 2PJPA 2VQHA 3U1DA 2XF6A 4LG0B 5KNLA 3SJMA 3WHBA 2DMNA 5D5XB 1K7AA 4XQFA 2NRAC 3BG3A 1WHUA 2X51A 4C9YA 4AIKA 1Y6IA 2E1NA 2OCEA 4CICA 1J9IA 4I09A 4A0YA 2LDUA 4Y33A 4A3JJ 4M9XA 4R1HA 4DOZA 2G7UA 1ZN2A 2V79A 4HQEA 2IS2A 2YU9J 1R23A 4XIDA 1FYLA 5IOYA 3A01B 3JRHA 3SFZA 3MD2A 3JRGA 2UZKA 3QWLA 4ZYDA 5A2QK 2ISYA 3LSIA 3SXYA 3DU6A 3FZVA 1CF7A 4BHBA 2V6CA 1ULYA 4KIGA 2LY9A 1LFBA 4OAYA 3RQ4A 5CVJA 3R4KA 4NC8A 3ZOBA 4ZDOA 1R36A 2QZ8A 2N8GA 4XN3A 2R7TA 4D1QA 1G59A 1IW7F 1SMTA 3V42A 4R79A 4IZZA 5GPAA 2R7WA 1GUUA 2HYFA 4A2UA 5GTHC 3MKWB 3KP2A 1TLHB 3KFWX 3TOBA 1MD0A 2X6WA 1BM9A 4EJUA 1UG0A 3KIOA 4M3BA 3V8LA 1VQLI 3L2CA 3AG2H 4XOPA 1XGOA 4A12A 5FFZA 3OYJA 1MNEA 3I53A 5M3FJ 3DP7A 5ILUA 5EEGA 1ZQ3P 1VZ0A 5JHUA 1LB2A 3CCRI 4F93B 3OSFA 2JQ7A 1JHHA 2XB0X 3QPTA 3T0YA 3ROUA 2K02A 4JK1X 5DS9A 3GFJA 3Q0VA 2GOMA 1OCPA 2V9VA 4GGGA 1TT0A 4D5FA 3CLOA 3OIQA 3HOXJ 2ELJA 4CCKA 1V3FA 2HR3A 3KZZA 1BN5A 3SEQA 2R4GA 1Y1VJ 3S16J 1FIAA 1FX7A 5EGOA 1MDMB 2EWNA 3AKZA 2QKLB 5FB2A 1T6SA 1WWXA 5E20A 5LFAA 1E3HA 1WGXA 5M5YJ 2VODA 4B48A 2KISA 2VBZA 1FTTA 2K3PA 2E34A 2OD5A 1MBEA 2H8WA 3ZRGA 2GXGA 1Z05A 4E7IA 2ZJ2A 2CQ7A 2VQLA 2E7XA 2VASA 2PMUA 1XMKA 3BJOA 1USSA 3G4SI 5KCMA 4UVAA 2P4WA 3CCVI 1NK3P 3VODA 1KU3A 4RLQA 2OTJI 3ZGKA 1MBJA 4MEXF 1WZ2A 2MLGA 1Z91A 2ETHA 1HW5A 3J81Z 1MGTA 2XAUA 2P5KA 1GV5A 4Q5SF 1Z67A 1KZHA 1TWAJ 3FXQA 5D8LB 5GAHJ 1RIOH 3J81K 3BTLA 5EJCA 5KHDA 1FC3A 2KJCA 4I76A 2O8XA 3QP5A 3ZMDA 1P9QC 3EDPA 2FQ4A 3CLQA 2L9VA 5GAEJ 2CYYA 4XKCA 5HOOA 2M3AA 2HDDA 1MJBA 2CQNA 3FKIJ 2A5WA 3M7GA 4HEA2 4A0ZA 3OS1A 2R7SA 4J01A 1R7JA 3KLNA 4ASNA 2TDXA 1EF4A 2XAGA 2HZTA 1X1CA 3H3VK 1EJ9A 4M74A 2ID6A 1HC8A 2BOLA 3IKVA 4L9VA 1XS9A 4L9NA 3AL0C 3QYBA 3HXLA 3EUAA 3K1MA 2MBFA 4WWCA 4U88A 3CDLA 4IHWA 3EYIA 3DPUA 1H9GA 3ZR8X 1FEXA 1IF1A 1YIJI 1XDSA 4UUSB 1AKHA 1XDUA 4G7HF 2STWA 3CCJI 5CVVA 1IXSB 2ZXJA 5CLSA 4KDPA 4MTEA 3CUQB 3DWLE 3GW2A 5JR3A 3KP3A 2BY0A 4AWXB 2DPDA 4LLNA 4HPQA 4OIOF 4MFDA 1I6XA 1IJWC 2M30A 3L2RA 4PJLA 4E7HA 4NDLA 2YU3A 4M71A 3FX3A 2R7UA 5E1WA 1OR7C 1ORKA 3F72A 5J47A 4IQ4A 1R5HA 2RN7A 2BY3A 4XLNF 3IL2A 2HVQA 4E70A 2F4OB 1X2NA 2L2OA 5TISC 4XORA 1T08B 2IGKA 3FK6A 3FMSA 1FLIA 1FP2A 3P9CA 1XG1A 4E6KG 3ML6A 2HS5A 2XPUA 4BQQA 2JVGA 4BXUA 4LIUA 4PCQA 3FXOA 3LA2A 1BIAA 3AL0B 5F1RA 2EJRA 4RGSA 1I39A 3IH3A 2DTRA 5BNGA 2HKOA 1H89C 2OAZA 2ZSIB 4F55A 4GDFA 1QBJA 2M8GX 2LK2A 2XGDA 4L0YB 2VPRA 1OCTC 4FQGA 2BGCA 4A0XA 1RKTA 4CXFA 4HBLA 2CU7A 2EV5A 3PNVA 1R5GA 3EQLF 1W36C 5KAFC 5GTIC 1LEAA 2OPTA 3H1CA 3BWGA 3W6KB 3H3ZA 3F21A 1EH6A 3C7JA 2EFNA 3OYNA 3VPRA 5GP9A 1ZGWA 1YJ9I 1EV7A 2KIQA 5HODA 4CCNA 4S05A 4IHSA 1MJAA 2M45A 3BZ6A 4IF4A 3HUGB 4CSWA 5H2FC 2R5ZA 3IRQA 3MQ0A 2MG4A 1LFUP 2UXNA 4BBSJ 5DV5A 1MW7A 2CSOA 4GFBA 5D5UB 4BAYA 4ZTFA 1X3UA 2X48A 3J80Z 5E3MA 2W57A 1MBFA 3K4JA 1VQMI 1HF0A 4IHXA 4IO9F 2F5FA 3RZOJ 1BI0A 2EFQA 2QCOA 3KX2A 2HOTA 3GZ5A 3ZQFA 4IPAA 2XF7A 1QO0D 1FSHA 3P5JA 2KDOA 1A6QA 2CH0A 2KRCA 2VJJA 1O3QA 1O7LA 1ZGAA 4P9FA 3WE3A 1XCVA 4HNTA 2JRMA 4MQVA 4CH7A 1NK2P 1QU3A 5HLTA 5J4YA 3KYLA 2EIJH 1T39A 2QBYB 4BXXJ 2YS9A 4QSHA 2XV4S 3W3CA 5H6RA 3H0GJ 3BY6A 2EBIA 3ZP5A 3BG6A 2QEXI 2NVQJ 2EPFA 2W1OA 4BQAA 2LKPA 1YX5A 5J40A 4IHYA 1K79A 4A3KJ 4EM0B 2QQAA 3WGIA 3GTLJ 1BJZA 1IV6A 3BQYA 1AOYA 1DUXC 2FMLA 1MSEC 2E19A 3GZNB 2GAUA 4GCVA 2IA0A 5E8IA 4XK4A 2DA7A 2F2EA 1YRNB 2F5DA 2WY8Q 4NQWB 3JTGA 4BE2A 1DDNA 2RREA 3V7SA 3N4MA 2Q2EB 3JR9A 2K85A 3TP3A 3S1NJ 3F9KA 3CD6I 4JOMA 3CMAI 1C0WA 2BEOA 3LSJA 4M3EA 3ZQIA 2W4SA 1I27A 2HWVA 3U21A 2R7VA 3Q3SA 2Z5UA 2DU9A 4II2A 4Y52J 2H6BA 3BTIA 3E5XA 4L5IA 1ONVA 1XSVA 4ZTJA 1FTZA 5D6FA 3IV5A 1BJAA 3AG3H 3ECHA 3HOUJ 2VJIA 2EIMH 3D0SA 4KICA 2LTPA 1ZKGA 3ECOA 4MHGA 2XF5A 4PSXA 3J7YJ 3CCMI 1TL8A 1MH4A 2L02A 4MNUA 5JLWA 4OMYA 2DFFA 5EEHA 4BDYA 1K78A 1D5YA 2PBIA 5CVUA 3SHFA 5KK1A 1R58A 3KLOA 2P8TA 5F0HA 2VOPA 4E4HA 2DODA 3BR1A 4ABZA 1FIPA 5FLXZ 1PUFA 2EQRA 1HKQA 4JQFA 1IUFA 4XLHA 5L3DA 5ICGA 1FBQA 2JT1A 3Q0WA 4XM3A 2ZO4A 2VLAA 4AYBN 1OLTA 3IH2A 2A5YB 1HDDC 1P4WA 1A6IA 2Y31A 4HX8A 4XLEA 5K7ZA 3DBHB 2E1CA 1SD6A 2IS1A 4HG2A 1U5TB 4HF1A 1S72I 4EJVA 3JRCA 3NWSA 2RGVA 2Y0SN 2HEOA 2BW3A 1BOBA 3KPHA 3PFIA 2VL8A 2HVRA 3VWBA 3VYUB 3S93A 3F8NA 1XN7A 4BE0A 4QPOA 2HQRA 2VKHA 4A69C 3C18A 1VI0A 3I59A 2Y0SA 5LBQA 1K78B 2EFOA 2EIKH 4HSRA 2R7DA 3S1RJ 4A3LJ 3BG9A 4KJZA 4F52A 4PSWA 1VF9A 2RKHA 4XKBA 4XKWA 4YFXF 2Y9YA 1SFKA 3RKXA 3KYDB 2IRFG 5LEKA 4ENKA 1UHMA 1ETOA 2K9MA 4MFEA 2XGXA 3RKQA 3B6CA 3AG1H 5K1YA 3P7NA 2VI6A 3F0CA 3QOEA 1JE8A 2WA0A 3I58A 2QLZA 5FROA 1ODDA 2W48A 1OQYA 2ZNZA 3Q9VA 5B66C 4Y15A 1ZREA 2A05A 2XVCA 3NRVA 1FZPB 4GYIA 2NS7A 4YIFA 3ASOH 2I10A 1VTNC 1W5CC 1SMYF 2HGCA 3LA7A 3PJRA 3CF2A 4JX6A 2ESNA 1OJLA 4I0BA 2V6EA 3GYHX 2JSCA 3P9IA 3S3OA 1GVJA 1T2KA 5LD2C 1FOXA 2LFBA 2E5NA 1RUOA 2XC7A 1I1SA 1B9NA 3H9GA 2CWEA 3DTIA 1REPC 3O8HA 1ZLKA 2ZXHA 1S29A 4Y3OA 2JUCA 4KT6A 1XGNA 1HKTA 1MMGA 1W0UA 2V26A 3RKWA 2Z99A 1VFCA 3QPLA 3R6SA 4HLYA 3H5NA 2PFBA 3K0LA 4EM1A 5J6XA 5IPAA 4ENJA 2UXXA 2JA2A 5CJ9A 4B3XA 3O8GA 3NAUA 5DUIA 1OKRA 2Y69H 1IUYA 4O3MA 4FETA 4AIJA 1YS7A 2Y0MA 1G8XA 1T38A 3ZXSA 2KHMA 4G94A 3OSGA 3W2AA 3H3UA 4P1WA 3TQNA 2EINH 1ZH5A 1TWHJ 3FWEA 4P55A 3QYEA 3G73A 2Z9OA 3WG9A 5ICCA 3CJQB 3QPSA 1YJNI 3AFHA 3CMEI 2HQ5A 3E6CC 1W5SA 3GMEA 3HOWJ 3VYTB 3K70D 5DCFA 3U2RA 2A68F 5F04A 3BR0A 4V19K 3PQJA 4YEJA 3N97A 2M9HA 2MA3A 3HYIA 2FSWA 3RSNA 4XRFA 3GXOA 2Z2SB 2JPBA 1MIJA 2K40A 5BPIA 2AO9A 2CV1A 1XCBA 1MDMA 4RAYA 1LKXA 5C4JJ 3RI4A 3ZMZA 1WQ2A 1UMQA 2WC2A 3BLYA 4WX9A 4WF2A 3TL4X 4HDVA 1G4DA 3CP2A 4LJZF 3ZMTA 2V9KA 1BA5A 2HPIA 4B43A 2ZCWA 1YE9A 3HSRA 2A6HF 2MH2A 3RYPA 1LDKB 2GXBA 1UAAA 2IGMA 1CQTA 1Y39A 3DKYA 4ZDLA 2DK8A 1Z3YA 2E1MB 3LQQA 3DU5A 4A5MA 1UELB 2FU4A 4UUSA 5GPCA 1LVAA 4CHUA 5ED4A 4XICA 3S14J 3ZN0A 4ZYHA 4QTRA 1IDYA 4ZZDA 2D1VA 1W4MA 1IXCA 2K9NA 2Z3YA 4E7KA 3LL7A 3RYRA 1FBUA 5F08A 2L9RA 2PJRB 1UZCA 4F3QA 4LITA 2E71A 1YO5C 2JWTA 4WXHA 2DOEA 4FE7A 2I5UA 1GV2A 1HSJA 1WJFA 1LPQA 2E35A 2V7FA 3ZQQA 3C2BA 1MJ9A 3SZPA 4C2TA 2K7LA 2EB7A 1S9HA 1U5TC 1N75A 3WTSC 3QYFA 4NNJA 3I56I 1FNNA 5KAIC 2L7KA 1LVKA 3CCLI 1ETYA 3WU1B 4EV0A 1TNSA 4AUXA 3PFYA 2W85A 4DYQA 1BOAA 3K9TA 1Z7LA 4RGRA 4OIRF 4DNCA 5HLGA 4H0EA 1AU7A 1P7IA 3ZCOA 1JT6A 5E17F 1R00A 2ESHA 4L5EA 1SFUA 1BC8C 1YI2I 3V8JA 2O6GE 5JVGF 4A5NA 4EQQA 2M34A 1YW7A 2LG4A 5K7HA 1MH3A 3MFKA 3RJPA 2O9LA 3F6OA 5K5QA 5C44J 2LVSA 3DTEA 1JXSA 5HDNA 2NS8A 3Q0UA 5B5EC 4BL0B 4WXCA 4KNYA 2AQEA 4BY1J 3HPHA 2HOEA 3TO9A 2DLLA 5FD6A 5FKOA 1HSTA 1IN8A 3K70C 1KYWA 1WFXA 4KUMA 3CCYA 3MMYB 4S04A 1WJDA 1ZGJA 1FWZA 2Y9ZA 2ZMEC 2LLKA 1X4OA 3JRFA 1UB9A 2GWRA 4YFKF 2FNAA 1ZRFA 4XKVA 5CVRA 5E3NA 1G3TA 2JTVA 1BI3A 4W97A 4CZZA 4CYCA 4RB2C 4BE1A 2L4MA 3BJAA 1D0ZA 1J2XA 1IRZA 5LLQA 4M9ZA 2BHZA 1FPQA 2Q1ZB 5JI6A 1YRNA 3C3WA 4BEHB 4L5JA 5AIPA 3OYHA 4LG3A 1IC8A 2FMYA 2HDCA 1N77A 2FQ3A 1VQPI 3FM3A 4PUSA 1V5EA 1OCZH 3TMOA 4DJAA 3L2UA 2EZIA 4AIHA 3ABTA 5J4VA 3D1NI 4ESBA 3CC7I 4RAGA 2Z1DA 2FF4A 3EUHA 5LHHA 3RQIA 3PNYA 3ELKA 3HEFA 2NVUB 1J09A 4A6EA 2DA5A 2LOOA 3M07A 2W82A 1JKQC 2R7OA 2F48A 4MLOA 1DPRA 1MNDA 2PJRA 5IYBJ 4IEJA 3FIWA 1TW2A 2WAEA 3LSMA 2KIMA 1UJ8A 1LJ9A 3KZYA 4CYCB 3SQNA 2C6YA 1NG7A 3HRTA 3RTRA 2ACJA 3X2QH 2CRGA 2ZMEB 1IN7A 3DV8A 3S32A 3JAMK 5EGOB 5EZHA 3JRDA 3DEWA 2W25A 2WAQN 2EV0A 2RQPA 2E36A 2UWMA 3S15J 1ZR2A 5AONA 3J80K 5DM6F 4UVBA 1SEUA 2VT3A 4D7NA 4N0BA 4OMZA 2ZFWA 2B9SA 2DA3A 3NARA 2DDBA 3OR2C 2R7RA 3I0TA 1GLNA 2OQGA 5D4SA 3HOVJ 5IP6A 1ETQA 2GOXB 5M5XJ 1CGPA 3DLAA 4LIVA 1IZ1A 1QGPA 1R71A 2XAHA 3B02A 3JTHA 3K4CA 5FFXA 3OYLA 1XGMA 4XSXF 1SFXA 1JJ8C 4A93J 3S2WA 2CQKA 2KZGA 2V1DA 2CJJA 5TGTA 2J5PA 1SVMA 3HB9A 1LDJA 1R6RA 3OL4A 2X6OA 2OF7A 4FHTA 2LMDA 2NXNB 3HOSA 1YW8A 2Y30A 2O61A 2LR8A 3E97A 2DAOA 2RVCA 3ABMH 1YOVB 2M7BA 4WK8F 2GM4A 4TV7A 1R22A 3F6VA 3CCEI 4BDZA 2PI0A 4XR6A 3GTMJ 2R3SA 1CF7B 1V54H 3BPXA 3K1NA 1UFMA 2M5WA 3OOUA 3GZ6A 1YW9A 1FT9A 2XPWA 4QPQA 3G1OA 2V1NA 4R8HA 4RDUA 2E2IJ 3GTQJ 1U6GA 4KN7X 4BGDA 2DXIA 1W36D 2MABA 1D0YA 4E7LA 3UNGC 4PFPA 5FD5A 4DYRA 2BYVE 3FISA 1B72B 2VBXA 2W24A 1WJ5A 4NC7A 2YR2A 2CV0A 2X9DA 1O57A 4G7ZF 1JUPA 3R0AA 1Y56A 3ULQB 1P6RA 5K7FA 1G3WA 3VSKA 3DTKA 4XRSG 1ZG3A 2VKDA 4D7MA 2GZWA 5KVRA 1UCRA 2FE3A 1VQKI 2L7ZA 2PMZN 4BJ6C 5ILSA 1SVLA 2G0EA 3OY9A 3EETA 3BCAA 4JBAA 1POGA 1TNTA 2VXDA 4AM3A 2WB1N 4HX4A 1LFPA 3E6MA 3IKTA 1LE8B 2FNPA 4S0HB 2MC4A 4M3FA 3H36A 2D5VA 4B8XA 5IY5H 2H27A 4A3MJ 2JA6J 1IRFA 3SZGA 4DQ2A 3CMYA 2OA4A 3DQVC 3FMRA 2KIFA 2VN2A 3FF5A 3WTWC 4RB0A 3OS2A 3BR3A 3K4LA 2BHYA 4NQWA 4XONA 2IEKA 2DMPA 1J59A 1IN4A 3RDIA 3BT9A 1MNMC 3T1BA 4DZJA 2E2HJ 1ETWA 3IC7A 4KIFA 4C3JJ 2M87A 2RV8A 2CO5A 1W7PB 2LH9A 1DU6A 5H6QA 2LP0A 3OV8A 2NAZA 4LMYA 4PFOA 1J0RA 2VKVA 4XOTA 4X0GA 1VQ5I 2MC3A 3OR1C 3W2WA 4V2GA 3OIPA 2FOKA 4D9JA 4ZYAA 3WODF 3FBNB 2CUFA 3CTAA 2M4GA 2KJBA 3VOEA 2P7VB 1BR2A 2QSFX 2RDPA 1X1AA 3V4GA 2OTLI 1DP7P 2QBYA 1KQ8A 4ENNA 4IXAA 2WBMA 3P9KA 1X19A 5FLMJ 3HGGA 1Z7UA 3LNQA 2OJED 4RBOA 3H5RA 2F5VA 1VQOI 1ETVA 3RCOA 4HZFA 1SANA 2EFWA 1EH7A 2DJIA 1JHFA 4ON0A 4OIPF 1OYYA 4W1UA 1HOMA 4ESFA 3KP5A 2BVMA 4E7SA 4BJ5C 2KLOA 1FBSA 5J8FA 1PUFB 1O3TA 3A2KA 4XLCA 1HBXG 2ZXWH 4BYYA 1X1PA 2CQQA 2O03A 1F4KA 3CCQI 3CC2I 1IN6A 1XTAA 5DDGA 3CCUI 1R1VA 2AQFA 4Y4RA 4CGZA 1MBKA 2B63J 3BR2A 3UKGA 3M8FA 4XNFA 1P4AA 2RNGA 2P81A 5DCMB 2F5EA 2K86A 3HUGA 3I4NJ 4IX7A 2O0YA 2X0LA 5L3EA 2CW0F 3COAC 3BR6A 3VYRB 2L54A 5E18F 4BBRJ 3BC8A 3B73A 4FE4A 1WSUA 3K4MA 2DFIA 2L4AA 2E7WA 3TDZC 3WTVC 2O3FA 5EEAA 3WTZA 3O2PE 5F64A 3CUQC 1V5FA 4ITVA 3CJRB 2W00A 1JJ6C 2ZB9A 4HNUA 3HC7A 1FP1D 3H5AA 2A69F 3DKXA 4UUVA 4JYKA 5J1YA 5F0FA 1IDZA 4A3EJ 1I3AA 4JX4A 3G3ZA 1NHAA 2CFOA 3G71I 4FT8A 4AD9A 4OWRB 3DBLB 3NEUA 3RKYA 2GQQA 2DJNA 4U0WA 3GTJJ 1I6HJ 5LRSA 1SFOJ 2MH9A 4L9TA 3V7CA 4ZYEA 3RPUA 1IN5A 2GXAA 2VUMJ 2CUEA 2BZTA 2XRLA 2QF7A 1OCOH 3L2VA 1OR7A 2MD5A 2R5YB 1A36A 1Y8RB 2X85A 3HSEA 2FBKA 4QWQA 1SAXA 3J7AY 4A3GJ 1UG2A 1RETA 4C2UA 1Z77A 1LE8A 3M8JA 3S3NA 2VPLA 2Z33A 1E17A 5B1AH 1QPIA 2K4BA 2GBYA 2RNJA 3A4CA 3HSFA 3OYKA 2GLOA 3HM5A 3JAMZ 4PJNA 2X4HA 1W1WE 4B3AA 2FUG2 3M4OJ 3LFUA 1DGWY 3PO3J 3LSGA 2R92J 3L09A 1E2XA 3VB2A 2H8RA 3KCCA 1GHCA 3K2AA 5GADJ 4EMSA 1F43A 1DQUA 3OS0A 3GTOJ 4FTHA 1GDTA 2I8DA 2PMZA 1AHDP 3FK7A 5J1UA 2QGUA 4N4NB 1R5ID 3MKLA 3HPGA 4HLXA 5A2QZ 1IGNA 2FOWA 4PJJA 4RMNA 4FCYA 2GA1A 2QENA 2XAFA 2MLKA 1B8IA 5IT3A 4EATA 1B72A 2K4JA 2M0CA 5E79C 2AHQA 2ZJRF 2EA4A 5CPRB 1YJWI 4X6AJ 3C2GA 3ERMA 4BH9A 4CCLA 2IXSA 3PM1A 3TKYA 5CVIA 5HS9A 2GA2A 2HQNA 1X3WB 4X1EA 2X1EA 1VQ7I 1E3PA 2YX4A 3IUOA 4B1RA 2LD5A 3HOTA 3WE2A 1Y8QB 1KU7A 2ID3A 4PGHA 3VYSB 5J1RA 2NOGA 2DTZA 3KEOA 4AVZA 3TW6A 4N9IA 1B1BA 2K9SA 1MMNA 3CJTB 4G12A 4HF2A 1OCCH 1RPWA 3T5XA 2P6TA 1GT0C 2K27A 3L2WA 2TCTA 4KT5C 2KL4A 3TBIA 1PJRA 2BY2A 3IWFA 3DXJF 1B8IB 1BBYA 2P0WA 5E8GA 4M72A 3BZCA 5M3MJ 4C30A 2BV6A 3MN2A 5CYVA 3QAHA 4BKXA 1F5TA 1Z9CA 3GTKJ 4AU7A 3HKZN 1TBXA 1YQAA 5B3SH 4P96A 5AIQA 4A3IJ 2OV7A 1NTCA 2DT6A 3HTUA 1MBHA 3LA3A 3UR3C 5C3EJ 5E3LA 5JLXA 3OYGA 1BW5A 4HW0A 3TDUC 2RC4A 4EJTA 2IP2A 2QVOA 2IBDA 2CMPA 2LF8A 4JP0A 4B47A 1XX5A 5HDKA 3LAJA 3HL2A 3G6EI 1V5GA 2JUGA 5EF6A 4BXFA 3MKZA 4EGZA 1K4SA 4M3DA 5FKMA 1APLC 2H6CA 2Y48A 3KETA 3MCZA 4UV9A 1QNTA 4BJTA 1LEBA 2VT2A 1QQIA 2EZHA 3ABUA 2A07F 3DKWA 4YELA 4IRIA 4RB1A 1YITI 3K7AJ 3HGYA 3QODA 2L5QA 2WADA 4BS9A 3F8BA 1JKOC 2MSYA 3BCBA 2O8KA 3HOZJ 1R4MB 1WJEA 3A0BC 4I01A 3WTXC 4H4KC 1KU2A 1DU0A 2CUJA 4GRIA 2IA1A 4A3BJ 1JUSA 2IJLA 2QQ9A 4LGWA 1ZARA 3DF8A 4XN0A 1B6AA 4MO7A 2IAIA 4ZC3A 4CA0A 2OZ6A 4WXDA 3CUOA 2M1BA 2ZNYA 2ZSHB 2DMQA 3FKJA 3MEXA 2HOSA 4AYBA 2BW3B 3OYFA 2Z16A 2Y2ZA 4RLFA 1WJBA 1A04A 1SFEA 3MAJA 3SDGA 2P6SA 4LD5A 1JGSA 1J7KA 2F5CA 3GBGA 3ASNH 1HA8A 2UUZA 4XMYA 3U1KA 1B4AA 5B1BH 1H0MA 1W7PD 3VFZA 2DFHA 2WAFA 3PSIA 3GTGJ 4M6YA 4ZJZA 1PP8F 1ZG5A 3DEEA 1Z6TA 4D0PA 1TW3A 4BQNA 2DMUA 3ZQCA 1TWGJ 3FM5A 2NVXJ 5FKKA 4ANJA 4F91B 1IAWA 2XAQA 3EUKL 3BJ6A 2DQLA 2OC6A 2VC0A 2WTEA 1XC5A 2X1DA 4OINF 2XAJA 1KQ0A 2QA4I 1U3EM 5H20A 2VBWA 2YPRA 2DA1A 3HRSA 5HNFA 2K5CA 3O6BB 2DYSH 1WI9A 3FXUA 1ETXA 1I50J 4NC6A 4CCMA 4PJMA 2VE9A 1MMAA 4LB6B 1AWCA 1YIOA 3HHHA 2P5VA 1TTYA 2HYGD 2ZJQF 3GCMA 4N9HA 3WGHA 4LLGF 4MTDA 2HVSA 4LK0F 1IXRC 2ZFUA 3H35A 2WY7Q 3CJNA 2V1XA 1JI8A 2H09A 1HXDA 4HOBA 3HBLA 1GXPA 1ZAOA 4BEHA 2YUSA 4U7BA 4C3HJ 5EG0B 2E5ZA 1JTYA 3LAPA 2BE5F 4G6TB 2KP6A 2R7FA 3S2DJ 1YLFA 3Q9SA 3E0JB 3LOCA 4CZCA 1V4RA 3AG4H 2BBYA 4OOIA 2XGEA 3FMQA 3GFMA 4XRMA 3WU0A 4FX4A 5E1ZB 3JW4A 1HCRA 4LFUA 3SFIA 1WRJA 4DYCA 4IRHA 4XLFA 3DEUA 1JKPC 3DCFA 4EJWA 1VQNI 2M2EA 2JMWA 2M0MA 1TT5B 1T0FA 5L3CA 3M1EA 3T8RA 2JRTA 1OCRH 3KP6A 5J8CA 3E5QA 2XKPA 2DW4A 4F92B 2DOAA 3WTTC 3QRFF 2VE8A 2QSHX 1TQPA 5EG0A 5FLXK 2COMA 2OBPA 3GVAA 3WTYC 1Q1HA 1U9OA 2PQ8A 3E5UA 3QQAA 4KMUX 1TWCJ 4Q47A 4RAFA 2H1LA 5F1JA 3CESA 4UB6C 5LEJA 3PO2J 4B09A 2CW8A 1T56A 4YRVA 4DBQA 4U0VA 2JSPA 2VJ4A 1B59A 1X58A 1GXQA 1T95A 2OZUA 4XRSA 3E6BA 4KN4X 4DIQA 3U9GA 3IRRA 3LFKA 4AVPA 4K2EA 1T8IA 2AS5F 4C3IJ 1ZTRA 4Q48A 5BQTA 2EH3A 5DTDA 1D8JA 3TO7A 3PIPF 1T0FC 2QKMB 1GVDA 2DQRA 2WAQA 2KDZA 1RC9A 2XDVA 1QZYA 3DPTA 1PDNC 3RZDJ 4XLAA 3W2VA 4Y7NJ 1ENHA 2VXZA 1ZELA 3VSLA 4G7OF 1LUJB 1U2WA 2JA5J 1X1DA 1BR4A 2HZDA 4AC0A 2D1HA 1S8NA 2VBYA 1LQ1A 1D1AA 3KE2A 4WCGA 1AA7A 4IOCF 5LGNA 3LQRA 2IVMA 1U5TA 3CP8A 1O4XA 1A35A 3V8KA 5LHGA 1F9NA 2KFDA 3GFLA 4MEYF 4XBFA 3OYMA 1YYVA 2E1MC 3CDIA 2KKOA 2HNHA 2LREA 5CKTA 4C2MJ 5K5OA 4QLCU 1WVRA 3FDYA 4HAMA 4CUGA 2PEXA 3F8MA 2DA6A 1FOKA 4M6VA 3PIOF 4OIQF 3OOPA 1UHWA 5CQGA 2JN6A 1QZZA 5DD4A 4MGRA 3JSOA 2LY2A 1ETKA 2BXYA 3SEZA 1MBGA 6PAXA 4UHTA 5DCMA 1VQ4I 4JX5A 2CW7A 4KITB 5HNHA 2PX9A 2DPUA 3I55I 3K4KA 5BOXA 2WWYA 1OISA 2PG4A 2JA8J 3BROA 1S3JA 4U7DA 1KU9A 3B6AA 1YHQI 1U0JA 4L0ZB 4UY8I 1ERDA 1D0XA 3Q5FA 2PN6A 2YSRA 1KQ9A 3HDDA 4PZJA 2K9QA 4B4CA 5C4XJ 1VNDA 2FEZA 1IO2A 3F22A 1O3SA 4YIIA 3M1CA 3ZMVA 2HTJA 1W5TA 2W7NA 1S7OA 4LG0A 2XIGA 2WB1A 3BTJA 1BR1A 2FBIA 1STZA 3RIRA 3KP7A 4J00A 2XRNA 1QA6A 5ERIA 4I0AA 1MSFC 3WGGA 4UV8A 3FXMA 3RPQA 3HRMA 3OYCA 2O7OA 2DN0A 4Z6YA 3S1QJ 3CO6C 2GIZA 2IS6A 1LDDA 1K6YA 1P2FA 3LSHA 2ECCA 2ZJPF 2FBHA 3EUHC 5HDGA 3ZQHA 3GLLA 3N05A 4L18B 4NHJA 2JVHA 3HJEA 1OMIA 2Q0OA 2ZXIA 1SD7A 5J3LA 2CUZA 3BZKA 3MWMA 5FRNA 3BDDA 3H9QA 1USTA 4IHTA 3L9FA 3JRBA 2X6XA 3CQZJ 4I6ZA 1SC7A 1H8AC 1TWFJ 2IPQX 5LRRA 2JA7J 3OIOA 3CF5F 4NUBA 3MZHA 2NVYJ 5BMZA 2F4IA 1I1GA 5DUKA 4HNVA 3BG7A 2HKXA 1DGRM 1QHGA 5L3GA 4UUTA 1ZK8A 1HW1A 3E3VA 4BUPA 3MKYB 2K9LA 2W84A 3JRIA 4HRIA 3EPZA 4P9UA 1QVTA 5FKNA 4Z2YA 1S5LC 5BS6A 5TJJA 4XSZF 3QOPA 2Y75A 3JSPA 1PYVA 2IT0A 2F4MB 1M1EB 3VDXA 1BL0A 4CDGA 1QVUA 3GO5A 2HTSA 2GIVA 2DO7A 1XD7A 3ERED 1U8BA 3OMYA 1RUNA 2A3SA 3RPUD 3TOAA 3JRAA 2QM3A 4MQ9F 3HOYJ 2EA2A 3W6VA 4GO1A 1RR8C 2UV1A 1MZBA 4LOCA 3WTUC 3D5RC 1I5ZA 2KT0A 3MVPA 2Q2EA 5HS7A 3FHNA 3M3YJ 1JKRC 5F6FA 4O6JA 1AKHB 3HZJA 3TW7A 3JREA 5FO5A 3FXLA 2H1KA 1MKMA 5K5RA 2KRFA 3WG7H 2P5LC 1K61A 4KIBA 5LGUA 3BG5A 5FLVA 3GLXA 3ZN1A 4MIMA 1FMVA 5TRDA 3F8CA 3WU2C 3DLLF 2XGCA 4BNCA 1IG7A 4I02A 2LNBA 3OL3A 5IYCJ 2BY1A 3M9AA 3FXJA 1BI1A 3KEQA 2CV2A 1VQ6I 2E2JJ 2KPMA 3ZQ7A 1VQ8I 4KYWA 3LWFA 3H0DA 4II3A 2EV6A 1ZYRF 3CO7C 5M5WJ 3E7LA 1R1TA 4IL6C 3ZMUA 2G7HA 4KA4A 2IS4A 1YG2A 3QP6A 5FJ8J 3OYBA 2ECBA 5F27A 3ESWB 4RM2A 5EZGA 3W6JB 1QRYA 2IW5A 1OYIA 2LBFA 4G6DA 2DBBA 3PSFA 1MMSA 2R7QA 2K3FA 2MFZA 2ICWG 2XKOA 3S3MA 1P92A 3ABKH 1ON1A 2YX7A 2JPCA 3A03A 4HA8A 1R49A 1HDPA 3I4PA 1FMWA 1RZ4A 1RNLA 2DMTA 1S6LA 2DOFA 2R7ZJ 2FD5A 3QU3A 1XB4A 3K69A 3CUQA 3MZ8A 1RI7A 3L2QA 2ADUA 1L0OC 4PDKA 1YS6A 1KYZA 3TGNA 2ME6A 3E1SA 4I99C 1KA8A 2FJ1A 1WI3A 3OYIA 2FX0A 3GWZA 1KGSA 3T8TA 4M73A 4EM2A 1IRGA 2OCCH 2OU2A 3K6GA 5L3FA 2MYSA 2ISZA 4HV6A 3LSPA 2R5ZB 2L9NA 2DFEA 4Y17A 1TQIA 1JT0A 2BXZA 1UHSA 2ZKZA 1ZR4A 1EA3A 2F6CA 3HG9A 4A3CJ 3BPVA 2M7AA 3SZTA 3CCSI 1G3SA 2MW8A 2VC1A 1N25A 4A6DA 3R61A 3S2HJ 2X1CA 3LSRA 2HPMA 1ZHFA 2JJ7A 1OFCX 4OU0A 2B7EA 1XSDA 3FXRA 2LBFB 1ACIA 1WJAA 2OUMA 4I2OA 3FXKA 3ONQA 4BY7J 1XMAA 4HYEA 5L3BA 2KZVA 4E7JA 2L9SA 3A0HC 5DYMA 4FASD 2QQBA 2O5RA 2ZC2A 1WPKA 2L3DA 1V55H 3HIFA 2LRDA 4BHPA 1TC3C 1O7FA 4L9JA 5D8KB 1X3ZB 3ISPA 3C1DA 5D5VB 1S7AA 2CQXA 3K4BA 2KRHA 3PUFA 3S8PA 1OPCA 3IHUA 1Y0UA 3K2ZA 4M6XA 1RR7A 4PGGA 4DW6A 2EZLA 2V1UA 3I5UA 1FY7A 5F0CA 2A61A 5IP7J 3GFIA 1R1UA 2NS0A 3BOQA 2EILH 2DYRH 2LC2A
chains in the Genus database with same CATH topology
1Z1DA 4I98B 1LNWA 1YTYA 4KMFA 1FSEA 1L3LA 5BPDA 2PLYA 5FGMA 1F1ZA 1D8KA 4RGUA 1FYMA 3PQKA 2NYXA 4LLLA 1OYWA 3R0JA 4I7HA 2DK5A 4EGYA 5D4RA 2OQRA 2WV0A 1WKMA 4RB3C 4UNOA 2FRHA 4HDUA 3I64A 3F23A 3K1PA 3CDHA 3D5LA 3ZPLA 2D2WA 1FYKA 1YFHA 2XROA 4ZYGA 4KFCA 3LSTA 1ZLJA 5ICFA 3VEPA 5LHIA 4UXNA 1D3YA 1HQCA 4CO8A 4CYDA 2CG4A 4ZH4F 1PUEE 5E1XA 4YG2F 3F3XA 3HRUA 2JZYA 2XASA 1XSXA 5ICEA 2VOOA 3H92A 2L01A 1ON2A 4HX7A 3I71A 4RAZA 3GEZA 2CGPA 4FX0A 4G8XA 4Q4ZF 5ILVA 4HV5A 5D5WB 1O3RA 2QWWA 1J5YA 2LF7A 2PMHA 2LSOA 4GXOA 1U78A 4O5VA 3GF2A 2QYOA 1Z6RA 3HTSB 4BHCA 5DD8A 2EFPA 2P7CB 3DPLC 5IT9K 1PP7U 2G9WA 4RS8A 2NNNA 3KP4A 3F8FA 4ETSA 3L00A 1U8RA 5DEQA 4U0YA 3L7WA 3REOA 3J7AO 1J75A 2HFHA 3E6DA 2D45A 4EVIA 2EK5A 4LB5A 3I54A 1K6OA 4IVNA 2J5OA 4G9YA 3R60A 3IWZA 1XGSA 4IRGA 4P5OA 1T98A 2B0LA 5LGTA 1ZRDA 2QUFA 3EYYA 1G3YA 5HVQC 1BC7C 2ZMEA 5HLHA 1ZRCA 1HW2A 5HS8A 2XHKA 4M9SA 3GUDA 2H94A 3O3KA 1BI2A 2AXLA 3HHGA 1HKSA 1TQMA 4ESJA 2XUBA 5JFRA 3AAFA 3QU6A 1B9MA 2ELHA 2DT5A 4ZZLA 4RGXA 5HLIA 4Y13A 1G6NA 1W7PA 2NNYA 2STTA 4ENMA 3FHZA 2Q8KA 3I59B 4GYGA 3TO6A 4HF0A 4UVCA 2FXAA 3M8EA 4YFNF 1P4XA 4HQMA 4IJAA 2KIUA 3DFGA 3V7RA 1BIBA 5D6EA 4EJOA 1SD5A 2DI3A 4F7ZA 3GX4X 1QPMA 3MZYA 4G6QA 2VONA 1SD4A 4NB5A 3NQOA 2FA5A 5IT9Z 5JVTA 4LK1F 2ZBKA 1H9TA 1ZG1A 3ZMSA 3BP8A 1D5VA 3QPHA 2M8EA 2A6EF 2CFXA 1DPUA 2IA2A 4XLPF 1EH8A 2PJPA 3U1DA 4LG0B 5D5XB 1K7AA 2NRAC 4AIKA 2E1NA 4CICA 1J9IA 4I09A 4A0YA 2LDUA 4M9XA 4R1HA 2G7UA 1ZN2A 2V79A 4HQEA 1R23A 1FYLA 3SFZA 2UZKA 5A2QK 4ZYDA 2ISYA 3SXYA 3FZVA 1CF7A 4BHBA 2V6CA 1ULYA 4KIGA 5CVJA 3R4KA 1R36A 2QZ8A 1IW7F 1SMTA 4R79A 2HYFA 4A2UA 3KP2A 1TLHB 3KFWX 3TOBA 1MD0A 1BM9A 4EJUA 3V8LA 3L2CA 1XGOA 4A12A 5FFZA 3I53A 3DP7A 5ILUA 5EEGA 5JHUA 1LB2A 1JHHA 3QPTA 3T0YA 3ROUA 2K02A 4JK1X 3GFJA 2V9VA 4GGGA 3CLOA 1V3FA 2HR3A 3KZZA 1BN5A 1FX7A 1MDMB 2EWNA 5FB2A 1T6SA 1WWXA 5E20A 2VODA 2VBZA 2OD5A 2GXGA 1Z05A 2ZJ2A 2E7XA 2PMUA 1XMKA 3BJOA 1USSA 4UVAA 2P4WA 3VODA 1KU3A 4MEXF 2MLGA 1Z91A 2ETHA 1HW5A 3J81Z 1MGTA 2P5KA 4Q5SF 3FXQA 5D8LB 1RIOH 3J81K 1FC3A 2KJCA 2O8XA 3QP5A 3ZMDA 3EDPA 2CYYA 5HOOA 1MJBA 3M7GA 4A0ZA 1R7JA 3KLNA 4ASNA 2TDXA 2XAGA 2HZTA 4M74A 3IKVA 4L9VA 4L9NA 3K1MA 2MBFA 4WWCA 4U88A 3EYIA 1H9GA 1IF1A 1XDSA 1XDUA 4G7HF 2STWA 5CVVA 1IXSB 2ZXJA 5CLSA 4KDPA 4MTEA 3CUQB 3GW2A 5JR3A 3KP3A 4AWXB 2DPDA 4LLNA 4OIOF 1I6XA 2M30A 2YU3A 4M71A 3FX3A 5E1WA 3F72A 1R5HA 2RN7A 4XLNF 3IL2A 4E70A 3FMSA 1FLIA 1FP2A 3P9CA 3ML6A 2HS5A 4BXUA 4PCQA 3LA2A 1BIAA 5F1RA 2EJRA 4RGSA 2DTRA 2HKOA 2OAZA 1QBJA 4L0YB 2BGCA 4A0XA 4CXFA 4HBLA 2EV5A 1R5GA 3EQLF 1LEAA 3BWGA 3W6KB 3H3ZA 3F21A 1EH6A 3C7JA 2EFNA 1EV7A 4S05A 4IHSA 1MJAA 2M45A 3BZ6A 4IF4A 5E17F 3IRQA 3MQ0A 2UXNA 5DV5A 2CSOA 5D5UB 4BAYA 1X3UA 3J80Z 2W57A 2F5FA 1BI0A 2EFQA 3GZ5A 4IPAA 1QO0D 1FSHA 1O3QA 1O7LA 1ZGAA 4P9FA 3WE3A 1XCVA 4MQVA 1T39A 2QBYB 2XV4S 5H6RA 3BY6A 3ZP5A 4BQAA 2LKPA 1K79A 4EM0B 2QQAA 3WGIA 1AOYA 1DUXC 2FMLA 2GAUA 4GCVA 2IA0A 5E8IA 2F2EA 2F5DA 3JTGA 1DDNA 3V7SA 3N4MA 1C0WA 2BEOA 1I27A 2HWVA 2Z5UA 2DU9A 2H6BA 3E5XA 4L5IA 1ONVA 1XSVA 5D6FA 1BJAA 3ECHA 4KICA 3D0SA 3ECOA 4MHGA 4OMYA 2L02A 4MNUA 5EEHA 1K78A 2PBIA 5CVUA 3SHFA 5KK1A 1R58A 3KLOA 2P8TA 2VOPA 5FLXZ 1HKQA 4JQFA 5L3DA 5ICGA 1FBQA 2JT1A 2ZO4A 2A5YB 1P4WA 2E1CA 4HX8A 1SD6A 1U5TB 4HF1A 4EJVA 2RGVA 2HEOA 3PFIA 3F8NA 1XN7A 2HQRA 3C18A 3I59A 5LBQA 1K78B 2EFOA 2R7DA 2RKHA 4YFXF 3RKXA 2IRFG 5LEKA 4ENKA 1UHMA 2XGXA 5K1YA 3P7NA 1JE8A 3I58A 2QLZA 1ODDA 2ZNZA 3Q9VA 4Y15A 1ZREA 2XVCA 3NRVA 1FZPB 4GYIA 4YIFA 1VTNC 1SMYF 2HGCA 3LA7A 2ESNA 4I0BA 3GYHX 2JSCA 3P9IA 1GVJA 1T2KA 1RUOA 1I1SA 1B9NA 1REPC 2CWEA 1ZLKA 1S29A 1XGNA 1HKTA 3RKWA 2Z99A 3R6SA 4HLYA 2PFBA 3K0LA 4EM1A 5J6XA 4ENJA 2UXXA 5CJ9A 5DUIA 1OKRA 1IUYA 4O3MA 1T38A 4AIJA 1YS7A 2Y0MA 4G94A 3H3UA 3TQNA 1ZH5A 4P55A 3FWEA 2Z9OA 3G73A 3WG9A 5ICCA 3E6CC 1W5SA 5DCFA 3U2RA 2A68F 3PQJA 3N97A 2MA3A 3HYIA 2FSWA 4XRFA 3GXOA 2JPBA 5BPIA 1XCBA 1MDMA 4RAYA 3RI4A 3ZMZA 1WQ2A 2WC2A 4WX9A 4WF2A 4HDVA 1G4DA 4LJZF 3ZMTA 2ZCWA 3HSRA 2A6HF 2MH2A 3RYPA 1LDKB 2GXBA 2DK8A 3LQQA 4A5MA 2FU4A 1LVAA 4CHUA 5ED4A 3ZN0A 4ZYHA 4ZZDA 2D1VA 1W4MA 1IXCA 2Z3YA 3RYRA 1FBUA 1YO5C 4WXHA 1HSJA 1MJ9A 3SZPA 2K7LA 2EB7A 1U5TC 3WTSC 1FNNA 3WU1B 4EV0A 1TNSA 2W85A 4H0EA 1BOAA 3K9TA 4RGRA 4OIRF 4DNCA 5HLGA 1R00A 2ESHA 1BC8C 1SFUA 3V8JA 2O6GE 4A5NA 4EQQA 1YW7A 3MFKA 3RJPA 3F6OA 5K5QA 1JXSA 5HDNA 4KNYA 4WXCA 2HOEA 3TO9A 2DLLA 5FD6A 1HSTA 1IN8A 1KYWA 4KUMA 4S04A 1ZGJA 1FWZA 1UB9A 2GWRA 4YFKF 2FNAA 1ZRFA 5CVRA 1G3TA 2JTVA 1BI3A 4CZZA 4RB2C 2L4MA 3BJAA 1J2XA 5LLQA 4M9ZA 1FPQA 5JI6A 3C3WA 4L5JA 5AIPA 2FMYA 2HDCA 2FQ3A 3FM3A 4AIHA 3ABTA 4ESBA 2FF4A 3EUHA 5LHHA 3ELKA 4A6EA 1DPRA 1TW2A 2KIMA 1LJ9A 3KZYA 2C6YA 3SQNA 3HRTA 3RTRA 2ACJA 3JAMK 2ZMEB 1IN7A 3DV8A 2W25A 2EV0A 2RQPA 2UWMA 5AONA 3J80K 4UVBA 2VT3A 4N0BA 4OMZA 2ZFWA 3I0TA 2OQGA 5D4SA 1CGPA 1IZ1A 1QGPA 2XAHA 3B02A 3JTHA 5FFXA 1XGMA 4XSXF 1SFXA 3S2WA 2CQKA 2V1DA 2J5PA 1LDJA 4FHTA 3HOSA 1YW8A 2O61A 3E97A 2DAOA 2RVCA 4WK8F 4TV7A 1R22A 3F6VA 2PI0A 2R3SA 1CF7B 3K1NA 3BPXA 1UFMA 2M5WA 3GZ6A 1YW9A 1FT9A 4R8HA 1U6GA 4KN7X 5FD5A 2BYVE 2VBXA 2W24A 2YR2A 1O57A 4G7ZF 3R0AA 3ULQB 1P6RA 1G3WA 1ZG3A 2GZWA 5KVRA 1UCRA 2FE3A 5ILSA 3EETA 4JBAA 1TNTA 4HX4A 3E6MA 3IKTA 2FNPA 4B8XA 2H27A 1IRFA 4DQ2A 2OA4A 3DQVC 3FMRA 2KIFA 2VN2A 3FF5A 3WTWC 4RB0A 4NQWA 1J59A 1IN4A 3RDIA 3T1BA 3IC7A 4KIFA 2M87A 2RV8A 2CO5A 1W7PB 5H6QA 3OV8A 2NAZA 4LMYA 1J0RA 2MC3A 2FOKA 3WODF 3CTAA 2KJBA 3VOEA 2P7VB 3V4GA 2RDPA 2QBYA 1KQ8A 1DP7P 4ENNA 4IXAA 3P9KA 1Z7UA 4HZFA 2EFWA 1EH7A 1JHFA 4ON0A 4OIPF 1OYYA 4ESFA 3KP5A 5J8FA 1FBSA 1O3TA 1HBXG 4BYYA 2O03A 1F4KA 1IN6A 5DDGA 1R1VA 4CGZA 3M8FA 1P4AA 5DCMB 2F5EA 2K86A 3HUGA 2O0YA 2X0LA 5L3EA 2CW0F 3COAC 2L54A 5E18F 3B73A 1WSUA 2DFIA 2L4AA 2E7WA 3TDZC 3WTVC 2O3FA 3WTZA 3O2PE 5F64A 3CUQC 1FP1D 2A69F 4UUVA 3G3ZA 1NHAA 4FT8A 4AD9A 3NEUA 3RKYA 2GQQA 4U0WA 5LRSA 2MH9A 4L9TA 3V7CA 4ZYEA 3RPUA 1IN5A 1OR7A 2MD5A 3HSEA 2FBKA 4QWQA 1SAXA 2Z33A 1E17A 2K4BA 2RNJA 3HSFA 3JAMZ 2X4HA 3L09A 1E2XA 3VB2A 3KCCA 1GHCA 4EMSA 5A2QZ 4HLXA 2GA1A 2QENA 2XAFA 2MLKA 5IT3A 2K4JA 2EA4A 4BH9A 3TKYA 5CVIA 5HS9A 2GA2A 2HQNA 2YX4A 3HOTA 3WE2A 1KU7A 4PGHA 3KEOA 4N9IA 1B1BA 4HF2A 3T5XA 2P6TA 2K27A 4KT5C 3IWFA 3DXJF 1BBYA 5E8GA 4M72A 2BV6A 5CYVA 3QAHA 1F5TA 1Z9CA 1TBXA 1YQAA 4P96A 5AIQA 3HTUA 3LA3A 4HW0A 3TDUC 2RC4A 4EJTA 2IP2A 2QVOA 2LF8A 5HDKA 3LAJA 4EGZA 2H6CA 2Y48A 3KETA 3MCZA 4UV9A 1QNTA 1LEBA 2VT2A 1QQIA 3ABUA 2A07F 3DKWA 4IRIA 4RB1A 3F8BA 4I01A 3WTXC 1KU2A 2IA1A 2IJLA 2QQ9A 4LGWA 1ZARA 3DF8A 1B6AA 2OZ6A 4WXDA 3CUOA 2M1BA 2ZNYA 3MEXA 1A04A 1SFEA 3MAJA 2P6SA 4LD5A 1JGSA 1J7KA 2F5CA 1B4AA 1H0MA 1W7PD 3VFZA 4M6YA 1PP8F 1ZG5A 1Z6TA 4D0PA 1TW3A 3FM5A 1IAWA 2XAQA 3BJ6A 2DQLA 2VC0A 2WTEA 4OINF 2XAJA 1KQ0A 1U3EM 5H20A 2VBWA 2YPRA 3HRSA 3O6BB 1WI9A 3FXUA 2VE9A 4LB6B 1AWCA 1YIOA 3HHHA 2P5VA 1TTYA 2HYGD 4N9HA 3WGHA 4LLGF 4MTDA 4LK0F 1IXRC 3CJNA 2V1XA 2H09A 1HXDA 4HOBA 1GXPA 1ZAOA 4U7BA 3LAPA 2BE5F 2R7FA 1YLFA 3Q9SA 1V4RA 2BBYA 4OOIA 3FMQA 3GFMA 3WU0A 4FX4A 5E1ZB 3JW4A 4LFUA 1WRJA 4IRHA 3DEUA 4EJWA 1T0FA 5L3CA 3M1EA 3T8RA 2JRTA 3KP6A 5J8CA 3E5QA 2XKPA 2DW4A 3WTTC 3QRFF 2VE8A 1TQPA 5FLXK 2COMA 2OBPA 3GVAA 3WTYC 1Q1HA 2PQ8A 3E5UA 4KMUX 4Q47A 5LEJA 4B09A 4U0VA 1B59A 1GXQA 2OZUA 3E6BA 4KN4X 3U9GA 3IRRA 3LFKA 4AVPA 4K2EA 2AS5F 4Q48A 5BQTA 1D8JA 3TO7A 2DQRA 1QZYA 3DPTA 1PDNC 2VXZA 4G7OF 1U2WA 2D1HA 1S8NA 2VBYA 1LQ1A 3KE2A 4WCGA 5LGNA 3LQRA 2IVMA 1U5TA 3V8KA 5LHGA 1F9NA 3GFLA 4MEYF 4XBFA 1YYVA 2KKOA 5K5OA 4QLCU 4HAMA 2PEXA 3F8MA 1FOKA 4OIQF 3OOPA 1UHWA 1QZZA 5DD4A 4MGRA 3JSOA 6PAXA 4UHTA 5DCMA 2DPUA 5BOXA 2WWYA 2PG4A 3BROA 1S3JA 4U7DA 1KU9A 4L0ZB 3Q5FA 2PN6A 2YSRA 1KQ9A 4PZJA 2FEZA 3F22A 1O3SA 4YIIA 3ZMVA 2HTJA 1W5TA 1S7OA 4LG0A 2XIGA 2FBIA 1STZA 3RIRA 3KP7A 2XRNA 5ERIA 4I0AA 3WGGA 4UV8A 3RPQA 3HRMA 3CO6C 1LDDA 1P2FA 2FBHA 5HDGA 4L18B 4NHJA 1OMIA 2Q0OA 1SD7A 3MWMA 3BDDA 1USTA 4IHTA 3L9FA 2IPQX 5LRRA 3MZHA 5BMZA 1I1GA 5DUKA 2HKXA 5L3GA 1HW1A 3E3VA 2W84A 4P9UA 4Z2YA 5BS6A 5TJJA 4XSZF 3QOPA 2Y75A 3JSPA 2IT0A 4CDGA 3GO5A 2HTSA 2GIVA 2DO7A 1XD7A 3ERED 1RUNA 2A3SA 3TOAA 2QM3A 4MQ9F 2EA2A 4GO1A 1MZBA 3WTUC 1I5ZA 2Q2EA 5HS7A 5F6FA 4O6JA 5FO5A 1MKMA 5K5RA 2KRFA 2P5LC 4KIBA 5LGUA 3GLXA 3ZN1A 5TRDA 3F8CA 4BNCA 4I02A 2LNBA 3M9AA 1BI1A 3KEQA 3ZQ7A 4KYWA 3LWFA 2EV6A 1ZYRF 3CO7C 1R1TA 3ZMUA 2G7HA 4KA4A 1YG2A 3QP6A 3W6JB 2IW5A 1OYIA 4G6DA 2DBBA 2XKOA 1P92A 1ON1A 2YX7A 2JPCA 4HA8A 3I4PA 1RZ4A 1RNLA 1S6LA 3QU3A 1XB4A 3K69A 3CUQA 1RI7A 2ADUA 1L0OC 4PDKA 1YS6A 1KYZA 3TGNA 1KA8A 3GWZA 1KGSA 3T8TA 4M73A 4EM2A 1IRGA 2OU2A 5L3FA 2ISZA 4HV6A 4Y17A 1TQIA 2ZKZA 3BPVA 3SZTA 1G3SA 2VC1A 4A6DA 3R61A 1ZHFA 4OU0A 1XSDA 3FXRA 4I2OA 1XMAA 4HYEA 5L3BA 5DYMA 2QQBA 2L3DA 3HIFA 4BHPA 1O7FA 4L9JA 5D8KB 3ISPA 3C1DA 5D5VB 1S7AA 1OPCA 3IHUA 1Y0UA 3K2ZA 4M6XA 4PGGA 2V1UA 3I5UA 1FY7A 2A61A 3GFIA 1R1UA 2NS0A 3BOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1D A;  4I98 B;  1LNW A;  1YTY A;  4KMF A;  1FSE A;  1L3L A;  5BPD A;  2PLY A;  5FGM A;  1F1Z A;  1D8K A;  4RGU A;  1FYM A;  3PQK A;  2NYX A;  4LLL A;  1OYW A;  3R0J A;  4I7H A;  2DK5 A;  4EGY A;  5D4R A;  2OQR A;  2WV0 A;  1WKM A;  4RB3 C;  4UNO A;  2FRH A;  4HDU A;  3I64 A;  3F23 A;  3K1P A;  3CDH A;  3D5L A;  3ZPL A;  2D2W A;  1FYK A;  1YFH A;  2XRO A;  4ZYG A;  4KFC A;  3LST A;  1ZLJ A;  5ICF A;  3VEP A;  5LHI A;  4UXN A;  1D3Y A;  1HQC A;  4CO8 A;  4CYD A;  2CG4 A;  4ZH4 F;  1PUE E;  5E1X A;  4YG2 F;  3F3X A;  3HRU A;  2JZY A;  2XAS A;  1XSX A;  5ICE A;  2VOO A;  3H92 A;  2L01 A;  1ON2 A;  4HX7 A;  3I71 A;  4RAZ A;  3GEZ A;  2CGP A;  4FX0 A;  4G8X A;  4Q4Z F;  5ILV A;  4HV5 A;  5D5W B;  1O3R A;  2QWW A;  1J5Y A;  2LF7 A;  2PMH A;  2LSO A;  4GXO A;  1U78 A;  4O5V A;  3GF2 A;  2QYO A;  1Z6R A;  3HTS B;  4BHC A;  5DD8 A;  2EFP A;  2P7C B;  3DPL C;  5IT9 K;  1PP7 U;  2G9W A;  4RS8 A;  2NNN A;  3KP4 A;  3F8F A;  4ETS A;  3L00 A;  1U8R A;  5DEQ A;  4U0Y A;  3L7W A;  3REO A;  3J7A O;  1J75 A;  2HFH A;  3E6D A;  2D45 A;  4EVI A;  2EK5 A;  4LB5 A;  3I54 A;  1K6O A;  4IVN A;  2J5O A;  4G9Y A;  3R60 A;  3IWZ A;  1XGS A;  4IRG A;  4P5O A;  1T98 A;  2B0L A;  5LGT A;  1ZRD A;  2QUF A;  3EYY A;  1G3Y A;  5HVQ C;  1BC7 C;  2ZME A;  5HLH A;  1ZRC A;  1HW2 A;  5HS8 A;  2XHK A;  4M9S A;  3GUD A;  2H94 A;  3O3K A;  1BI2 A;  2AXL A;  3HHG A;  1HKS A;  1TQM A;  4ESJ A;  2XUB A;  5JFR A;  3AAF A;  3QU6 A;  1B9M A;  2ELH A;  2DT5 A;  4ZZL A;  4RGX A;  5HLI A;  4Y13 A;  1G6N A;  1W7P A;  2NNY A;  2STT A;  4ENM A;  3FHZ A;  2Q8K A;  3I59 B;  4GYG A;  3TO6 A;  4HF0 A;  4UVC A;  2FXA A;  3M8E A;  4YFN F;  1P4X A;  4HQM A;  4IJA A;  2KIU A;  3DFG A;  3V7R A;  1BIB A;  5D6E A;  4EJO A;  1SD5 A;  2DI3 A;  4F7Z A;  3GX4 X;  1QPM A;  3MZY A;  4G6Q A;  2VON A;  1SD4 A;  4NB5 A;  3NQO A;  2FA5 A;  5IT9 Z;  5JVT A;  4LK1 F;  2ZBK A;  1H9T A;  1ZG1 A;  3ZMS A;  3BP8 A;  1D5V A;  3QPH A;  2M8E A;  2A6E F;  2CFX A;  1DPU A;  2IA2 A;  4XLP F;  1EH8 A;  2PJP A;  3U1D A;  4LG0 B;  5D5X B;  1K7A A;  2NRA C;  4AIK A;  2E1N A;  4CIC A;  1J9I A;  4I09 A;  4A0Y A;  2LDU A;  4M9X A;  4R1H A;  2G7U A;  1ZN2 A;  2V79 A;  4HQE A;  1R23 A;  1FYL A;  3SFZ A;  2UZK A;  5A2Q K;  4ZYD A;  2ISY A;  3SXY A;  3FZV A;  1CF7 A;  4BHB A;  2V6C A;  1ULY A;  4KIG A;  5CVJ A;  3R4K A;  1R36 A;  2QZ8 A;  1IW7 F;  1SMT A;  4R79 A;  2HYF A;  4A2U A;  3KP2 A;  1TLH B;  3KFW X;  3TOB A;  1MD0 A;  1BM9 A;  4EJU A;  3V8L A;  3L2C A;  1XGO A;  4A12 A;  5FFZ A;  3I53 A;  3DP7 A;  5ILU A;  5EEG A;  5JHU A;  1LB2 A;  1JHH A;  3QPT A;  3T0Y A;  3ROU A;  2K02 A;  4JK1 X;  3GFJ A;  2V9V A;  4GGG A;  3CLO A;  1V3F A;  2HR3 A;  3KZZ A;  1BN5 A;  1FX7 A;  1MDM B;  2EWN A;  5FB2 A;  1T6S A;  1WWX A;  5E20 A;  2VOD A;  2VBZ A;  2OD5 A;  2GXG A;  1Z05 A;  2ZJ2 A;  2E7X A;  2PMU A;  1XMK A;  3BJO A;  1USS A;  4UVA A;  2P4W A;  3VOD A;  1KU3 A;  4MEX F;  2MLG A;  1Z91 A;  2ETH A;  1HW5 A;  3J81 Z;  1MGT A;  2P5K A;  4Q5S F;  3FXQ A;  5D8L B;  1RIO H;  3J81 K;  1FC3 A;  2KJC A;  2O8X A;  3QP5 A;  3ZMD A;  3EDP A;  2CYY A;  5HOO A;  1MJB A;  3M7G A;  4A0Z A;  1R7J A;  3KLN A;  4ASN A;  2TDX A;  2XAG A;  2HZT A;  4M74 A;  3IKV A;  4L9V A;  4L9N A;  3K1M A;  2MBF A;  4WWC A;  4U88 A;  3EYI A;  1H9G A;  1IF1 A;  1XDS A;  1XDU A;  4G7H F;  2STW A;  5CVV A;  1IXS B;  2ZXJ A;  5CLS A;  4KDP A;  4MTE A;  3CUQ B;  3GW2 A;  5JR3 A;  3KP3 A;  4AWX B;  2DPD A;  4LLN A;  4OIO F;  1I6X A;  2M30 A;  2YU3 A;  4M71 A;  3FX3 A;  5E1W A;  3F72 A;  1R5H A;  2RN7 A;  4XLN F;  3IL2 A;  4E70 A;  3FMS A;  1FLI A;  1FP2 A;  3P9C A;  3ML6 A;  2HS5 A;  4BXU A;  4PCQ A;  3LA2 A;  1BIA A;  5F1R A;  2EJR A;  4RGS A;  2DTR A;  2HKO A;  2OAZ A;  1QBJ A;  4L0Y B;  2BGC A;  4A0X A;  4CXF A;  4HBL A;  2EV5 A;  1R5G A;  3EQL F;  1LEA A;  3BWG A;  3W6K B;  3H3Z A;  3F21 A;  1EH6 A;  3C7J A;  2EFN A;  1EV7 A;  4S05 A;  4IHS A;  1MJA A;  2M45 A;  3BZ6 A;  4IF4 A;  5E17 F;  3IRQ A;  3MQ0 A;  2UXN A;  5DV5 A;  2CSO A;  5D5U B;  4BAY A;  1X3U A;  3J80 Z;  2W57 A;  2F5F A;  1BI0 A;  2EFQ A;  3GZ5 A;  4IPA A;  1QO0 D;  1FSH A;  1O3Q A;  1O7L A;  1ZGA A;  4P9F A;  3WE3 A;  1XCV A;  4MQV A;  1T39 A;  2QBY B;  2XV4 S;  5H6R A;  3BY6 A;  3ZP5 A;  4BQA A;  2LKP A;  1K79 A;  4EM0 B;  2QQA A;  3WGI A;  1AOY A;  1DUX C;  2FML A;  2GAU A;  4GCV A;  2IA0 A;  5E8I A;  2F2E A;  2F5D A;  3JTG A;  1DDN A;  3V7S A;  3N4M A;  1C0W A;  2BEO A;  1I27 A;  2HWV A;  2Z5U A;  2DU9 A;  2H6B A;  3E5X A;  4L5I A;  1ONV A;  1XSV A;  5D6F A;  1BJA A;  3ECH A;  4KIC A;  3D0S A;  3ECO A;  4MHG A;  4OMY A;  2L02 A;  4MNU A;  5EEH A;  1K78 A;  2PBI A;  5CVU A;  3SHF A;  5KK1 A;  1R58 A;  3KLO A;  2P8T A;  2VOP A;  5FLX Z;  1HKQ A;  4JQF A;  5L3D A;  5ICG A;  1FBQ A;  2JT1 A;  2ZO4 A;  2A5Y B;  1P4W A;  2E1C A;  4HX8 A;  1SD6 A;  1U5T B;  4HF1 A;  4EJV A;  2RGV A;  2HEO A;  3PFI A;  3F8N A;  1XN7 A;  2HQR A;  3C18 A;  3I59 A;  5LBQ A;  1K78 B;  2EFO A;  2R7D A;  2RKH A;  4YFX F;  3RKX A;  2IRF G;  5LEK A;  4ENK A;  1UHM A;  2XGX A;  5K1Y A;  3P7N A;  1JE8 A;  3I58 A;  2QLZ A;  1ODD A;  2ZNZ A;  3Q9V A;  4Y15 A;  1ZRE A;  2XVC A;  3NRV A;  1FZP B;  4GYI A;  4YIF A;  1VTN C;  1SMY F;  2HGC A;  3LA7 A;  2ESN A;  4I0B A;  3GYH X;  2JSC A;  3P9I A;  1GVJ A;  1T2K A;  1RUO A;  1I1S A;  1B9N A;  1REP C;  2CWE A;  1ZLK A;  1S29 A;  1XGN A;  1HKT A;  3RKW A;  2Z99 A;  3R6S A;  4HLY A;  2PFB A;  3K0L A;  4EM1 A;  5J6X A;  4ENJ A;  2UXX A;  5CJ9 A;  5DUI A;  1OKR A;  1IUY A;  4O3M A;  1T38 A;  4AIJ A;  1YS7 A;  2Y0M A;  4G94 A;  3H3U A;  3TQN A;  1ZH5 A;  4P55 A;  3FWE A;  2Z9O A;  3G73 A;  3WG9 A;  5ICC A;  3E6C C;  1W5S A;  5DCF A;  3U2R A;  2A68 F;  3PQJ A;  3N97 A;  2MA3 A;  3HYI A;  2FSW A;  4XRF A;  3GXO A;  2JPB A;  5BPI A;  1XCB A;  1MDM A;  4RAY A;  3RI4 A;  3ZMZ A;  1WQ2 A;  2WC2 A;  4WX9 A;  4WF2 A;  4HDV A;  1G4D A;  4LJZ F;  3ZMT A;  2ZCW A;  3HSR A;  2A6H F;  2MH2 A;  3RYP A;  1LDK B;  2GXB A;  2DK8 A;  3LQQ A;  4A5M A;  2FU4 A;  1LVA A;  4CHU A;  5ED4 A;  3ZN0 A;  4ZYH A;  4ZZD A;  2D1V A;  1W4M A;  1IXC A;  2Z3Y A;  3RYR A;  1FBU A;  1YO5 C;  4WXH A;  1HSJ A;  1MJ9 A;  3SZP A;  2K7L A;  2EB7 A;  1U5T C;  3WTS C;  1FNN A;  3WU1 B;  4EV0 A;  1TNS A;  2W85 A;  4H0E A;  1BOA A;  3K9T A;  4RGR A;  4OIR F;  4DNC A;  5HLG A;  1R00 A;  2ESH A;  1BC8 C;  1SFU A;  3V8J A;  2O6G E;  4A5N A;  4EQQ A;  1YW7 A;  3MFK A;  3RJP A;  3F6O A;  5K5Q A;  1JXS A;  5HDN A;  4KNY A;  4WXC A;  2HOE A;  3TO9 A;  2DLL A;  5FD6 A;  1HST A;  1IN8 A;  1KYW A;  4KUM A;  4S04 A;  1ZGJ A;  1FWZ A;  1UB9 A;  2GWR A;  4YFK F;  2FNA A;  1ZRF A;  5CVR A;  1G3T A;  2JTV A;  1BI3 A;  4CZZ A;  4RB2 C;  2L4M A;  3BJA A;  1J2X A;  5LLQ A;  4M9Z A;  1FPQ A;  5JI6 A;  3C3W A;  4L5J A;  5AIP A;  2FMY A;  2HDC A;  2FQ3 A;  3FM3 A;  4AIH A;  3ABT A;  4ESB A;  2FF4 A;  3EUH A;  5LHH A;  3ELK A;  4A6E A;  1DPR A;  1TW2 A;  2KIM A;  1LJ9 A;  3KZY A;  2C6Y A;  3SQN A;  3HRT A;  3RTR A;  2ACJ A;  3JAM K;  2ZME B;  1IN7 A;  3DV8 A;  2W25 A;  2EV0 A;  2RQP A;  2UWM A;  5AON A;  3J80 K;  4UVB A;  2VT3 A;  4N0B A;  4OMZ A;  2ZFW A;  3I0T A;  2OQG A;  5D4S A;  1CGP A;  1IZ1 A;  1QGP A;  2XAH A;  3B02 A;  3JTH A;  5FFX A;  1XGM A;  4XSX F;  1SFX A;  3S2W A;  2CQK A;  2V1D A;  2J5P A;  1LDJ A;  4FHT A;  3HOS A;  1YW8 A;  2O61 A;  3E97 A;  2DAO A;  2RVC A;  4WK8 F;  4TV7 A;  1R22 A;  3F6V A;  2PI0 A;  2R3S A;  1CF7 B;  3K1N A;  3BPX A;  1UFM A;  2M5W A;  3GZ6 A;  1YW9 A;  1FT9 A;  4R8H A;  1U6G A;  4KN7 X;  5FD5 A;  2BYV E;  2VBX A;  2W24 A;  2YR2 A;  1O57 A;  4G7Z F;  3R0A A;  3ULQ B;  1P6R A;  1G3W A;  1ZG3 A;  2GZW A;  5KVR A;  1UCR A;  2FE3 A;  5ILS A;  3EET A;  4JBA A;  1TNT A;  4HX4 A;  3E6M A;  3IKT A;  2FNP A;  4B8X A;  2H27 A;  1IRF A;  4DQ2 A;  2OA4 A;  3DQV C;  3FMR A;  2KIF A;  2VN2 A;  3FF5 A;  3WTW C;  4RB0 A;  4NQW A;  1J59 A;  1IN4 A;  3RDI A;  3T1B A;  3IC7 A;  4KIF A;  2M87 A;  2RV8 A;  2CO5 A;  1W7P B;  5H6Q A;  3OV8 A;  2NAZ A;  4LMY A;  1J0R A;  2MC3 A;  2FOK A;  3WOD F;  3CTA A;  2KJB A;  3VOE A;  2P7V B;  3V4G A;  2RDP A;  2QBY A;  1KQ8 A;  1DP7 P;  4ENN A;  4IXA A;  3P9K A;  1Z7U A;  4HZF A;  2EFW A;  1EH7 A;  1JHF A;  4ON0 A;  4OIP F;  1OYY A;  4ESF A;  3KP5 A;  5J8F A;  1FBS A;  1O3T A;  1HBX G;  4BYY A;  2O03 A;  1F4K A;  1IN6 A;  5DDG A;  1R1V A;  4CGZ A;  3M8F A;  1P4A A;  5DCM B;  2F5E A;  2K86 A;  3HUG A;  2O0Y A;  2X0L A;  5L3E A;  2CW0 F;  3COA C;  2L54 A;  5E18 F;  3B73 A;  1WSU A;  2DFI A;  2L4A A;  2E7W A;  3TDZ C;  3WTV C;  2O3F A;  3WTZ A;  3O2P E;  5F64 A;  3CUQ C;  1FP1 D;  2A69 F;  4UUV A;  3G3Z A;  1NHA A;  4FT8 A;  4AD9 A;  3NEU A;  3RKY A;  2GQQ A;  4U0W A;  5LRS A;  2MH9 A;  4L9T A;  3V7C A;  4ZYE A;  3RPU A;  1IN5 A;  1OR7 A;  2MD5 A;  3HSE A;  2FBK A;  4QWQ A;  1SAX A;  2Z33 A;  1E17 A;  2K4B A;  2RNJ A;  3HSF A;  3JAM Z;  2X4H A;  3L09 A;  1E2X A;  3VB2 A;  3KCC A;  1GHC A;  4EMS A;  5A2Q Z;  4HLX A;  2GA1 A;  2QEN A;  2XAF A;  2MLK A;  5IT3 A;  2K4J A;  2EA4 A;  4BH9 A;  3TKY A;  5CVI A;  5HS9 A;  2GA2 A;  2HQN A;  2YX4 A;  3HOT A;  3WE2 A;  1KU7 A;  4PGH A;  3KEO A;  4N9I A;  1B1B A;  4HF2 A;  3T5X A;  2P6T A;  2K27 A;  4KT5 C;  3IWF A;  3DXJ F;  1BBY A;  5E8G A;  4M72 A;  2BV6 A;  5CYV A;  3QAH A;  1F5T A;  1Z9C A;  1TBX A;  1YQA A;  4P96 A;  5AIQ A;  3HTU A;  3LA3 A;  4HW0 A;  3TDU C;  2RC4 A;  4EJT A;  2IP2 A;  2QVO A;  2LF8 A;  5HDK A;  3LAJ A;  4EGZ A;  2H6C A;  2Y48 A;  3KET A;  3MCZ A;  4UV9 A;  1QNT A;  1LEB A;  2VT2 A;  1QQI A;  3ABU A;  2A07 F;  3DKW A;  4IRI A;  4RB1 A;  3F8B A;  4I01 A;  3WTX C;  1KU2 A;  2IA1 A;  2IJL A;  2QQ9 A;  4LGW A;  1ZAR A;  3DF8 A;  1B6A A;  2OZ6 A;  4WXD A;  3CUO A;  2M1B A;  2ZNY A;  3MEX A;  1A04 A;  1SFE A;  3MAJ A;  2P6S A;  4LD5 A;  1JGS A;  1J7K A;  2F5C A;  1B4A A;  1H0M A;  1W7P D;  3VFZ A;  4M6Y A;  1PP8 F;  1ZG5 A;  1Z6T A;  4D0P A;  1TW3 A;  3FM5 A;  1IAW A;  2XAQ A;  3BJ6 A;  2DQL A;  2VC0 A;  2WTE A;  4OIN F;  2XAJ A;  1KQ0 A;  1U3E M;  5H20 A;  2VBW A;  2YPR A;  3HRS A;  3O6B B;  1WI9 A;  3FXU A;  2VE9 A;  4LB6 B;  1AWC A;  1YIO A;  3HHH A;  2P5V A;  1TTY A;  2HYG D;  4N9H A;  3WGH A;  4LLG F;  4MTD A;  4LK0 F;  1IXR C;  3CJN A;  2V1X A;  2H09 A;  1HXD A;  4HOB A;  1GXP A;  1ZAO A;  4U7B A;  3LAP A;  2BE5 F;  2R7F A;  1YLF A;  3Q9S A;  1V4R A;  2BBY A;  4OOI A;  3FMQ A;  3GFM A;  3WU0 A;  4FX4 A;  5E1Z B;  3JW4 A;  4LFU A;  1WRJ A;  4IRH A;  3DEU A;  4EJW A;  1T0F A;  5L3C A;  3M1E A;  3T8R A;  2JRT A;  3KP6 A;  5J8C A;  3E5Q A;  2XKP A;  2DW4 A;  3WTT C;  3QRF F;  2VE8 A;  1TQP A;  5FLX K;  2COM A;  2OBP A;  3GVA A;  3WTY C;  1Q1H A;  2PQ8 A;  3E5U A;  4KMU X;  4Q47 A;  5LEJ A;  4B09 A;  4U0V A;  1B59 A;  1GXQ A;  2OZU A;  3E6B A;  4KN4 X;  3U9G A;  3IRR A;  3LFK A;  4AVP A;  4K2E A;  2AS5 F;  4Q48 A;  5BQT A;  1D8J A;  3TO7 A;  2DQR A;  1QZY A;  3DPT A;  1PDN C;  2VXZ A;  4G7O F;  1U2W A;  2D1H A;  1S8N A;  2VBY A;  1LQ1 A;  3KE2 A;  4WCG A;  5LGN A;  3LQR A;  2IVM A;  1U5T A;  3V8K A;  5LHG A;  1F9N A;  3GFL A;  4MEY F;  4XBF A;  1YYV A;  2KKO A;  5K5O A;  4QLC U;  4HAM A;  2PEX A;  3F8M A;  1FOK A;  4OIQ F;  3OOP A;  1UHW A;  1QZZ A;  5DD4 A;  4MGR A;  3JSO A;  6PAX A;  4UHT A;  5DCM A;  2DPU A;  5BOX A;  2WWY A;  2PG4 A;  3BRO A;  1S3J A;  4U7D A;  1KU9 A;  4L0Z B;  3Q5F A;  2PN6 A;  2YSR A;  1KQ9 A;  4PZJ A;  2FEZ A;  3F22 A;  1O3S A;  4YII A;  3ZMV A;  2HTJ A;  1W5T A;  1S7O A;  4LG0 A;  2XIG A;  2FBI A;  1STZ A;  3RIR A;  3KP7 A;  2XRN A;  5ERI A;  4I0A A;  3WGG A;  4UV8 A;  3RPQ A;  3HRM A;  3CO6 C;  1LDD A;  1P2F A;  2FBH A;  5HDG A;  4L18 B;  4NHJ A;  1OMI A;  2Q0O A;  1SD7 A;  3MWM A;  3BDD A;  1UST A;  4IHT A;  3L9F A;  2IPQ X;  5LRR A;  3MZH A;  5BMZ A;  1I1G A;  5DUK A;  2HKX A;  5L3G A;  1HW1 A;  3E3V A;  2W84 A;  4P9U A;  4Z2Y A;  5BS6 A;  5TJJ A;  4XSZ F;  3QOP A;  2Y75 A;  3JSP A;  2IT0 A;  4CDG A;  3GO5 A;  2HTS A;  2GIV A;  2DO7 A;  1XD7 A;  3ERE D;  1RUN A;  2A3S A;  3TOA A;  2QM3 A;  4MQ9 F;  2EA2 A;  4GO1 A;  1MZB A;  3WTU C;  1I5Z A;  2Q2E A;  5HS7 A;  5F6F A;  4O6J A;  5FO5 A;  1MKM A;  5K5R A;  2KRF A;  2P5L C;  4KIB A;  5LGU A;  3GLX A;  3ZN1 A;  5TRD A;  3F8C A;  4BNC A;  4I02 A;  2LNB A;  3M9A A;  1BI1 A;  3KEQ A;  3ZQ7 A;  4KYW A;  3LWF A;  2EV6 A;  1ZYR F;  3CO7 C;  1R1T A;  3ZMU A;  2G7H A;  4KA4 A;  1YG2 A;  3QP6 A;  3W6J B;  2IW5 A;  1OYI A;  4G6D A;  2DBB A;  2XKO A;  1P92 A;  1ON1 A;  2YX7 A;  2JPC A;  4HA8 A;  3I4P A;  1RZ4 A;  1RNL A;  1S6L A;  3QU3 A;  1XB4 A;  3K69 A;  3CUQ A;  1RI7 A;  2ADU A;  1L0O C;  4PDK A;  1YS6 A;  1KYZ A;  3TGN A;  1KA8 A;  3GWZ A;  1KGS A;  3T8T A;  4M73 A;  4EM2 A;  1IRG A;  2OU2 A;  5L3F A;  2ISZ A;  4HV6 A;  4Y17 A;  1TQI A;  2ZKZ A;  3BPV A;  3SZT A;  1G3S A;  2VC1 A;  4A6D A;  3R61 A;  1ZHF A;  4OU0 A;  1XSD A;  3FXR A;  4I2O A;  1XMA A;  4HYE A;  5L3B A;  5DYM A;  2QQB A;  2L3D A;  3HIF A;  4BHP A;  1O7F A;  4L9J A;  5D8K B;  3ISP A;  3C1D A;  5D5V B;  1S7A A;  1OPC A;  3IHU A;  1Y0U A;  3K2Z A;  4M6X A;  4PGG A;  2V1U A;  3I5U A;  1FY7 A;  2A61 A;  3GFI A;  1R1U A;  2NS0 A;  3BOQ A; 
#chains in the Genus database with same CATH topology
 2DA4 A;  3K10 A;  1Z1D A;  4CCO A;  1Y1W J;  4I98 B;  2E60 A;  1LNW A;  1YTY A;  4KMF A;  4IKF A;  1FSE A;  1L3L A;  2AXT C;  2RAE A;  5FKL A;  5BPD A;  2PLY A;  1JUM A;  5FGM A;  1F1Z A;  1D8K A;  4RGU A;  3PL8 A;  1FYM A;  3A02 A;  3PQK A;  2NYX A;  4LLL A;  1VQ9 I;  1QZE A;  1OYW A;  1EKE A;  1RKW A;  1D1B A;  1NH3 A;  1SAU A;  3R0J A;  4I7H A;  2DK5 A;  3ZQG A;  1E0E A;  4EGY A;  3KEY A;  5D4R A;  2OQR A;  4BU2 A;  2WV0 A;  1WKM A;  4RA2 A;  4RB3 C;  2A6T A;  4UNO A;  2FRH A;  4HDU A;  3FBI B;  3I64 A;  1JTX A;  2HI3 A;  3F23 A;  1Z0X A;  3K1P A;  5IOZ A;  2TRT A;  3CDH A;  3JCU C;  4RM3 A;  4DZP A;  1I3Q J;  3D5L A;  3ZPL A;  2R93 J;  3IAS 2;  3ZQL A;  2D2W A;  4CCJ A;  1FYK A;  1YFH A;  3PNT A;  4IQJ A;  2XRO A;  3H9J A;  2R0Q C;  4ZYG A;  4KFC A;  4ZDP A;  3LST A;  1H88 C;  2KQR A;  2R5Y A;  1ZLJ A;  5ICF A;  4U87 A;  3A1Y A;  3VEP A;  5LHI A;  4UXN A;  1D3Y A;  1HQC A;  4CO8 A;  2V4J C;  4CYD A;  5IYD J;  2CG4 A;  4ZH4 F;  1PUE E;  5E1X A;  1HLV A;  2XSJ C;  4YG2 F;  2R7X A;  4DGW B;  5CQE A;  3F3X A;  2HXO A;  3HRU A;  2JZY A;  2XAS A;  1XSX A;  5ICE A;  4EEF G;  3H92 A;  2VOO A;  2L01 A;  2QSG X;  1ON2 A;  3LMM A;  9ANT A;  1Z3X A;  1XMX A;  4HX7 A;  3BQZ A;  3I71 A;  4RAZ A;  1WJC A;  5JHF A;  3GEZ A;  4YIR X;  3NWT A;  2CGP A;  3IH4 A;  1U9N A;  4UB8 C;  1TZL A;  4FX0 A;  2RQQ A;  4G8X A;  4Q4Z F;  5ILV A;  1IV8 A;  3CC4 I;  1KON A;  4HV5 A;  5D5W B;  1O3R A;  1G2H A;  1MMD A;  1R4N B;  2QWW A;  1J5Y A;  4BQO A;  2LF7 A;  2PMH A;  2LSO A;  2VQC A;  4GXO A;  2DDA A;  2BVL A;  2HDW A;  1RRJ A;  1U78 A;  1K83 J;  4KIS A;  4AID A;  1WCM J;  4O5V A;  3GF2 A;  2QYO A;  1Z6R A;  3HTS B;  2XPV A;  4BHC A;  1D1C A;  5DD8 A;  2EFP A;  4BAC A;  2X6Y A;  2E1O A;  2P7C B;  3DPL C;  5IT9 K;  1PP7 U;  3TED A;  2G9W A;  3WHC A;  3LSK A;  2JK3 A;  4RS8 A;  1NG6 A;  2V9P A;  1X2M A;  4OAZ A;  3OYE A;  2NNN A;  1WH5 A;  3KP4 A;  4J19 A;  1WH7 A;  3C2H A;  3F8F A;  3G1M A;  4IOA F;  3IAM 2;  2VIX A;  4ETS A;  3L00 A;  1P7J A;  1U8R A;  5DEQ A;  2IGO A;  4U0Y A;  3L7W A;  2HOA A;  3REO A;  4HST A;  1Z21 A;  3J7A O;  1J75 A;  4PJ0 C;  1QHH D;  2VJ5 A;  2HFH A;  3E6D A;  1DP3 A;  2D45 A;  4E7Z A;  3BTC A;  3SDB A;  3J7Z I;  5E3O A;  4EVI A;  2DCE A;  1K4T A;  2LYC A;  2IGN A;  2EZK A;  1RES A;  3ABL H;  2VQG A;  2EK5 A;  4LB5 A;  3I54 A;  1K6O A;  3G2B A;  4IVN A;  3IP4 B;  2NVT J;  2J5O A;  4FIS A;  4G9Y A;  3A01 A;  5IP9 J;  3IWZ A;  3R60 A;  1XGS A;  1S7E A;  4IRG A;  4P5O A;  1T98 A;  2B0L A;  1BW6 A;  4DBR A;  4NBQ A;  5LGT A;  1F36 A;  2M4K A;  2VB6 A;  3BR5 A;  1FJL A;  1ZRD A;  3GTP J;  2QUF A;  2LKS A;  3EYY A;  4QIW N;  3S17 J;  4IHV A;  1Q1V A;  1W0T A;  1G3Y A;  5HVQ C;  2LKX A;  1BC7 C;  2ZME A;  1PVE A;  2XB5 A;  5GAG J;  5HLH A;  1ZRC A;  1R9T J;  1HW2 A;  1X1B A;  5HS8 A;  1FOY A;  2HYJ A;  2XHK A;  4M9S A;  3GUD A;  2H94 A;  3O3K A;  1BI2 A;  2AXL A;  3D5S C;  3HHG A;  1HKS A;  2ME0 A;  1TQM A;  2HU9 A;  4ESJ A;  2XUB A;  3OWT A;  5JFR A;  3AAF A;  3QU6 A;  1B9M A;  2ELK A;  2ELH A;  3S1M J;  2DT5 A;  5EYR A;  4ZZL A;  4XL9 A;  1A31 A;  3KZI C;  4RGX A;  2L7M P;  3SYT A;  5HLI A;  4Y13 A;  3L1P A;  1G6N A;  2LY1 A;  1W7P A;  4N4O B;  2NNY A;  3K4N A;  2WV1 A;  2STT A;  4ENM A;  1XPX A;  3FHZ A;  2Q8K A;  3I59 B;  4GYG A;  3TO6 A;  4HF0 A;  4UVC A;  4B44 A;  4A3D J;  2FXA A;  3M8E A;  4YFN F;  1E3O C;  1Y0N A;  1P4X A;  4HQM A;  2VKE A;  4IJA A;  4V2F A;  2KIU A;  3DFG A;  4D5C A;  1A5J A;  3V7R A;  1BIB A;  3PUB A;  3TP0 A;  3KYC B;  1IRX A;  5D6E A;  4EJO A;  1SD5 A;  2DI3 A;  3CZ6 A;  3OYD A;  4F7Z A;  3GX4 X;  1N78 A;  1QPM A;  2QQ8 A;  2DA2 A;  3MZY A;  1X4P A;  2CS3 A;  4G6Q A;  2VON A;  3DBR B;  1SD4 A;  4NB5 A;  2L7F P;  3NQO A;  2FA5 A;  3CMM A;  5IT9 Z;  5JVT A;  3HKZ A;  3I4M J;  2NOJ B;  4LK1 F;  2COB A;  1SVO A;  2ZBK A;  1FOW A;  3G1L A;  2MGQ A;  5DM7 F;  3OYA A;  1TP4 A;  5EDN A;  1H9T A;  1ZG1 A;  3ZMS A;  2HXI A;  4M3G A;  3BP8 A;  2HQA A;  1T33 A;  1D5V A;  4PK4 A;  5FRM A;  3QPH A;  3I3L A;  2M8E A;  2XSD C;  2KMU A;  2A6E F;  2DT7 B;  1YX3 A;  1JGG A;  4A3F J;  2CFX A;  2MD0 A;  1DPU A;  2IA2 A;  4XLP F;  1EH8 A;  2L0K A;  1ITY A;  3I9V 2;  2PJP A;  2VQH A;  3U1D A;  2XF6 A;  4LG0 B;  5KNL A;  3SJM A;  3WHB A;  2DMN A;  5D5X B;  1K7A A;  4XQF A;  2NRA C;  3BG3 A;  1WHU A;  2X51 A;  4C9Y A;  4AIK A;  1Y6I A;  2E1N A;  2OCE A;  4CIC A;  1J9I A;  4I09 A;  4A0Y A;  2LDU A;  4Y33 A;  4A3J J;  4M9X A;  4R1H A;  4DOZ A;  2G7U A;  1ZN2 A;  2V79 A;  4HQE A;  2IS2 A;  2YU9 J;  1R23 A;  4XID A;  1FYL A;  5IOY A;  3A01 B;  3JRH A;  3SFZ A;  3MD2 A;  3JRG A;  2UZK A;  3QWL A;  4ZYD A;  5A2Q K;  2ISY A;  3LSI A;  3SXY A;  3DU6 A;  3FZV A;  1CF7 A;  4BHB A;  2V6C A;  1ULY A;  4KIG A;  2LY9 A;  1LFB A;  4OAY A;  3RQ4 A;  5CVJ A;  3R4K A;  4NC8 A;  3ZOB A;  4ZDO A;  1R36 A;  2QZ8 A;  2N8G A;  4XN3 A;  2R7T A;  4D1Q A;  1G59 A;  1IW7 F;  1SMT A;  3V42 A;  4R79 A;  4IZZ A;  5GPA A;  2R7W A;  1GUU A;  2HYF A;  4A2U A;  5GTH C;  3MKW B;  3KP2 A;  1TLH B;  3KFW X;  3TOB A;  1MD0 A;  2X6W A;  1BM9 A;  4EJU A;  1UG0 A;  3KIO A;  4M3B A;  3V8L A;  1VQL I;  3L2C A;  3AG2 H;  4XOP A;  1XGO A;  4A12 A;  5FFZ A;  3OYJ A;  1MNE A;  3I53 A;  5M3F J;  3DP7 A;  5ILU A;  5EEG A;  1ZQ3 P;  1VZ0 A;  5JHU A;  1LB2 A;  3CCR I;  4F93 B;  3OSF A;  2JQ7 A;  1JHH A;  2XB0 X;  3QPT A;  3T0Y A;  3ROU A;  2K02 A;  4JK1 X;  5DS9 A;  3GFJ A;  3Q0V A;  2GOM A;  1OCP A;  2V9V A;  4GGG A;  1TT0 A;  4D5F A;  3CLO A;  3OIQ A;  3HOX J;  2ELJ A;  4CCK A;  1V3F A;  2HR3 A;  3KZZ A;  1BN5 A;  3SEQ A;  2R4G A;  1Y1V J;  3S16 J;  1FIA A;  1FX7 A;  5EGO A;  1MDM B;  2EWN A;  3AKZ A;  2QKL B;  5FB2 A;  1T6S A;  1WWX A;  5E20 A;  5LFA A;  1E3H A;  1WGX A;  5M5Y J;  2VOD A;  4B48 A;  2KIS A;  2VBZ A;  1FTT A;  2K3P A;  2E34 A;  2OD5 A;  1MBE A;  2H8W A;  3ZRG A;  2GXG A;  1Z05 A;  4E7I A;  2ZJ2 A;  2CQ7 A;  2VQL A;  2E7X A;  2VAS A;  2PMU A;  1XMK A;  3BJO A;  1USS A;  3G4S I;  5KCM A;  4UVA A;  2P4W A;  3CCV I;  1NK3 P;  3VOD A;  1KU3 A;  4RLQ A;  2OTJ I;  3ZGK A;  1MBJ A;  4MEX F;  1WZ2 A;  2MLG A;  1Z91 A;  2ETH A;  1HW5 A;  3J81 Z;  1MGT A;  2XAU A;  2P5K A;  1GV5 A;  4Q5S F;  1Z67 A;  1KZH A;  1TWA J;  3FXQ A;  5D8L B;  5GAH J;  1RIO H;  3J81 K;  3BTL A;  5EJC A;  5KHD A;  1FC3 A;  2KJC A;  4I76 A;  2O8X A;  3QP5 A;  3ZMD A;  1P9Q C;  3EDP A;  2FQ4 A;  3CLQ A;  2L9V A;  5GAE J;  2CYY A;  4XKC A;  5HOO A;  2M3A A;  2HDD A;  1MJB A;  2CQN A;  3FKI J;  2A5W A;  3M7G A;  4HEA 2;  4A0Z A;  3OS1 A;  2R7S A;  4J01 A;  1R7J A;  3KLN A;  4ASN A;  2TDX A;  1EF4 A;  2XAG A;  2HZT A;  1X1C A;  3H3V K;  1EJ9 A;  4M74 A;  2ID6 A;  1HC8 A;  2BOL A;  3IKV A;  4L9V A;  1XS9 A;  4L9N A;  3AL0 C;  3QYB A;  3HXL A;  3EUA A;  3K1M A;  2MBF A;  4WWC A;  4U88 A;  3CDL A;  4IHW A;  3EYI A;  3DPU A;  1H9G A;  3ZR8 X;  1FEX A;  1IF1 A;  1YIJ I;  1XDS A;  4UUS B;  1AKH A;  1XDU A;  4G7H F;  2STW A;  3CCJ I;  5CVV A;  1IXS B;  2ZXJ A;  5CLS A;  4KDP A;  4MTE A;  3CUQ B;  3DWL E;  3GW2 A;  5JR3 A;  3KP3 A;  2BY0 A;  4AWX B;  2DPD A;  4LLN A;  4HPQ A;  4OIO F;  4MFD A;  1I6X A;  1IJW C;  2M30 A;  3L2R A;  4PJL A;  4E7H A;  4NDL A;  2YU3 A;  4M71 A;  3FX3 A;  2R7U A;  5E1W A;  1OR7 C;  1ORK A;  3F72 A;  5J47 A;  4IQ4 A;  1R5H A;  2RN7 A;  2BY3 A;  4XLN F;  3IL2 A;  2HVQ A;  4E70 A;  2F4O B;  1X2N A;  2L2O A;  5TIS C;  4XOR A;  1T08 B;  2IGK A;  3FK6 A;  3FMS A;  1FLI A;  1FP2 A;  3P9C A;  1XG1 A;  4E6K G;  3ML6 A;  2HS5 A;  2XPU A;  4BQQ A;  2JVG A;  4BXU A;  4LIU A;  4PCQ A;  3FXO A;  3LA2 A;  1BIA A;  3AL0 B;  5F1R A;  2EJR A;  4RGS A;  1I39 A;  3IH3 A;  2DTR A;  5BNG A;  2HKO A;  1H89 C;  2OAZ A;  2ZSI B;  4F55 A;  4GDF A;  1QBJ A;  2M8G X;  2LK2 A;  2XGD A;  4L0Y B;  2VPR A;  1OCT C;  4FQG A;  2BGC A;  4A0X A;  1RKT A;  4CXF A;  4HBL A;  2CU7 A;  2EV5 A;  3PNV A;  1R5G A;  3EQL F;  1W36 C;  5KAF C;  5GTI C;  1LEA A;  2OPT A;  3H1C A;  3BWG A;  3W6K B;  3H3Z A;  3F21 A;  1EH6 A;  3C7J A;  2EFN A;  3OYN A;  3VPR A;  5GP9 A;  1ZGW A;  1YJ9 I;  1EV7 A;  2KIQ A;  5HOD A;  4CCN A;  4S05 A;  4IHS A;  1MJA A;  2M45 A;  3BZ6 A;  4IF4 A;  3HUG B;  4CSW A;  5H2F C;  2R5Z A;  3IRQ A;  3MQ0 A;  2MG4 A;  1LFU P;  2UXN A;  4BBS J;  5DV5 A;  1MW7 A;  2CSO A;  4GFB A;  5D5U B;  4BAY A;  4ZTF A;  1X3U A;  2X48 A;  3J80 Z;  5E3M A;  2W57 A;  1MBF A;  3K4J A;  1VQM I;  1HF0 A;  4IHX A;  4IO9 F;  2F5F A;  3RZO J;  1BI0 A;  2EFQ A;  2QCO A;  3KX2 A;  2HOT A;  3GZ5 A;  3ZQF A;  4IPA A;  2XF7 A;  1QO0 D;  1FSH A;  3P5J A;  2KDO A;  1A6Q A;  2CH0 A;  2KRC A;  2VJJ A;  1O3Q A;  1O7L A;  1ZGA A;  4P9F A;  3WE3 A;  1XCV A;  4HNT A;  2JRM A;  4MQV A;  4CH7 A;  1NK2 P;  1QU3 A;  5HLT A;  5J4Y A;  3KYL A;  2EIJ H;  1T39 A;  2QBY B;  4BXX J;  2YS9 A;  4QSH A;  2XV4 S;  3W3C A;  5H6R A;  3H0G J;  3BY6 A;  2EBI A;  3ZP5 A;  3BG6 A;  2QEX I;  2NVQ J;  2EPF A;  2W1O A;  4BQA A;  2LKP A;  1YX5 A;  5J40 A;  4IHY A;  1K79 A;  4A3K J;  4EM0 B;  2QQA A;  3WGI A;  3GTL J;  1BJZ A;  1IV6 A;  3BQY A;  1AOY A;  1DUX C;  2FML A;  1MSE C;  2E19 A;  3GZN B;  2GAU A;  4GCV A;  2IA0 A;  5E8I A;  4XK4 A;  2DA7 A;  2F2E A;  1YRN B;  2F5D A;  2WY8 Q;  4NQW B;  3JTG A;  4BE2 A;  1DDN A;  2RRE A;  3V7S A;  3N4M A;  2Q2E B;  3JR9 A;  2K85 A;  3TP3 A;  3S1N J;  3F9K A;  3CD6 I;  4JOM A;  3CMA I;  1C0W A;  2BEO A;  3LSJ A;  4M3E A;  3ZQI A;  2W4S A;  1I27 A;  2HWV A;  3U21 A;  2R7V A;  3Q3S A;  2Z5U A;  2DU9 A;  4II2 A;  4Y52 J;  2H6B A;  3BTI A;  3E5X A;  4L5I A;  1ONV A;  1XSV A;  4ZTJ A;  1FTZ A;  5D6F A;  3IV5 A;  1BJA A;  3AG3 H;  3ECH A;  3HOU J;  2VJI A;  2EIM H;  3D0S A;  4KIC A;  2LTP A;  1ZKG A;  3ECO A;  4MHG A;  2XF5 A;  4PSX A;  3J7Y J;  3CCM I;  1TL8 A;  1MH4 A;  2L02 A;  4MNU A;  5JLW A;  4OMY A;  2DFF A;  5EEH A;  4BDY A;  1K78 A;  1D5Y A;  2PBI A;  5CVU A;  3SHF A;  5KK1 A;  1R58 A;  3KLO A;  2P8T A;  5F0H A;  2VOP A;  4E4H A;  2DOD A;  3BR1 A;  4ABZ A;  1FIP A;  5FLX Z;  1PUF A;  2EQR A;  1HKQ A;  4JQF A;  1IUF A;  4XLH A;  5L3D A;  5ICG A;  1FBQ A;  2JT1 A;  3Q0W A;  4XM3 A;  2ZO4 A;  2VLA A;  4AYB N;  1OLT A;  3IH2 A;  2A5Y B;  1HDD C;  1P4W A;  1A6I A;  2Y31 A;  4HX8 A;  4XLE A;  5K7Z A;  3DBH B;  2E1C A;  1SD6 A;  2IS1 A;  4HG2 A;  1U5T B;  4HF1 A;  1S72 I;  4EJV A;  3JRC A;  3NWS A;  2RGV A;  2Y0S N;  2HEO A;  2BW3 A;  1BOB A;  3KPH A;  3PFI A;  2VL8 A;  2HVR A;  3VWB A;  3VYU B;  3S93 A;  3F8N A;  1XN7 A;  4BE0 A;  4QPO A;  2HQR A;  2VKH A;  4A69 C;  3C18 A;  1VI0 A;  3I59 A;  2Y0S A;  5LBQ A;  1K78 B;  2EFO A;  2EIK H;  4HSR A;  2R7D A;  3S1R J;  4A3L J;  3BG9 A;  4KJZ A;  4F52 A;  4PSW A;  1VF9 A;  2RKH A;  4XKB A;  4XKW A;  4YFX F;  2Y9Y A;  1SFK A;  3RKX A;  3KYD B;  2IRF G;  5LEK A;  4ENK A;  1UHM A;  1ETO A;  2K9M A;  4MFE A;  2XGX A;  3RKQ A;  3B6C A;  3AG1 H;  5K1Y A;  3P7N A;  2VI6 A;  3F0C A;  3QOE A;  1JE8 A;  2WA0 A;  3I58 A;  2QLZ A;  5FRO A;  1ODD A;  2W48 A;  1OQY A;  2ZNZ A;  3Q9V A;  5B66 C;  4Y15 A;  1ZRE A;  2A05 A;  2XVC A;  3NRV A;  1FZP B;  4GYI A;  2NS7 A;  4YIF A;  3ASO H;  2I10 A;  1VTN C;  1W5C C;  1SMY F;  2HGC A;  3LA7 A;  3PJR A;  3CF2 A;  4JX6 A;  2ESN A;  1OJL A;  4I0B A;  2V6E A;  3GYH X;  2JSC A;  3P9I A;  3S3O A;  1GVJ A;  1T2K A;  5LD2 C;  1FOX A;  2LFB A;  2E5N A;  1RUO A;  2XC7 A;  1I1S A;  1B9N A;  3H9G A;  2CWE A;  3DTI A;  1REP C;  3O8H A;  1ZLK A;  2ZXH A;  1S29 A;  4Y3O A;  2JUC A;  4KT6 A;  1XGN A;  1HKT A;  1MMG A;  1W0U A;  2V26 A;  3RKW A;  2Z99 A;  1VFC A;  3QPL A;  3R6S A;  4HLY A;  3H5N A;  2PFB A;  3K0L A;  4EM1 A;  5J6X A;  5IPA A;  4ENJ A;  2UXX A;  2JA2 A;  5CJ9 A;  4B3X A;  3O8G A;  3NAU A;  5DUI A;  1OKR A;  2Y69 H;  1IUY A;  4O3M A;  4FET A;  4AIJ A;  1YS7 A;  2Y0M A;  1G8X A;  1T38 A;  3ZXS A;  2KHM A;  4G94 A;  3OSG A;  3W2A A;  3H3U A;  4P1W A;  3TQN A;  2EIN H;  1ZH5 A;  1TWH J;  3FWE A;  4P55 A;  3QYE A;  3G73 A;  2Z9O A;  3WG9 A;  5ICC A;  3CJQ B;  3QPS A;  1YJN I;  3AFH A;  3CME I;  2HQ5 A;  3E6C C;  1W5S A;  3GME A;  3HOW J;  3VYT B;  3K70 D;  5DCF A;  3U2R A;  2A68 F;  5F04 A;  3BR0 A;  4V19 K;  3PQJ A;  4YEJ A;  3N97 A;  2M9H A;  2MA3 A;  3HYI A;  2FSW A;  3RSN A;  4XRF A;  3GXO A;  2Z2S B;  2JPB A;  1MIJ A;  2K40 A;  5BPI A;  2AO9 A;  2CV1 A;  1XCB A;  1MDM A;  4RAY A;  1LKX A;  5C4J J;  3RI4 A;  3ZMZ A;  1WQ2 A;  1UMQ A;  2WC2 A;  3BLY A;  4WX9 A;  4WF2 A;  3TL4 X;  4HDV A;  1G4D A;  3CP2 A;  4LJZ F;  3ZMT A;  2V9K A;  1BA5 A;  2HPI A;  4B43 A;  2ZCW A;  1YE9 A;  3HSR A;  2A6H F;  2MH2 A;  3RYP A;  1LDK B;  2GXB A;  1UAA A;  2IGM A;  1CQT A;  1Y39 A;  3DKY A;  4ZDL A;  2DK8 A;  1Z3Y A;  2E1M B;  3LQQ A;  3DU5 A;  4A5M A;  1UEL B;  2FU4 A;  4UUS A;  5GPC A;  1LVA A;  4CHU A;  5ED4 A;  4XIC A;  3S14 J;  3ZN0 A;  4ZYH A;  4QTR A;  1IDY A;  4ZZD A;  2D1V A;  1W4M A;  1IXC A;  2K9N A;  2Z3Y A;  4E7K A;  3LL7 A;  3RYR A;  1FBU A;  5F08 A;  2L9R A;  2PJR B;  1UZC A;  4F3Q A;  4LIT A;  2E71 A;  1YO5 C;  2JWT A;  4WXH A;  2DOE A;  4FE7 A;  2I5U A;  1GV2 A;  1HSJ A;  1WJF A;  1LPQ A;  2E35 A;  2V7F A;  3ZQQ A;  3C2B A;  1MJ9 A;  3SZP A;  4C2T A;  2K7L A;  2EB7 A;  1S9H A;  1U5T C;  1N75 A;  3WTS C;  3QYF A;  4NNJ A;  3I56 I;  1FNN A;  5KAI C;  2L7K A;  1LVK A;  3CCL I;  1ETY A;  3WU1 B;  4EV0 A;  1TNS A;  4AUX A;  3PFY A;  2W85 A;  4DYQ A;  1BOA A;  3K9T A;  1Z7L A;  4RGR A;  4OIR F;  4DNC A;  5HLG A;  4H0E A;  1AU7 A;  1P7I A;  3ZCO A;  1JT6 A;  5E17 F;  1R00 A;  2ESH A;  4L5E A;  1SFU A;  1BC8 C;  1YI2 I;  3V8J A;  2O6G E;  5JVG F;  4A5N A;  4EQQ A;  2M34 A;  1YW7 A;  2LG4 A;  5K7H A;  1MH3 A;  3MFK A;  3RJP A;  2O9L A;  3F6O A;  5K5Q A;  5C44 J;  2LVS A;  3DTE A;  1JXS A;  5HDN A;  2NS8 A;  3Q0U A;  5B5E C;  4BL0 B;  4WXC A;  4KNY A;  2AQE A;  4BY1 J;  3HPH A;  2HOE A;  3TO9 A;  2DLL A;  5FD6 A;  5FKO A;  1HST A;  1IN8 A;  3K70 C;  1KYW A;  1WFX A;  4KUM A;  3CCY A;  3MMY B;  4S04 A;  1WJD A;  1ZGJ A;  1FWZ A;  2Y9Z A;  2ZME C;  2LLK A;  1X4O A;  3JRF A;  1UB9 A;  2GWR A;  4YFK F;  2FNA A;  1ZRF A;  4XKV A;  5CVR A;  5E3N A;  1G3T A;  2JTV A;  1BI3 A;  4W97 A;  4CZZ A;  4CYC A;  4RB2 C;  4BE1 A;  2L4M A;  3BJA A;  1D0Z A;  1J2X A;  1IRZ A;  5LLQ A;  4M9Z A;  2BHZ A;  1FPQ A;  2Q1Z B;  5JI6 A;  1YRN A;  3C3W A;  4BEH B;  4L5J A;  5AIP A;  3OYH A;  4LG3 A;  1IC8 A;  2FMY A;  2HDC A;  1N77 A;  2FQ3 A;  1VQP I;  3FM3 A;  4PUS A;  1V5E A;  1OCZ H;  3TMO A;  4DJA A;  3L2U A;  2EZI A;  4AIH A;  3ABT A;  5J4V A;  3D1N I;  4ESB A;  3CC7 I;  4RAG A;  2Z1D A;  2FF4 A;  3EUH A;  5LHH A;  3RQI A;  3PNY A;  3ELK A;  3HEF A;  2NVU B;  1J09 A;  4A6E A;  2DA5 A;  2LOO A;  3M07 A;  2W82 A;  1JKQ C;  2R7O A;  2F48 A;  4MLO A;  1DPR A;  1MND A;  2PJR A;  5IYB J;  4IEJ A;  3FIW A;  1TW2 A;  2WAE A;  3LSM A;  2KIM A;  1UJ8 A;  1LJ9 A;  3KZY A;  4CYC B;  3SQN A;  2C6Y A;  1NG7 A;  3HRT A;  3RTR A;  2ACJ A;  3X2Q H;  2CRG A;  2ZME B;  1IN7 A;  3DV8 A;  3S32 A;  3JAM K;  5EGO B;  5EZH A;  3JRD A;  3DEW A;  2W25 A;  2WAQ N;  2EV0 A;  2RQP A;  2E36 A;  2UWM A;  3S15 J;  1ZR2 A;  5AON A;  3J80 K;  5DM6 F;  4UVB A;  1SEU A;  2VT3 A;  4D7N A;  4N0B A;  4OMZ A;  2ZFW A;  2B9S A;  2DA3 A;  3NAR A;  2DDB A;  3OR2 C;  2R7R A;  3I0T A;  1GLN A;  2OQG A;  5D4S A;  3HOV J;  5IP6 A;  1ETQ A;  2GOX B;  5M5X J;  1CGP A;  3DLA A;  4LIV A;  1IZ1 A;  1QGP A;  1R71 A;  2XAH A;  3B02 A;  3JTH A;  3K4C A;  5FFX A;  3OYL A;  1XGM A;  4XSX F;  1SFX A;  1JJ8 C;  4A93 J;  3S2W A;  2CQK A;  2KZG A;  2V1D A;  2CJJ A;  5TGT A;  2J5P A;  1SVM A;  3HB9 A;  1LDJ A;  1R6R A;  3OL4 A;  2X6O A;  2OF7 A;  4FHT A;  2LMD A;  2NXN B;  3HOS A;  1YW8 A;  2Y30 A;  2O61 A;  2LR8 A;  3E97 A;  2DAO A;  2RVC A;  3ABM H;  1YOV B;  2M7B A;  4WK8 F;  2GM4 A;  4TV7 A;  1R22 A;  3F6V A;  3CCE I;  4BDZ A;  2PI0 A;  4XR6 A;  3GTM J;  2R3S A;  1CF7 B;  1V54 H;  3BPX A;  3K1N A;  1UFM A;  2M5W A;  3OOU A;  3GZ6 A;  1YW9 A;  1FT9 A;  2XPW A;  4QPQ A;  3G1O A;  2V1N A;  4R8H A;  4RDU A;  2E2I J;  3GTQ J;  1U6G A;  4KN7 X;  4BGD A;  2DXI A;  1W36 D;  2MAB A;  1D0Y A;  4E7L A;  3UNG C;  4PFP A;  5FD5 A;  4DYR A;  2BYV E;  3FIS A;  1B72 B;  2VBX A;  2W24 A;  1WJ5 A;  4NC7 A;  2YR2 A;  2CV0 A;  2X9D A;  1O57 A;  4G7Z F;  1JUP A;  3R0A A;  1Y56 A;  3ULQ B;  1P6R A;  5K7F A;  1G3W A;  3VSK A;  3DTK A;  4XRS G;  1ZG3 A;  2VKD A;  4D7M A;  2GZW A;  5KVR A;  1UCR A;  2FE3 A;  1VQK I;  2L7Z A;  2PMZ N;  4BJ6 C;  5ILS A;  1SVL A;  2G0E A;  3OY9 A;  3EET A;  3BCA A;  4JBA A;  1POG A;  1TNT A;  2VXD A;  4AM3 A;  2WB1 N;  4HX4 A;  1LFP A;  3E6M A;  3IKT A;  1LE8 B;  2FNP A;  4S0H B;  2MC4 A;  4M3F A;  3H36 A;  2D5V A;  4B8X A;  5IY5 H;  2H27 A;  4A3M J;  2JA6 J;  1IRF A;  3SZG A;  4DQ2 A;  3CMY A;  2OA4 A;  3DQV C;  3FMR A;  2KIF A;  2VN2 A;  3FF5 A;  3WTW C;  4RB0 A;  3OS2 A;  3BR3 A;  3K4L A;  2BHY A;  4NQW A;  4XON A;  2IEK A;  2DMP A;  1J59 A;  1IN4 A;  3RDI A;  3BT9 A;  1MNM C;  3T1B A;  4DZJ A;  2E2H J;  1ETW A;  3IC7 A;  4KIF A;  4C3J J;  2M87 A;  2RV8 A;  2CO5 A;  1W7P B;  2LH9 A;  1DU6 A;  5H6Q A;  2LP0 A;  3OV8 A;  2NAZ A;  4LMY A;  4PFO A;  1J0R A;  2VKV A;  4XOT A;  4X0G A;  1VQ5 I;  2MC3 A;  3OR1 C;  3W2W A;  4V2G A;  3OIP A;  2FOK A;  4D9J A;  4ZYA A;  3WOD F;  3FBN B;  2CUF A;  3CTA A;  2M4G A;  2KJB A;  3VOE A;  2P7V B;  1BR2 A;  2QSF X;  2RDP A;  1X1A A;  3V4G A;  2OTL I;  1DP7 P;  2QBY A;  1KQ8 A;  4ENN A;  4IXA A;  2WBM A;  3P9K A;  1X19 A;  5FLM J;  3HGG A;  1Z7U A;  3LNQ A;  2OJE D;  4RBO A;  3H5R A;  2F5V A;  1VQO I;  1ETV A;  3RCO A;  4HZF A;  1SAN A;  2EFW A;  1EH7 A;  2DJI A;  1JHF A;  4ON0 A;  4OIP F;  1OYY A;  4W1U A;  1HOM A;  4ESF A;  3KP5 A;  2BVM A;  4E7S A;  4BJ5 C;  2KLO A;  1FBS A;  5J8F A;  1PUF B;  1O3T A;  3A2K A;  4XLC A;  1HBX G;  2ZXW H;  4BYY A;  1X1P A;  2CQQ A;  2O03 A;  1F4K A;  3CCQ I;  3CC2 I;  1IN6 A;  1XTA A;  5DDG A;  3CCU I;  1R1V A;  2AQF A;  4Y4R A;  4CGZ A;  1MBK A;  2B63 J;  3BR2 A;  3UKG A;  3M8F A;  4XNF A;  1P4A A;  2RNG A;  2P81 A;  5DCM B;  2F5E A;  2K86 A;  3HUG A;  3I4N J;  4IX7 A;  2O0Y A;  2X0L A;  5L3E A;  2CW0 F;  3COA C;  3BR6 A;  3VYR B;  2L54 A;  5E18 F;  4BBR J;  3BC8 A;  3B73 A;  4FE4 A;  1WSU A;  3K4M A;  2DFI A;  2L4A A;  2E7W A;  3TDZ C;  3WTV C;  2O3F A;  5EEA A;  3WTZ A;  3O2P E;  5F64 A;  3CUQ C;  1V5F A;  4ITV A;  3CJR B;  2W00 A;  1JJ6 C;  2ZB9 A;  4HNU A;  3HC7 A;  1FP1 D;  3H5A A;  2A69 F;  3DKX A;  4UUV A;  4JYK A;  5J1Y A;  5F0F A;  1IDZ A;  4A3E J;  1I3A A;  4JX4 A;  3G3Z A;  1NHA A;  2CFO A;  3G71 I;  4FT8 A;  4AD9 A;  4OWR B;  3DBL B;  3NEU A;  3RKY A;  2GQQ A;  2DJN A;  4U0W A;  3GTJ J;  1I6H J;  5LRS A;  1SFO J;  2MH9 A;  4L9T A;  3V7C A;  4ZYE A;  3RPU A;  1IN5 A;  2GXA A;  2VUM J;  2CUE A;  2BZT A;  2XRL A;  2QF7 A;  1OCO H;  3L2V A;  1OR7 A;  2MD5 A;  2R5Y B;  1A36 A;  1Y8R B;  2X85 A;  3HSE A;  2FBK A;  4QWQ A;  1SAX A;  3J7A Y;  4A3G J;  1UG2 A;  1RET A;  4C2U A;  1Z77 A;  1LE8 A;  3M8J A;  3S3N A;  2VPL A;  2Z33 A;  1E17 A;  5B1A H;  1QPI A;  2K4B A;  2GBY A;  2RNJ A;  3A4C A;  3HSF A;  3OYK A;  2GLO A;  3HM5 A;  3JAM Z;  4PJN A;  2X4H A;  1W1W E;  4B3A A;  2FUG 2;  3M4O J;  3LFU A;  1DGW Y;  3PO3 J;  3LSG A;  2R92 J;  3L09 A;  1E2X A;  3VB2 A;  2H8R A;  3KCC A;  1GHC A;  3K2A A;  5GAD J;  4EMS A;  1F43 A;  1DQU A;  3OS0 A;  3GTO J;  4FTH A;  1GDT A;  2I8D A;  2PMZ A;  1AHD P;  3FK7 A;  5J1U A;  2QGU A;  4N4N B;  1R5I D;  3MKL A;  3HPG A;  4HLX A;  5A2Q Z;  1IGN A;  2FOW A;  4PJJ A;  4RMN A;  4FCY A;  2GA1 A;  2QEN A;  2XAF A;  2MLK A;  1B8I A;  5IT3 A;  4EAT A;  1B72 A;  2K4J A;  2M0C A;  5E79 C;  2AHQ A;  2ZJR F;  2EA4 A;  5CPR B;  1YJW I;  4X6A J;  3C2G A;  3ERM A;  4BH9 A;  4CCL A;  2IXS A;  3PM1 A;  3TKY A;  5CVI A;  5HS9 A;  2GA2 A;  2HQN A;  1X3W B;  4X1E A;  2X1E A;  1VQ7 I;  1E3P A;  2YX4 A;  3IUO A;  4B1R A;  2LD5 A;  3HOT A;  3WE2 A;  1Y8Q B;  1KU7 A;  2ID3 A;  4PGH A;  3VYS B;  5J1R A;  2NOG A;  2DTZ A;  3KEO A;  4AVZ A;  3TW6 A;  4N9I A;  1B1B A;  2K9S A;  1MMN A;  3CJT B;  4G12 A;  4HF2 A;  1OCC H;  1RPW A;  3T5X A;  2P6T A;  1GT0 C;  2K27 A;  3L2W A;  2TCT A;  4KT5 C;  2KL4 A;  3TBI A;  1PJR A;  2BY2 A;  3IWF A;  3DXJ F;  1B8I B;  1BBY A;  2P0W A;  5E8G A;  4M72 A;  3BZC A;  5M3M J;  4C30 A;  2BV6 A;  3MN2 A;  5CYV A;  3QAH A;  4BKX A;  1F5T A;  1Z9C A;  3GTK J;  4AU7 A;  3HKZ N;  1TBX A;  1YQA A;  5B3S H;  4P96 A;  5AIQ A;  4A3I J;  2OV7 A;  1NTC A;  2DT6 A;  3HTU A;  1MBH A;  3LA3 A;  3UR3 C;  5C3E J;  5E3L A;  5JLX A;  3OYG A;  1BW5 A;  4HW0 A;  3TDU C;  2RC4 A;  4EJT A;  2IP2 A;  2QVO A;  2IBD A;  2CMP A;  2LF8 A;  4JP0 A;  4B47 A;  1XX5 A;  5HDK A;  3LAJ A;  3HL2 A;  3G6E I;  1V5G A;  2JUG A;  5EF6 A;  4BXF A;  3MKZ A;  4EGZ A;  1K4S A;  4M3D A;  5FKM A;  1APL C;  2H6C A;  2Y48 A;  3KET A;  3MCZ A;  4UV9 A;  1QNT A;  4BJT A;  1LEB A;  2VT2 A;  1QQI A;  2EZH A;  3ABU A;  2A07 F;  3DKW A;  4YEL A;  4IRI A;  4RB1 A;  1YIT I;  3K7A J;  3HGY A;  3QOD A;  2L5Q A;  2WAD A;  4BS9 A;  3F8B A;  1JKO C;  2MSY A;  3BCB A;  2O8K A;  3HOZ J;  1R4M B;  1WJE A;  3A0B C;  4I01 A;  3WTX C;  4H4K C;  1KU2 A;  1DU0 A;  2CUJ A;  4GRI A;  2IA1 A;  4A3B J;  1JUS A;  2IJL A;  2QQ9 A;  4LGW A;  1ZAR A;  3DF8 A;  4XN0 A;  1B6A A;  4MO7 A;  2IAI A;  4ZC3 A;  4CA0 A;  2OZ6 A;  4WXD A;  3CUO A;  2M1B A;  2ZNY A;  2ZSH B;  2DMQ A;  3FKJ A;  3MEX A;  2HOS A;  4AYB A;  2BW3 B;  3OYF A;  2Z16 A;  2Y2Z A;  4RLF A;  1WJB A;  1A04 A;  1SFE A;  3MAJ A;  3SDG A;  2P6S A;  4LD5 A;  1JGS A;  1J7K A;  2F5C A;  3GBG A;  3ASN H;  1HA8 A;  2UUZ A;  4XMY A;  3U1K A;  1B4A A;  5B1B H;  1H0M A;  1W7P D;  3VFZ A;  2DFH A;  2WAF A;  3PSI A;  3GTG J;  4M6Y A;  4ZJZ A;  1PP8 F;  1ZG5 A;  3DEE A;  1Z6T A;  4D0P A;  1TW3 A;  4BQN A;  2DMU A;  3ZQC A;  1TWG J;  3FM5 A;  2NVX J;  5FKK A;  4ANJ A;  4F91 B;  1IAW A;  2XAQ A;  3EUK L;  3BJ6 A;  2DQL A;  2OC6 A;  2VC0 A;  2WTE A;  1XC5 A;  2X1D A;  4OIN F;  2XAJ A;  1KQ0 A;  2QA4 I;  1U3E M;  5H20 A;  2VBW A;  2YPR A;  2DA1 A;  3HRS A;  5HNF A;  2K5C A;  3O6B B;  2DYS H;  1WI9 A;  3FXU A;  1ETX A;  1I50 J;  4NC6 A;  4CCM A;  4PJM A;  2VE9 A;  1MMA A;  4LB6 B;  1AWC A;  1YIO A;  3HHH A;  2P5V A;  1TTY A;  2HYG D;  2ZJQ F;  3GCM A;  4N9H A;  3WGH A;  4LLG F;  4MTD A;  2HVS A;  4LK0 F;  1IXR C;  2ZFU A;  3H35 A;  2WY7 Q;  3CJN A;  2V1X A;  1JI8 A;  2H09 A;  1HXD A;  4HOB A;  3HBL A;  1GXP A;  1ZAO A;  4BEH A;  2YUS A;  4U7B A;  4C3H J;  5EG0 B;  2E5Z A;  1JTY A;  3LAP A;  2BE5 F;  4G6T B;  2KP6 A;  2R7F A;  3S2D J;  1YLF A;  3Q9S A;  3E0J B;  3LOC A;  4CZC A;  1V4R A;  3AG4 H;  2BBY A;  4OOI A;  2XGE A;  3FMQ A;  3GFM A;  4XRM A;  3WU0 A;  4FX4 A;  5E1Z B;  3JW4 A;  1HCR A;  4LFU A;  3SFI A;  1WRJ A;  4DYC A;  4IRH A;  4XLF A;  3DEU A;  1JKP C;  3DCF A;  4EJW A;  1VQN I;  2M2E A;  2JMW A;  2M0M A;  1TT5 B;  1T0F A;  5L3C A;  3M1E A;  3T8R A;  2JRT A;  1OCR H;  3KP6 A;  5J8C A;  3E5Q A;  2XKP A;  2DW4 A;  4F92 B;  2DOA A;  3WTT C;  3QRF F;  2VE8 A;  2QSH X;  1TQP A;  5EG0 A;  5FLX K;  2COM A;  2OBP A;  3GVA A;  3WTY C;  1Q1H A;  1U9O A;  2PQ8 A;  3E5U A;  3QQA A;  4KMU X;  1TWC J;  4Q47 A;  4RAF A;  2H1L A;  5F1J A;  3CES A;  4UB6 C;  5LEJ A;  3PO2 J;  4B09 A;  2CW8 A;  1T56 A;  4YRV A;  4DBQ A;  4U0V A;  2JSP A;  2VJ4 A;  1B59 A;  1X58 A;  1GXQ A;  1T95 A;  2OZU A;  4XRS A;  3E6B A;  4KN4 X;  4DIQ A;  3U9G A;  3IRR A;  3LFK A;  4AVP A;  4K2E A;  1T8I A;  2AS5 F;  4C3I J;  1ZTR A;  4Q48 A;  5BQT A;  2EH3 A;  5DTD A;  1D8J A;  3TO7 A;  3PIP F;  1T0F C;  2QKM B;  1GVD A;  2DQR A;  2WAQ A;  2KDZ A;  1RC9 A;  2XDV A;  1QZY A;  3DPT A;  1PDN C;  3RZD J;  4XLA A;  3W2V A;  4Y7N J;  1ENH A;  2VXZ A;  1ZEL A;  3VSL A;  4G7O F;  1LUJ B;  1U2W A;  2JA5 J;  1X1D A;  1BR4 A;  2HZD A;  4AC0 A;  2D1H A;  1S8N A;  2VBY A;  1LQ1 A;  1D1A A;  3KE2 A;  4WCG A;  1AA7 A;  4IOC F;  5LGN A;  3LQR A;  2IVM A;  1U5T A;  3CP8 A;  1O4X A;  1A35 A;  3V8K A;  5LHG A;  1F9N A;  2KFD A;  3GFL A;  4MEY F;  4XBF A;  3OYM A;  1YYV A;  2E1M C;  3CDI A;  2KKO A;  2HNH A;  2LRE A;  5CKT A;  4C2M J;  5K5O A;  4QLC U;  1WVR A;  3FDY A;  4HAM A;  4CUG A;  2PEX A;  3F8M A;  2DA6 A;  1FOK A;  4M6V A;  3PIO F;  4OIQ F;  3OOP A;  1UHW A;  5CQG A;  2JN6 A;  1QZZ A;  5DD4 A;  4MGR A;  3JSO A;  2LY2 A;  1ETK A;  2BXY A;  3SEZ A;  1MBG A;  6PAX A;  4UHT A;  5DCM A;  1VQ4 I;  4JX5 A;  2CW7 A;  4KIT B;  5HNH A;  2PX9 A;  2DPU A;  3I55 I;  3K4K A;  5BOX A;  2WWY A;  1OIS A;  2PG4 A;  2JA8 J;  3BRO A;  1S3J A;  4U7D A;  1KU9 A;  3B6A A;  1YHQ I;  1U0J A;  4L0Z B;  4UY8 I;  1ERD A;  1D0X A;  3Q5F A;  2PN6 A;  2YSR A;  1KQ9 A;  3HDD A;  4PZJ A;  2K9Q A;  4B4C A;  5C4X J;  1VND A;  2FEZ A;  1IO2 A;  3F22 A;  1O3S A;  4YII A;  3M1C A;  3ZMV A;  2HTJ A;  1W5T A;  2W7N A;  1S7O A;  4LG0 A;  2XIG A;  2WB1 A;  3BTJ A;  1BR1 A;  2FBI A;  1STZ A;  3RIR A;  3KP7 A;  4J00 A;  2XRN A;  1QA6 A;  5ERI A;  4I0A A;  1MSF C;  3WGG A;  4UV8 A;  3FXM A;  3RPQ A;  3HRM A;  3OYC A;  2O7O A;  2DN0 A;  4Z6Y A;  3S1Q J;  3CO6 C;  2GIZ A;  2IS6 A;  1LDD A;  1K6Y A;  1P2F A;  3LSH A;  2ECC A;  2ZJP F;  2FBH A;  3EUH C;  5HDG A;  3ZQH A;  3GLL A;  3N05 A;  4L18 B;  4NHJ A;  2JVH A;  3HJE A;  1OMI A;  2Q0O A;  2ZXI A;  1SD7 A;  5J3L A;  2CUZ A;  3BZK A;  3MWM A;  5FRN A;  3BDD A;  3H9Q A;  1UST A;  4IHT A;  3L9F A;  3JRB A;  2X6X A;  3CQZ J;  4I6Z A;  1SC7 A;  1H8A C;  1TWF J;  2IPQ X;  5LRR A;  2JA7 J;  3OIO A;  3CF5 F;  4NUB A;  3MZH A;  2NVY J;  5BMZ A;  2F4I A;  1I1G A;  5DUK A;  4HNV A;  3BG7 A;  2HKX A;  1DGR M;  1QHG A;  5L3G A;  4UUT A;  1ZK8 A;  1HW1 A;  3E3V A;  4BUP A;  3MKY B;  2K9L A;  2W84 A;  3JRI A;  4HRI A;  3EPZ A;  4P9U A;  1QVT A;  5FKN A;  4Z2Y A;  1S5L C;  5BS6 A;  5TJJ A;  4XSZ F;  3QOP A;  2Y75 A;  3JSP A;  1PYV A;  2IT0 A;  2F4M B;  1M1E B;  3VDX A;  1BL0 A;  4CDG A;  1QVU A;  3GO5 A;  2HTS A;  2GIV A;  2DO7 A;  1XD7 A;  3ERE D;  1U8B A;  3OMY A;  1RUN A;  2A3S A;  3RPU D;  3TOA A;  3JRA A;  2QM3 A;  4MQ9 F;  3HOY J;  2EA2 A;  3W6V A;  4GO1 A;  1RR8 C;  2UV1 A;  1MZB A;  4LOC A;  3WTU C;  3D5R C;  1I5Z A;  2KT0 A;  3MVP A;  2Q2E A;  5HS7 A;  3FHN A;  3M3Y J;  1JKR C;  5F6F A;  4O6J A;  1AKH B;  3HZJ A;  3TW7 A;  3JRE A;  5FO5 A;  3FXL A;  2H1K A;  1MKM A;  5K5R A;  2KRF A;  3WG7 H;  2P5L C;  1K61 A;  4KIB A;  5LGU A;  3BG5 A;  5FLV A;  3GLX A;  3ZN1 A;  4MIM A;  1FMV A;  5TRD A;  3F8C A;  3WU2 C;  3DLL F;  2XGC A;  4BNC A;  1IG7 A;  4I02 A;  2LNB A;  3OL3 A;  5IYC J;  2BY1 A;  3M9A A;  3FXJ A;  1BI1 A;  3KEQ A;  2CV2 A;  1VQ6 I;  2E2J J;  2KPM A;  3ZQ7 A;  1VQ8 I;  4KYW A;  3LWF A;  3H0D A;  4II3 A;  2EV6 A;  1ZYR F;  3CO7 C;  5M5W J;  3E7L A;  1R1T A;  4IL6 C;  3ZMU A;  2G7H A;  4KA4 A;  2IS4 A;  1YG2 A;  3QP6 A;  5FJ8 J;  3OYB A;  2ECB A;  5F27 A;  3ESW B;  4RM2 A;  5EZG A;  3W6J B;  1QRY A;  2IW5 A;  1OYI A;  2LBF A;  4G6D A;  2DBB A;  3PSF A;  1MMS A;  2R7Q A;  2K3F A;  2MFZ A;  2ICW G;  2XKO A;  3S3M A;  1P92 A;  3ABK H;  1ON1 A;  2YX7 A;  2JPC A;  3A03 A;  4HA8 A;  1R49 A;  1HDP A;  3I4P A;  1FMW A;  1RZ4 A;  1RNL A;  2DMT A;  1S6L A;  2DOF A;  2R7Z J;  2FD5 A;  3QU3 A;  1XB4 A;  3K69 A;  3CUQ A;  3MZ8 A;  1RI7 A;  3L2Q A;  2ADU A;  1L0O C;  4PDK A;  1YS6 A;  1KYZ A;  3TGN A;  2ME6 A;  3E1S A;  4I99 C;  1KA8 A;  2FJ1 A;  1WI3 A;  3OYI A;  2FX0 A;  3GWZ A;  1KGS A;  3T8T A;  4M73 A;  4EM2 A;  1IRG A;  2OCC H;  2OU2 A;  3K6G A;  5L3F A;  2MYS A;  2ISZ A;  4HV6 A;  3LSP A;  2R5Z B;  2L9N A;  2DFE A;  4Y17 A;  1TQI A;  1JT0 A;  2BXZ A;  1UHS A;  2ZKZ A;  1ZR4 A;  1EA3 A;  2F6C A;  3HG9 A;  4A3C J;  3BPV A;  2M7A A;  3SZT A;  3CCS I;  1G3S A;  2MW8 A;  2VC1 A;  1N25 A;  4A6D A;  3R61 A;  3S2H J;  2X1C A;  3LSR A;  2HPM A;  1ZHF A;  2JJ7 A;  1OFC X;  4OU0 A;  2B7E A;  1XSD A;  3FXR A;  2LBF B;  1ACI A;  1WJA A;  2OUM A;  4I2O A;  3FXK A;  3ONQ A;  4BY7 J;  1XMA A;  4HYE A;  5L3B A;  2KZV A;  4E7J A;  2L9S A;  3A0H C;  5DYM A;  4FAS D;  2QQB A;  2O5R A;  2ZC2 A;  1WPK A;  2L3D A;  1V55 H;  3HIF A;  2LRD A;  4BHP A;  1TC3 C;  1O7F A;  4L9J A;  5D8K B;  1X3Z B;  3ISP A;  3C1D A;  5D5V B;  1S7A A;  2CQX A;  3K4B A;  2KRH A;  3PUF A;  3S8P A;  1OPC A;  3IHU A;  1Y0U A;  3K2Z A;  4M6X A;  1RR7 A;  4PGG A;  4DW6 A;  2EZL A;  2V1U A;  3I5U A;  1FY7 A;  5F0C A;  2A61 A;  5IP7 J;  3GFI A;  1R1U A;  2NS0 A;  3BOQ A;  2EIL H;  2DYR H;  2LC2 A; 
#chains in the Genus database with same CATH homology
 1Z1D A;  4I98 B;  1LNW A;  1YTY A;  4KMF A;  1FSE A;  1L3L A;  5BPD A;  2PLY A;  5FGM A;  1F1Z A;  1D8K A;  4RGU A;  1FYM A;  3PQK A;  2NYX A;  4LLL A;  1OYW A;  3R0J A;  4I7H A;  2DK5 A;  4EGY A;  5D4R A;  2OQR A;  2WV0 A;  1WKM A;  4RB3 C;  4UNO A;  2FRH A;  4HDU A;  3I64 A;  3F23 A;  3K1P A;  3CDH A;  3D5L A;  3ZPL A;  2D2W A;  1FYK A;  1YFH A;  2XRO A;  4ZYG A;  4KFC A;  3LST A;  1ZLJ A;  5ICF A;  3VEP A;  5LHI A;  4UXN A;  1D3Y A;  1HQC A;  4CO8 A;  4CYD A;  2CG4 A;  4ZH4 F;  1PUE E;  5E1X A;  4YG2 F;  3F3X A;  3HRU A;  2JZY A;  2XAS A;  1XSX A;  5ICE A;  2VOO A;  3H92 A;  2L01 A;  1ON2 A;  4HX7 A;  3I71 A;  4RAZ A;  3GEZ A;  2CGP A;  4FX0 A;  4G8X A;  4Q4Z F;  5ILV A;  4HV5 A;  5D5W B;  1O3R A;  2QWW A;  1J5Y A;  2LF7 A;  2PMH A;  2LSO A;  4GXO A;  1U78 A;  4O5V A;  3GF2 A;  2QYO A;  1Z6R A;  3HTS B;  4BHC A;  5DD8 A;  2EFP A;  2P7C B;  3DPL C;  5IT9 K;  1PP7 U;  2G9W A;  4RS8 A;  2NNN A;  3KP4 A;  3F8F A;  4ETS A;  3L00 A;  1U8R A;  5DEQ A;  4U0Y A;  3L7W A;  3REO A;  3J7A O;  1J75 A;  2HFH A;  3E6D A;  2D45 A;  4EVI A;  2EK5 A;  4LB5 A;  3I54 A;  1K6O A;  4IVN A;  2J5O A;  4G9Y A;  3R60 A;  3IWZ A;  1XGS A;  4IRG A;  4P5O A;  1T98 A;  2B0L A;  5LGT A;  1ZRD A;  2QUF A;  3EYY A;  1G3Y A;  5HVQ C;  1BC7 C;  2ZME A;  5HLH A;  1ZRC A;  1HW2 A;  5HS8 A;  2XHK A;  4M9S A;  3GUD A;  2H94 A;  3O3K A;  1BI2 A;  2AXL A;  3HHG A;  1HKS A;  1TQM A;  4ESJ A;  2XUB A;  5JFR A;  3AAF A;  3QU6 A;  1B9M A;  2ELH A;  2DT5 A;  4ZZL A;  4RGX A;  5HLI A;  4Y13 A;  1G6N A;  1W7P A;  2NNY A;  2STT A;  4ENM A;  3FHZ A;  2Q8K A;  3I59 B;  4GYG A;  3TO6 A;  4HF0 A;  4UVC A;  2FXA A;  3M8E A;  4YFN F;  1P4X A;  4HQM A;  4IJA A;  2KIU A;  3DFG A;  3V7R A;  1BIB A;  5D6E A;  4EJO A;  1SD5 A;  2DI3 A;  4F7Z A;  3GX4 X;  1QPM A;  3MZY A;  4G6Q A;  2VON A;  1SD4 A;  4NB5 A;  3NQO A;  2FA5 A;  5IT9 Z;  5JVT A;  4LK1 F;  2ZBK A;  1H9T A;  1ZG1 A;  3ZMS A;  3BP8 A;  1D5V A;  3QPH A;  2M8E A;  2A6E F;  2CFX A;  1DPU A;  2IA2 A;  4XLP F;  1EH8 A;  2PJP A;  3U1D A;  4LG0 B;  5D5X B;  1K7A A;  2NRA C;  4AIK A;  2E1N A;  4CIC A;  1J9I A;  4I09 A;  4A0Y A;  2LDU A;  4M9X A;  4R1H A;  2G7U A;  1ZN2 A;  2V79 A;  4HQE A;  1R23 A;  1FYL A;  3SFZ A;  2UZK A;  5A2Q K;  4ZYD A;  2ISY A;  3SXY A;  3FZV A;  1CF7 A;  4BHB A;  2V6C A;  1ULY A;  4KIG A;  5CVJ A;  3R4K A;  1R36 A;  2QZ8 A;  1IW7 F;  1SMT A;  4R79 A;  2HYF A;  4A2U A;  3KP2 A;  1TLH B;  3KFW X;  3TOB A;  1MD0 A;  1BM9 A;  4EJU A;  3V8L A;  3L2C A;  1XGO A;  4A12 A;  5FFZ A;  3I53 A;  3DP7 A;  5ILU A;  5EEG A;  5JHU A;  1LB2 A;  1JHH A;  3QPT A;  3T0Y A;  3ROU A;  2K02 A;  4JK1 X;  3GFJ A;  2V9V A;  4GGG A;  3CLO A;  1V3F A;  2HR3 A;  3KZZ A;  1BN5 A;  1FX7 A;  1MDM B;  2EWN A;  5FB2 A;  1T6S A;  1WWX A;  5E20 A;  2VOD A;  2VBZ A;  2OD5 A;  2GXG A;  1Z05 A;  2ZJ2 A;  2E7X A;  2PMU A;  1XMK A;  3BJO A;  1USS A;  4UVA A;  2P4W A;  3VOD A;  1KU3 A;  4MEX F;  2MLG A;  1Z91 A;  2ETH A;  1HW5 A;  3J81 Z;  1MGT A;  2P5K A;  4Q5S F;  3FXQ A;  5D8L B;  1RIO H;  3J81 K;  1FC3 A;  2KJC A;  2O8X A;  3QP5 A;  3ZMD A;  3EDP A;  2CYY A;  5HOO A;  1MJB A;  3M7G A;  4A0Z A;  1R7J A;  3KLN A;  4ASN A;  2TDX A;  2XAG A;  2HZT A;  4M74 A;  3IKV A;  4L9V A;  4L9N A;  3K1M A;  2MBF A;  4WWC A;  4U88 A;  3EYI A;  1H9G A;  1IF1 A;  1XDS A;  1XDU A;  4G7H F;  2STW A;  5CVV A;  1IXS B;  2ZXJ A;  5CLS A;  4KDP A;  4MTE A;  3CUQ B;  3GW2 A;  5JR3 A;  3KP3 A;  4AWX B;  2DPD A;  4LLN A;  4OIO F;  1I6X A;  2M30 A;  2YU3 A;  4M71 A;  3FX3 A;  5E1W A;  3F72 A;  1R5H A;  2RN7 A;  4XLN F;  3IL2 A;  4E70 A;  3FMS A;  1FLI A;  1FP2 A;  3P9C A;  3ML6 A;  2HS5 A;  4BXU A;  4PCQ A;  3LA2 A;  1BIA A;  5F1R A;  2EJR A;  4RGS A;  2DTR A;  2HKO A;  2OAZ A;  1QBJ A;  4L0Y B;  2BGC A;  4A0X A;  4CXF A;  4HBL A;  2EV5 A;  1R5G A;  3EQL F;  1LEA A;  3BWG A;  3W6K B;  3H3Z A;  3F21 A;  1EH6 A;  3C7J A;  2EFN A;  1EV7 A;  4S05 A;  4IHS A;  1MJA A;  2M45 A;  3BZ6 A;  4IF4 A;  5E17 F;  3IRQ A;  3MQ0 A;  2UXN A;  5DV5 A;  2CSO A;  5D5U B;  4BAY A;  1X3U A;  3J80 Z;  2W57 A;  2F5F A;  1BI0 A;  2EFQ A;  3GZ5 A;  4IPA A;  1QO0 D;  1FSH A;  1O3Q A;  1O7L A;  1ZGA A;  4P9F A;  3WE3 A;  1XCV A;  4MQV A;  1T39 A;  2QBY B;  2XV4 S;  5H6R A;  3BY6 A;  3ZP5 A;  4BQA A;  2LKP A;  1K79 A;  4EM0 B;  2QQA A;  3WGI A;  1AOY A;  1DUX C;  2FML A;  2GAU A;  4GCV A;  2IA0 A;  5E8I A;  2F2E A;  2F5D A;  3JTG A;  1DDN A;  3V7S A;  3N4M A;  1C0W A;  2BEO A;  1I27 A;  2HWV A;  2Z5U A;  2DU9 A;  2H6B A;  3E5X A;  4L5I A;  1ONV A;  1XSV A;  5D6F A;  1BJA A;  3ECH A;  4KIC A;  3D0S A;  3ECO A;  4MHG A;  4OMY A;  2L02 A;  4MNU A;  5EEH A;  1K78 A;  2PBI A;  5CVU A;  3SHF A;  5KK1 A;  1R58 A;  3KLO A;  2P8T A;  2VOP A;  5FLX Z;  1HKQ A;  4JQF A;  5L3D A;  5ICG A;  1FBQ A;  2JT1 A;  2ZO4 A;  2A5Y B;  1P4W A;  2E1C A;  4HX8 A;  1SD6 A;  1U5T B;  4HF1 A;  4EJV A;  2RGV A;  2HEO A;  3PFI A;  3F8N A;  1XN7 A;  2HQR A;  3C18 A;  3I59 A;  5LBQ A;  1K78 B;  2EFO A;  2R7D A;  2RKH A;  4YFX F;  3RKX A;  2IRF G;  5LEK A;  4ENK A;  1UHM A;  2XGX A;  5K1Y A;  3P7N A;  1JE8 A;  3I58 A;  2QLZ A;  1ODD A;  2ZNZ A;  3Q9V A;  4Y15 A;  1ZRE A;  2XVC A;  3NRV A;  1FZP B;  4GYI A;  4YIF A;  1VTN C;  1SMY F;  2HGC A;  3LA7 A;  2ESN A;  4I0B A;  3GYH X;  2JSC A;  3P9I A;  1GVJ A;  1T2K A;  1RUO A;  1I1S A;  1B9N A;  1REP C;  2CWE A;  1ZLK A;  1S29 A;  1XGN A;  1HKT A;  3RKW A;  2Z99 A;  3R6S A;  4HLY A;  2PFB A;  3K0L A;  4EM1 A;  5J6X A;  4ENJ A;  2UXX A;  5CJ9 A;  5DUI A;  1OKR A;  1IUY A;  4O3M A;  1T38 A;  4AIJ A;  1YS7 A;  2Y0M A;  4G94 A;  3H3U A;  3TQN A;  1ZH5 A;  4P55 A;  3FWE A;  2Z9O A;  3G73 A;  3WG9 A;  5ICC A;  3E6C C;  1W5S A;  5DCF A;  3U2R A;  2A68 F;  3PQJ A;  3N97 A;  2MA3 A;  3HYI A;  2FSW A;  4XRF A;  3GXO A;  2JPB A;  5BPI A;  1XCB A;  1MDM A;  4RAY A;  3RI4 A;  3ZMZ A;  1WQ2 A;  2WC2 A;  4WX9 A;  4WF2 A;  4HDV A;  1G4D A;  4LJZ F;  3ZMT A;  2ZCW A;  3HSR A;  2A6H F;  2MH2 A;  3RYP A;  1LDK B;  2GXB A;  2DK8 A;  3LQQ A;  4A5M A;  2FU4 A;  1LVA A;  4CHU A;  5ED4 A;  3ZN0 A;  4ZYH A;  4ZZD A;  2D1V A;  1W4M A;  1IXC A;  2Z3Y A;  3RYR A;  1FBU A;  1YO5 C;  4WXH A;  1HSJ A;  1MJ9 A;  3SZP A;  2K7L A;  2EB7 A;  1U5T C;  3WTS C;  1FNN A;  3WU1 B;  4EV0 A;  1TNS A;  2W85 A;  4H0E A;  1BOA A;  3K9T A;  4RGR A;  4OIR F;  4DNC A;  5HLG A;  1R00 A;  2ESH A;  1BC8 C;  1SFU A;  3V8J A;  2O6G E;  4A5N A;  4EQQ A;  1YW7 A;  3MFK A;  3RJP A;  3F6O A;  5K5Q A;  1JXS A;  5HDN A;  4KNY A;  4WXC A;  2HOE A;  3TO9 A;  2DLL A;  5FD6 A;  1HST A;  1IN8 A;  1KYW A;  4KUM A;  4S04 A;  1ZGJ A;  1FWZ A;  1UB9 A;  2GWR A;  4YFK F;  2FNA A;  1ZRF A;  5CVR A;  1G3T A;  2JTV A;  1BI3 A;  4CZZ A;  4RB2 C;  2L4M A;  3BJA A;  1J2X A;  5LLQ A;  4M9Z A;  1FPQ A;  5JI6 A;  3C3W A;  4L5J A;  5AIP A;  2FMY A;  2HDC A;  2FQ3 A;  3FM3 A;  4AIH A;  3ABT A;  4ESB A;  2FF4 A;  3EUH A;  5LHH A;  3ELK A;  4A6E A;  1DPR A;  1TW2 A;  2KIM A;  1LJ9 A;  3KZY A;  2C6Y A;  3SQN A;  3HRT A;  3RTR A;  2ACJ A;  3JAM K;  2ZME B;  1IN7 A;  3DV8 A;  2W25 A;  2EV0 A;  2RQP A;  2UWM A;  5AON A;  3J80 K;  4UVB A;  2VT3 A;  4N0B A;  4OMZ A;  2ZFW A;  3I0T A;  2OQG A;  5D4S A;  1CGP A;  1IZ1 A;  1QGP A;  2XAH A;  3B02 A;  3JTH A;  5FFX A;  1XGM A;  4XSX F;  1SFX A;  3S2W A;  2CQK A;  2V1D A;  2J5P A;  1LDJ A;  4FHT A;  3HOS A;  1YW8 A;  2O61 A;  3E97 A;  2DAO A;  2RVC A;  4WK8 F;  4TV7 A;  1R22 A;  3F6V A;  2PI0 A;  2R3S A;  1CF7 B;  3K1N A;  3BPX A;  1UFM A;  2M5W A;  3GZ6 A;  1YW9 A;  1FT9 A;  4R8H A;  1U6G A;  4KN7 X;  5FD5 A;  2BYV E;  2VBX A;  2W24 A;  2YR2 A;  1O57 A;  4G7Z F;  3R0A A;  3ULQ B;  1P6R A;  1G3W A;  1ZG3 A;  2GZW A;  5KVR A;  1UCR A;  2FE3 A;  5ILS A;  3EET A;  4JBA A;  1TNT A;  4HX4 A;  3E6M A;  3IKT A;  2FNP A;  4B8X A;  2H27 A;  1IRF A;  4DQ2 A;  2OA4 A;  3DQV C;  3FMR A;  2KIF A;  2VN2 A;  3FF5 A;  3WTW C;  4RB0 A;  4NQW A;  1J59 A;  1IN4 A;  3RDI A;  3T1B A;  3IC7 A;  4KIF A;  2M87 A;  2RV8 A;  2CO5 A;  1W7P B;  5H6Q A;  3OV8 A;  2NAZ A;  4LMY A;  1J0R A;  2MC3 A;  2FOK A;  3WOD F;  3CTA A;  2KJB A;  3VOE A;  2P7V B;  3V4G A;  2RDP A;  2QBY A;  1KQ8 A;  1DP7 P;  4ENN A;  4IXA A;  3P9K A;  1Z7U A;  4HZF A;  2EFW A;  1EH7 A;  1JHF A;  4ON0 A;  4OIP F;  1OYY A;  4ESF A;  3KP5 A;  5J8F A;  1FBS A;  1O3T A;  1HBX G;  4BYY A;  2O03 A;  1F4K A;  1IN6 A;  5DDG A;  1R1V A;  4CGZ A;  3M8F A;  1P4A A;  5DCM B;  2F5E A;  2K86 A;  3HUG A;  2O0Y A;  2X0L A;  5L3E A;  2CW0 F;  3COA C;  2L54 A;  5E18 F;  3B73 A;  1WSU A;  2DFI A;  2L4A A;  2E7W A;  3TDZ C;  3WTV C;  2O3F A;  3WTZ A;  3O2P E;  5F64 A;  3CUQ C;  1FP1 D;  2A69 F;  4UUV A;  3G3Z A;  1NHA A;  4FT8 A;  4AD9 A;  3NEU A;  3RKY A;  2GQQ A;  4U0W A;  5LRS A;  2MH9 A;  4L9T A;  3V7C A;  4ZYE A;  3RPU A;  1IN5 A;  1OR7 A;  2MD5 A;  3HSE A;  2FBK A;  4QWQ A;  1SAX A;  2Z33 A;  1E17 A;  2K4B A;  2RNJ A;  3HSF A;  3JAM Z;  2X4H A;  3L09 A;  1E2X A;  3VB2 A;  3KCC A;  1GHC A;  4EMS A;  5A2Q Z;  4HLX A;  2GA1 A;  2QEN A;  2XAF A;  2MLK A;  5IT3 A;  2K4J A;  2EA4 A;  4BH9 A;  3TKY A;  5CVI A;  5HS9 A;  2GA2 A;  2HQN A;  2YX4 A;  3HOT A;  3WE2 A;  1KU7 A;  4PGH A;  3KEO A;  4N9I A;  1B1B A;  4HF2 A;  3T5X A;  2P6T A;  2K27 A;  4KT5 C;  3IWF A;  3DXJ F;  1BBY A;  5E8G A;  4M72 A;  2BV6 A;  5CYV A;  3QAH A;  1F5T A;  1Z9C A;  1TBX A;  1YQA A;  4P96 A;  5AIQ A;  3HTU A;  3LA3 A;  4HW0 A;  3TDU C;  2RC4 A;  4EJT A;  2IP2 A;  2QVO A;  2LF8 A;  5HDK A;  3LAJ A;  4EGZ A;  2H6C A;  2Y48 A;  3KET A;  3MCZ A;  4UV9 A;  1QNT A;  1LEB A;  2VT2 A;  1QQI A;  3ABU A;  2A07 F;  3DKW A;  4IRI A;  4RB1 A;  3F8B A;  4I01 A;  3WTX C;  1KU2 A;  2IA1 A;  2IJL A;  2QQ9 A;  4LGW A;  1ZAR A;  3DF8 A;  1B6A A;  2OZ6 A;  4WXD A;  3CUO A;  2M1B A;  2ZNY A;  3MEX A;  1A04 A;  1SFE A;  3MAJ A;  2P6S A;  4LD5 A;  1JGS A;  1J7K A;  2F5C A;  1B4A A;  1H0M A;  1W7P D;  3VFZ A;  4M6Y A;  1PP8 F;  1ZG5 A;  1Z6T A;  4D0P A;  1TW3 A;  3FM5 A;  1IAW A;  2XAQ A;  3BJ6 A;  2DQL A;  2VC0 A;  2WTE A;  4OIN F;  2XAJ A;  1KQ0 A;  1U3E M;  5H20 A;  2VBW A;  2YPR A;  3HRS A;  3O6B B;  1WI9 A;  3FXU A;  2VE9 A;  4LB6 B;  1AWC A;  1YIO A;  3HHH A;  2P5V A;  1TTY A;  2HYG D;  4N9H A;  3WGH A;  4LLG F;  4MTD A;  4LK0 F;  1IXR C;  3CJN A;  2V1X A;  2H09 A;  1HXD A;  4HOB A;  1GXP A;  1ZAO A;  4U7B A;  3LAP A;  2BE5 F;  2R7F A;  1YLF A;  3Q9S A;  1V4R A;  2BBY A;  4OOI A;  3FMQ A;  3GFM A;  3WU0 A;  4FX4 A;  5E1Z B;  3JW4 A;  4LFU A;  1WRJ A;  4IRH A;  3DEU A;  4EJW A;  1T0F A;  5L3C A;  3M1E A;  3T8R A;  2JRT A;  3KP6 A;  5J8C A;  3E5Q A;  2XKP A;  2DW4 A;  3WTT C;  3QRF F;  2VE8 A;  1TQP A;  5FLX K;  2COM A;  2OBP A;  3GVA A;  3WTY C;  1Q1H A;  2PQ8 A;  3E5U A;  4KMU X;  4Q47 A;  5LEJ A;  4B09 A;  4U0V A;  1B59 A;  1GXQ A;  2OZU A;  3E6B A;  4KN4 X;  3U9G A;  3IRR A;  3LFK A;  4AVP A;  4K2E A;  2AS5 F;  4Q48 A;  5BQT A;  1D8J A;  3TO7 A;  2DQR A;  1QZY A;  3DPT A;  1PDN C;  2VXZ A;  4G7O F;  1U2W A;  2D1H A;  1S8N A;  2VBY A;  1LQ1 A;  3KE2 A;  4WCG A;  5LGN A;  3LQR A;  2IVM A;  1U5T A;  3V8K A;  5LHG A;  1F9N A;  3GFL A;  4MEY F;  4XBF A;  1YYV A;  2KKO A;  5K5O A;  4QLC U;  4HAM A;  2PEX A;  3F8M A;  1FOK A;  4OIQ F;  3OOP A;  1UHW A;  1QZZ A;  5DD4 A;  4MGR A;  3JSO A;  6PAX A;  4UHT A;  5DCM A;  2DPU A;  5BOX A;  2WWY A;  2PG4 A;  3BRO A;  1S3J A;  4U7D A;  1KU9 A;  4L0Z B;  3Q5F A;  2PN6 A;  2YSR A;  1KQ9 A;  4PZJ A;  2FEZ A;  3F22 A;  1O3S A;  4YII A;  3ZMV A;  2HTJ A;  1W5T A;  1S7O A;  4LG0 A;  2XIG A;  2FBI A;  1STZ A;  3RIR A;  3KP7 A;  2XRN A;  5ERI A;  4I0A A;  3WGG A;  4UV8 A;  3RPQ A;  3HRM A;  3CO6 C;  1LDD A;  1P2F A;  2FBH A;  5HDG A;  4L18 B;  4NHJ A;  1OMI A;  2Q0O A;  1SD7 A;  3MWM A;  3BDD A;  1UST A;  4IHT A;  3L9F A;  2IPQ X;  5LRR A;  3MZH A;  5BMZ A;  1I1G A;  5DUK A;  2HKX A;  5L3G A;  1HW1 A;  3E3V A;  2W84 A;  4P9U A;  4Z2Y A;  5BS6 A;  5TJJ A;  4XSZ F;  3QOP A;  2Y75 A;  3JSP A;  2IT0 A;  4CDG A;  3GO5 A;  2HTS A;  2GIV A;  2DO7 A;  1XD7 A;  3ERE D;  1RUN A;  2A3S A;  3TOA A;  2QM3 A;  4MQ9 F;  2EA2 A;  4GO1 A;  1MZB A;  3WTU C;  1I5Z A;  2Q2E A;  5HS7 A;  5F6F A;  4O6J A;  5FO5 A;  1MKM A;  5K5R A;  2KRF A;  2P5L C;  4KIB A;  5LGU A;  3GLX A;  3ZN1 A;  5TRD A;  3F8C A;  4BNC A;  4I02 A;  2LNB A;  3M9A A;  1BI1 A;  3KEQ A;  3ZQ7 A;  4KYW A;  3LWF A;  2EV6 A;  1ZYR F;  3CO7 C;  1R1T A;  3ZMU A;  2G7H A;  4KA4 A;  1YG2 A;  3QP6 A;  3W6J B;  2IW5 A;  1OYI A;  4G6D A;  2DBB A;  2XKO A;  1P92 A;  1ON1 A;  2YX7 A;  2JPC A;  4HA8 A;  3I4P A;  1RZ4 A;  1RNL A;  1S6L A;  3QU3 A;  1XB4 A;  3K69 A;  3CUQ A;  1RI7 A;  2ADU A;  1L0O C;  4PDK A;  1YS6 A;  1KYZ A;  3TGN A;  1KA8 A;  3GWZ A;  1KGS A;  3T8T A;  4M73 A;  4EM2 A;  1IRG A;  2OU2 A;  5L3F A;  2ISZ A;  4HV6 A;  4Y17 A;  1TQI A;  2ZKZ A;  3BPV A;  3SZT A;  1G3S A;  2VC1 A;  4A6D A;  3R61 A;  1ZHF A;  4OU0 A;  1XSD A;  3FXR A;  4I2O A;  1XMA A;  4HYE A;  5L3B A;  5DYM A;  2QQB A;  2L3D A;  3HIF A;  4BHP A;  1O7F A;  4L9J A;  5D8K B;  3ISP A;  3C1D A;  5D5V B;  1S7A A;  1OPC A;  3IHU A;  1Y0U A;  3K2Z A;  4M6X A;  4PGG A;  2V1U A;  3I5U A;  1FY7 A;  2A61 A;  3GFI A;  1R1U A;  2NS0 A;  3BOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...