1DP7P

Cocrystal structure of rfx-dbd in complex with its cognate x-box binding site
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*(BRU)P*TP*AP*CP*CP*AP*(BRU)P*GP*GP*TP*AP*AP
publication title Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dp7P00
3DKWA 3R4KA 1R1TA 1IN8A 1WRJA 4F7ZA 2VBZA 1ZRDA 4LD5A 3K9TA 2GXBA 1TNSA 2DTRA 5K1YA 2RVCA 4Q5SF 1TW3A 3M8FA 5ILSA 3E5UA 3QPTA 4UXNA 5E17F 5K5RA 2NNYA 4ENKA 3BDDA 3G3ZA 5DCMA 4HDVA 1I1SA 3ZMDA 3REOA 5E1WA 3BPVA 2MA3A 1WI9A 1P2FA 5HS7A 2K02A 2UXXA 1R22A 2ZMEA 4A2UA 2RN7A 3F21A 3H92A 4L0ZB 1RUNA 3AAFA 5HDKA 2MD5A 2RDPA 1KU2A 4OIOF 2FNPA 4NQWA 3JAMZ 1EH6A 1Z91A 3RJPA 1LB2A 1YG2A 2BEOA 5HLGA 4L18B 2NYXA 3RYPA 2EB7A 2P6TA 2VBYA 5E1ZB 5H6QA 3EQLF 1F5TA 3V8KA 2EFWA 3BP8A 4WX9A 3KE2A 3BZ6A 2V9VA 1R1UA 2XAQA 4P9FA 5HS9A 2EFQA 3QP6A 3ZMVA 3HHGA 4KT5C 1BIBA 2K27A 3L2CA 1T0FA 1LEBA 3E3VA 1U2WA 1P4XA 4BNCA 1KA8A 3F8CA 2UWMA 1BC8C 2V1DA 3QPHA 3HOSA 1SD4A 1ZAOA 2ZO4A 3E6DA 5ILVA 3WGGA 4EJTA 3IKVA 5CVIA 3PQJA 1IUYA 3FWEA 3CUOA 2E1CA 1U5TA 2HYGD 3QU3A 4R79A 2F5EA 1FWZA 2HGCA 1XSVA 2P7VB 3H3UA 4LB6B 4G7ZF 1BI1A 4UUVA 3WTXC 2MBFA 5ERIA 1DUXC 3HIFA 1D8JA 2A61A 2YX7A 1SD7A 4Q47A 3C18A 3RIRA 3WTVC 4TV7A 1BOAA 1FOKA 1JHFA 3RKWA 1S8NA 1STZA 4K2EA 1BIAA 2P7CB 5J6XA 4EGZA 1K6OA 2V79A 2FXAA 2XHKA 3GUDA 2JTVA 2P5VA 4EV0A 1D5VA 4G6DA 4GCVA 1LDDA 3WODF 3LAPA 3T8TA 1U78A 3SFZA 2OZ6A 3J81K 1MJBA 5IT3A 1LQ1A 2OQRA 2ZCWA 2HTSA 1GHCA 2VT2A 4HBLA 2D1VA 3ZQ7A 1YFHA 3MFKA 2A07F 3LQQA 4U0YA 2BBYA 1YO5C 3KFWX 2FOKA 1R36A 1IXSB 2IA0A 3E5XA 2EWNA 5FFZA 4G7HF 2OBPA 3KEOA 5DD4A 5TRDA 5K5QA 2P5LC 1KQ9A 1HKQA 4R8HA 2HOEA 3R61A 2KIUA 1HXDA 2EK5A 2O03A 1TTYA 3Q9SA 2H27A 4EM1A 1I5ZA 4ENJA 1UHWA 2Q0OA 2R3SA 3RKXA 4E70A 3KLOA 4BH9A 2M1BA 2EV6A 2ZXJA 4Y15A 1W7PD 1BBYA 4H0EA 2O0YA 1IW7F 4ZH4F 3SZPA 4KNYA 1HKTA 5DCMB 2HEOA 2NNNA 4MTDA 1BN5A 5ICCA 3IWFA 4N9IA 1SD6A 2RNJA 5CYVA 1AWCA 5D5WB 3MCZA 1ZRFA 1KYWA 3WU0A 3J7AO 4Q48A 2GWRA 1T2KA 4U0VA 3H3ZA 2ZMEB 5L3FA 2DQRA 2PG4A 4XSZF 3BWGA 2K4JA 1TQPA 4EJVA 3GFIA 3G73A 4N9HA 2QVOA 1SD5A 1BI3A 2JPBA 1G4DA 1YW7A 4ZZDA 2A6HF 1OMIA 3CO7C 1XGSA 1G3TA 1P4AA 2FRHA 2KIFA 2PFBA 2XAFA 3PFIA 3GXOA 2HTJA 2HFHA 1FSHA 4AIJA 2DK5A 5IT9K 2V6CA 4IPAA 2QBYA 2EA4A 4HX7A 4EQQA 2CSOA 3GVAA 1J5YA 2E1NA 4GO1A 4A0XA 2M5WA 3EUHA 1Z9CA 1DPUA 1XGOA 2MH9A 3IKTA 3LA7A 3OOPA 3W6KB 2R7DA 3TOAA 3KP4A 3K1PA 4YIFA 4I09A 4CXFA 4EGYA 4MEYF 3V7CA 3KP3A 1XGNA 2YPRA 1D8KA 5E20A 4L9VA 3L00A 3VEPA 1S7OA 2BV6A 2QLZA 5DEQA 2X0LA 4LLGF 4A5NA 3KETA 5L3GA 4BQAA 3SQNA 4A6DA 1FT9A 4A6EA 1LVAA 4HZFA 2L4MA 2F5CA 3F3XA 2AS5F 1B6AA 4WWCA 1WKMA 3F22A 4XBFA 1S7AA 3TO7A 1FSEA 2EFOA 1ZLKA 5BPIA 2FA5A 3TDUC 3VFZA 3T8RA 1ZG3A 4BHBA 2FSWA 3DP7A 2LSOA 2ISZA 3P9CA 4LK1F 5L3EA 1FC3A 4M71A 3LA3A 4EJWA 2VODA 1GVJA 2IVMA 4NB5A 3JAMK 1R5HA 4N0BA 1KYZA 4FX4A 3SZTA 5FO5A 4KYWA 4PDKA 1ZG5A 2XAGA 1PUEE 2OU2A 2OD5A 2Z33A 5E8GA 5LEJA 4FHTA 2EV5A 5DCFA 4IRIA 1XDUA 2VE8A 3FXQA 1QGPA 1SFXA 5F1RA 4ESFA 2H09A 1USTA 1U6GA 5CVRA 3COAC 1V4RA 1KU7A 4CDGA 3V7SA 3HHHA 4GYGA 1FLIA 3I59A 2DI3A 1R58A 3BJAA 3CUQA 3WTZA 1U3EM 3ML6A 2Z99A 2NAZA 3P9IA 4MTEA 2DPUA 3I4PA 3NQOA 4GGGA 2PLYA 4O3MA 2HR3A 1D3YA 1MDMA 2KJBA 1G6NA 5D6FA 2G7HA 4Q4ZF 1FYMA 3KZYA 1HW1A 1Z6RA 4L5IA 4CO8A 4OU0A 2IT0A 3P7NA 1KQ0A 2BE5F 5CVVA 1WWXA 4P55A 2WTEA 3RPUA 2JRTA 4KDPA 4KIFA 2DPDA 4KA4A 1O7FA 2H6BA 3RPQA 2Y0MA 1ZREA 1HBXG 1TNTA 5DDGA 1B1BA 4Z2YA 1EV7A 3MZYA 3SXYA 1O3TA 1UCRA 5LHIA 3CTAA 5ICGA 4LK0F 2A3SA 2M30A 2V1UA 4CGZA 2ESHA 1SFUA 3JTHA 4O5VA 2P6SA 3J80Z 3ABUA 1LDKB 4RB0A 5TJJA 5LHGA 3ECOA 2CWEA 2XUBA 1QZYA 3WGIA 3HTUA 1E2XA 1U5TC 3QU6A 4KMUX 4AD9A 3ERED 4HOBA 5L3CA 1YW8A 1HW2A 1JXSA 1AOYA 4MNUA 3WTWC 3D0SA 1QPMA 1I1GA 3QP5A 2QBYB 2RKHA 2IRFG 4L5JA 2DAOA 2FMYA 4MHGA 3R0JA 1Y0UA 2FE3A 1LDJA 3N4MA 3KLNA 4O6JA 2GZWA 3CDHA 1J75A 3GZ6A 3HSEA 3LWFA 5FFXA 3BPXA 5HVQC 4JK1X 1I27A 3V8JA 3GFLA 4IJAA 5FLXZ 1BJAA 2HKXA 4AIKA 2KKOA 5ICEA 3NRVA 4R1HA 3MQ0A 4HX8A 2XAJA 5KK1A 2HQNA 1OR7A 1G3SA 2J5PA 5LEKA 3GX4X 2QYOA 1XMKA 3ZPLA 3V7RA 2XGXA 2CFXA 3O2PE 2LKPA 4G9YA 3I71A 3V8LA 5D5UB 3FHZA 5KVRA 1ZLJA 3E6BA 1OYYA 3EDPA 4WK8F 1OYWA 4RB1A 2STWA 3HSRA 1YW9A 3KZZA 2DLLA 2MLKA 4ZZLA 4HV6A 4OMYA 4WXDA 2ESNA 1GXQA 4ETSA 3W6JB 4HX4A 4RB3C 4EM0B 2BGCA 4DNCA 5HDGA 5D4SA 5ICFA 3KCCA 1JGSA 4RGUA 3WE3A 1Z7UA 1FBQA 3F72A 2QWWA 3CLOA 1OYIA 2L02A 4LGWA 3DQVC 3VODA 1W4MA 2OZUA 4WCGA 4L0YB 2VE9A 3BY6A 1YQAA 4BYYA 2EFPA 4KICA 5BQTA 1MZBA 2EA2A 3IL2A 2JZYA 2XASA 2CYYA 3F6OA 4KN4X 4A0ZA 4AIHA 1QBJA 1T6SA 1J9IA 1EH7A 3TOBA 3ECHA 1YS7A 2ZBKA 4UVBA 4RAZA 1J2XA 4YG2F 4UHTA 1IRFA 2PJPA 1RZ4A 2L4AA 1T38A 5FB2A 2EFNA 2NRAC 3E6CC 3ZP5A 5D4RA 3L7WA 1LJ9A 3I0TA 4ZYHA 5K5OA 1G3YA 2D45A 3FXRA 2GA1A 3FM5A 4HF0A 4EM2A 1XSDA 4M6XA 2FF4A 3T0YA 2ETHA 1XCVA 3I59B 5A2QK 5FD6A 3CUQB 4YIIA 2A5YB 2FMLA 5J8FA 2W25A 4RGSA 1HSTA 2MLGA 2MC3A 2NS0A 4OOIA 3TQNA 3WTYC 1MDMB 1P4WA 1B9MA 4EMSA 3FX3A 3MZHA 2HWVA 4CICA 3I64A 2CO5A 2P4WA 4UVCA 3BJOA 3F8NA 3F23A 1HQCA 2YU3A 3J81Z 2PEXA 3MEXA 3F8FA 2DW4A 3FMRA 1FX7A 2Q2EA 2W84A 3K1NA 1C0WA 3C3WA 1XGMA 3IHUA 4XSXF 1TW2A 2C6YA 1W5TA 1XB4A 3GLXA 2GQQA 3GFMA 2R7FA 2M45A 2A68F 1H9GA 4UVAA 1K7AA 2STTA 5F6FA 1TQIA 3LFKA 5FD5A 4BXUA 1OKRA 1ZHFA 2L54A 2F5FA 3M7GA 4LFUA 2TDXA 2OAZA 2RQPA 3WTUC 5CVUA 1O7LA 1A04A 5H20A 2GXGA 1FNNA 3L9FA 3LA2A 4Y17A 4HLYA 5JFRA 1I6XA 4PCQA 2ELHA 1GXPA 3ZMSA 1TLHB 2OA4A 2ZKZA 1SMTA 4U0WA 5BOXA 3O6BB 4WF2A 3KP2A 5CLSA 4FX0A 4B09A 1XSXA 3KP5A 4BAYA 1HKSA 4L9TA 1CGPA 4ZYEA 1JE8A 3KP6A 1LNWA 4GYIA 3F6VA 3ZN0A 1ODDA 2PMHA 1PDNC 1K78A 4P96A 4GXOA 2RV8A 4P5OA 2W85A 2A69F 3WG9A 1IZ1A 3VB2A 5EEHA 1QQIA 3OV8A 4EJOA 4S04A 1IN5A 3K1MA 1WSUA 5E18F 2DK8A 3GWZA 1IN4A 1YLFA 1H0MA 2RGVA 3E5QA 3QOPA 1KGSA 3WTTC 4YFNF 3QRFF 2A6EF 4OINF 3CJNA 2HS5A 2QUFA 4KIBA 4L9NA 3CO6C 3K69A 4PGHA 2ADUA 1YYVA 2O3FA 1S6LA 2K7LA 4IXAA 1H9TA 3HRSA 4UV8A 1MJAA 3DPTA 2QQBA 2DU9A 3E97A 4RGRA 3RTRA 4ZYGA 4ON0A 1SAXA 4MEXF 4HA8A 1MKMA 5LLQA 3NEUA 5LGTA 3IRQA 3ISPA 3SHFA 3MAJA 5AONA 1O57A 3CUQC 1ZGAA 4WXHA 1ON1A 5JI6A 2Y48A 1T39A 4G94A 2VXZA 2XKOA 3T5XA 1TQMA 1ONVA 3KEQA 4U7DA 1USSA 5BS6A 3BROA 2Z3YA 4BHCA 3J80K 1YS6A 5JHUA 3DV8A 3B02A 1E17A 5EEGA 3ABTA 4YFKF 2AXLA 4A0YA 3IC7A 3N97A 1FPQA 2IA2A 2G9WA 4G8XA 1U8RA 4EVIA 1F1ZA 4I2OA 3GFJA 5E8IA 1XCBA 4CZZA 1CF7A 4OMZA 2BYVE 4IVNA 5H6RA 2IA1A 2P8TA 4MGRA 1K79A 2FNAA 1DDNA 2EV0A 3D5LA 4LMYA 3VOEA 2J5OA 3RDIA 3TO9A 2CG4A 3EYYA 3RI4A 4JQFA 2VC1A 4U7BA 4CHUA 3I5UA 2M87A 3O3KA 2L01A 1UHMA 5FLXK 4HQMA 1SFEA 3TGNA 4IHTA 2HQRA 1O3SA 2YSRA 2H6CA 2UXNA 4G6QA 4OIPF 1ZARA 1F4KA 4JBAA 1BC7C 4I02A 2DO7A 2E7WA 3I54A 4LJZF 2FBIA 3FF5A 1REPC 2VONA 3GW2A 4ZYDA 2Y75A 2G7UA 2JT1A 2ZFWA 3R0AA 4MQ9F 3GF2A 3GYHX 3L09A 2PQ8A 3LSTA 1QNTA 2K86A 2GIVA 4ASNA 4S05A 5J8CA 2Z5UA 1IXCA 3GZ5A 5HLHA 5D5VB 1ZH5A 3BJ6A 4M73A 5D8LB 2LNBA 2QENA 2FEZA 1W7PA 3M8EA 5LGNA 2QQAA 4KN7X 1KQ8A 4NHJA 5E1XA 2HYFA 1R7JA 2VOPA 4ENNA 2D2WA 3JSOA 4LB5A 1FP2A 2DQLA 2D1HA 4IRGA 2DFIA 2ZJ2A 3ELKA 5D5XB 3E6MA 1O3QA 3S2WA 5D6EA 5BMZA 2XVCA 1P92A 3K0LA 5LRSA 1XDSA 5CVJA 5JR3A 2YR2A 1IXRC 4P9UA 3PQKA 5LHHA 2W24A 1IF1A 2XV4S 3U9GA 2B0LA 1G3WA 3V4GA 4U88A 5BPDA 3HTSB 3U1DA 3HRUA 2KJCA 2IPQX 4KIGA 5F64A 2KIMA 1ULYA 2VOOA 2PBIA 3KP7A 1RUOA 2K4BA 1Z6TA 1J59A 5AIPA 3DXJF 5DUKA 1K78B 5HOOA 3WGHA 2ISYA 1YTYA 1OPCA 2HZTA 4HDUA 3I58A 1R00A 4LLLA 1SMYF 1ZRCA 2PMUA 3HRMA 2VT3A 1L0OC 3QAHA 1R23A 1S29A 2CQKA 5DV5A 4M9XA 3Q9VA 3GEZA 1WQ2A 2WV0A 4AVPA 1YIOA 4KFCA 3P9KA 4RB2C 1RNLA 3HSFA 2LDUA 4LG0A 1IAWA 1MJ9A 4OIQF 5CJ9A 5DYMA 1F9NA 2FU4A 2O8XA 1MGTA 3EYIA 3R6SA 3JTGA 2O6GE 5D8KB 4HAMA 1ZN2A 1X3UA 3M9AA 2MH2A 4FT8A 3FZVA 4WXCA 5L3BA 1ZGJA 3JW4A 4OIRF 1MD0A 1R1VA 1P6RA 1PP7U 2VC0A 1O3RA 2F5DA 5AIQA 2F2EA 1RIOH 1EH8A 2FBHA 3JSPA 4G7OF 4HLXA 4PGGA 4IF4A 1BM9A 3Q5FA 2QM3A 4M6YA 1IRGA 4CYDA 3FMSA 2VBXA 1IN7A 3R60A 1T98A 3ZMUA 1XD7A 3IWZA 1KU3A 4ENMA 4IHSA 5HDNA 2LF7A 1CF7B 1ZYRF 2ZNZA 1L3LA 1JHHA 2JPCA 1FZPB 1DPRA 3TDZC 4M9ZA 2QZ8A 2IW5A 5HLIA 4DQ2A 2W57A 3DPLC 4I01A 3HUGA 2E7XA 1HSJA 3DEUA 3FXUA 4PZJA 2HDCA 4UV9A 4LLNA 4M72A 1FP1D 3WE2A 2L3DA 4M9SA 2XAHA 3F8BA 3K2ZA 1IN6A 5LBQA 3M1EA 3B73A 3HRTA 3DF8A 5DUIA 1BI0A 5HS8A 4QLCU 1FBSA 5LRRA 2O61A 4M74A 2EJRA 4A12A 1VTNC 2ACJA 4YFXF 1B4AA 2ZNYA 1FYLA 2LF8A 4L9JA 2PI0A 3FM3A 2XRNA 2HKOA 2GAUA 5DD8A 3C1DA 1PP8F 2CW0F 2DBBA 3LAJA 4I0BA 3WTSC 2GA2A 3DFGA 2H94A 1XMAA 2KRFA 5L3DA 4HV5A 3IRRA 1V3FA 1W7PB 2P5KA 2X4HA 4I7HA 4AWXB 4BHPA 1BI2A 4D0PA 3I53A 3GO5A 6PAXA 5A2QZ 4RAYA 2V1XA 1R5GA 2RC4A 3RYRA 1TBXA 3ZN1A 4EJUA 2CGPA 4B8XA 1NHAA 2FBKA 4XLPF 1XN7A 3TKYA 1ON2A 1UFMA 2IP2A 4MQVA 4HQEA 2FQ3A 3ZMZA 2UZKA 4Y13A 3ULQB 1LEAA 3C7JA 4HYEA 4IRHA 1J0RA 2VN2A 4HW0A 1U5TB 4UNOA 4QWQA 2OQGA 5FGMA 3ROUA 4XLNF 4XRFA 1Q1HA 3ZMTA 3MWMA 2XKPA 2IJLA 2WWYA 4RS8A 3LQRA 4KUMA 2JSCA 2COMA 1QZZA 2DT5A 2VBWA 2YX4A 3EETA 1S3JA 4ESJA 2PN6A 1J7KA 5IT9Z 4RGXA 2WC2A 1DP7P 1FBUA 1Z05A 2QQ9A 3WU1B 3TO6A 5ED4A 3HOTA 1KU9A 1UB9A 4I0AA 1B59A 3RKYA 5ILUA 5LGUA 1W5SA 4I98B 2XIGA 4ESBA 3T1BA 1ZG1A 4LG0B 3FMQA 1FYKA 2XROA 4HF1A 2Q8KA 1HW5A 1QO0D 1RI7A 3HYIA 3BOQA 3F8MA 4HF2A 4KMFA 2M8EA 1Z1DA 3U2RA 4A5MA 1FY7A 5JVTA 2Z9OA 1B9NA
chains in the Genus database with same CATH superfamily
4XKVA 2M7BA 5IP6A 3DKWA 1I39A 3GZNB 2ZXWH 3N05A 3GTJJ 3B6AA 1R1TA 3R4KA 4FCYA 1IN8A 2KFDA 1WRJA 3U21A 1SVMA 4F7ZA 5M5YJ 1SVOA 2VBZA 1ZRDA 1VQ8I 4LD5A 3K9TA 2GXBA 1TNSA 2DTRA 2DT7B 5K1YA 3M1CA 2RVCA 1JJ8C 4Q5SF 1ZTRA 1TW3A 3M8FA 5ILSA 3E5UA 3QPTA 2I10A 4UXNA 5E17F 5FKNA 5CPRB 5JLXA 2CH0A 2DA4A 3BG9A 5K5RA 2NNYA 3PNYA 4ENKA 3BDDA 3G3ZA 3TBIA 1P9QC 2VIXA 4FQGA 5DCMA 1WH5A 4HDVA 4ZTJA 2WB1N 2XF7A 4XKBA 3S14J 1I1SA 3ZMDA 3LMMA 3LSIA 3CC4I 4YIRX 1JKPC 3REOA 5E1WA 3BPVA 3CDIA 2R5ZA 3J7ZI 1Y39A 1B72A 1HF0A 2MA3A 4DW6A 1WI9A 1P2FA 5HS7A 2K02A 2UXXA 1ORKA 3DU6A 4PSWA 1R22A 2DN0A 2Y30A 3Q0WA 3BZCA 2ZMEA 4A2UA 2DA3A 3K4LA 2RN7A 3F21A 2VPLA 2E5NA 1P7IA 3OOUA 2DDBA 3H92A 1KONA 1A6IA 3ASOH 4L0ZB 1RUNA 3AAFA 5F27A 2UUZA 1PUFA 1APLC 5B1BH 3HUGB 5HDKA 2MD5A 2VI6A 1D5YA 2RDPA 2DOAA 3H0DA 1KU2A 4M6VA 5EGOB 4OIOF 2L2OA 2FNPA 4NQWA 2NVUB 3BTLA 1UHSA 3PNVA 4PJJA 1XX5A 3JAMZ 1R4MB 1EH6A 1R71A 1Z91A 3ZQFA 2GM4A 4IHVA 3IH2A 1UG0A 3RJPA 5GADJ 1LB2A 1YG2A 2BEOA 1ZELA 5HLGA 5F0HA 2V9PA 4G6TB 5IYCJ 4L18B 2NYXA 5EYRA 3RYPA 3L2QA 2EB7A 2WAEA 1ETVA 5J3LA 4DZJA 1JUSA 2P6TA 2MGQA 2Q1ZB 2VBYA 5E1ZB 4LOCA 2MC4A 5H6QA 3VYRB 3EQLF 1F5TA 3V8KA 2EFWA 3BP8A 4WX9A 1MBEA 3KE2A 1OCZH 3BZ6A 2EIKH 1VQOI 1FTZA 2V9VA 4HNTA 1WJEA 1R1UA 4BDYA 2XAQA 4P9FA 2HVSA 5HS9A 1VFCA 2Z2SB 2EFQA 3QYEA 3HPHA 2NVQJ 1X19A 3QP6A 2BHYA 3ZMVA 1RC9A 3JRIA 3JR9A 2K40A 3HHGA 3H9QA 4CZCA 3EUAA 4KT5C 1RRJA 1BIBA 5EZGA 2K27A 3L2CA 1T0FA 1LEBA 3E3VA 1U2WA 2LR8A 1P4XA 4BNCA 3B6CA 1KA8A 3OYLA 3F8CA 2UWMA 3OS2A 3G2BA 2NVYJ 1JGGA 1BC8C 2V1DA 3QPHA 4HRIA 2WB1A 3HOSA 1ZR4A 1SD4A 1YITI 1AKHA 1JI8A 1HOMA 3W2WA 1ZAOA 2DMTA 2ZO4A 1XPXA 3BR6A 1N78A 3E6DA 1SANA 2JMWA 3BQYA 5ILVA 3WGGA 1ZK8A 4X0GA 1YJWI 1U0JA 4EJTA 3IKVA 3OSGA 2ZJQF 5CVIA 3PQJA 3ZRGA 4N4NB 1FJLA 1IUYA 1E3HA 3I55I 3FWEA 3OYEA 3CUOA 2JRMA 2O5RA 2X6XA 2E1CA 1U5TA 2HYGD 2IS6A 5CKTA 2WY8Q 3QU3A 2K85A 4R79A 1R5ID 3BQZA 2VUMJ 2F5EA 1FWZA 4XOTA 1N75A 2WAQN 4MO7A 2HGCA 1XSVA 2WA0A 4FE4A 2P7VB 3MKZA 1DQUA 1MBJA 5K7ZA 2TRTA 3H3UA 3IAS2 2LMDA 1Y1VJ 4LB6B 4G7ZF 1BI1A 4HNUA 3PL8A 1F43A 4IQ4A 3WTXC 5FKLA 4UUVA 2MBFA 3SEZA 5ERIA 5C3EJ 2M4KA 1DUXC 3HIFA 1D8JA 3OYGA 3IH3A 2A61A 3S1QJ 2YX7A 4G12A 1SD7A 3QYBA 3S3MA 3FBNB 1GDTA 4Q47A 3C18A 3RIRA 4RLFA 3QWLA 3WTVC 4TV7A 1BOAA 1LFBA 1FOKA 3OYHA 3CP2A 1S72I 1JHFA 3RKWA 1WZ2A 1S8NA 1STZA 2D5VA 4K2EA 4FETA 1BIAA 2P7CB 5J6XA 2P81A 2V9KA 4EGZA 1K6OA 4A93J 2V79A 2YU9J 4I99C 2FXAA 2N8GA 1ETWA 1D1CA 2XHKA 3GUDA 2JTVA 1ZR2A 2P5VA 4EV0A 1D5VA 4G6DA 4GCVA 1LDDA 4MFEA 3WODF 3LAPA 1MMNA 1OCCH 1MMDA 3T8TA 2BXZA 4RMNA 1B8IA 1U78A 3SFZA 5BNGA 3BZKA 1IV8A 2OZ6A 3J81K 1MJBA 5IT3A 3OS0A 1LQ1A 3UKGA 2OQRA 2ZCWA 4B43A 4XQFA 2LH9A 4PK4A 2HTSA 4AIDA 1A6QA 2CQ7A 1GHCA 2LBFA 3D5SC 2VT2A 4HBLA 3SFIA 1H88C 2D1VA 4XIDA 3ZQ7A 2CV0A 1T8IA 1YFHA 4NBQA 4BBSJ 3MFKA 1JJ6C 3GCMA 1VQMI 2A07F 3OYIA 3K4NA 3CCVI 3GTMJ 3LQQA 4U0YA 2BBYA 1YO5C 3KFWX 1UZCA 1R36A 2FOKA 1IXSB 2IA0A 3E5XA 1VQ9I 1WH7A 2EWNA 2WAQA 3ABLH 5FFZA 4G7HF 2OBPA 3FKIJ 4GFBA 3CCMI 3KEOA 5DD4A 5TRDA 5K5QA 2P5LC 1KQ9A 1HKQA 4R8HA 1M1EB 5HODA 3HKZN 2HOEA 3R61A 2LP0A 2KIUA 2XGDA 4CA0A 1HXDA 2EK5A 3ESWB 2O03A 1MSEC 1TTYA 3Q9SA 2H27A 4EM1A 1I5ZA 4ENJA 3TW6A 4LG3A 1UHWA 2Q0OA 2WAFA 2R3SA 3RKXA 4E70A 2CRGA 4AC0A 1R9TJ 3KLOA 4BH9A 2M1BA 2EV6A 2ZXJA 4Y15A 1W7PD 1BBYA 2DJNA 4LIUA 4DBRA 2I5UA 2HQ5A 2O0YA 3QODA 1IW7F 2ZB9A 4ZH4F 4H0EA 1SEUA 2DXIA 1YIJI 3SZPA 4KNYA 1HKTA 5FKMA 5DCMB 2HEOA 2KP6A 2NNNA 4MTDA 3ASNH 4FTHA 1BN5A 4DJAA 2M2EA 4AYBN 2VJJA 3RSNA 3H3VK 2XPVA 5ICCA 3CCUI 4MIMA 3IWFA 4N9IA 1SD6A 5GAGJ 2Z1DA 2R5ZB 1B72B 4NNJA 2RNJA 5CYVA 4RA2A 1AWCA 4RDUA 5D5WB 3IH4A 3MCZA 1ZRFA 1KYWA 3WU0A 3J7AO 4IOCF 4Q48A 2GWRA 2R92J 1T2KA 4U0VA 2EQRA 2VKDA 3G1OA 3H3ZA 4XLFA 3X2QH 2ZMEB 5L3FA 1D0XA 2DQRA 2PG4A 4XSZF 3BWGA 2K4JA 1QRYA 4RAGA 4CSWA 1PUFB 1TQPA 3BCBA 4EJVA 3H9GA 2E34A 2EBIA 3GFIA 3G73A 4NQWB 4N9HA 4BQQA 4XKCA 2IAIA 2QVOA 2CQQA 2JA5J 1SD5A 1BI3A 2JPBA 1G4DA 5JLWA 2HZDA 1YW7A 2K9MA 2ZXHA 4ZZDA 2A6HF 4LIVA 2R7UA 2KZVA 2BOLA 4XICA 1OMIA 3CO7C 3AL0B 2CUJA 1POGA 4CCKA 1XGSA 1G3TA 3CMAI 1I6HJ 2M34A 2V1NA 1P4AA 2FRHA 3QPSA 3DCFA 1Z3XA 2KIFA 3HOVJ 2PFBA 1JUPA 2XAFA 3W3CA 1XG1A 3PFIA 3GXOA 2HTJA 2VL8A 2HFHA 3ZCOA 1FSHA 4AIJA 5K7FA 2CU7A 3FXMA 1WPKA 1BA5A 4IHWA 1I3QJ 2K9NA 4X6AJ 3HKZA 2DK5A 4UB6C 5IT9K 2V6CA 4IPAA 2QBYA 2EA4A 4HX7A 4EQQA 1Z3YA 1W0TA 2CSOA 2M3AA 3GVAA 1J5YA 3KEYA 1SVLA 4M3FA 2E1NA 4B3XA 2VQHA 4ZDPA 4GO1A 1PYVA 4A0XA 4XOPA 4AM3A 3CLQA 1T95A 2M5WA 3EUHA 4ZYAA 1Z9CA 2BW3A 3LNQA 1DPUA 1FIPA 1DGRM 1BR2A 1XGOA 2MH9A 3IKTA 4GDFA 2OCCH 2GOMA 3LA7A 3OOPA 3W6KB 2EINH 2KT0A 2AHQA 4F92B 4YRVA 3JREA 2R7DA 1E3PA 3KP4A 3K1PA 4QPQA 3TOAA 5M3MJ 1FEXA 3FK6A 1AKHB 1RKTA 4YIFA 4AYBA 4I09A 4CXFA 3L2WA 2ZFUA 3ERMA 5FKKA 4EGYA 1ETQA 2QF7A 4C3HJ 4MEYF 3V7CA 3LSKA 3KP3A 3CQZJ 1XGNA 2YPRA 1D8KA 1TZLA 5E20A 4L9VA 5J4VA 4A3JJ 1VZ0A 3L00A 2IS1A 3TEDA 3VEPA 1S7OA 2BV6A 3OYFA 4AVZA 3AG1H 2AQEA 2M4GA 2QLZA 4OAZA 5DEQA 2X0LA 4LLGF 2X85A 4A5NA 2DMUA 3KETA 1H8AC 5L3GA 4BQAA 3SQNA 4A6DA 1FT9A 4A6EA 1LVAA 2VJIA 3CCSI 2R7ZJ 2ELJA 4HZFA 2L5QA 4IX7A 3PJRA 3BTCA 2CJJA 2L4MA 3OYNA 4A3GJ 5FROA 3S3NA 2F5CA 3F3XA 2H8WA 2AS5F 1B6AA 4WWCA 1HCRA 1WKMA 3F22A 2Y69H 4XBFA 1VNDA 1S7AA 3TO7A 1FSEA 2V6EA 2L9VA 3CJRB 2EFOA 1ZLKA 5BPIA 1ETKA 2HPIA 2FA5A 3TDUC 2RREA 3VFZA 4OAYA 2MABA 2KMUA 3OR1C 3T8RA 4F55A 1U9NA 3HEFA 1ZG3A 3DLAA 3S32A 2XRLA 4BHBA 1K61A 2Z16A 4L5EA 1G8XA 2FSWA 3DP7A 4QTRA 3UNGC 5IPAA 2LSOA 2ISZA 3P9CA 1RESA 2HVQA 4LK1F 5L3EA 1FC3A 5KAIC 2KL4A 2QQ8A 4M71A 3LA3A 1O4XA 4HSRA 1MH4A 5GPCA 2XPUA 4EJWA 2VODA 1GVJA 1MBHA 2IVMA 2HVRA 4NB5A 3RQ4A 2AQFA 3JAMK 1R5HA 1ZGWA 3W6VA 3ZQIA 1IRXA 4N0BA 1B8IB 1KYZA 4FX4A 1X4OA 1RR7A 1TT5B 1V55H 4DYCA 3SZTA 5FO5A 4QPOA 1X4PA 4KYWA 4PDKA 1ZG5A 1LVKA 3E7LA 1XC5A 2XAGA 1D0ZA 1PUEE 1X2MA 2OU2A 2OD5A 2Z33A 5E8GA 5LEJA 4FHTA 2LBFB 2EV5A 5DCFA 2A05A 4IRIA 4XONA 2EZIA 2OPTA 3OYBA 3K4KA 1XDUA 2BY0A 4XLEA 2ZJRF 2VE8A 3FXQA 5DM7F 4Y33A 1QGPA 1SFXA 5KHDA 5F1RA 4ESFA 2P0WA 2H09A 1VQNI 5F0FA 1USTA 2R7WA 2DMPA 2ZMEC 4BXXJ 1U6GA 3HOWJ 5CVRA 3LSGA 3COAC 1V4RA 1WCMJ 1I3AA 1KU7A 2W48A 4CDGA 3V7SA 3JRBA 2RQQA 2WY7Q 3HHHA 3HBLA 4GYGA 3ABKH 4PFPA 3S1RJ 1FLIA 2H8RA 1XS9A 3I59A 2DI3A 1YRNA 1R58A 1ETOA 3BJAA 3CUQA 3WTZA 1U3EM 3ML6A 2Z99A 2NAZA 3K10A 3P9IA 4MTEA 3RZOJ 2DPUA 3I4PA 1A31A 2L9RA 3NQOA 4GGGA 2PLYA 2HOSA 3LFUA 4ITVA 4O3MA 2KPMA 3LSMA 2HR3A 1D3YA 3H9JA 1MDMA 1RKWA 2KJBA 2Y31A 3U1KA 3ZQGA 1G6NA 1MNDA 5D6FA 3ONQA 2G7HA 3DTIA 4Q4ZF 2A6TA 1FYMA 3KZYA 5FLVA 2QSFX 1HW1A 1Z6RA 3VSKA 4L5IA 4CO8A 4OU0A 2E35A 3M07A 2IT0A 3P7NA 1KQ0A 2BE5F 5CVVA 1WWXA 4P55A 1LFPA 4YEJA 3F0CA 2HQAA 2WTEA 2K9SA 3RPUA 2PJRA 2JK3A 4ABZA 2JRTA 4KDPA 4KIFA 1JT0A 4V19K 4M3GA 2DPDA 3FXLA 1JTYA 3HXLA 4KA4A 1O7FA 2E2HJ 2H6BA 3RPQA 3VDXA 2Y0MA 1ZREA 1HBXG 3BR0A 1A36A 2RNGA 1TNTA 5DDGA 1NH3A 1B1BA 1MW7A 4Z2YA 1EV7A 4MLOA 1VQ7I 3MZYA 3SXYA 4BXFA 1O3TA 1UCRA 3SZGA 5LHIA 1T0FC 3CTAA 4Y4RA 4LK0F 5ICGA 2A3SA 3S3OA 2M30A 4E4HA 2V1UA 4CGZA 2ESHA 1BR1A 1Z7LA 1SFUA 3OYDA 1FOYA 3GLLA 3JTHA 4YELA 2X1CA 4O5VA 3D1NI 1IUFA 5IYBJ 4B4CA 2P6SA 2EZHA 3J80Z 2HNHA 3GBGA 1W0UA 3NAUA 1JKRC 1R6RA 3ABUA 3DBHB 2IXSA 1LDKB 4OWRB 1EA3A 4RB0A 5TJJA 5LHGA 3CP8A 3ECOA 2CWEA 3W2VA 3RQIA 2XUBA 1QZYA 2R4GA 3WGIA 4C9YA 2JVHA 3J7YJ 1WVRA 2E1OA 3HTUA 4A3DJ 3FXKA 2B7EA 1E2XA 1U5TC 3KYCB 4EEFG 3QU6A 4NC8A 1AHDP 4KMUX 2F6CA 4AD9A 3ERED 4HOBA 5E3OA 3KYDB 2CW7A 2FOWA 5L3CA 1YW8A 1HW2A 1JXSA 1AOYA 4MNUA 3WTWC 4CCNA 2K3PA 3D0SA 3UR3C 1QPMA 4BEHB 1I1GA 3QP5A 2QBYB 1HDDC 3F9KA 1WJDA 3HGYA 2RKHA 3ZQCA 4L5JA 2XSDC 2IRFG 2DAOA 2FMYA 4MHGA 3R0JA 1Z21A 3HG9A 1Y0UA 4D1QA 2FE3A 2YS9A 1LDJA 3N4MA 1LPQA 3KLNA 4LITA 4O6JA 1HDPA 2ME0A 2GZWA 3CDHA 3G6EI 1J75A 3GZ6A 5CQGA 2X6OA 2BW3B 3BG3A 4A69C 1X58A 5EJCA 3HSEA 3VYUB 3LWFA 5FFXA 2K9QA 3BPXA 5HVQC 2XPWA 3CJTB 4JK1X 2Y2ZA 2LFBA 1I27A 3V8JA 3HOUJ 2KLOA 3GFLA 4IJAA 5FLXZ 1V54H 4A3CJ 2COBA 1BJAA 2HKXA 2MD0A 4AIKA 3MKLA 2KKOA 5ICEA 3NRVA 3S8PA 3OWTA 4R1HA 3DU5A 3MQ0A 4I6ZA 2ZXIA 4XM3A 4HX8A 5HLTA 2CMPA 2XAJA 1K6YA 5KK1A 2HQNA 1G2HA 5EZHA 1OR7A 1G3SA 2J5PA 3H1CA 5LEKA 3MKYB 4JX4A 3GX4X 2QYOA 1XMKA 3ZPLA 4F91B 3V7RA 2XGXA 3VYTB 2CFXA 3O2PE 2LKPA 4G9YA 3S2DJ 3I71A 1IDYA 3KX2A 4PJNA 3V8LA 4S0HB 1FTTA 1YX3A 5D5UB 3FHZA 1T08B 5KVRA 1EKEA 1ZLJA 3E6BA 2CW8A 2L9NA 4I76A 1OYYA 2ID6A 3O8HA 4RM3A 3SDBA 4C3JJ 3HL2A 3EDPA 1TWCJ 4WK8F 4AU7A 1OYWA 5EEAA 3SJMA 4RB1A 2LKXA 4XL9A 2STWA 1TWAJ 3HSRA 1YW9A 4CCJA 3LSRA 2OV7A 3KZZA 2R93J 2OF7A 1MIJA 2JN6A 2DLLA 2MLKA 4ZZLA 4QSHA 1Y6IA 2E60A 3AG3H 4HV6A 4OMYA 2X51A 4WXDA 2ESNA 1GXQA 3QPLA 1MBFA 3PNTA 4ETSA 3JRFA 3W6JB 4HX4A 3K70C 4XR6A 4RB3C 4EM0B 1GUUA 4IO9F 2BGCA 2F4OB 4D7MA 4DNCA 5HDGA 3AFHA 5D4SA 5ICFA 1UELB 4BJTA 2IGKA 2DMNA 3KCCA 2OJED 5DS9A 1JGSA 4RGUA 3WE3A 1Z7UA 1FBQA 3F72A 4JOMA 1QHGA 1ZQ3P 2QWWA 3CLOA 4DGWB 1OYIA 5B66C 2L02A 1ITYA 2M0MA 4NC6A 4LGWA 3DQVC 2LY9A 5B5EC 2X1DA 3LL7A 1W4MA 3VODA 2OZUA 4WCGA 4X1EA 3C2HA 3LSPA 2LOOA 2A5WA 4L0YB 3Q0VA 4DBQA 2VE9A 3BY6A 1YQAA 4BYYA 2YUSA 2EFPA 4KICA 3GMEA 2DT6A 3BLYA 2L7FP 1IDZA 2GLOA 4CYCA 5GAEJ 5BQTA 1MZBA 2XASA 2EA2A 2JZYA 3F6OA 2CYYA 4KN4X 3IL2A 4NC7A 4A0ZA 2M0CA 4AIHA 1QBJA 1T6SA 2DFFA 4Y52J 2F4MB 3CCYA 1J9IA 4E7HA 2LYCA 5FLMJ 2JWTA 3C2BA 1GLNA 3PSIA 3S93A 2CQNA 1EH7A 3MN2A 3TOBA 3ECHA 3WU2C 2M9HA 1V5FA 1YS7A 1S5LC 1WJFA 2ZBKA 1TL8A 3V42A 3OIQA 4UVBA 4RAZA 1J2XA 3S1NJ 4YG2F 2QKLB 1ZKGA 5IYDJ 4UHTA 1IRFA 2PJPA 1RZ4A 3I4MJ 2L4AA 1T38A 2E71A 2ZSIB 5FB2A 4N4OB 1ETYA 3DEWA 1MMSA 2EFNA 3VWBA 2NRAC 3E6CC 2DFEA 3ZP5A 5IY5H 5D4RA 2DA7A 3L7WA 3MVPA 2MG4A 3ZQHA 1LJ9A 3I0TA 3P5JA 2NXNB 3M8JA 4ZYHA 1UAAA 3FK7A 5K5OA 1G3YA 1WJBA 2D45A 4BE0A 5F0CA 3FXRA 2GA1A 3FM5A 4HF0A 3ZGKA 1RR8C 4EM2A 1XSDA 2ELKA 4M6XA 2EIJH 2BVLA 1TWFJ 2FF4A 2Y0SN 3T0YA 2ETHA 1XCVA 3I59B 5A2QK 3JRHA 2NOJB 1YRNB 5FD6A 2XB5A 3CUQB 2UV1A 4YIIA 2A5YB 4C2UA 2FMLA 5J8FA 1BOBA 2W25A 2ID3A 4RGSA 1HSTA 2XGEA 2MLGA 5B1AH 4B3AA 3OYKA 1LKXA 2MC3A 2NS0A 4M3EA 4OOIA 3TQNA 3WTYC 1MSFC 2XSJC 1MDMB 2VPRA 4RM2A 2V7FA 1MBGA 4ZJZA 1P4WA 1B9MA 2VJ5A 4EMSA 3FX3A 3OY9A 4MFDA 3MZHA 2HWVA 2W82A 2LKSA 5E79C 4CICA 2L0KA 3D5RC 2H1KA 3I64A 2R7SA 3FXOA 2CO5A 5C44J 2P4WA 1T56A 4UVCA 4XRSG 1RETA 1TP4A 2CV2A 3BJOA 3FHNA 4II3A 3HPGA 3JRDA 2PJRB 3F8NA 3F23A 2DFHA 2K9LA 1HQCA 2YU3A 3J81Z 2PEXA 3NARA 3GTKJ 3MEXA 3F8FA 2DW4A 4J00A 2CS3A 3FMRA 3EUHC 3OL4A 3K4CA 1FX7A 1VQPI 2Q2EA 3OIOA 3S15J 3G1LA 2W84A 5EG0A 4IHXA 3K1NA 3FXJA 1C0WA 1V5EA 3C3WA 1XGMA 3IHUA 4XSXF 1TW2A 1I50J 1A35A 2C6YA 1W5TA 1XB4A 3TMOA 1TT0A 1OISA 2DJIA 2DYSH 3GLXA 2GQQA 2JSPA 3GFMA 4Y7NJ 2R7XA 2R7FA 2M45A 3GTGJ 2A68F 4BEHA 2XF5A 3PM1A 1H9GA 3GTOJ 2KHMA 3AG4H 4UVAA 1K7AA 2STTA 5F6FA 1TQIA 3LFKA 5FD5A 4BXUA 3OMYA 4CCMA 2F48A 3DWLE 2R7VA 1OKRA 1ZHFA 2L54A 2F5FA 2DDAA 3M7GA 2TDXA 4LFUA 5HNFA 1QA6A 2OAZA 2VKVA 2VQGA 2RQPA 3EPZA 3WTUC 5CVUA 1O7LA 2DA2A 1A04A 5H20A 2GXGA 1FNNA 3BG6A 3L9FA 2LY1A 3LA2A 1U9OA 1WHUA 3HOYJ 2Y0SA 4Y17A 1MMAA 2R7RA 4HLYA 5JFRA 1I6XA 4PCQA 1HC8A 2ELHA 1GXPA 3CMYA 3ZMSA 5GTHC 2HI3A 1TLHB 5IP9J 1MMGA 4GRIA 2OA4A 2ZKZA 5F08A 2IBDA 1SMTA 4QIWN 4U0WA 3DBLB 4E7KA 5BOXA 1NTCA 3ZOBA 3O6BB 2IEKA 4WF2A 3CC2I 1GV2A 3KP2A 3GTLJ 5CLSA 3IUOA 4D9JA 1E0EA 4FX0A 3L2UA 4B09A 2CV1A 3HOXJ 5GAHJ 3FBIB 3SEQA 4E7LA 1XSXA 3KP5A 4BAYA 3CF5F 2OTLI 2DODA 3K4MA 3H36A 1HKSA 3CJQB 4L9TA 5DTDA 1CGPA 3G1MA 3CCRI 2XF6A 3G71I 4ZYEA 1JE8A 3KP6A 1LNWA 4GYIA 1HLVA 3I4NJ 2QKMB 3K70D 4XRMA 3F6VA 2X48A 2E1MB 3ZN0A 1ODDA 2PMHA 1PDNC 1K78A 4P96A 4GXOA 5KAFC 2RV8A 4PJ0C 3KZIC 2M7AA 3QYFA 3EUKL 4P5OA 2Y9ZA 2W85A 1SC7A 3BR1A 4P1WA 2A69F 3WG9A 1IZ1A 3VB2A 2ZC2A 3K4BA 1QQIA 5EEHA 3OV8A 4EJOA 3MD2A 4D5FA 4S04A 3CF2A 1IN5A 4A3BJ 3NWSA 2FJ1A 1WJ5A 3K1MA 1X1AA 1WSUA 1XMXA 5E18F 2DK8A 3PO3J 3GWZA 1IN4A 1YLFA 4D5CA 3M3YJ 2VB6A 4XN0A 2NOGA 1H0MA 2RGVA 2G0EA 3E5QA 5E3MA 1X2NA 3QOPA 4B47A 1KGSA 3WTTC 4YFNF 3QRFF 3BR3A 2A6EF 3PIPF 1UMQA 2DMQA 2KDZA 3KPHA 4OINF 2EZKA 2FUG2 2HS5A 2QUFA 3CJNA 4KIBA 4L9NA 3CO6C 5J1RA 1U8BA 1GV5A 3K69A 4BU2A 4PGHA 2DA6A 2ADUA 1YYVA 4CUGA 3HGGA 2O3FA 4B48A 1S6LA 1JKOC 1OFCX 3BCAA 2K7LA 5J4YA 4IXAA 1H9TA 2FX0A 3HRSA 4UV8A 1MJAA 2JUCA 3DPTA 1JKQC 3H5AA 2QQBA 2DU9A 1V5GA 1VQLI 3E97A 3DEEA 4RGRA 3TW7A 3RTRA 2IGMA 4ZYGA 1FOXA 4ON0A 1SAXA 3H5NA 2MYSA 3ZQLA 4MEXF 4HA8A 3ZR8X 1MKMA 3A02A 5LLQA 3CCQI 1Y8QB 3NEUA 5LGTA 2EPFA 3IRQA 3ISPA 5IP7J 2EIMH 4IL6C 3SHFA 3MAJA 4M3DA 5AONA 5JVGF 1O57A 1OCOH 3CUQC 1ZGAA 3PIOF 4WXHA 1ON1A 2TCTA 5JI6A 2Y48A 3A01A 1T39A 2IS2A 4G94A 1Y56A 2VXZA 2XKOA 4XN3A 2QA4I 1BW5A 3T5XA 2KRCA 1IO2A 3OS1A 1TQMA 1ONVA 3KEQA 4U7DA 1USSA 5BS6A 2VJ4A 1IV6A 3BROA 2Z3YA 3OR2C 4BHCA 3BTIA 3J80K 1YS6A 5JHUA 2OTJI 3DV8A 5M5XJ 3B02A 3FIWA 4CYCB 2IGNA 1E17A 5EEGA 4BY1J 3ABTA 3TL4X 4YFKF 5B3SH 1VF9A 2AXLA 2E2IJ 9ANTA 3QQAA 4A0YA 3IC7A 3DBRB 3DPUA 1UG2A 4C3IJ 1VQ5I 3N97A 1FPQA 2IA2A 2G9WA 2CUEA 4C2MJ 2R0QC 3CC7I 4G8XA 2QCOA 1Y0NA 1U8RA 4EVIA 1F1ZA 4I2OA 1NK3P 3W2AA 3GFJA 5E8IA 2JQ7A 1XCBA 3S2HJ 4XORA 4CZZA 1CF7A 4OMZA 2BYVE 3AL0C 4A3LJ 4EATA 4A3IJ 4IVNA 3S17J 5H6RA 2QGUA 2B63J 2IA1A 2P8TA 4MGRA 1FIAA 1K79A 2FNAA 4BKXA 1DDNA 4HEA2 2X6WA 1VI0A 2EV0A 2ZSHB 3D5LA 3RCOA 4LMYA 3VOEA 2NS8A 2GXAA 2J5OA 3RDIA 4FE7A 1NK2P 4UUSA 1XTAA 3TO9A 2CG4A 3EYYA 3RI4A 4JQFA 2X1EA 2VC1A 4U7BA 4CHUA 3FISA 4IZZA 2EZLA 3I5UA 2M87A 3O3KA 2JA6J 2L01A 5FKOA 1MNMC 2QSGX 1UHMA 2DA5A 3DKXA 1OCPA 5FLXK 4RAFA 4HQMA 5KCMA 5J1YA 2LY2A 3A4CA 3E1SA 1SFEA 2KDOA 3TGNA 3CCLI 4IHTA 2HQRA 1O3SA 2YSRA 2H6CA 2UXNA 4G6QA 3HOZJ 1MNEA 4OIPF 1ZARA 1EF4A 1F4KA 4JBAA 1BC7C 2VQCA 4I02A 2DO7A 3OYJA 2E7WA 3I54A 3HC7A 4LJZF 2FBIA 1MBKA 3FF5A 4J19A 2VLAA 1IG7A 4NUBA 3RKQA 1REPC 2VONA 1VQ6I 4C2TA 3GW2A 4ZYDA 2E36A 2Y75A 2OC6A 3RZDJ 4FISA 2GOXB 4PSXA 2G7UA 4BGDA 1BW6A 1YHQI 4E7ZA 2JT1A 2ZFWA 4JYKA 3R0AA 3C2GA 4MQ9F 5FJ8J 3GF2A 3ZXSA 3GYHX 2LC2A 3L09A 2PQ8A 3H0GJ 1QNTA 1F36A 3LSTA 4B44A 1YX5A 1WJCA 2K86A 2GIVA 4ASNA 2Q2EB 5EG0B 4S05A 5J8CA 3HM5A 5M5WJ 2KQRA 1IC8A 4BJ6C 2Z5UA 1IXCA 3BC8A 3OYAA 3Q3SA 3GZ5A 5EF6A 5GP9A 5HLHA 4FASD 5D5VB 1ZH5A 3BJ6A 4M73A 5D8LB 2LNBA 4KITB 2DYRH 2QENA 3LOCA 3SYTA 2FEZA 1WJAA 2E1MC 1W7PA 1SAUA 3M8EA 5LGNA 2QQAA 4KN7X 1KQ8A 4NHJA 1OR7C 2L7MP 5E1XA 4BQNA 2HYFA 4E7IA 1R7JA 1WGXA 1W36C 2VOPA 1WI3A 4ENNA 2D2WA 3JSOA 4LB5A 1FP2A 2DQLA 1N25A 2LVSA 4J01A 2D1HA 4IRGA 2DFIA 2ZJ2A 3ELKA 3HB9A 5F1JA 4KISA 4XLCA 5D5XB 3E6MA 1O3QA 3GTPJ 2BHZA 2ZJPF 1TC3C 3S2WA 3G4SI 1Z67A 3PUFA 5D6EA 5BMZA 1OCRH 1P92A 2XVCA 3IAM2 3K0LA 5LRSA 1XDSA 5CVJA 5JR3A 2YR2A 1IXRC 4V2GA 2EILH 4P9UA 3CCEI 3PQKA 5LHHA 2R5YA 3CZ6A 2W24A 1IF1A 1FOWA 2XV4S 3U9GA 2AXTC 1YJ9I 1TWGJ 2B0LA 3JRGA 4W1UA 1QU3A 1G59A 1G3WA 3IV5A 3V4GA 4U88A 2JA7J 1OJLA 3CMEI 5BPDA 3HTSB 3CD6I 3OYCA 2B9SA 3U1DA 3VPRA 5E3LA 3HRUA 1X1DA 2KJCA 4XLAA 1LE8A 2IPQX 1JUMA 1UJ8A 4KJZA 2MFZA 4Y3OA 1Z0XA 4KIGA 4IEJA 5F64A 2OCEA 5F04A 2KIMA 5KNLA 1ULYA 2VOOA 2PBIA 3KP7A 1RUOA 2K4BA 1Z6TA 2LG4A 2L7KA 4V2FA 1J59A 5AIPA 3TP3A 1R49A 3DXJF 5DUKA 2R7QA 4DIQA 5IOYA 1VQ4I 1K78B 4C30A 2WBMA 5HOOA 4HPQA 5H2FC 3S16J 3WGHA 2ISYA 3BG5A 1OPCA 2HZTA 3FDYA 2ECCA 3I58A 4HDUA 1YTYA 4M3BA 1R00A 3A0BC 4LLLA 1SMYF 3LSHA 2PMUA 5DM6F 1ZRCA 2JUGA 3HRMA 2FQ4A 4A3KJ 2VT3A 2V26A 2LRDA 1L0OC 2Y9YA 3QAHA 3OYMA 2CUZA 1R23A 4CCOA 1S29A 2CQKA 5DV5A 4M9XA 2NVXJ 2HOAA 3Q9VA 4IHYA 3GEZA 2XGCA 3AKZA 1WQ2A 2WV0A 4AVPA 1YIOA 4KFCA 2KIQA 2H1LA 4E7SA 3P9KA 4RB2C 2O9LA 1RNLA 2K5CA 2O7OA 1Y1WJ 4AUXA 3HSFA 2LDUA 4Z6YA 4LG0A 5JHFA 2XC7A 4U87A 1IAWA 3S1MJ 1MJ9A 3GTQJ 4OIQF 5CJ9A 5DYMA 1F9NA 2FU4A 3RPUD 2O8XA 1X1BA 2E5ZA 1MGTA 2F5VA 4BQOA 2JA2A 3EYIA 2ECBA 3R6SA 3JTGA 1MH3A 1W1WE 2L7ZA 2O6GE 3A2KA 1LFUP 5D8KB 2GIZA 4CH7A 4HAMA 1ZN2A 3K7AJ 1X3UA 3M9AA 2MH2A 1E3OC 4FT8A 3FZVA 4WXCA 2ICWG 2BXYA 4NDLA 5K7HA 5L3BA 1ZGJA 3TP0A 3JW4A 1VQKI 1KZHA 4OIRF 1MD0A 1YJNI 5HNHA 1R1VA 3K4JA 3JRCA 1P6RA 1FMVA 1PP7U 2VC0A 4ANJA 4XNFA 2IGOA 1O3RA 2F5DA 5AIQA 3A01B 2F2EA 2W7NA 1RIOH 3DLLF 1EH8A 2FBHA 3JSPA 2QEXI 4G7OF 2R7TA 4HLXA 3BR2A 4F93B 4PGGA 4IF4A 2HPMA 1BM9A 3Q5FA 2QM3A 2FD5A 3PFYA 4M6YA 2R7OA 4DYRA 1DU0A 2MW8A 2BY3A 2XDVA 1IRGA 3I3LA 4CYDA 1JTXA 3FMSA 3AG2H 3JRAA 2VBXA 1IN7A 4BL0B 3CMMA 2DOFA 3R60A 3KIOA 2BY2A 1T98A 3ZMUA 1XD7A 3IWZA 1KU3A 2LLKA 2RAEA 3A03A 4ENMA 3K2AA 4IHSA 5C4JJ 5HDNA 2LF7A 4UY8I 1EJ9A 2NS7A 1GVDA 5FRMA 2HOTA 3OSFA 1PJRA 5GPAA 4KT6A 2MSYA 1CF7B 1FMWA 1ZYRF 2HXIA 3MMYB 2ZNZA 2XB0X 1L3LA 1JHHA 2JPCA 2LD5A 1DPRA 3TDZC 1FZPB 4M9ZA 1SFKA 4ZTFA 2QZ8A 3L1PA 2IW5A 4ZDLA 5HLIA 4II2A 4DQ2A 2W57A 4A3FJ 3DPLC 4PUSA 4I01A 3HUGA 4IQJA 3CDLA 4XKWA 4BE1A 5GTIC 2E7XA 1AU7A 1HSJA 3DEUA 2X6YA 3FXUA 4PZJA 5EGOA 2HDCA 3M4OJ 4UUSB 3WG7H 4UV9A 4LLNA 2WV1A 2CFOA 2KRHA 4M72A 1FP1D 3WE2A 4F3QA 2L3DA 4M9SA 1P7JA 1NG6A 2XAHA 3F8BA 3K2ZA 2EH3A 1IN6A 3O8GA 5LBQA 2K3FA 1K83J 3M1EA 1WFXA 5LD2C 4PFOA 2W4SA 1R4NB 2HU9A 3B73A 3J7AY 3HRTA 4XMYA 3VYSB 3DF8A 5DUIA 1BI0A 1OQYA 3SDGA 2L9SA 5HS8A 3NWTA 4QLCU 1FBSA 1X3WB 3MKWB 2X9DA 5LRRA 1HA8A 3DTKA 2O61A 1W36D 1OCTC 1QZEA 4M74A 2EJRA 4A12A 5IOZA 1VTNC 2ACJA 4YFXF 3WHBA 3A1YA 4IKFA 2GBYA 1B4AA 2W1OA 1PVEA 2ZNYA 1QVTA 1FYLA 1YE9A 2LF8A 4L9JA 3OL3A 2OUMA 2PI0A 3FM3A 4XLHA 4W97A 2XRNA 3L2VA 1IGNA 2HDWA 3BG7A 2NVTJ 3MZ8A 1NG7A 2PMZN 4PJLA 3OIPA 3HZJA 3I9V2 2HKOA 4IOAF 2GAUA 5DD8A 2HXOA 3C1DA 3IP4B 3VSLA 4HSTA 1ACIA 1PP8F 3H5RA 1TWHJ 1CQTA 2CW0F 2DBBA 3PO2J 4XRSA 3LAJA 4I0BA 3WTSC 2GA2A 3DTEA 4DZPA 3DFGA 2H94A 1JT6A 1XMAA 1ETXA 2KRFA 4BUPA 1X3ZB 2JJ7A 4HNVA 3ABMH 3CCJI 5L3DA 1J09A 2BZTA 4UB8C 5C4XJ 2VXDA 3FKJA 5M3FJ 4HV5A 1S9HA 1D1BA 3IRRA 3PUBA 1Q1VA 2JVGA 1V3FA 1W7PB 1DU6A 3I56I 2M8GX 2P5KA 2X4HA 3KYLA 4I7HA 2V4JC 3E0JB 4AWXB 4ZC3A 1AA7A 2LK2A 3DKYA 4A3EJ 4BHPA 1BI2A 4D0PA 5LFAA 3I53A 3GO5A 5EDNA 1BJZA 6PAXA 2DA1A 2AO9A 2VASA 5J40A 5A2QZ 4RAYA 2V1XA 1R5GA 2RC4A 3BR5A 3RYRA 2QSHX 3A0HC 1TBXA 2ME6A 2E2JJ 3ZN1A 3WHCA 4EJUA 1S7EA 2CGPA 4BE2A 4B8XA 1NHAA 2FBKA 3BT9A 3CESA 4XLPF 1XN7A 3ZQQA 2HDDA 3TKYA 1W5CC 1ON2A 3BTJA 5E3NA 1UFMA 2IP2A 5CQEA 2XAUA 2VQLA 4BACA 4MQVA 3Q0UA 4PJMA 1ENHA 4HQEA 2FQ3A 3ZMZA 2R5YB 1Y8RB 2WADA 4Y13A 3ULQB 2UZKA 1LEAA 2IS4A 5J1UA 3C7JA 4BS9A 4HYEA 4IRHA 3L2RA 1J0RA 2VN2A 4HW0A 3HDDA 2CUFA 3K6GA 1A5JA 2VKEA 2LTPA 1U5TB 2BVMA 4UNOA 5TGTA 1BR4A 4QWQA 2F4IA 2E19A 2OQGA 1IRZA 5FGMA 2VKHA 1BL0A 2O8KA 3ROUA 1LE8B 4XLNF 4XRFA 1GT0C 1DP3A 1Q1HA 1YOVB 3PSFA 3ZMTA 2DOEA 4JX6A 5FRNA 3MWMA 2XKPA 2IJLA 5TISC 2WWYA 4RS8A 2W00A 2DTZA 3JCUC 3LQRA 4KUMA 1DGWY 2JSCA 2PMZA 2COMA 1YI2I 4DOZA 1QZZA 4D7NA 2CQXA 2DT5A 4BY7J 3QOEA 2VBWA 1N77A 1K4TA 2YX4A 3EETA 1S3JA 1QPIA 1ERDA 1LUJB 1QHHD 4XK4A 4ESJA 2PN6A 1J7KA 5IT9Z 4BJ5C 4RGXA 2WC2A 4F52A 1SFOJ 4H4KC 4E7JA 2JA8J 1DP7P 1FBUA 1Z05A 3LSJA 2QQ9A 3WU1B 2HYJA 3TO6A 5ED4A 3HOTA 4A3MJ 1KU9A 2LREA 1D1AA 1UB9A 4I0AA 1B59A 3RKYA 4ZDOA 5ILUA 5LGUA 1D0YA 1W5SA 4I98B 4B1RA 5J47A 1X1CA 1K4SA 1Z77A 2XIGA 4ESBA 4HG2A 3T1BA 1ZG1A 1X1PA 1T33A 4LG0B 3FMQA 4CCLA 3HJEA 2PX9A 1FYKA 1IJWC 4RLQA 2XROA 4DYQA 4BBRJ 4HF1A 2Q8KA 1HW5A 1QO0D 2DCEA 1RI7A 2KZGA 3HYIA 3BOQA 4BDZA 1QVUA 3F8MA 4JP0A 3H35A 4HF2A 1RPWA 4E6KG 2BY1A 4KMFA 2M8EA 1Z1DA 4JX5A 3U2RA 2I8DA 4UUTA 4A5MA 1H89C 2KISA 1FY7A 5JVTA 2Z9OA 1OLTA 4RBOA 1B9NA
chains in the Genus database with same CATH topology
3DKWA 3R4KA 1R1TA 1IN8A 1WRJA 4F7ZA 2VBZA 1ZRDA 4LD5A 3K9TA 2GXBA 1TNSA 2DTRA 5K1YA 2RVCA 4Q5SF 1TW3A 3M8FA 5ILSA 3E5UA 3QPTA 4UXNA 5E17F 5K5RA 2NNYA 4ENKA 3BDDA 3G3ZA 5DCMA 4HDVA 1I1SA 3ZMDA 3REOA 5E1WA 3BPVA 2MA3A 1WI9A 1P2FA 5HS7A 2K02A 2UXXA 1R22A 2ZMEA 4A2UA 2RN7A 3F21A 3H92A 4L0ZB 1RUNA 3AAFA 5HDKA 2MD5A 2RDPA 1KU2A 4OIOF 2FNPA 4NQWA 3JAMZ 1EH6A 1Z91A 3RJPA 1LB2A 1YG2A 2BEOA 5HLGA 4L18B 2NYXA 3RYPA 2EB7A 2P6TA 2VBYA 5E1ZB 5H6QA 3EQLF 1F5TA 3V8KA 2EFWA 3BP8A 4WX9A 3KE2A 3BZ6A 2V9VA 1R1UA 2XAQA 4P9FA 5HS9A 2EFQA 3QP6A 3ZMVA 3HHGA 4KT5C 1BIBA 2K27A 3L2CA 1T0FA 1LEBA 3E3VA 1U2WA 1P4XA 4BNCA 1KA8A 3F8CA 2UWMA 1BC8C 2V1DA 3QPHA 3HOSA 1SD4A 1ZAOA 2ZO4A 3E6DA 5ILVA 3WGGA 4EJTA 3IKVA 5CVIA 3PQJA 1IUYA 3FWEA 3CUOA 2E1CA 1U5TA 2HYGD 3QU3A 4R79A 2F5EA 1FWZA 2HGCA 1XSVA 2P7VB 3H3UA 4LB6B 4G7ZF 1BI1A 4UUVA 3WTXC 2MBFA 5ERIA 1DUXC 3HIFA 1D8JA 2A61A 2YX7A 1SD7A 4Q47A 3C18A 3RIRA 3WTVC 4TV7A 1BOAA 1FOKA 1JHFA 3RKWA 1S8NA 1STZA 4K2EA 1BIAA 2P7CB 5J6XA 4EGZA 1K6OA 2V79A 2FXAA 2XHKA 3GUDA 2JTVA 2P5VA 4EV0A 1D5VA 4G6DA 4GCVA 1LDDA 3WODF 3LAPA 3T8TA 1U78A 3SFZA 2OZ6A 3J81K 1MJBA 5IT3A 1LQ1A 2OQRA 2ZCWA 2HTSA 1GHCA 2VT2A 4HBLA 2D1VA 3ZQ7A 1YFHA 3MFKA 2A07F 3LQQA 4U0YA 2BBYA 1YO5C 3KFWX 2FOKA 1R36A 1IXSB 2IA0A 3E5XA 2EWNA 5FFZA 4G7HF 2OBPA 3KEOA 5DD4A 5TRDA 5K5QA 2P5LC 1KQ9A 1HKQA 4R8HA 2HOEA 3R61A 2KIUA 1HXDA 2EK5A 2O03A 1TTYA 3Q9SA 2H27A 4EM1A 1I5ZA 4ENJA 1UHWA 2Q0OA 2R3SA 3RKXA 4E70A 3KLOA 4BH9A 2M1BA 2EV6A 2ZXJA 4Y15A 1W7PD 1BBYA 4H0EA 2O0YA 1IW7F 4ZH4F 3SZPA 4KNYA 1HKTA 5DCMB 2HEOA 2NNNA 4MTDA 1BN5A 5ICCA 3IWFA 4N9IA 1SD6A 2RNJA 5CYVA 1AWCA 5D5WB 3MCZA 1ZRFA 1KYWA 3WU0A 3J7AO 4Q48A 2GWRA 1T2KA 4U0VA 3H3ZA 2ZMEB 5L3FA 2DQRA 2PG4A 4XSZF 3BWGA 2K4JA 1TQPA 4EJVA 3GFIA 3G73A 4N9HA 2QVOA 1SD5A 1BI3A 2JPBA 1G4DA 1YW7A 4ZZDA 2A6HF 1OMIA 3CO7C 1XGSA 1G3TA 1P4AA 2FRHA 2KIFA 2PFBA 2XAFA 3PFIA 3GXOA 2HTJA 2HFHA 1FSHA 4AIJA 2DK5A 5IT9K 2V6CA 4IPAA 2QBYA 2EA4A 4HX7A 4EQQA 2CSOA 3GVAA 1J5YA 2E1NA 4GO1A 4A0XA 2M5WA 3EUHA 1Z9CA 1DPUA 1XGOA 2MH9A 3IKTA 3LA7A 3OOPA 3W6KB 2R7DA 3TOAA 3KP4A 3K1PA 4YIFA 4I09A 4CXFA 4EGYA 4MEYF 3V7CA 3KP3A 1XGNA 2YPRA 1D8KA 5E20A 4L9VA 3L00A 3VEPA 1S7OA 2BV6A 2QLZA 5DEQA 2X0LA 4LLGF 4A5NA 3KETA 5L3GA 4BQAA 3SQNA 4A6DA 1FT9A 4A6EA 1LVAA 4HZFA 2L4MA 2F5CA 3F3XA 2AS5F 1B6AA 4WWCA 1WKMA 3F22A 4XBFA 1S7AA 3TO7A 1FSEA 2EFOA 1ZLKA 5BPIA 2FA5A 3TDUC 3VFZA 3T8RA 1ZG3A 4BHBA 2FSWA 3DP7A 2LSOA 2ISZA 3P9CA 4LK1F 5L3EA 1FC3A 4M71A 3LA3A 4EJWA 2VODA 1GVJA 2IVMA 4NB5A 3JAMK 1R5HA 4N0BA 1KYZA 4FX4A 3SZTA 5FO5A 4KYWA 4PDKA 1ZG5A 2XAGA 1PUEE 2OU2A 2OD5A 2Z33A 5E8GA 5LEJA 4FHTA 2EV5A 5DCFA 4IRIA 1XDUA 2VE8A 3FXQA 1QGPA 1SFXA 5F1RA 4ESFA 2H09A 1USTA 1U6GA 5CVRA 3COAC 1V4RA 1KU7A 4CDGA 3V7SA 3HHHA 4GYGA 1FLIA 3I59A 2DI3A 1R58A 3BJAA 3CUQA 3WTZA 1U3EM 3ML6A 2Z99A 2NAZA 3P9IA 4MTEA 2DPUA 3I4PA 3NQOA 4GGGA 2PLYA 4O3MA 2HR3A 1D3YA 1MDMA 2KJBA 1G6NA 5D6FA 2G7HA 4Q4ZF 1FYMA 3KZYA 1HW1A 1Z6RA 4L5IA 4CO8A 4OU0A 2IT0A 3P7NA 1KQ0A 2BE5F 5CVVA 1WWXA 4P55A 2WTEA 3RPUA 2JRTA 4KDPA 4KIFA 2DPDA 4KA4A 1O7FA 2H6BA 3RPQA 2Y0MA 1ZREA 1HBXG 1TNTA 5DDGA 1B1BA 4Z2YA 1EV7A 3MZYA 3SXYA 1O3TA 1UCRA 5LHIA 3CTAA 5ICGA 4LK0F 2A3SA 2M30A 2V1UA 4CGZA 2ESHA 1SFUA 3JTHA 4O5VA 2P6SA 3J80Z 3ABUA 1LDKB 4RB0A 5TJJA 5LHGA 3ECOA 2CWEA 2XUBA 1QZYA 3WGIA 3HTUA 1E2XA 1U5TC 3QU6A 4KMUX 4AD9A 3ERED 4HOBA 5L3CA 1YW8A 1HW2A 1JXSA 1AOYA 4MNUA 3WTWC 3D0SA 1QPMA 1I1GA 3QP5A 2QBYB 2RKHA 2IRFG 4L5JA 2DAOA 2FMYA 4MHGA 3R0JA 1Y0UA 2FE3A 1LDJA 3N4MA 3KLNA 4O6JA 2GZWA 3CDHA 1J75A 3GZ6A 3HSEA 3LWFA 5FFXA 3BPXA 5HVQC 4JK1X 1I27A 3V8JA 3GFLA 4IJAA 5FLXZ 1BJAA 2HKXA 4AIKA 2KKOA 5ICEA 3NRVA 4R1HA 3MQ0A 4HX8A 2XAJA 5KK1A 2HQNA 1OR7A 1G3SA 2J5PA 5LEKA 3GX4X 2QYOA 1XMKA 3ZPLA 3V7RA 2XGXA 2CFXA 3O2PE 2LKPA 4G9YA 3I71A 3V8LA 5D5UB 3FHZA 5KVRA 1ZLJA 3E6BA 1OYYA 3EDPA 4WK8F 1OYWA 4RB1A 2STWA 3HSRA 1YW9A 3KZZA 2DLLA 2MLKA 4ZZLA 4HV6A 4OMYA 4WXDA 2ESNA 1GXQA 4ETSA 3W6JB 4HX4A 4RB3C 4EM0B 2BGCA 4DNCA 5HDGA 5D4SA 5ICFA 3KCCA 1JGSA 4RGUA 3WE3A 1Z7UA 1FBQA 3F72A 2QWWA 3CLOA 1OYIA 2L02A 4LGWA 3DQVC 3VODA 1W4MA 2OZUA 4WCGA 4L0YB 2VE9A 3BY6A 1YQAA 4BYYA 2EFPA 4KICA 5BQTA 1MZBA 2EA2A 3IL2A 2JZYA 2XASA 2CYYA 3F6OA 4KN4X 4A0ZA 4AIHA 1QBJA 1T6SA 1J9IA 1EH7A 3TOBA 3ECHA 1YS7A 2ZBKA 4UVBA 4RAZA 1J2XA 4YG2F 4UHTA 1IRFA 2PJPA 1RZ4A 2L4AA 1T38A 5FB2A 2EFNA 2NRAC 3E6CC 3ZP5A 5D4RA 3L7WA 1LJ9A 3I0TA 4ZYHA 5K5OA 1G3YA 2D45A 3FXRA 2GA1A 3FM5A 4HF0A 4EM2A 1XSDA 4M6XA 2FF4A 3T0YA 2ETHA 1XCVA 3I59B 5A2QK 5FD6A 3CUQB 4YIIA 2A5YB 2FMLA 5J8FA 2W25A 4RGSA 1HSTA 2MLGA 2MC3A 2NS0A 4OOIA 3TQNA 3WTYC 1MDMB 1P4WA 1B9MA 4EMSA 3FX3A 3MZHA 2HWVA 4CICA 3I64A 2CO5A 2P4WA 4UVCA 3BJOA 3F8NA 3F23A 1HQCA 2YU3A 3J81Z 2PEXA 3MEXA 3F8FA 2DW4A 3FMRA 1FX7A 2Q2EA 2W84A 3K1NA 1C0WA 3C3WA 1XGMA 3IHUA 4XSXF 1TW2A 2C6YA 1W5TA 1XB4A 3GLXA 2GQQA 3GFMA 2R7FA 2M45A 2A68F 1H9GA 4UVAA 1K7AA 2STTA 5F6FA 1TQIA 3LFKA 5FD5A 4BXUA 1OKRA 1ZHFA 2L54A 2F5FA 3M7GA 4LFUA 2TDXA 2OAZA 2RQPA 3WTUC 5CVUA 1O7LA 1A04A 5H20A 2GXGA 1FNNA 3L9FA 3LA2A 4Y17A 4HLYA 5JFRA 1I6XA 4PCQA 2ELHA 1GXPA 3ZMSA 1TLHB 2OA4A 2ZKZA 1SMTA 4U0WA 5BOXA 3O6BB 4WF2A 3KP2A 5CLSA 4FX0A 4B09A 1XSXA 3KP5A 4BAYA 1HKSA 4L9TA 1CGPA 4ZYEA 1JE8A 3KP6A 1LNWA 4GYIA 3F6VA 3ZN0A 1ODDA 2PMHA 1PDNC 1K78A 4P96A 4GXOA 2RV8A 4P5OA 2W85A 2A69F 3WG9A 1IZ1A 3VB2A 5EEHA 1QQIA 3OV8A 4EJOA 4S04A 1IN5A 3K1MA 1WSUA 5E18F 2DK8A 3GWZA 1IN4A 1YLFA 1H0MA 2RGVA 3E5QA 3QOPA 1KGSA 3WTTC 4YFNF 3QRFF 2A6EF 4OINF 3CJNA 2HS5A 2QUFA 4KIBA 4L9NA 3CO6C 3K69A 4PGHA 2ADUA 1YYVA 2O3FA 1S6LA 2K7LA 4IXAA 1H9TA 3HRSA 4UV8A 1MJAA 3DPTA 2QQBA 2DU9A 3E97A 4RGRA 3RTRA 4ZYGA 4ON0A 1SAXA 4MEXF 4HA8A 1MKMA 5LLQA 3NEUA 5LGTA 3IRQA 3ISPA 3SHFA 3MAJA 5AONA 1O57A 3CUQC 1ZGAA 4WXHA 1ON1A 5JI6A 2Y48A 1T39A 4G94A 2VXZA 2XKOA 3T5XA 1TQMA 1ONVA 3KEQA 4U7DA 1USSA 5BS6A 3BROA 2Z3YA 4BHCA 3J80K 1YS6A 5JHUA 3DV8A 3B02A 1E17A 5EEGA 3ABTA 4YFKF 2AXLA 4A0YA 3IC7A 3N97A 1FPQA 2IA2A 2G9WA 4G8XA 1U8RA 4EVIA 1F1ZA 4I2OA 3GFJA 5E8IA 1XCBA 4CZZA 1CF7A 4OMZA 2BYVE 4IVNA 5H6RA 2IA1A 2P8TA 4MGRA 1K79A 2FNAA 1DDNA 2EV0A 3D5LA 4LMYA 3VOEA 2J5OA 3RDIA 3TO9A 2CG4A 3EYYA 3RI4A 4JQFA 2VC1A 4U7BA 4CHUA 3I5UA 2M87A 3O3KA 2L01A 1UHMA 5FLXK 4HQMA 1SFEA 3TGNA 4IHTA 2HQRA 1O3SA 2YSRA 2H6CA 2UXNA 4G6QA 4OIPF 1ZARA 1F4KA 4JBAA 1BC7C 4I02A 2DO7A 2E7WA 3I54A 4LJZF 2FBIA 3FF5A 1REPC 2VONA 3GW2A 4ZYDA 2Y75A 2G7UA 2JT1A 2ZFWA 3R0AA 4MQ9F 3GF2A 3GYHX 3L09A 2PQ8A 3LSTA 1QNTA 2K86A 2GIVA 4ASNA 4S05A 5J8CA 2Z5UA 1IXCA 3GZ5A 5HLHA 5D5VB 1ZH5A 3BJ6A 4M73A 5D8LB 2LNBA 2QENA 2FEZA 1W7PA 3M8EA 5LGNA 2QQAA 4KN7X 1KQ8A 4NHJA 5E1XA 2HYFA 1R7JA 2VOPA 4ENNA 2D2WA 3JSOA 4LB5A 1FP2A 2DQLA 2D1HA 4IRGA 2DFIA 2ZJ2A 3ELKA 5D5XB 3E6MA 1O3QA 3S2WA 5D6EA 5BMZA 2XVCA 1P92A 3K0LA 5LRSA 1XDSA 5CVJA 5JR3A 2YR2A 1IXRC 4P9UA 3PQKA 5LHHA 2W24A 1IF1A 2XV4S 3U9GA 2B0LA 1G3WA 3V4GA 4U88A 5BPDA 3HTSB 3U1DA 3HRUA 2KJCA 2IPQX 4KIGA 5F64A 2KIMA 1ULYA 2VOOA 2PBIA 3KP7A 1RUOA 2K4BA 1Z6TA 1J59A 5AIPA 3DXJF 5DUKA 1K78B 5HOOA 3WGHA 2ISYA 1YTYA 1OPCA 2HZTA 4HDUA 3I58A 1R00A 4LLLA 1SMYF 1ZRCA 2PMUA 3HRMA 2VT3A 1L0OC 3QAHA 1R23A 1S29A 2CQKA 5DV5A 4M9XA 3Q9VA 3GEZA 1WQ2A 2WV0A 4AVPA 1YIOA 4KFCA 3P9KA 4RB2C 1RNLA 3HSFA 2LDUA 4LG0A 1IAWA 1MJ9A 4OIQF 5CJ9A 5DYMA 1F9NA 2FU4A 2O8XA 1MGTA 3EYIA 3R6SA 3JTGA 2O6GE 5D8KB 4HAMA 1ZN2A 1X3UA 3M9AA 2MH2A 4FT8A 3FZVA 4WXCA 5L3BA 1ZGJA 3JW4A 4OIRF 1MD0A 1R1VA 1P6RA 1PP7U 2VC0A 1O3RA 2F5DA 5AIQA 2F2EA 1RIOH 1EH8A 2FBHA 3JSPA 4G7OF 4HLXA 4PGGA 4IF4A 1BM9A 3Q5FA 2QM3A 4M6YA 1IRGA 4CYDA 3FMSA 2VBXA 1IN7A 3R60A 1T98A 3ZMUA 1XD7A 3IWZA 1KU3A 4ENMA 4IHSA 5HDNA 2LF7A 1CF7B 1ZYRF 2ZNZA 1L3LA 1JHHA 2JPCA 1FZPB 1DPRA 3TDZC 4M9ZA 2QZ8A 2IW5A 5HLIA 4DQ2A 2W57A 3DPLC 4I01A 3HUGA 2E7XA 1HSJA 3DEUA 3FXUA 4PZJA 2HDCA 4UV9A 4LLNA 4M72A 1FP1D 3WE2A 2L3DA 4M9SA 2XAHA 3F8BA 3K2ZA 1IN6A 5LBQA 3M1EA 3B73A 3HRTA 3DF8A 5DUIA 1BI0A 5HS8A 4QLCU 1FBSA 5LRRA 2O61A 4M74A 2EJRA 4A12A 1VTNC 2ACJA 4YFXF 1B4AA 2ZNYA 1FYLA 2LF8A 4L9JA 2PI0A 3FM3A 2XRNA 2HKOA 2GAUA 5DD8A 3C1DA 1PP8F 2CW0F 2DBBA 3LAJA 4I0BA 3WTSC 2GA2A 3DFGA 2H94A 1XMAA 2KRFA 5L3DA 4HV5A 3IRRA 1V3FA 1W7PB 2P5KA 2X4HA 4I7HA 4AWXB 4BHPA 1BI2A 4D0PA 3I53A 3GO5A 6PAXA 5A2QZ 4RAYA 2V1XA 1R5GA 2RC4A 3RYRA 1TBXA 3ZN1A 4EJUA 2CGPA 4B8XA 1NHAA 2FBKA 4XLPF 1XN7A 3TKYA 1ON2A 1UFMA 2IP2A 4MQVA 4HQEA 2FQ3A 3ZMZA 2UZKA 4Y13A 3ULQB 1LEAA 3C7JA 4HYEA 4IRHA 1J0RA 2VN2A 4HW0A 1U5TB 4UNOA 4QWQA 2OQGA 5FGMA 3ROUA 4XLNF 4XRFA 1Q1HA 3ZMTA 3MWMA 2XKPA 2IJLA 2WWYA 4RS8A 3LQRA 4KUMA 2JSCA 2COMA 1QZZA 2DT5A 2VBWA 2YX4A 3EETA 1S3JA 4ESJA 2PN6A 1J7KA 5IT9Z 4RGXA 2WC2A 1DP7P 1FBUA 1Z05A 2QQ9A 3WU1B 3TO6A 5ED4A 3HOTA 1KU9A 1UB9A 4I0AA 1B59A 3RKYA 5ILUA 5LGUA 1W5SA 4I98B 2XIGA 4ESBA 3T1BA 1ZG1A 4LG0B 3FMQA 1FYKA 2XROA 4HF1A 2Q8KA 1HW5A 1QO0D 1RI7A 3HYIA 3BOQA 3F8MA 4HF2A 4KMFA 2M8EA 1Z1DA 3U2RA 4A5MA 1FY7A 5JVTA 2Z9OA 1B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKW A;  3R4K A;  1R1T A;  1IN8 A;  1WRJ A;  4F7Z A;  2VBZ A;  1ZRD A;  4LD5 A;  3K9T A;  2GXB A;  1TNS A;  2DTR A;  5K1Y A;  2RVC A;  4Q5S F;  1TW3 A;  3M8F A;  5ILS A;  3E5U A;  3QPT A;  4UXN A;  5E17 F;  5K5R A;  2NNY A;  4ENK A;  3BDD A;  3G3Z A;  5DCM A;  4HDV A;  1I1S A;  3ZMD A;  3REO A;  5E1W A;  3BPV A;  2MA3 A;  1WI9 A;  1P2F A;  5HS7 A;  2K02 A;  2UXX A;  1R22 A;  2ZME A;  4A2U A;  2RN7 A;  3F21 A;  3H92 A;  4L0Z B;  1RUN A;  3AAF A;  5HDK A;  2MD5 A;  2RDP A;  1KU2 A;  4OIO F;  2FNP A;  4NQW A;  3JAM Z;  1EH6 A;  1Z91 A;  3RJP A;  1LB2 A;  1YG2 A;  2BEO A;  5HLG A;  4L18 B;  2NYX A;  3RYP A;  2EB7 A;  2P6T A;  2VBY A;  5E1Z B;  5H6Q A;  3EQL F;  1F5T A;  3V8K A;  2EFW A;  3BP8 A;  4WX9 A;  3KE2 A;  3BZ6 A;  2V9V A;  1R1U A;  2XAQ A;  4P9F A;  5HS9 A;  2EFQ A;  3QP6 A;  3ZMV A;  3HHG A;  4KT5 C;  1BIB A;  2K27 A;  3L2C A;  1T0F A;  1LEB A;  3E3V A;  1U2W A;  1P4X A;  4BNC A;  1KA8 A;  3F8C A;  2UWM A;  1BC8 C;  2V1D A;  3QPH A;  3HOS A;  1SD4 A;  1ZAO A;  2ZO4 A;  3E6D A;  5ILV A;  3WGG A;  4EJT A;  3IKV A;  5CVI A;  3PQJ A;  1IUY A;  3FWE A;  3CUO A;  2E1C A;  1U5T A;  2HYG D;  3QU3 A;  4R79 A;  2F5E A;  1FWZ A;  2HGC A;  1XSV A;  2P7V B;  3H3U A;  4LB6 B;  4G7Z F;  1BI1 A;  4UUV A;  3WTX C;  2MBF A;  5ERI A;  1DUX C;  3HIF A;  1D8J A;  2A61 A;  2YX7 A;  1SD7 A;  4Q47 A;  3C18 A;  3RIR A;  3WTV C;  4TV7 A;  1BOA A;  1FOK A;  1JHF A;  3RKW A;  1S8N A;  1STZ A;  4K2E A;  1BIA A;  2P7C B;  5J6X A;  4EGZ A;  1K6O A;  2V79 A;  2FXA A;  2XHK A;  3GUD A;  2JTV A;  2P5V A;  4EV0 A;  1D5V A;  4G6D A;  4GCV A;  1LDD A;  3WOD F;  3LAP A;  3T8T A;  1U78 A;  3SFZ A;  2OZ6 A;  3J81 K;  1MJB A;  5IT3 A;  1LQ1 A;  2OQR A;  2ZCW A;  2HTS A;  1GHC A;  2VT2 A;  4HBL A;  2D1V A;  3ZQ7 A;  1YFH A;  3MFK A;  2A07 F;  3LQQ A;  4U0Y A;  2BBY A;  1YO5 C;  3KFW X;  2FOK A;  1R36 A;  1IXS B;  2IA0 A;  3E5X A;  2EWN A;  5FFZ A;  4G7H F;  2OBP A;  3KEO A;  5DD4 A;  5TRD A;  5K5Q A;  2P5L C;  1KQ9 A;  1HKQ A;  4R8H A;  2HOE A;  3R61 A;  2KIU A;  1HXD A;  2EK5 A;  2O03 A;  1TTY A;  3Q9S A;  2H27 A;  4EM1 A;  1I5Z A;  4ENJ A;  1UHW A;  2Q0O A;  2R3S A;  3RKX A;  4E70 A;  3KLO A;  4BH9 A;  2M1B A;  2EV6 A;  2ZXJ A;  4Y15 A;  1W7P D;  1BBY A;  4H0E A;  2O0Y A;  1IW7 F;  4ZH4 F;  3SZP A;  4KNY A;  1HKT A;  5DCM B;  2HEO A;  2NNN A;  4MTD A;  1BN5 A;  5ICC A;  3IWF A;  4N9I A;  1SD6 A;  2RNJ A;  5CYV A;  1AWC A;  5D5W B;  3MCZ A;  1ZRF A;  1KYW A;  3WU0 A;  3J7A O;  4Q48 A;  2GWR A;  1T2K A;  4U0V A;  3H3Z A;  2ZME B;  5L3F A;  2DQR A;  2PG4 A;  4XSZ F;  3BWG A;  2K4J A;  1TQP A;  4EJV A;  3GFI A;  3G73 A;  4N9H A;  2QVO A;  1SD5 A;  1BI3 A;  2JPB A;  1G4D A;  1YW7 A;  4ZZD A;  2A6H F;  1OMI A;  3CO7 C;  1XGS A;  1G3T A;  1P4A A;  2FRH A;  2KIF A;  2PFB A;  2XAF A;  3PFI A;  3GXO A;  2HTJ A;  2HFH A;  1FSH A;  4AIJ A;  2DK5 A;  5IT9 K;  2V6C A;  4IPA A;  2QBY A;  2EA4 A;  4HX7 A;  4EQQ A;  2CSO A;  3GVA A;  1J5Y A;  2E1N A;  4GO1 A;  4A0X A;  2M5W A;  3EUH A;  1Z9C A;  1DPU A;  1XGO A;  2MH9 A;  3IKT A;  3LA7 A;  3OOP A;  3W6K B;  2R7D A;  3TOA A;  3KP4 A;  3K1P A;  4YIF A;  4I09 A;  4CXF A;  4EGY A;  4MEY F;  3V7C A;  3KP3 A;  1XGN A;  2YPR A;  1D8K A;  5E20 A;  4L9V A;  3L00 A;  3VEP A;  1S7O A;  2BV6 A;  2QLZ A;  5DEQ A;  2X0L A;  4LLG F;  4A5N A;  3KET A;  5L3G A;  4BQA A;  3SQN A;  4A6D A;  1FT9 A;  4A6E A;  1LVA A;  4HZF A;  2L4M A;  2F5C A;  3F3X A;  2AS5 F;  1B6A A;  4WWC A;  1WKM A;  3F22 A;  4XBF A;  1S7A A;  3TO7 A;  1FSE A;  2EFO A;  1ZLK A;  5BPI A;  2FA5 A;  3TDU C;  3VFZ A;  3T8R A;  1ZG3 A;  4BHB A;  2FSW A;  3DP7 A;  2LSO A;  2ISZ A;  3P9C A;  4LK1 F;  5L3E A;  1FC3 A;  4M71 A;  3LA3 A;  4EJW A;  2VOD A;  1GVJ A;  2IVM A;  4NB5 A;  3JAM K;  1R5H A;  4N0B A;  1KYZ A;  4FX4 A;  3SZT A;  5FO5 A;  4KYW A;  4PDK A;  1ZG5 A;  2XAG A;  1PUE E;  2OU2 A;  2OD5 A;  2Z33 A;  5E8G A;  5LEJ A;  4FHT A;  2EV5 A;  5DCF A;  4IRI A;  1XDU A;  2VE8 A;  3FXQ A;  1QGP A;  1SFX A;  5F1R A;  4ESF A;  2H09 A;  1UST A;  1U6G A;  5CVR A;  3COA C;  1V4R A;  1KU7 A;  4CDG A;  3V7S A;  3HHH A;  4GYG A;  1FLI A;  3I59 A;  2DI3 A;  1R58 A;  3BJA A;  3CUQ A;  3WTZ A;  1U3E M;  3ML6 A;  2Z99 A;  2NAZ A;  3P9I A;  4MTE A;  2DPU A;  3I4P A;  3NQO A;  4GGG A;  2PLY A;  4O3M A;  2HR3 A;  1D3Y A;  1MDM A;  2KJB A;  1G6N A;  5D6F A;  2G7H A;  4Q4Z F;  1FYM A;  3KZY A;  1HW1 A;  1Z6R A;  4L5I A;  4CO8 A;  4OU0 A;  2IT0 A;  3P7N A;  1KQ0 A;  2BE5 F;  5CVV A;  1WWX A;  4P55 A;  2WTE A;  3RPU A;  2JRT A;  4KDP A;  4KIF A;  2DPD A;  4KA4 A;  1O7F A;  2H6B A;  3RPQ A;  2Y0M A;  1ZRE A;  1HBX G;  1TNT A;  5DDG A;  1B1B A;  4Z2Y A;  1EV7 A;  3MZY A;  3SXY A;  1O3T A;  1UCR A;  5LHI A;  3CTA A;  5ICG A;  4LK0 F;  2A3S A;  2M30 A;  2V1U A;  4CGZ A;  2ESH A;  1SFU A;  3JTH A;  4O5V A;  2P6S A;  3J80 Z;  3ABU A;  1LDK B;  4RB0 A;  5TJJ A;  5LHG A;  3ECO A;  2CWE A;  2XUB A;  1QZY A;  3WGI A;  3HTU A;  1E2X A;  1U5T C;  3QU6 A;  4KMU X;  4AD9 A;  3ERE D;  4HOB A;  5L3C A;  1YW8 A;  1HW2 A;  1JXS A;  1AOY A;  4MNU A;  3WTW C;  3D0S A;  1QPM A;  1I1G A;  3QP5 A;  2QBY B;  2RKH A;  2IRF G;  4L5J A;  2DAO A;  2FMY A;  4MHG A;  3R0J A;  1Y0U A;  2FE3 A;  1LDJ A;  3N4M A;  3KLN A;  4O6J A;  2GZW A;  3CDH A;  1J75 A;  3GZ6 A;  3HSE A;  3LWF A;  5FFX A;  3BPX A;  5HVQ C;  4JK1 X;  1I27 A;  3V8J A;  3GFL A;  4IJA A;  5FLX Z;  1BJA A;  2HKX A;  4AIK A;  2KKO A;  5ICE A;  3NRV A;  4R1H A;  3MQ0 A;  4HX8 A;  2XAJ A;  5KK1 A;  2HQN A;  1OR7 A;  1G3S A;  2J5P A;  5LEK A;  3GX4 X;  2QYO A;  1XMK A;  3ZPL A;  3V7R A;  2XGX A;  2CFX A;  3O2P E;  2LKP A;  4G9Y A;  3I71 A;  3V8L A;  5D5U B;  3FHZ A;  5KVR A;  1ZLJ A;  3E6B A;  1OYY A;  3EDP A;  4WK8 F;  1OYW A;  4RB1 A;  2STW A;  3HSR A;  1YW9 A;  3KZZ A;  2DLL A;  2MLK A;  4ZZL A;  4HV6 A;  4OMY A;  4WXD A;  2ESN A;  1GXQ A;  4ETS A;  3W6J B;  4HX4 A;  4RB3 C;  4EM0 B;  2BGC A;  4DNC A;  5HDG A;  5D4S A;  5ICF A;  3KCC A;  1JGS A;  4RGU A;  3WE3 A;  1Z7U A;  1FBQ A;  3F72 A;  2QWW A;  3CLO A;  1OYI A;  2L02 A;  4LGW A;  3DQV C;  3VOD A;  1W4M A;  2OZU A;  4WCG A;  4L0Y B;  2VE9 A;  3BY6 A;  1YQA A;  4BYY A;  2EFP A;  4KIC A;  5BQT A;  1MZB A;  2EA2 A;  3IL2 A;  2JZY A;  2XAS A;  2CYY A;  3F6O A;  4KN4 X;  4A0Z A;  4AIH A;  1QBJ A;  1T6S A;  1J9I A;  1EH7 A;  3TOB A;  3ECH A;  1YS7 A;  2ZBK A;  4UVB A;  4RAZ A;  1J2X A;  4YG2 F;  4UHT A;  1IRF A;  2PJP A;  1RZ4 A;  2L4A A;  1T38 A;  5FB2 A;  2EFN A;  2NRA C;  3E6C C;  3ZP5 A;  5D4R A;  3L7W A;  1LJ9 A;  3I0T A;  4ZYH A;  5K5O A;  1G3Y A;  2D45 A;  3FXR A;  2GA1 A;  3FM5 A;  4HF0 A;  4EM2 A;  1XSD A;  4M6X A;  2FF4 A;  3T0Y A;  2ETH A;  1XCV A;  3I59 B;  5A2Q K;  5FD6 A;  3CUQ B;  4YII A;  2A5Y B;  2FML A;  5J8F A;  2W25 A;  4RGS A;  1HST A;  2MLG A;  2MC3 A;  2NS0 A;  4OOI A;  3TQN A;  3WTY C;  1MDM B;  1P4W A;  1B9M A;  4EMS A;  3FX3 A;  3MZH A;  2HWV A;  4CIC A;  3I64 A;  2CO5 A;  2P4W A;  4UVC A;  3BJO A;  3F8N A;  3F23 A;  1HQC A;  2YU3 A;  3J81 Z;  2PEX A;  3MEX A;  3F8F A;  2DW4 A;  3FMR A;  1FX7 A;  2Q2E A;  2W84 A;  3K1N A;  1C0W A;  3C3W A;  1XGM A;  3IHU A;  4XSX F;  1TW2 A;  2C6Y A;  1W5T A;  1XB4 A;  3GLX A;  2GQQ A;  3GFM A;  2R7F A;  2M45 A;  2A68 F;  1H9G A;  4UVA A;  1K7A A;  2STT A;  5F6F A;  1TQI A;  3LFK A;  5FD5 A;  4BXU A;  1OKR A;  1ZHF A;  2L54 A;  2F5F A;  3M7G A;  4LFU A;  2TDX A;  2OAZ A;  2RQP A;  3WTU C;  5CVU A;  1O7L A;  1A04 A;  5H20 A;  2GXG A;  1FNN A;  3L9F A;  3LA2 A;  4Y17 A;  4HLY A;  5JFR A;  1I6X A;  4PCQ A;  2ELH A;  1GXP A;  3ZMS A;  1TLH B;  2OA4 A;  2ZKZ A;  1SMT A;  4U0W A;  5BOX A;  3O6B B;  4WF2 A;  3KP2 A;  5CLS A;  4FX0 A;  4B09 A;  1XSX A;  3KP5 A;  4BAY A;  1HKS A;  4L9T A;  1CGP A;  4ZYE A;  1JE8 A;  3KP6 A;  1LNW A;  4GYI A;  3F6V A;  3ZN0 A;  1ODD A;  2PMH A;  1PDN C;  1K78 A;  4P96 A;  4GXO A;  2RV8 A;  4P5O A;  2W85 A;  2A69 F;  3WG9 A;  1IZ1 A;  3VB2 A;  5EEH A;  1QQI A;  3OV8 A;  4EJO A;  4S04 A;  1IN5 A;  3K1M A;  1WSU A;  5E18 F;  2DK8 A;  3GWZ A;  1IN4 A;  1YLF A;  1H0M A;  2RGV A;  3E5Q A;  3QOP A;  1KGS A;  3WTT C;  4YFN F;  3QRF F;  2A6E F;  4OIN F;  3CJN A;  2HS5 A;  2QUF A;  4KIB A;  4L9N A;  3CO6 C;  3K69 A;  4PGH A;  2ADU A;  1YYV A;  2O3F A;  1S6L A;  2K7L A;  4IXA A;  1H9T A;  3HRS A;  4UV8 A;  1MJA A;  3DPT A;  2QQB A;  2DU9 A;  3E97 A;  4RGR A;  3RTR A;  4ZYG A;  4ON0 A;  1SAX A;  4MEX F;  4HA8 A;  1MKM A;  5LLQ A;  3NEU A;  5LGT A;  3IRQ A;  3ISP A;  3SHF A;  3MAJ A;  5AON A;  1O57 A;  3CUQ C;  1ZGA A;  4WXH A;  1ON1 A;  5JI6 A;  2Y48 A;  1T39 A;  4G94 A;  2VXZ A;  2XKO A;  3T5X A;  1TQM A;  1ONV A;  3KEQ A;  4U7D A;  1USS A;  5BS6 A;  3BRO A;  2Z3Y A;  4BHC A;  3J80 K;  1YS6 A;  5JHU A;  3DV8 A;  3B02 A;  1E17 A;  5EEG A;  3ABT A;  4YFK F;  2AXL A;  4A0Y A;  3IC7 A;  3N97 A;  1FPQ A;  2IA2 A;  2G9W A;  4G8X A;  1U8R A;  4EVI A;  1F1Z A;  4I2O A;  3GFJ A;  5E8I A;  1XCB A;  4CZZ A;  1CF7 A;  4OMZ A;  2BYV E;  4IVN A;  5H6R A;  2IA1 A;  2P8T A;  4MGR A;  1K79 A;  2FNA A;  1DDN A;  2EV0 A;  3D5L A;  4LMY A;  3VOE A;  2J5O A;  3RDI A;  3TO9 A;  2CG4 A;  3EYY A;  3RI4 A;  4JQF A;  2VC1 A;  4U7B A;  4CHU A;  3I5U A;  2M87 A;  3O3K A;  2L01 A;  1UHM A;  5FLX K;  4HQM A;  1SFE A;  3TGN A;  4IHT A;  2HQR A;  1O3S A;  2YSR A;  2H6C A;  2UXN A;  4G6Q A;  4OIP F;  1ZAR A;  1F4K A;  4JBA A;  1BC7 C;  4I02 A;  2DO7 A;  2E7W A;  3I54 A;  4LJZ F;  2FBI A;  3FF5 A;  1REP C;  2VON A;  3GW2 A;  4ZYD A;  2Y75 A;  2G7U A;  2JT1 A;  2ZFW A;  3R0A A;  4MQ9 F;  3GF2 A;  3GYH X;  3L09 A;  2PQ8 A;  3LST A;  1QNT A;  2K86 A;  2GIV A;  4ASN A;  4S05 A;  5J8C A;  2Z5U A;  1IXC A;  3GZ5 A;  5HLH A;  5D5V B;  1ZH5 A;  3BJ6 A;  4M73 A;  5D8L B;  2LNB A;  2QEN A;  2FEZ A;  1W7P A;  3M8E A;  5LGN A;  2QQA A;  4KN7 X;  1KQ8 A;  4NHJ A;  5E1X A;  2HYF A;  1R7J A;  2VOP A;  4ENN A;  2D2W A;  3JSO A;  4LB5 A;  1FP2 A;  2DQL A;  2D1H A;  4IRG A;  2DFI A;  2ZJ2 A;  3ELK A;  5D5X B;  3E6M A;  1O3Q A;  3S2W A;  5D6E A;  5BMZ A;  2XVC A;  1P92 A;  3K0L A;  5LRS A;  1XDS A;  5CVJ A;  5JR3 A;  2YR2 A;  1IXR C;  4P9U A;  3PQK A;  5LHH A;  2W24 A;  1IF1 A;  2XV4 S;  3U9G A;  2B0L A;  1G3W A;  3V4G A;  4U88 A;  5BPD A;  3HTS B;  3U1D A;  3HRU A;  2KJC A;  2IPQ X;  4KIG A;  5F64 A;  2KIM A;  1ULY A;  2VOO A;  2PBI A;  3KP7 A;  1RUO A;  2K4B A;  1Z6T A;  1J59 A;  5AIP A;  3DXJ F;  5DUK A;  1K78 B;  5HOO A;  3WGH A;  2ISY A;  1YTY A;  1OPC A;  2HZT A;  4HDU A;  3I58 A;  1R00 A;  4LLL A;  1SMY F;  1ZRC A;  2PMU A;  3HRM A;  2VT3 A;  1L0O C;  3QAH A;  1R23 A;  1S29 A;  2CQK A;  5DV5 A;  4M9X A;  3Q9V A;  3GEZ A;  1WQ2 A;  2WV0 A;  4AVP A;  1YIO A;  4KFC A;  3P9K A;  4RB2 C;  1RNL A;  3HSF A;  2LDU A;  4LG0 A;  1IAW A;  1MJ9 A;  4OIQ F;  5CJ9 A;  5DYM A;  1F9N A;  2FU4 A;  2O8X A;  1MGT A;  3EYI A;  3R6S A;  3JTG A;  2O6G E;  5D8K B;  4HAM A;  1ZN2 A;  1X3U A;  3M9A A;  2MH2 A;  4FT8 A;  3FZV A;  4WXC A;  5L3B A;  1ZGJ A;  3JW4 A;  4OIR F;  1MD0 A;  1R1V A;  1P6R A;  1PP7 U;  2VC0 A;  1O3R A;  2F5D A;  5AIQ A;  2F2E A;  1RIO H;  1EH8 A;  2FBH A;  3JSP A;  4G7O F;  4HLX A;  4PGG A;  4IF4 A;  1BM9 A;  3Q5F A;  2QM3 A;  4M6Y A;  1IRG A;  4CYD A;  3FMS A;  2VBX A;  1IN7 A;  3R60 A;  1T98 A;  3ZMU A;  1XD7 A;  3IWZ A;  1KU3 A;  4ENM A;  4IHS A;  5HDN A;  2LF7 A;  1CF7 B;  1ZYR F;  2ZNZ A;  1L3L A;  1JHH A;  2JPC A;  1FZP B;  1DPR A;  3TDZ C;  4M9Z A;  2QZ8 A;  2IW5 A;  5HLI A;  4DQ2 A;  2W57 A;  3DPL C;  4I01 A;  3HUG A;  2E7X A;  1HSJ A;  3DEU A;  3FXU A;  4PZJ A;  2HDC A;  4UV9 A;  4LLN A;  4M72 A;  1FP1 D;  3WE2 A;  2L3D A;  4M9S A;  2XAH A;  3F8B A;  3K2Z A;  1IN6 A;  5LBQ A;  3M1E A;  3B73 A;  3HRT A;  3DF8 A;  5DUI A;  1BI0 A;  5HS8 A;  4QLC U;  1FBS A;  5LRR A;  2O61 A;  4M74 A;  2EJR A;  4A12 A;  1VTN C;  2ACJ A;  4YFX F;  1B4A A;  2ZNY A;  1FYL A;  2LF8 A;  4L9J A;  2PI0 A;  3FM3 A;  2XRN A;  2HKO A;  2GAU A;  5DD8 A;  3C1D A;  1PP8 F;  2CW0 F;  2DBB A;  3LAJ A;  4I0B A;  3WTS C;  2GA2 A;  3DFG A;  2H94 A;  1XMA A;  2KRF A;  5L3D A;  4HV5 A;  3IRR A;  1V3F A;  1W7P B;  2P5K A;  2X4H A;  4I7H A;  4AWX B;  4BHP A;  1BI2 A;  4D0P A;  3I53 A;  3GO5 A;  6PAX A;  5A2Q Z;  4RAY A;  2V1X A;  1R5G A;  2RC4 A;  3RYR A;  1TBX A;  3ZN1 A;  4EJU A;  2CGP A;  4B8X A;  1NHA A;  2FBK A;  4XLP F;  1XN7 A;  3TKY A;  1ON2 A;  1UFM A;  2IP2 A;  4MQV A;  4HQE A;  2FQ3 A;  3ZMZ A;  2UZK A;  4Y13 A;  3ULQ B;  1LEA A;  3C7J A;  4HYE A;  4IRH A;  1J0R A;  2VN2 A;  4HW0 A;  1U5T B;  4UNO A;  4QWQ A;  2OQG A;  5FGM A;  3ROU A;  4XLN F;  4XRF A;  1Q1H A;  3ZMT A;  3MWM A;  2XKP A;  2IJL A;  2WWY A;  4RS8 A;  3LQR A;  4KUM A;  2JSC A;  2COM A;  1QZZ A;  2DT5 A;  2VBW A;  2YX4 A;  3EET A;  1S3J A;  4ESJ A;  2PN6 A;  1J7K A;  5IT9 Z;  4RGX A;  2WC2 A;  1DP7 P;  1FBU A;  1Z05 A;  2QQ9 A;  3WU1 B;  3TO6 A;  5ED4 A;  3HOT A;  1KU9 A;  1UB9 A;  4I0A A;  1B59 A;  3RKY A;  5ILU A;  5LGU A;  1W5S A;  4I98 B;  2XIG A;  4ESB A;  3T1B A;  1ZG1 A;  4LG0 B;  3FMQ A;  1FYK A;  2XRO A;  4HF1 A;  2Q8K A;  1HW5 A;  1QO0 D;  1RI7 A;  3HYI A;  3BOQ A;  3F8M A;  4HF2 A;  4KMF A;  2M8E A;  1Z1D A;  3U2R A;  4A5M A;  1FY7 A;  5JVT A;  2Z9O A;  1B9N A; 
#chains in the Genus database with same CATH topology
 4XKV A;  2M7B A;  5IP6 A;  3DKW A;  1I39 A;  3GZN B;  2ZXW H;  3N05 A;  3GTJ J;  3B6A A;  1R1T A;  3R4K A;  4FCY A;  1IN8 A;  2KFD A;  1WRJ A;  3U21 A;  1SVM A;  4F7Z A;  5M5Y J;  1SVO A;  2VBZ A;  1ZRD A;  1VQ8 I;  4LD5 A;  3K9T A;  2GXB A;  1TNS A;  2DTR A;  2DT7 B;  5K1Y A;  3M1C A;  2RVC A;  1JJ8 C;  4Q5S F;  1ZTR A;  1TW3 A;  3M8F A;  5ILS A;  3E5U A;  3QPT A;  2I10 A;  4UXN A;  5E17 F;  5FKN A;  5CPR B;  5JLX A;  2CH0 A;  2DA4 A;  3BG9 A;  5K5R A;  2NNY A;  3PNY A;  4ENK A;  3BDD A;  3G3Z A;  3TBI A;  1P9Q C;  2VIX A;  4FQG A;  5DCM A;  1WH5 A;  4HDV A;  4ZTJ A;  2WB1 N;  2XF7 A;  4XKB A;  3S14 J;  1I1S A;  3ZMD A;  3LMM A;  3LSI A;  3CC4 I;  4YIR X;  1JKP C;  3REO A;  5E1W A;  3BPV A;  3CDI A;  2R5Z A;  3J7Z I;  1Y39 A;  1B72 A;  1HF0 A;  2MA3 A;  4DW6 A;  1WI9 A;  1P2F A;  5HS7 A;  2K02 A;  2UXX A;  1ORK A;  3DU6 A;  4PSW A;  1R22 A;  2DN0 A;  2Y30 A;  3Q0W A;  3BZC A;  2ZME A;  4A2U A;  2DA3 A;  3K4L A;  2RN7 A;  3F21 A;  2VPL A;  2E5N A;  1P7I A;  3OOU A;  2DDB A;  3H92 A;  1KON A;  1A6I A;  3ASO H;  4L0Z B;  1RUN A;  3AAF A;  5F27 A;  2UUZ A;  1PUF A;  1APL C;  5B1B H;  3HUG B;  5HDK A;  2MD5 A;  2VI6 A;  1D5Y A;  2RDP A;  2DOA A;  3H0D A;  1KU2 A;  4M6V A;  5EGO B;  4OIO F;  2L2O A;  2FNP A;  4NQW A;  2NVU B;  3BTL A;  1UHS A;  3PNV A;  4PJJ A;  1XX5 A;  3JAM Z;  1R4M B;  1EH6 A;  1R71 A;  1Z91 A;  3ZQF A;  2GM4 A;  4IHV A;  3IH2 A;  1UG0 A;  3RJP A;  5GAD J;  1LB2 A;  1YG2 A;  2BEO A;  1ZEL A;  5HLG A;  5F0H A;  2V9P A;  4G6T B;  5IYC J;  4L18 B;  2NYX A;  5EYR A;  3RYP A;  3L2Q A;  2EB7 A;  2WAE A;  1ETV A;  5J3L A;  4DZJ A;  1JUS A;  2P6T A;  2MGQ A;  2Q1Z B;  2VBY A;  5E1Z B;  4LOC A;  2MC4 A;  5H6Q A;  3VYR B;  3EQL F;  1F5T A;  3V8K A;  2EFW A;  3BP8 A;  4WX9 A;  1MBE A;  3KE2 A;  1OCZ H;  3BZ6 A;  2EIK H;  1VQO I;  1FTZ A;  2V9V A;  4HNT A;  1WJE A;  1R1U A;  4BDY A;  2XAQ A;  4P9F A;  2HVS A;  5HS9 A;  1VFC A;  2Z2S B;  2EFQ A;  3QYE A;  3HPH A;  2NVQ J;  1X19 A;  3QP6 A;  2BHY A;  3ZMV A;  1RC9 A;  3JRI A;  3JR9 A;  2K40 A;  3HHG A;  3H9Q A;  4CZC A;  3EUA A;  4KT5 C;  1RRJ A;  1BIB A;  5EZG A;  2K27 A;  3L2C A;  1T0F A;  1LEB A;  3E3V A;  1U2W A;  2LR8 A;  1P4X A;  4BNC A;  3B6C A;  1KA8 A;  3OYL A;  3F8C A;  2UWM A;  3OS2 A;  3G2B A;  2NVY J;  1JGG A;  1BC8 C;  2V1D A;  3QPH A;  4HRI A;  2WB1 A;  3HOS A;  1ZR4 A;  1SD4 A;  1YIT I;  1AKH A;  1JI8 A;  1HOM A;  3W2W A;  1ZAO A;  2DMT A;  2ZO4 A;  1XPX A;  3BR6 A;  1N78 A;  3E6D A;  1SAN A;  2JMW A;  3BQY A;  5ILV A;  3WGG A;  1ZK8 A;  4X0G A;  1YJW I;  1U0J A;  4EJT A;  3IKV A;  3OSG A;  2ZJQ F;  5CVI A;  3PQJ A;  3ZRG A;  4N4N B;  1FJL A;  1IUY A;  1E3H A;  3I55 I;  3FWE A;  3OYE A;  3CUO A;  2JRM A;  2O5R A;  2X6X A;  2E1C A;  1U5T A;  2HYG D;  2IS6 A;  5CKT A;  2WY8 Q;  3QU3 A;  2K85 A;  4R79 A;  1R5I D;  3BQZ A;  2VUM J;  2F5E A;  1FWZ A;  4XOT A;  1N75 A;  2WAQ N;  4MO7 A;  2HGC A;  1XSV A;  2WA0 A;  4FE4 A;  2P7V B;  3MKZ A;  1DQU A;  1MBJ A;  5K7Z A;  2TRT A;  3H3U A;  3IAS 2;  2LMD A;  1Y1V J;  4LB6 B;  4G7Z F;  1BI1 A;  4HNU A;  3PL8 A;  1F43 A;  4IQ4 A;  3WTX C;  5FKL A;  4UUV A;  2MBF A;  3SEZ A;  5ERI A;  5C3E J;  2M4K A;  1DUX C;  3HIF A;  1D8J A;  3OYG A;  3IH3 A;  2A61 A;  3S1Q J;  2YX7 A;  4G12 A;  1SD7 A;  3QYB A;  3S3M A;  3FBN B;  1GDT A;  4Q47 A;  3C18 A;  3RIR A;  4RLF A;  3QWL A;  3WTV C;  4TV7 A;  1BOA A;  1LFB A;  1FOK A;  3OYH A;  3CP2 A;  1S72 I;  1JHF A;  3RKW A;  1WZ2 A;  1S8N A;  1STZ A;  2D5V A;  4K2E A;  4FET A;  1BIA A;  2P7C B;  5J6X A;  2P81 A;  2V9K A;  4EGZ A;  1K6O A;  4A93 J;  2V79 A;  2YU9 J;  4I99 C;  2FXA A;  2N8G A;  1ETW A;  1D1C A;  2XHK A;  3GUD A;  2JTV A;  1ZR2 A;  2P5V A;  4EV0 A;  1D5V A;  4G6D A;  4GCV A;  1LDD A;  4MFE A;  3WOD F;  3LAP A;  1MMN A;  1OCC H;  1MMD A;  3T8T A;  2BXZ A;  4RMN A;  1B8I A;  1U78 A;  3SFZ A;  5BNG A;  3BZK A;  1IV8 A;  2OZ6 A;  3J81 K;  1MJB A;  5IT3 A;  3OS0 A;  1LQ1 A;  3UKG A;  2OQR A;  2ZCW A;  4B43 A;  4XQF A;  2LH9 A;  4PK4 A;  2HTS A;  4AID A;  1A6Q A;  2CQ7 A;  1GHC A;  2LBF A;  3D5S C;  2VT2 A;  4HBL A;  3SFI A;  1H88 C;  2D1V A;  4XID A;  3ZQ7 A;  2CV0 A;  1T8I A;  1YFH A;  4NBQ A;  4BBS J;  3MFK A;  1JJ6 C;  3GCM A;  1VQM I;  2A07 F;  3OYI A;  3K4N A;  3CCV I;  3GTM J;  3LQQ A;  4U0Y A;  2BBY A;  1YO5 C;  3KFW X;  1UZC A;  1R36 A;  2FOK A;  1IXS B;  2IA0 A;  3E5X A;  1VQ9 I;  1WH7 A;  2EWN A;  2WAQ A;  3ABL H;  5FFZ A;  4G7H F;  2OBP A;  3FKI J;  4GFB A;  3CCM I;  3KEO A;  5DD4 A;  5TRD A;  5K5Q A;  2P5L C;  1KQ9 A;  1HKQ A;  4R8H A;  1M1E B;  5HOD A;  3HKZ N;  2HOE A;  3R61 A;  2LP0 A;  2KIU A;  2XGD A;  4CA0 A;  1HXD A;  2EK5 A;  3ESW B;  2O03 A;  1MSE C;  1TTY A;  3Q9S A;  2H27 A;  4EM1 A;  1I5Z A;  4ENJ A;  3TW6 A;  4LG3 A;  1UHW A;  2Q0O A;  2WAF A;  2R3S A;  3RKX A;  4E70 A;  2CRG A;  4AC0 A;  1R9T J;  3KLO A;  4BH9 A;  2M1B A;  2EV6 A;  2ZXJ A;  4Y15 A;  1W7P D;  1BBY A;  2DJN A;  4LIU A;  4DBR A;  2I5U A;  2HQ5 A;  2O0Y A;  3QOD A;  1IW7 F;  2ZB9 A;  4ZH4 F;  4H0E A;  1SEU A;  2DXI A;  1YIJ I;  3SZP A;  4KNY A;  1HKT A;  5FKM A;  5DCM B;  2HEO A;  2KP6 A;  2NNN A;  4MTD A;  3ASN H;  4FTH A;  1BN5 A;  4DJA A;  2M2E A;  4AYB N;  2VJJ A;  3RSN A;  3H3V K;  2XPV A;  5ICC A;  3CCU I;  4MIM A;  3IWF A;  4N9I A;  1SD6 A;  5GAG J;  2Z1D A;  2R5Z B;  1B72 B;  4NNJ A;  2RNJ A;  5CYV A;  4RA2 A;  1AWC A;  4RDU A;  5D5W B;  3IH4 A;  3MCZ A;  1ZRF A;  1KYW A;  3WU0 A;  3J7A O;  4IOC F;  4Q48 A;  2GWR A;  2R92 J;  1T2K A;  4U0V A;  2EQR A;  2VKD A;  3G1O A;  3H3Z A;  4XLF A;  3X2Q H;  2ZME B;  5L3F A;  1D0X A;  2DQR A;  2PG4 A;  4XSZ F;  3BWG A;  2K4J A;  1QRY A;  4RAG A;  4CSW A;  1PUF B;  1TQP A;  3BCB A;  4EJV A;  3H9G A;  2E34 A;  2EBI A;  3GFI A;  3G73 A;  4NQW B;  4N9H A;  4BQQ A;  4XKC A;  2IAI A;  2QVO A;  2CQQ A;  2JA5 J;  1SD5 A;  1BI3 A;  2JPB A;  1G4D A;  5JLW A;  2HZD A;  1YW7 A;  2K9M A;  2ZXH A;  4ZZD A;  2A6H F;  4LIV A;  2R7U A;  2KZV A;  2BOL A;  4XIC A;  1OMI A;  3CO7 C;  3AL0 B;  2CUJ A;  1POG A;  4CCK A;  1XGS A;  1G3T A;  3CMA I;  1I6H J;  2M34 A;  2V1N A;  1P4A A;  2FRH A;  3QPS A;  3DCF A;  1Z3X A;  2KIF A;  3HOV J;  2PFB A;  1JUP A;  2XAF A;  3W3C A;  1XG1 A;  3PFI A;  3GXO A;  2HTJ A;  2VL8 A;  2HFH A;  3ZCO A;  1FSH A;  4AIJ A;  5K7F A;  2CU7 A;  3FXM A;  1WPK A;  1BA5 A;  4IHW A;  1I3Q J;  2K9N A;  4X6A J;  3HKZ A;  2DK5 A;  4UB6 C;  5IT9 K;  2V6C A;  4IPA A;  2QBY A;  2EA4 A;  4HX7 A;  4EQQ A;  1Z3Y A;  1W0T A;  2CSO A;  2M3A A;  3GVA A;  1J5Y A;  3KEY A;  1SVL A;  4M3F A;  2E1N A;  4B3X A;  2VQH A;  4ZDP A;  4GO1 A;  1PYV A;  4A0X A;  4XOP A;  4AM3 A;  3CLQ A;  1T95 A;  2M5W A;  3EUH A;  4ZYA A;  1Z9C A;  2BW3 A;  3LNQ A;  1DPU A;  1FIP A;  1DGR M;  1BR2 A;  1XGO A;  2MH9 A;  3IKT A;  4GDF A;  2OCC H;  2GOM A;  3LA7 A;  3OOP A;  3W6K B;  2EIN H;  2KT0 A;  2AHQ A;  4F92 B;  4YRV A;  3JRE A;  2R7D A;  1E3P A;  3KP4 A;  3K1P A;  4QPQ A;  3TOA A;  5M3M J;  1FEX A;  3FK6 A;  1AKH B;  1RKT A;  4YIF A;  4AYB A;  4I09 A;  4CXF A;  3L2W A;  2ZFU A;  3ERM A;  5FKK A;  4EGY A;  1ETQ A;  2QF7 A;  4C3H J;  4MEY F;  3V7C A;  3LSK A;  3KP3 A;  3CQZ J;  1XGN A;  2YPR A;  1D8K A;  1TZL A;  5E20 A;  4L9V A;  5J4V A;  4A3J J;  1VZ0 A;  3L00 A;  2IS1 A;  3TED A;  3VEP A;  1S7O A;  2BV6 A;  3OYF A;  4AVZ A;  3AG1 H;  2AQE A;  2M4G A;  2QLZ A;  4OAZ A;  5DEQ A;  2X0L A;  4LLG F;  2X85 A;  4A5N A;  2DMU A;  3KET A;  1H8A C;  5L3G A;  4BQA A;  3SQN A;  4A6D A;  1FT9 A;  4A6E A;  1LVA A;  2VJI A;  3CCS I;  2R7Z J;  2ELJ A;  4HZF A;  2L5Q A;  4IX7 A;  3PJR A;  3BTC A;  2CJJ A;  2L4M A;  3OYN A;  4A3G J;  5FRO A;  3S3N A;  2F5C A;  3F3X A;  2H8W A;  2AS5 F;  1B6A A;  4WWC A;  1HCR A;  1WKM A;  3F22 A;  2Y69 H;  4XBF A;  1VND A;  1S7A A;  3TO7 A;  1FSE A;  2V6E A;  2L9V A;  3CJR B;  2EFO A;  1ZLK A;  5BPI A;  1ETK A;  2HPI A;  2FA5 A;  3TDU C;  2RRE A;  3VFZ A;  4OAY A;  2MAB A;  2KMU A;  3OR1 C;  3T8R A;  4F55 A;  1U9N A;  3HEF A;  1ZG3 A;  3DLA A;  3S32 A;  2XRL A;  4BHB A;  1K61 A;  2Z16 A;  4L5E A;  1G8X A;  2FSW A;  3DP7 A;  4QTR A;  3UNG C;  5IPA A;  2LSO A;  2ISZ A;  3P9C A;  1RES A;  2HVQ A;  4LK1 F;  5L3E A;  1FC3 A;  5KAI C;  2KL4 A;  2QQ8 A;  4M71 A;  3LA3 A;  1O4X A;  4HSR A;  1MH4 A;  5GPC A;  2XPU A;  4EJW A;  2VOD A;  1GVJ A;  1MBH A;  2IVM A;  2HVR A;  4NB5 A;  3RQ4 A;  2AQF A;  3JAM K;  1R5H A;  1ZGW A;  3W6V A;  3ZQI A;  1IRX A;  4N0B A;  1B8I B;  1KYZ A;  4FX4 A;  1X4O A;  1RR7 A;  1TT5 B;  1V55 H;  4DYC A;  3SZT A;  5FO5 A;  4QPO A;  1X4P A;  4KYW A;  4PDK A;  1ZG5 A;  1LVK A;  3E7L A;  1XC5 A;  2XAG A;  1D0Z A;  1PUE E;  1X2M A;  2OU2 A;  2OD5 A;  2Z33 A;  5E8G A;  5LEJ A;  4FHT A;  2LBF B;  2EV5 A;  5DCF A;  2A05 A;  4IRI A;  4XON A;  2EZI A;  2OPT A;  3OYB A;  3K4K A;  1XDU A;  2BY0 A;  4XLE A;  2ZJR F;  2VE8 A;  3FXQ A;  5DM7 F;  4Y33 A;  1QGP A;  1SFX A;  5KHD A;  5F1R A;  4ESF A;  2P0W A;  2H09 A;  1VQN I;  5F0F A;  1UST A;  2R7W A;  2DMP A;  2ZME C;  4BXX J;  1U6G A;  3HOW J;  5CVR A;  3LSG A;  3COA C;  1V4R A;  1WCM J;  1I3A A;  1KU7 A;  2W48 A;  4CDG A;  3V7S A;  3JRB A;  2RQQ A;  2WY7 Q;  3HHH A;  3HBL A;  4GYG A;  3ABK H;  4PFP A;  3S1R J;  1FLI A;  2H8R A;  1XS9 A;  3I59 A;  2DI3 A;  1YRN A;  1R58 A;  1ETO A;  3BJA A;  3CUQ A;  3WTZ A;  1U3E M;  3ML6 A;  2Z99 A;  2NAZ A;  3K10 A;  3P9I A;  4MTE A;  3RZO J;  2DPU A;  3I4P A;  1A31 A;  2L9R A;  3NQO A;  4GGG A;  2PLY A;  2HOS A;  3LFU A;  4ITV A;  4O3M A;  2KPM A;  3LSM A;  2HR3 A;  1D3Y A;  3H9J A;  1MDM A;  1RKW A;  2KJB A;  2Y31 A;  3U1K A;  3ZQG A;  1G6N A;  1MND A;  5D6F A;  3ONQ A;  2G7H A;  3DTI A;  4Q4Z F;  2A6T A;  1FYM A;  3KZY A;  5FLV A;  2QSF X;  1HW1 A;  1Z6R A;  3VSK A;  4L5I A;  4CO8 A;  4OU0 A;  2E35 A;  3M07 A;  2IT0 A;  3P7N A;  1KQ0 A;  2BE5 F;  5CVV A;  1WWX A;  4P55 A;  1LFP A;  4YEJ A;  3F0C A;  2HQA A;  2WTE A;  2K9S A;  3RPU A;  2PJR A;  2JK3 A;  4ABZ A;  2JRT A;  4KDP A;  4KIF A;  1JT0 A;  4V19 K;  4M3G A;  2DPD A;  3FXL A;  1JTY A;  3HXL A;  4KA4 A;  1O7F A;  2E2H J;  2H6B A;  3RPQ A;  3VDX A;  2Y0M A;  1ZRE A;  1HBX G;  3BR0 A;  1A36 A;  2RNG A;  1TNT A;  5DDG A;  1NH3 A;  1B1B A;  1MW7 A;  4Z2Y A;  1EV7 A;  4MLO A;  1VQ7 I;  3MZY A;  3SXY A;  4BXF A;  1O3T A;  1UCR A;  3SZG A;  5LHI A;  1T0F C;  3CTA A;  4Y4R A;  4LK0 F;  5ICG A;  2A3S A;  3S3O A;  2M30 A;  4E4H A;  2V1U A;  4CGZ A;  2ESH A;  1BR1 A;  1Z7L A;  1SFU A;  3OYD A;  1FOY A;  3GLL A;  3JTH A;  4YEL A;  2X1C A;  4O5V A;  3D1N I;  1IUF A;  5IYB J;  4B4C A;  2P6S A;  2EZH A;  3J80 Z;  2HNH A;  3GBG A;  1W0U A;  3NAU A;  1JKR C;  1R6R A;  3ABU A;  3DBH B;  2IXS A;  1LDK B;  4OWR B;  1EA3 A;  4RB0 A;  5TJJ A;  5LHG A;  3CP8 A;  3ECO A;  2CWE A;  3W2V A;  3RQI A;  2XUB A;  1QZY A;  2R4G A;  3WGI A;  4C9Y A;  2JVH A;  3J7Y J;  1WVR A;  2E1O A;  3HTU A;  4A3D J;  3FXK A;  2B7E A;  1E2X A;  1U5T C;  3KYC B;  4EEF G;  3QU6 A;  4NC8 A;  1AHD P;  4KMU X;  2F6C A;  4AD9 A;  3ERE D;  4HOB A;  5E3O A;  3KYD B;  2CW7 A;  2FOW A;  5L3C A;  1YW8 A;  1HW2 A;  1JXS A;  1AOY A;  4MNU A;  3WTW C;  4CCN A;  2K3P A;  3D0S A;  3UR3 C;  1QPM A;  4BEH B;  1I1G A;  3QP5 A;  2QBY B;  1HDD C;  3F9K A;  1WJD A;  3HGY A;  2RKH A;  3ZQC A;  4L5J A;  2XSD C;  2IRF G;  2DAO A;  2FMY A;  4MHG A;  3R0J A;  1Z21 A;  3HG9 A;  1Y0U A;  4D1Q A;  2FE3 A;  2YS9 A;  1LDJ A;  3N4M A;  1LPQ A;  3KLN A;  4LIT A;  4O6J A;  1HDP A;  2ME0 A;  2GZW A;  3CDH A;  3G6E I;  1J75 A;  3GZ6 A;  5CQG A;  2X6O A;  2BW3 B;  3BG3 A;  4A69 C;  1X58 A;  5EJC A;  3HSE A;  3VYU B;  3LWF A;  5FFX A;  2K9Q A;  3BPX A;  5HVQ C;  2XPW A;  3CJT B;  4JK1 X;  2Y2Z A;  2LFB A;  1I27 A;  3V8J A;  3HOU J;  2KLO A;  3GFL A;  4IJA A;  5FLX Z;  1V54 H;  4A3C J;  2COB A;  1BJA A;  2HKX A;  2MD0 A;  4AIK A;  3MKL A;  2KKO A;  5ICE A;  3NRV A;  3S8P A;  3OWT A;  4R1H A;  3DU5 A;  3MQ0 A;  4I6Z A;  2ZXI A;  4XM3 A;  4HX8 A;  5HLT A;  2CMP A;  2XAJ A;  1K6Y A;  5KK1 A;  2HQN A;  1G2H A;  5EZH A;  1OR7 A;  1G3S A;  2J5P A;  3H1C A;  5LEK A;  3MKY B;  4JX4 A;  3GX4 X;  2QYO A;  1XMK A;  3ZPL A;  4F91 B;  3V7R A;  2XGX A;  3VYT B;  2CFX A;  3O2P E;  2LKP A;  4G9Y A;  3S2D J;  3I71 A;  1IDY A;  3KX2 A;  4PJN A;  3V8L A;  4S0H B;  1FTT A;  1YX3 A;  5D5U B;  3FHZ A;  1T08 B;  5KVR A;  1EKE A;  1ZLJ A;  3E6B A;  2CW8 A;  2L9N A;  4I76 A;  1OYY A;  2ID6 A;  3O8H A;  4RM3 A;  3SDB A;  4C3J J;  3HL2 A;  3EDP A;  1TWC J;  4WK8 F;  4AU7 A;  1OYW A;  5EEA A;  3SJM A;  4RB1 A;  2LKX A;  4XL9 A;  2STW A;  1TWA J;  3HSR A;  1YW9 A;  4CCJ A;  3LSR A;  2OV7 A;  3KZZ A;  2R93 J;  2OF7 A;  1MIJ A;  2JN6 A;  2DLL A;  2MLK A;  4ZZL A;  4QSH A;  1Y6I A;  2E60 A;  3AG3 H;  4HV6 A;  4OMY A;  2X51 A;  4WXD A;  2ESN A;  1GXQ A;  3QPL A;  1MBF A;  3PNT A;  4ETS A;  3JRF A;  3W6J B;  4HX4 A;  3K70 C;  4XR6 A;  4RB3 C;  4EM0 B;  1GUU A;  4IO9 F;  2BGC A;  2F4O B;  4D7M A;  4DNC A;  5HDG A;  3AFH A;  5D4S A;  5ICF A;  1UEL B;  4BJT A;  2IGK A;  2DMN A;  3KCC A;  2OJE D;  5DS9 A;  1JGS A;  4RGU A;  3WE3 A;  1Z7U A;  1FBQ A;  3F72 A;  4JOM A;  1QHG A;  1ZQ3 P;  2QWW A;  3CLO A;  4DGW B;  1OYI A;  5B66 C;  2L02 A;  1ITY A;  2M0M A;  4NC6 A;  4LGW A;  3DQV C;  2LY9 A;  5B5E C;  2X1D A;  3LL7 A;  1W4M A;  3VOD A;  2OZU A;  4WCG A;  4X1E A;  3C2H A;  3LSP A;  2LOO A;  2A5W A;  4L0Y B;  3Q0V A;  4DBQ A;  2VE9 A;  3BY6 A;  1YQA A;  4BYY A;  2YUS A;  2EFP A;  4KIC A;  3GME A;  2DT6 A;  3BLY A;  2L7F P;  1IDZ A;  2GLO A;  4CYC A;  5GAE J;  5BQT A;  1MZB A;  2XAS A;  2EA2 A;  2JZY A;  3F6O A;  2CYY A;  4KN4 X;  3IL2 A;  4NC7 A;  4A0Z A;  2M0C A;  4AIH A;  1QBJ A;  1T6S A;  2DFF A;  4Y52 J;  2F4M B;  3CCY A;  1J9I A;  4E7H A;  2LYC A;  5FLM J;  2JWT A;  3C2B A;  1GLN A;  3PSI A;  3S93 A;  2CQN A;  1EH7 A;  3MN2 A;  3TOB A;  3ECH A;  3WU2 C;  2M9H A;  1V5F A;  1YS7 A;  1S5L C;  1WJF A;  2ZBK A;  1TL8 A;  3V42 A;  3OIQ A;  4UVB A;  4RAZ A;  1J2X A;  3S1N J;  4YG2 F;  2QKL B;  1ZKG A;  5IYD J;  4UHT A;  1IRF A;  2PJP A;  1RZ4 A;  3I4M J;  2L4A A;  1T38 A;  2E71 A;  2ZSI B;  5FB2 A;  4N4O B;  1ETY A;  3DEW A;  1MMS A;  2EFN A;  3VWB A;  2NRA C;  3E6C C;  2DFE A;  3ZP5 A;  5IY5 H;  5D4R A;  2DA7 A;  3L7W A;  3MVP A;  2MG4 A;  3ZQH A;  1LJ9 A;  3I0T A;  3P5J A;  2NXN B;  3M8J A;  4ZYH A;  1UAA A;  3FK7 A;  5K5O A;  1G3Y A;  1WJB A;  2D45 A;  4BE0 A;  5F0C A;  3FXR A;  2GA1 A;  3FM5 A;  4HF0 A;  3ZGK A;  1RR8 C;  4EM2 A;  1XSD A;  2ELK A;  4M6X A;  2EIJ H;  2BVL A;  1TWF J;  2FF4 A;  2Y0S N;  3T0Y A;  2ETH A;  1XCV A;  3I59 B;  5A2Q K;  3JRH A;  2NOJ B;  1YRN B;  5FD6 A;  2XB5 A;  3CUQ B;  2UV1 A;  4YII A;  2A5Y B;  4C2U A;  2FML A;  5J8F A;  1BOB A;  2W25 A;  2ID3 A;  4RGS A;  1HST A;  2XGE A;  2MLG A;  5B1A H;  4B3A A;  3OYK A;  1LKX A;  2MC3 A;  2NS0 A;  4M3E A;  4OOI A;  3TQN A;  3WTY C;  1MSF C;  2XSJ C;  1MDM B;  2VPR A;  4RM2 A;  2V7F A;  1MBG A;  4ZJZ A;  1P4W A;  1B9M A;  2VJ5 A;  4EMS A;  3FX3 A;  3OY9 A;  4MFD A;  3MZH A;  2HWV A;  2W82 A;  2LKS A;  5E79 C;  4CIC A;  2L0K A;  3D5R C;  2H1K A;  3I64 A;  2R7S A;  3FXO A;  2CO5 A;  5C44 J;  2P4W A;  1T56 A;  4UVC A;  4XRS G;  1RET A;  1TP4 A;  2CV2 A;  3BJO A;  3FHN A;  4II3 A;  3HPG A;  3JRD A;  2PJR B;  3F8N A;  3F23 A;  2DFH A;  2K9L A;  1HQC A;  2YU3 A;  3J81 Z;  2PEX A;  3NAR A;  3GTK J;  3MEX A;  3F8F A;  2DW4 A;  4J00 A;  2CS3 A;  3FMR A;  3EUH C;  3OL4 A;  3K4C A;  1FX7 A;  1VQP I;  2Q2E A;  3OIO A;  3S15 J;  3G1L A;  2W84 A;  5EG0 A;  4IHX A;  3K1N A;  3FXJ A;  1C0W A;  1V5E A;  3C3W A;  1XGM A;  3IHU A;  4XSX F;  1TW2 A;  1I50 J;  1A35 A;  2C6Y A;  1W5T A;  1XB4 A;  3TMO A;  1TT0 A;  1OIS A;  2DJI A;  2DYS H;  3GLX A;  2GQQ A;  2JSP A;  3GFM A;  4Y7N J;  2R7X A;  2R7F A;  2M45 A;  3GTG J;  2A68 F;  4BEH A;  2XF5 A;  3PM1 A;  1H9G A;  3GTO J;  2KHM A;  3AG4 H;  4UVA A;  1K7A A;  2STT A;  5F6F A;  1TQI A;  3LFK A;  5FD5 A;  4BXU A;  3OMY A;  4CCM A;  2F48 A;  3DWL E;  2R7V A;  1OKR A;  1ZHF A;  2L54 A;  2F5F A;  2DDA A;  3M7G A;  2TDX A;  4LFU A;  5HNF A;  1QA6 A;  2OAZ A;  2VKV A;  2VQG A;  2RQP A;  3EPZ A;  3WTU C;  5CVU A;  1O7L A;  2DA2 A;  1A04 A;  5H20 A;  2GXG A;  1FNN A;  3BG6 A;  3L9F A;  2LY1 A;  3LA2 A;  1U9O A;  1WHU A;  3HOY J;  2Y0S A;  4Y17 A;  1MMA A;  2R7R A;  4HLY A;  5JFR A;  1I6X A;  4PCQ A;  1HC8 A;  2ELH A;  1GXP A;  3CMY A;  3ZMS A;  5GTH C;  2HI3 A;  1TLH B;  5IP9 J;  1MMG A;  4GRI A;  2OA4 A;  2ZKZ A;  5F08 A;  2IBD A;  1SMT A;  4QIW N;  4U0W A;  3DBL B;  4E7K A;  5BOX A;  1NTC A;  3ZOB A;  3O6B B;  2IEK A;  4WF2 A;  3CC2 I;  1GV2 A;  3KP2 A;  3GTL J;  5CLS A;  3IUO A;  4D9J A;  1E0E A;  4FX0 A;  3L2U A;  4B09 A;  2CV1 A;  3HOX J;  5GAH J;  3FBI B;  3SEQ A;  4E7L A;  1XSX A;  3KP5 A;  4BAY A;  3CF5 F;  2OTL I;  2DOD A;  3K4M A;  3H36 A;  1HKS A;  3CJQ B;  4L9T A;  5DTD A;  1CGP A;  3G1M A;  3CCR I;  2XF6 A;  3G71 I;  4ZYE A;  1JE8 A;  3KP6 A;  1LNW A;  4GYI A;  1HLV A;  3I4N J;  2QKM B;  3K70 D;  4XRM A;  3F6V A;  2X48 A;  2E1M B;  3ZN0 A;  1ODD A;  2PMH A;  1PDN C;  1K78 A;  4P96 A;  4GXO A;  5KAF C;  2RV8 A;  4PJ0 C;  3KZI C;  2M7A A;  3QYF A;  3EUK L;  4P5O A;  2Y9Z A;  2W85 A;  1SC7 A;  3BR1 A;  4P1W A;  2A69 F;  3WG9 A;  1IZ1 A;  3VB2 A;  2ZC2 A;  3K4B A;  1QQI A;  5EEH A;  3OV8 A;  4EJO A;  3MD2 A;  4D5F A;  4S04 A;  3CF2 A;  1IN5 A;  4A3B J;  3NWS A;  2FJ1 A;  1WJ5 A;  3K1M A;  1X1A A;  1WSU A;  1XMX A;  5E18 F;  2DK8 A;  3PO3 J;  3GWZ A;  1IN4 A;  1YLF A;  4D5C A;  3M3Y J;  2VB6 A;  4XN0 A;  2NOG A;  1H0M A;  2RGV A;  2G0E A;  3E5Q A;  5E3M A;  1X2N A;  3QOP A;  4B47 A;  1KGS A;  3WTT C;  4YFN F;  3QRF F;  3BR3 A;  2A6E F;  3PIP F;  1UMQ A;  2DMQ A;  2KDZ A;  3KPH A;  4OIN F;  2EZK A;  2FUG 2;  2HS5 A;  2QUF A;  3CJN A;  4KIB A;  4L9N A;  3CO6 C;  5J1R A;  1U8B A;  1GV5 A;  3K69 A;  4BU2 A;  4PGH A;  2DA6 A;  2ADU A;  1YYV A;  4CUG A;  3HGG A;  2O3F A;  4B48 A;  1S6L A;  1JKO C;  1OFC X;  3BCA A;  2K7L A;  5J4Y A;  4IXA A;  1H9T A;  2FX0 A;  3HRS A;  4UV8 A;  1MJA A;  2JUC A;  3DPT A;  1JKQ C;  3H5A A;  2QQB A;  2DU9 A;  1V5G A;  1VQL I;  3E97 A;  3DEE A;  4RGR A;  3TW7 A;  3RTR A;  2IGM A;  4ZYG A;  1FOX A;  4ON0 A;  1SAX A;  3H5N A;  2MYS A;  3ZQL A;  4MEX F;  4HA8 A;  3ZR8 X;  1MKM A;  3A02 A;  5LLQ A;  3CCQ I;  1Y8Q B;  3NEU A;  5LGT A;  2EPF A;  3IRQ A;  3ISP A;  5IP7 J;  2EIM H;  4IL6 C;  3SHF A;  3MAJ A;  4M3D A;  5AON A;  5JVG F;  1O57 A;  1OCO H;  3CUQ C;  1ZGA A;  3PIO F;  4WXH A;  1ON1 A;  2TCT A;  5JI6 A;  2Y48 A;  3A01 A;  1T39 A;  2IS2 A;  4G94 A;  1Y56 A;  2VXZ A;  2XKO A;  4XN3 A;  2QA4 I;  1BW5 A;  3T5X A;  2KRC A;  1IO2 A;  3OS1 A;  1TQM A;  1ONV A;  3KEQ A;  4U7D A;  1USS A;  5BS6 A;  2VJ4 A;  1IV6 A;  3BRO A;  2Z3Y A;  3OR2 C;  4BHC A;  3BTI A;  3J80 K;  1YS6 A;  5JHU A;  2OTJ I;  3DV8 A;  5M5X J;  3B02 A;  3FIW A;  4CYC B;  2IGN A;  1E17 A;  5EEG A;  4BY1 J;  3ABT A;  3TL4 X;  4YFK F;  5B3S H;  1VF9 A;  2AXL A;  2E2I J;  9ANT A;  3QQA A;  4A0Y A;  3IC7 A;  3DBR B;  3DPU A;  1UG2 A;  4C3I J;  1VQ5 I;  3N97 A;  1FPQ A;  2IA2 A;  2G9W A;  2CUE A;  4C2M J;  2R0Q C;  3CC7 I;  4G8X A;  2QCO A;  1Y0N A;  1U8R A;  4EVI A;  1F1Z A;  4I2O A;  1NK3 P;  3W2A A;  3GFJ A;  5E8I A;  2JQ7 A;  1XCB A;  3S2H J;  4XOR A;  4CZZ A;  1CF7 A;  4OMZ A;  2BYV E;  3AL0 C;  4A3L J;  4EAT A;  4A3I J;  4IVN A;  3S17 J;  5H6R A;  2QGU A;  2B63 J;  2IA1 A;  2P8T A;  4MGR A;  1FIA A;  1K79 A;  2FNA A;  4BKX A;  1DDN A;  4HEA 2;  2X6W A;  1VI0 A;  2EV0 A;  2ZSH B;  3D5L A;  3RCO A;  4LMY A;  3VOE A;  2NS8 A;  2GXA A;  2J5O A;  3RDI A;  4FE7 A;  1NK2 P;  4UUS A;  1XTA A;  3TO9 A;  2CG4 A;  3EYY A;  3RI4 A;  4JQF A;  2X1E A;  2VC1 A;  4U7B A;  4CHU A;  3FIS A;  4IZZ A;  2EZL A;  3I5U A;  2M87 A;  3O3K A;  2JA6 J;  2L01 A;  5FKO A;  1MNM C;  2QSG X;  1UHM A;  2DA5 A;  3DKX A;  1OCP A;  5FLX K;  4RAF A;  4HQM A;  5KCM A;  5J1Y A;  2LY2 A;  3A4C A;  3E1S A;  1SFE A;  2KDO A;  3TGN A;  3CCL I;  4IHT A;  2HQR A;  1O3S A;  2YSR A;  2H6C A;  2UXN A;  4G6Q A;  3HOZ J;  1MNE A;  4OIP F;  1ZAR A;  1EF4 A;  1F4K A;  4JBA A;  1BC7 C;  2VQC A;  4I02 A;  2DO7 A;  3OYJ A;  2E7W A;  3I54 A;  3HC7 A;  4LJZ F;  2FBI A;  1MBK A;  3FF5 A;  4J19 A;  2VLA A;  1IG7 A;  4NUB A;  3RKQ A;  1REP C;  2VON A;  1VQ6 I;  4C2T A;  3GW2 A;  4ZYD A;  2E36 A;  2Y75 A;  2OC6 A;  3RZD J;  4FIS A;  2GOX B;  4PSX A;  2G7U A;  4BGD A;  1BW6 A;  1YHQ I;  4E7Z A;  2JT1 A;  2ZFW A;  4JYK A;  3R0A A;  3C2G A;  4MQ9 F;  5FJ8 J;  3GF2 A;  3ZXS A;  3GYH X;  2LC2 A;  3L09 A;  2PQ8 A;  3H0G J;  1QNT A;  1F36 A;  3LST A;  4B44 A;  1YX5 A;  1WJC A;  2K86 A;  2GIV A;  4ASN A;  2Q2E B;  5EG0 B;  4S05 A;  5J8C A;  3HM5 A;  5M5W J;  2KQR A;  1IC8 A;  4BJ6 C;  2Z5U A;  1IXC A;  3BC8 A;  3OYA A;  3Q3S A;  3GZ5 A;  5EF6 A;  5GP9 A;  5HLH A;  4FAS D;  5D5V B;  1ZH5 A;  3BJ6 A;  4M73 A;  5D8L B;  2LNB A;  4KIT B;  2DYR H;  2QEN A;  3LOC A;  3SYT A;  2FEZ A;  1WJA A;  2E1M C;  1W7P A;  1SAU A;  3M8E A;  5LGN A;  2QQA A;  4KN7 X;  1KQ8 A;  4NHJ A;  1OR7 C;  2L7M P;  5E1X A;  4BQN A;  2HYF A;  4E7I A;  1R7J A;  1WGX A;  1W36 C;  2VOP A;  1WI3 A;  4ENN A;  2D2W A;  3JSO A;  4LB5 A;  1FP2 A;  2DQL A;  1N25 A;  2LVS A;  4J01 A;  2D1H A;  4IRG A;  2DFI A;  2ZJ2 A;  3ELK A;  3HB9 A;  5F1J A;  4KIS A;  4XLC A;  5D5X B;  3E6M A;  1O3Q A;  3GTP J;  2BHZ A;  2ZJP F;  1TC3 C;  3S2W A;  3G4S I;  1Z67 A;  3PUF A;  5D6E A;  5BMZ A;  1OCR H;  1P92 A;  2XVC A;  3IAM 2;  3K0L A;  5LRS A;  1XDS A;  5CVJ A;  5JR3 A;  2YR2 A;  1IXR C;  4V2G A;  2EIL H;  4P9U A;  3CCE I;  3PQK A;  5LHH A;  2R5Y A;  3CZ6 A;  2W24 A;  1IF1 A;  1FOW A;  2XV4 S;  3U9G A;  2AXT C;  1YJ9 I;  1TWG J;  2B0L A;  3JRG A;  4W1U A;  1QU3 A;  1G59 A;  1G3W A;  3IV5 A;  3V4G A;  4U88 A;  2JA7 J;  1OJL A;  3CME I;  5BPD A;  3HTS B;  3CD6 I;  3OYC A;  2B9S A;  3U1D A;  3VPR A;  5E3L A;  3HRU A;  1X1D A;  2KJC A;  4XLA A;  1LE8 A;  2IPQ X;  1JUM A;  1UJ8 A;  4KJZ A;  2MFZ A;  4Y3O A;  1Z0X A;  4KIG A;  4IEJ A;  5F64 A;  2OCE A;  5F04 A;  2KIM A;  5KNL A;  1ULY A;  2VOO A;  2PBI A;  3KP7 A;  1RUO A;  2K4B A;  1Z6T A;  2LG4 A;  2L7K A;  4V2F A;  1J59 A;  5AIP A;  3TP3 A;  1R49 A;  3DXJ F;  5DUK A;  2R7Q A;  4DIQ A;  5IOY A;  1VQ4 I;  1K78 B;  4C30 A;  2WBM A;  5HOO A;  4HPQ A;  5H2F C;  3S16 J;  3WGH A;  2ISY A;  3BG5 A;  1OPC A;  2HZT A;  3FDY A;  2ECC A;  3I58 A;  4HDU A;  1YTY A;  4M3B A;  1R00 A;  3A0B C;  4LLL A;  1SMY F;  3LSH A;  2PMU A;  5DM6 F;  1ZRC A;  2JUG A;  3HRM A;  2FQ4 A;  4A3K J;  2VT3 A;  2V26 A;  2LRD A;  1L0O C;  2Y9Y A;  3QAH A;  3OYM A;  2CUZ A;  1R23 A;  4CCO A;  1S29 A;  2CQK A;  5DV5 A;  4M9X A;  2NVX J;  2HOA A;  3Q9V A;  4IHY A;  3GEZ A;  2XGC A;  3AKZ A;  1WQ2 A;  2WV0 A;  4AVP A;  1YIO A;  4KFC A;  2KIQ A;  2H1L A;  4E7S A;  3P9K A;  4RB2 C;  2O9L A;  1RNL A;  2K5C A;  2O7O A;  1Y1W J;  4AUX A;  3HSF A;  2LDU A;  4Z6Y A;  4LG0 A;  5JHF A;  2XC7 A;  4U87 A;  1IAW A;  3S1M J;  1MJ9 A;  3GTQ J;  4OIQ F;  5CJ9 A;  5DYM A;  1F9N A;  2FU4 A;  3RPU D;  2O8X A;  1X1B A;  2E5Z A;  1MGT A;  2F5V A;  4BQO A;  2JA2 A;  3EYI A;  2ECB A;  3R6S A;  3JTG A;  1MH3 A;  1W1W E;  2L7Z A;  2O6G E;  3A2K A;  1LFU P;  5D8K B;  2GIZ A;  4CH7 A;  4HAM A;  1ZN2 A;  3K7A J;  1X3U A;  3M9A A;  2MH2 A;  1E3O C;  4FT8 A;  3FZV A;  4WXC A;  2ICW G;  2BXY A;  4NDL A;  5K7H A;  5L3B A;  1ZGJ A;  3TP0 A;  3JW4 A;  1VQK I;  1KZH A;  4OIR F;  1MD0 A;  1YJN I;  5HNH A;  1R1V A;  3K4J A;  3JRC A;  1P6R A;  1FMV A;  1PP7 U;  2VC0 A;  4ANJ A;  4XNF A;  2IGO A;  1O3R A;  2F5D A;  5AIQ A;  3A01 B;  2F2E A;  2W7N A;  1RIO H;  3DLL F;  1EH8 A;  2FBH A;  3JSP A;  2QEX I;  4G7O F;  2R7T A;  4HLX A;  3BR2 A;  4F93 B;  4PGG A;  4IF4 A;  2HPM A;  1BM9 A;  3Q5F A;  2QM3 A;  2FD5 A;  3PFY A;  4M6Y A;  2R7O A;  4DYR A;  1DU0 A;  2MW8 A;  2BY3 A;  2XDV A;  1IRG A;  3I3L A;  4CYD A;  1JTX A;  3FMS A;  3AG2 H;  3JRA A;  2VBX A;  1IN7 A;  4BL0 B;  3CMM A;  2DOF A;  3R60 A;  3KIO A;  2BY2 A;  1T98 A;  3ZMU A;  1XD7 A;  3IWZ A;  1KU3 A;  2LLK A;  2RAE A;  3A03 A;  4ENM A;  3K2A A;  4IHS A;  5C4J J;  5HDN A;  2LF7 A;  4UY8 I;  1EJ9 A;  2NS7 A;  1GVD A;  5FRM A;  2HOT A;  3OSF A;  1PJR A;  5GPA A;  4KT6 A;  2MSY A;  1CF7 B;  1FMW A;  1ZYR F;  2HXI A;  3MMY B;  2ZNZ A;  2XB0 X;  1L3L A;  1JHH A;  2JPC A;  2LD5 A;  1DPR A;  3TDZ C;  1FZP B;  4M9Z A;  1SFK A;  4ZTF A;  2QZ8 A;  3L1P A;  2IW5 A;  4ZDL A;  5HLI A;  4II2 A;  4DQ2 A;  2W57 A;  4A3F J;  3DPL C;  4PUS A;  4I01 A;  3HUG A;  4IQJ A;  3CDL A;  4XKW A;  4BE1 A;  5GTI C;  2E7X A;  1AU7 A;  1HSJ A;  3DEU A;  2X6Y A;  3FXU A;  4PZJ A;  5EGO A;  2HDC A;  3M4O J;  4UUS B;  3WG7 H;  4UV9 A;  4LLN A;  2WV1 A;  2CFO A;  2KRH A;  4M72 A;  1FP1 D;  3WE2 A;  4F3Q A;  2L3D A;  4M9S A;  1P7J A;  1NG6 A;  2XAH A;  3F8B A;  3K2Z A;  2EH3 A;  1IN6 A;  3O8G A;  5LBQ A;  2K3F A;  1K83 J;  3M1E A;  1WFX A;  5LD2 C;  4PFO A;  2W4S A;  1R4N B;  2HU9 A;  3B73 A;  3J7A Y;  3HRT A;  4XMY A;  3VYS B;  3DF8 A;  5DUI A;  1BI0 A;  1OQY A;  3SDG A;  2L9S A;  5HS8 A;  3NWT A;  4QLC U;  1FBS A;  1X3W B;  3MKW B;  2X9D A;  5LRR A;  1HA8 A;  3DTK A;  2O61 A;  1W36 D;  1OCT C;  1QZE A;  4M74 A;  2EJR A;  4A12 A;  5IOZ A;  1VTN C;  2ACJ A;  4YFX F;  3WHB A;  3A1Y A;  4IKF A;  2GBY A;  1B4A A;  2W1O A;  1PVE A;  2ZNY A;  1QVT A;  1FYL A;  1YE9 A;  2LF8 A;  4L9J A;  3OL3 A;  2OUM A;  2PI0 A;  3FM3 A;  4XLH A;  4W97 A;  2XRN A;  3L2V A;  1IGN A;  2HDW A;  3BG7 A;  2NVT J;  3MZ8 A;  1NG7 A;  2PMZ N;  4PJL A;  3OIP A;  3HZJ A;  3I9V 2;  2HKO A;  4IOA F;  2GAU A;  5DD8 A;  2HXO A;  3C1D A;  3IP4 B;  3VSL A;  4HST A;  1ACI A;  1PP8 F;  3H5R A;  1TWH J;  1CQT A;  2CW0 F;  2DBB A;  3PO2 J;  4XRS A;  3LAJ A;  4I0B A;  3WTS C;  2GA2 A;  3DTE A;  4DZP A;  3DFG A;  2H94 A;  1JT6 A;  1XMA A;  1ETX A;  2KRF A;  4BUP A;  1X3Z B;  2JJ7 A;  4HNV A;  3ABM H;  3CCJ I;  5L3D A;  1J09 A;  2BZT A;  4UB8 C;  5C4X J;  2VXD A;  3FKJ A;  5M3F J;  4HV5 A;  1S9H A;  1D1B A;  3IRR A;  3PUB A;  1Q1V A;  2JVG A;  1V3F A;  1W7P B;  1DU6 A;  3I56 I;  2M8G X;  2P5K A;  2X4H A;  3KYL A;  4I7H A;  2V4J C;  3E0J B;  4AWX B;  4ZC3 A;  1AA7 A;  2LK2 A;  3DKY A;  4A3E J;  4BHP A;  1BI2 A;  4D0P A;  5LFA A;  3I53 A;  3GO5 A;  5EDN A;  1BJZ A;  6PAX A;  2DA1 A;  2AO9 A;  2VAS A;  5J40 A;  5A2Q Z;  4RAY A;  2V1X A;  1R5G A;  2RC4 A;  3BR5 A;  3RYR A;  2QSH X;  3A0H C;  1TBX A;  2ME6 A;  2E2J J;  3ZN1 A;  3WHC A;  4EJU A;  1S7E A;  2CGP A;  4BE2 A;  4B8X A;  1NHA A;  2FBK A;  3BT9 A;  3CES A;  4XLP F;  1XN7 A;  3ZQQ A;  2HDD A;  3TKY A;  1W5C C;  1ON2 A;  3BTJ A;  5E3N A;  1UFM A;  2IP2 A;  5CQE A;  2XAU A;  2VQL A;  4BAC A;  4MQV A;  3Q0U A;  4PJM A;  1ENH A;  4HQE A;  2FQ3 A;  3ZMZ A;  2R5Y B;  1Y8R B;  2WAD A;  4Y13 A;  3ULQ B;  2UZK A;  1LEA A;  2IS4 A;  5J1U A;  3C7J A;  4BS9 A;  4HYE A;  4IRH A;  3L2R A;  1J0R A;  2VN2 A;  4HW0 A;  3HDD A;  2CUF A;  3K6G A;  1A5J A;  2VKE A;  2LTP A;  1U5T B;  2BVM A;  4UNO A;  5TGT A;  1BR4 A;  4QWQ A;  2F4I A;  2E19 A;  2OQG A;  1IRZ A;  5FGM A;  2VKH A;  1BL0 A;  2O8K A;  3ROU A;  1LE8 B;  4XLN F;  4XRF A;  1GT0 C;  1DP3 A;  1Q1H A;  1YOV B;  3PSF A;  3ZMT A;  2DOE A;  4JX6 A;  5FRN A;  3MWM A;  2XKP A;  2IJL A;  5TIS C;  2WWY A;  4RS8 A;  2W00 A;  2DTZ A;  3JCU C;  3LQR A;  4KUM A;  1DGW Y;  2JSC A;  2PMZ A;  2COM A;  1YI2 I;  4DOZ A;  1QZZ A;  4D7N A;  2CQX A;  2DT5 A;  4BY7 J;  3QOE A;  2VBW A;  1N77 A;  1K4T A;  2YX4 A;  3EET A;  1S3J A;  1QPI A;  1ERD A;  1LUJ B;  1QHH D;  4XK4 A;  4ESJ A;  2PN6 A;  1J7K A;  5IT9 Z;  4BJ5 C;  4RGX A;  2WC2 A;  4F52 A;  1SFO J;  4H4K C;  4E7J A;  2JA8 J;  1DP7 P;  1FBU A;  1Z05 A;  3LSJ A;  2QQ9 A;  3WU1 B;  2HYJ A;  3TO6 A;  5ED4 A;  3HOT A;  4A3M J;  1KU9 A;  2LRE A;  1D1A A;  1UB9 A;  4I0A A;  1B59 A;  3RKY A;  4ZDO A;  5ILU A;  5LGU A;  1D0Y A;  1W5S A;  4I98 B;  4B1R A;  5J47 A;  1X1C A;  1K4S A;  1Z77 A;  2XIG A;  4ESB A;  4HG2 A;  3T1B A;  1ZG1 A;  1X1P A;  1T33 A;  4LG0 B;  3FMQ A;  4CCL A;  3HJE A;  2PX9 A;  1FYK A;  1IJW C;  4RLQ A;  2XRO A;  4DYQ A;  4BBR J;  4HF1 A;  2Q8K A;  1HW5 A;  1QO0 D;  2DCE A;  1RI7 A;  2KZG A;  3HYI A;  3BOQ A;  4BDZ A;  1QVU A;  3F8M A;  4JP0 A;  3H35 A;  4HF2 A;  1RPW A;  4E6K G;  2BY1 A;  4KMF A;  2M8E A;  1Z1D A;  4JX5 A;  3U2R A;  2I8D A;  4UUT A;  4A5M A;  1H89 C;  2KIS A;  1FY7 A;  5JVT A;  2Z9O A;  1OLT A;  4RBO A;  1B9N A; 
#chains in the Genus database with same CATH homology
 3DKW A;  3R4K A;  1R1T A;  1IN8 A;  1WRJ A;  4F7Z A;  2VBZ A;  1ZRD A;  4LD5 A;  3K9T A;  2GXB A;  1TNS A;  2DTR A;  5K1Y A;  2RVC A;  4Q5S F;  1TW3 A;  3M8F A;  5ILS A;  3E5U A;  3QPT A;  4UXN A;  5E17 F;  5K5R A;  2NNY A;  4ENK A;  3BDD A;  3G3Z A;  5DCM A;  4HDV A;  1I1S A;  3ZMD A;  3REO A;  5E1W A;  3BPV A;  2MA3 A;  1WI9 A;  1P2F A;  5HS7 A;  2K02 A;  2UXX A;  1R22 A;  2ZME A;  4A2U A;  2RN7 A;  3F21 A;  3H92 A;  4L0Z B;  1RUN A;  3AAF A;  5HDK A;  2MD5 A;  2RDP A;  1KU2 A;  4OIO F;  2FNP A;  4NQW A;  3JAM Z;  1EH6 A;  1Z91 A;  3RJP A;  1LB2 A;  1YG2 A;  2BEO A;  5HLG A;  4L18 B;  2NYX A;  3RYP A;  2EB7 A;  2P6T A;  2VBY A;  5E1Z B;  5H6Q A;  3EQL F;  1F5T A;  3V8K A;  2EFW A;  3BP8 A;  4WX9 A;  3KE2 A;  3BZ6 A;  2V9V A;  1R1U A;  2XAQ A;  4P9F A;  5HS9 A;  2EFQ A;  3QP6 A;  3ZMV A;  3HHG A;  4KT5 C;  1BIB A;  2K27 A;  3L2C A;  1T0F A;  1LEB A;  3E3V A;  1U2W A;  1P4X A;  4BNC A;  1KA8 A;  3F8C A;  2UWM A;  1BC8 C;  2V1D A;  3QPH A;  3HOS A;  1SD4 A;  1ZAO A;  2ZO4 A;  3E6D A;  5ILV A;  3WGG A;  4EJT A;  3IKV A;  5CVI A;  3PQJ A;  1IUY A;  3FWE A;  3CUO A;  2E1C A;  1U5T A;  2HYG D;  3QU3 A;  4R79 A;  2F5E A;  1FWZ A;  2HGC A;  1XSV A;  2P7V B;  3H3U A;  4LB6 B;  4G7Z F;  1BI1 A;  4UUV A;  3WTX C;  2MBF A;  5ERI A;  1DUX C;  3HIF A;  1D8J A;  2A61 A;  2YX7 A;  1SD7 A;  4Q47 A;  3C18 A;  3RIR A;  3WTV C;  4TV7 A;  1BOA A;  1FOK A;  1JHF A;  3RKW A;  1S8N A;  1STZ A;  4K2E A;  1BIA A;  2P7C B;  5J6X A;  4EGZ A;  1K6O A;  2V79 A;  2FXA A;  2XHK A;  3GUD A;  2JTV A;  2P5V A;  4EV0 A;  1D5V A;  4G6D A;  4GCV A;  1LDD A;  3WOD F;  3LAP A;  3T8T A;  1U78 A;  3SFZ A;  2OZ6 A;  3J81 K;  1MJB A;  5IT3 A;  1LQ1 A;  2OQR A;  2ZCW A;  2HTS A;  1GHC A;  2VT2 A;  4HBL A;  2D1V A;  3ZQ7 A;  1YFH A;  3MFK A;  2A07 F;  3LQQ A;  4U0Y A;  2BBY A;  1YO5 C;  3KFW X;  2FOK A;  1R36 A;  1IXS B;  2IA0 A;  3E5X A;  2EWN A;  5FFZ A;  4G7H F;  2OBP A;  3KEO A;  5DD4 A;  5TRD A;  5K5Q A;  2P5L C;  1KQ9 A;  1HKQ A;  4R8H A;  2HOE A;  3R61 A;  2KIU A;  1HXD A;  2EK5 A;  2O03 A;  1TTY A;  3Q9S A;  2H27 A;  4EM1 A;  1I5Z A;  4ENJ A;  1UHW A;  2Q0O A;  2R3S A;  3RKX A;  4E70 A;  3KLO A;  4BH9 A;  2M1B A;  2EV6 A;  2ZXJ A;  4Y15 A;  1W7P D;  1BBY A;  4H0E A;  2O0Y A;  1IW7 F;  4ZH4 F;  3SZP A;  4KNY A;  1HKT A;  5DCM B;  2HEO A;  2NNN A;  4MTD A;  1BN5 A;  5ICC A;  3IWF A;  4N9I A;  1SD6 A;  2RNJ A;  5CYV A;  1AWC A;  5D5W B;  3MCZ A;  1ZRF A;  1KYW A;  3WU0 A;  3J7A O;  4Q48 A;  2GWR A;  1T2K A;  4U0V A;  3H3Z A;  2ZME B;  5L3F A;  2DQR A;  2PG4 A;  4XSZ F;  3BWG A;  2K4J A;  1TQP A;  4EJV A;  3GFI A;  3G73 A;  4N9H A;  2QVO A;  1SD5 A;  1BI3 A;  2JPB A;  1G4D A;  1YW7 A;  4ZZD A;  2A6H F;  1OMI A;  3CO7 C;  1XGS A;  1G3T A;  1P4A A;  2FRH A;  2KIF A;  2PFB A;  2XAF A;  3PFI A;  3GXO A;  2HTJ A;  2HFH A;  1FSH A;  4AIJ A;  2DK5 A;  5IT9 K;  2V6C A;  4IPA A;  2QBY A;  2EA4 A;  4HX7 A;  4EQQ A;  2CSO A;  3GVA A;  1J5Y A;  2E1N A;  4GO1 A;  4A0X A;  2M5W A;  3EUH A;  1Z9C A;  1DPU A;  1XGO A;  2MH9 A;  3IKT A;  3LA7 A;  3OOP A;  3W6K B;  2R7D A;  3TOA A;  3KP4 A;  3K1P A;  4YIF A;  4I09 A;  4CXF A;  4EGY A;  4MEY F;  3V7C A;  3KP3 A;  1XGN A;  2YPR A;  1D8K A;  5E20 A;  4L9V A;  3L00 A;  3VEP A;  1S7O A;  2BV6 A;  2QLZ A;  5DEQ A;  2X0L A;  4LLG F;  4A5N A;  3KET A;  5L3G A;  4BQA A;  3SQN A;  4A6D A;  1FT9 A;  4A6E A;  1LVA A;  4HZF A;  2L4M A;  2F5C A;  3F3X A;  2AS5 F;  1B6A A;  4WWC A;  1WKM A;  3F22 A;  4XBF A;  1S7A A;  3TO7 A;  1FSE A;  2EFO A;  1ZLK A;  5BPI A;  2FA5 A;  3TDU C;  3VFZ A;  3T8R A;  1ZG3 A;  4BHB A;  2FSW A;  3DP7 A;  2LSO A;  2ISZ A;  3P9C A;  4LK1 F;  5L3E A;  1FC3 A;  4M71 A;  3LA3 A;  4EJW A;  2VOD A;  1GVJ A;  2IVM A;  4NB5 A;  3JAM K;  1R5H A;  4N0B A;  1KYZ A;  4FX4 A;  3SZT A;  5FO5 A;  4KYW A;  4PDK A;  1ZG5 A;  2XAG A;  1PUE E;  2OU2 A;  2OD5 A;  2Z33 A;  5E8G A;  5LEJ A;  4FHT A;  2EV5 A;  5DCF A;  4IRI A;  1XDU A;  2VE8 A;  3FXQ A;  1QGP A;  1SFX A;  5F1R A;  4ESF A;  2H09 A;  1UST A;  1U6G A;  5CVR A;  3COA C;  1V4R A;  1KU7 A;  4CDG A;  3V7S A;  3HHH A;  4GYG A;  1FLI A;  3I59 A;  2DI3 A;  1R58 A;  3BJA A;  3CUQ A;  3WTZ A;  1U3E M;  3ML6 A;  2Z99 A;  2NAZ A;  3P9I A;  4MTE A;  2DPU A;  3I4P A;  3NQO A;  4GGG A;  2PLY A;  4O3M A;  2HR3 A;  1D3Y A;  1MDM A;  2KJB A;  1G6N A;  5D6F A;  2G7H A;  4Q4Z F;  1FYM A;  3KZY A;  1HW1 A;  1Z6R A;  4L5I A;  4CO8 A;  4OU0 A;  2IT0 A;  3P7N A;  1KQ0 A;  2BE5 F;  5CVV A;  1WWX A;  4P55 A;  2WTE A;  3RPU A;  2JRT A;  4KDP A;  4KIF A;  2DPD A;  4KA4 A;  1O7F A;  2H6B A;  3RPQ A;  2Y0M A;  1ZRE A;  1HBX G;  1TNT A;  5DDG A;  1B1B A;  4Z2Y A;  1EV7 A;  3MZY A;  3SXY A;  1O3T A;  1UCR A;  5LHI A;  3CTA A;  5ICG A;  4LK0 F;  2A3S A;  2M30 A;  2V1U A;  4CGZ A;  2ESH A;  1SFU A;  3JTH A;  4O5V A;  2P6S A;  3J80 Z;  3ABU A;  1LDK B;  4RB0 A;  5TJJ A;  5LHG A;  3ECO A;  2CWE A;  2XUB A;  1QZY A;  3WGI A;  3HTU A;  1E2X A;  1U5T C;  3QU6 A;  4KMU X;  4AD9 A;  3ERE D;  4HOB A;  5L3C A;  1YW8 A;  1HW2 A;  1JXS A;  1AOY A;  4MNU A;  3WTW C;  3D0S A;  1QPM A;  1I1G A;  3QP5 A;  2QBY B;  2RKH A;  2IRF G;  4L5J A;  2DAO A;  2FMY A;  4MHG A;  3R0J A;  1Y0U A;  2FE3 A;  1LDJ A;  3N4M A;  3KLN A;  4O6J A;  2GZW A;  3CDH A;  1J75 A;  3GZ6 A;  3HSE A;  3LWF A;  5FFX A;  3BPX A;  5HVQ C;  4JK1 X;  1I27 A;  3V8J A;  3GFL A;  4IJA A;  5FLX Z;  1BJA A;  2HKX A;  4AIK A;  2KKO A;  5ICE A;  3NRV A;  4R1H A;  3MQ0 A;  4HX8 A;  2XAJ A;  5KK1 A;  2HQN A;  1OR7 A;  1G3S A;  2J5P A;  5LEK A;  3GX4 X;  2QYO A;  1XMK A;  3ZPL A;  3V7R A;  2XGX A;  2CFX A;  3O2P E;  2LKP A;  4G9Y A;  3I71 A;  3V8L A;  5D5U B;  3FHZ A;  5KVR A;  1ZLJ A;  3E6B A;  1OYY A;  3EDP A;  4WK8 F;  1OYW A;  4RB1 A;  2STW A;  3HSR A;  1YW9 A;  3KZZ A;  2DLL A;  2MLK A;  4ZZL A;  4HV6 A;  4OMY A;  4WXD A;  2ESN A;  1GXQ A;  4ETS A;  3W6J B;  4HX4 A;  4RB3 C;  4EM0 B;  2BGC A;  4DNC A;  5HDG A;  5D4S A;  5ICF A;  3KCC A;  1JGS A;  4RGU A;  3WE3 A;  1Z7U A;  1FBQ A;  3F72 A;  2QWW A;  3CLO A;  1OYI A;  2L02 A;  4LGW A;  3DQV C;  3VOD A;  1W4M A;  2OZU A;  4WCG A;  4L0Y B;  2VE9 A;  3BY6 A;  1YQA A;  4BYY A;  2EFP A;  4KIC A;  5BQT A;  1MZB A;  2EA2 A;  3IL2 A;  2JZY A;  2XAS A;  2CYY A;  3F6O A;  4KN4 X;  4A0Z A;  4AIH A;  1QBJ A;  1T6S A;  1J9I A;  1EH7 A;  3TOB A;  3ECH A;  1YS7 A;  2ZBK A;  4UVB A;  4RAZ A;  1J2X A;  4YG2 F;  4UHT A;  1IRF A;  2PJP A;  1RZ4 A;  2L4A A;  1T38 A;  5FB2 A;  2EFN A;  2NRA C;  3E6C C;  3ZP5 A;  5D4R A;  3L7W A;  1LJ9 A;  3I0T A;  4ZYH A;  5K5O A;  1G3Y A;  2D45 A;  3FXR A;  2GA1 A;  3FM5 A;  4HF0 A;  4EM2 A;  1XSD A;  4M6X A;  2FF4 A;  3T0Y A;  2ETH A;  1XCV A;  3I59 B;  5A2Q K;  5FD6 A;  3CUQ B;  4YII A;  2A5Y B;  2FML A;  5J8F A;  2W25 A;  4RGS A;  1HST A;  2MLG A;  2MC3 A;  2NS0 A;  4OOI A;  3TQN A;  3WTY C;  1MDM B;  1P4W A;  1B9M A;  4EMS A;  3FX3 A;  3MZH A;  2HWV A;  4CIC A;  3I64 A;  2CO5 A;  2P4W A;  4UVC A;  3BJO A;  3F8N A;  3F23 A;  1HQC A;  2YU3 A;  3J81 Z;  2PEX A;  3MEX A;  3F8F A;  2DW4 A;  3FMR A;  1FX7 A;  2Q2E A;  2W84 A;  3K1N A;  1C0W A;  3C3W A;  1XGM A;  3IHU A;  4XSX F;  1TW2 A;  2C6Y A;  1W5T A;  1XB4 A;  3GLX A;  2GQQ A;  3GFM A;  2R7F A;  2M45 A;  2A68 F;  1H9G A;  4UVA A;  1K7A A;  2STT A;  5F6F A;  1TQI A;  3LFK A;  5FD5 A;  4BXU A;  1OKR A;  1ZHF A;  2L54 A;  2F5F A;  3M7G A;  4LFU A;  2TDX A;  2OAZ A;  2RQP A;  3WTU C;  5CVU A;  1O7L A;  1A04 A;  5H20 A;  2GXG A;  1FNN A;  3L9F A;  3LA2 A;  4Y17 A;  4HLY A;  5JFR A;  1I6X A;  4PCQ A;  2ELH A;  1GXP A;  3ZMS A;  1TLH B;  2OA4 A;  2ZKZ A;  1SMT A;  4U0W A;  5BOX A;  3O6B B;  4WF2 A;  3KP2 A;  5CLS A;  4FX0 A;  4B09 A;  1XSX A;  3KP5 A;  4BAY A;  1HKS A;  4L9T A;  1CGP A;  4ZYE A;  1JE8 A;  3KP6 A;  1LNW A;  4GYI A;  3F6V A;  3ZN0 A;  1ODD A;  2PMH A;  1PDN C;  1K78 A;  4P96 A;  4GXO A;  2RV8 A;  4P5O A;  2W85 A;  2A69 F;  3WG9 A;  1IZ1 A;  3VB2 A;  5EEH A;  1QQI A;  3OV8 A;  4EJO A;  4S04 A;  1IN5 A;  3K1M A;  1WSU A;  5E18 F;  2DK8 A;  3GWZ A;  1IN4 A;  1YLF A;  1H0M A;  2RGV A;  3E5Q A;  3QOP A;  1KGS A;  3WTT C;  4YFN F;  3QRF F;  2A6E F;  4OIN F;  3CJN A;  2HS5 A;  2QUF A;  4KIB A;  4L9N A;  3CO6 C;  3K69 A;  4PGH A;  2ADU A;  1YYV A;  2O3F A;  1S6L A;  2K7L A;  4IXA A;  1H9T A;  3HRS A;  4UV8 A;  1MJA A;  3DPT A;  2QQB A;  2DU9 A;  3E97 A;  4RGR A;  3RTR A;  4ZYG A;  4ON0 A;  1SAX A;  4MEX F;  4HA8 A;  1MKM A;  5LLQ A;  3NEU A;  5LGT A;  3IRQ A;  3ISP A;  3SHF A;  3MAJ A;  5AON A;  1O57 A;  3CUQ C;  1ZGA A;  4WXH A;  1ON1 A;  5JI6 A;  2Y48 A;  1T39 A;  4G94 A;  2VXZ A;  2XKO A;  3T5X A;  1TQM A;  1ONV A;  3KEQ A;  4U7D A;  1USS A;  5BS6 A;  3BRO A;  2Z3Y A;  4BHC A;  3J80 K;  1YS6 A;  5JHU A;  3DV8 A;  3B02 A;  1E17 A;  5EEG A;  3ABT A;  4YFK F;  2AXL A;  4A0Y A;  3IC7 A;  3N97 A;  1FPQ A;  2IA2 A;  2G9W A;  4G8X A;  1U8R A;  4EVI A;  1F1Z A;  4I2O A;  3GFJ A;  5E8I A;  1XCB A;  4CZZ A;  1CF7 A;  4OMZ A;  2BYV E;  4IVN A;  5H6R A;  2IA1 A;  2P8T A;  4MGR A;  1K79 A;  2FNA A;  1DDN A;  2EV0 A;  3D5L A;  4LMY A;  3VOE A;  2J5O A;  3RDI A;  3TO9 A;  2CG4 A;  3EYY A;  3RI4 A;  4JQF A;  2VC1 A;  4U7B A;  4CHU A;  3I5U A;  2M87 A;  3O3K A;  2L01 A;  1UHM A;  5FLX K;  4HQM A;  1SFE A;  3TGN A;  4IHT A;  2HQR A;  1O3S A;  2YSR A;  2H6C A;  2UXN A;  4G6Q A;  4OIP F;  1ZAR A;  1F4K A;  4JBA A;  1BC7 C;  4I02 A;  2DO7 A;  2E7W A;  3I54 A;  4LJZ F;  2FBI A;  3FF5 A;  1REP C;  2VON A;  3GW2 A;  4ZYD A;  2Y75 A;  2G7U A;  2JT1 A;  2ZFW A;  3R0A A;  4MQ9 F;  3GF2 A;  3GYH X;  3L09 A;  2PQ8 A;  3LST A;  1QNT A;  2K86 A;  2GIV A;  4ASN A;  4S05 A;  5J8C A;  2Z5U A;  1IXC A;  3GZ5 A;  5HLH A;  5D5V B;  1ZH5 A;  3BJ6 A;  4M73 A;  5D8L B;  2LNB A;  2QEN A;  2FEZ A;  1W7P A;  3M8E A;  5LGN A;  2QQA A;  4KN7 X;  1KQ8 A;  4NHJ A;  5E1X A;  2HYF A;  1R7J A;  2VOP A;  4ENN A;  2D2W A;  3JSO A;  4LB5 A;  1FP2 A;  2DQL A;  2D1H A;  4IRG A;  2DFI A;  2ZJ2 A;  3ELK A;  5D5X B;  3E6M A;  1O3Q A;  3S2W A;  5D6E A;  5BMZ A;  2XVC A;  1P92 A;  3K0L A;  5LRS A;  1XDS A;  5CVJ A;  5JR3 A;  2YR2 A;  1IXR C;  4P9U A;  3PQK A;  5LHH A;  2W24 A;  1IF1 A;  2XV4 S;  3U9G A;  2B0L A;  1G3W A;  3V4G A;  4U88 A;  5BPD A;  3HTS B;  3U1D A;  3HRU A;  2KJC A;  2IPQ X;  4KIG A;  5F64 A;  2KIM A;  1ULY A;  2VOO A;  2PBI A;  3KP7 A;  1RUO A;  2K4B A;  1Z6T A;  1J59 A;  5AIP A;  3DXJ F;  5DUK A;  1K78 B;  5HOO A;  3WGH A;  2ISY A;  1YTY A;  1OPC A;  2HZT A;  4HDU A;  3I58 A;  1R00 A;  4LLL A;  1SMY F;  1ZRC A;  2PMU A;  3HRM A;  2VT3 A;  1L0O C;  3QAH A;  1R23 A;  1S29 A;  2CQK A;  5DV5 A;  4M9X A;  3Q9V A;  3GEZ A;  1WQ2 A;  2WV0 A;  4AVP A;  1YIO A;  4KFC A;  3P9K A;  4RB2 C;  1RNL A;  3HSF A;  2LDU A;  4LG0 A;  1IAW A;  1MJ9 A;  4OIQ F;  5CJ9 A;  5DYM A;  1F9N A;  2FU4 A;  2O8X A;  1MGT A;  3EYI A;  3R6S A;  3JTG A;  2O6G E;  5D8K B;  4HAM A;  1ZN2 A;  1X3U A;  3M9A A;  2MH2 A;  4FT8 A;  3FZV A;  4WXC A;  5L3B A;  1ZGJ A;  3JW4 A;  4OIR F;  1MD0 A;  1R1V A;  1P6R A;  1PP7 U;  2VC0 A;  1O3R A;  2F5D A;  5AIQ A;  2F2E A;  1RIO H;  1EH8 A;  2FBH A;  3JSP A;  4G7O F;  4HLX A;  4PGG A;  4IF4 A;  1BM9 A;  3Q5F A;  2QM3 A;  4M6Y A;  1IRG A;  4CYD A;  3FMS A;  2VBX A;  1IN7 A;  3R60 A;  1T98 A;  3ZMU A;  1XD7 A;  3IWZ A;  1KU3 A;  4ENM A;  4IHS A;  5HDN A;  2LF7 A;  1CF7 B;  1ZYR F;  2ZNZ A;  1L3L A;  1JHH A;  2JPC A;  1FZP B;  1DPR A;  3TDZ C;  4M9Z A;  2QZ8 A;  2IW5 A;  5HLI A;  4DQ2 A;  2W57 A;  3DPL C;  4I01 A;  3HUG A;  2E7X A;  1HSJ A;  3DEU A;  3FXU A;  4PZJ A;  2HDC A;  4UV9 A;  4LLN A;  4M72 A;  1FP1 D;  3WE2 A;  2L3D A;  4M9S A;  2XAH A;  3F8B A;  3K2Z A;  1IN6 A;  5LBQ A;  3M1E A;  3B73 A;  3HRT A;  3DF8 A;  5DUI A;  1BI0 A;  5HS8 A;  4QLC U;  1FBS A;  5LRR A;  2O61 A;  4M74 A;  2EJR A;  4A12 A;  1VTN C;  2ACJ A;  4YFX F;  1B4A A;  2ZNY A;  1FYL A;  2LF8 A;  4L9J A;  2PI0 A;  3FM3 A;  2XRN A;  2HKO A;  2GAU A;  5DD8 A;  3C1D A;  1PP8 F;  2CW0 F;  2DBB A;  3LAJ A;  4I0B A;  3WTS C;  2GA2 A;  3DFG A;  2H94 A;  1XMA A;  2KRF A;  5L3D A;  4HV5 A;  3IRR A;  1V3F A;  1W7P B;  2P5K A;  2X4H A;  4I7H A;  4AWX B;  4BHP A;  1BI2 A;  4D0P A;  3I53 A;  3GO5 A;  6PAX A;  5A2Q Z;  4RAY A;  2V1X A;  1R5G A;  2RC4 A;  3RYR A;  1TBX A;  3ZN1 A;  4EJU A;  2CGP A;  4B8X A;  1NHA A;  2FBK A;  4XLP F;  1XN7 A;  3TKY A;  1ON2 A;  1UFM A;  2IP2 A;  4MQV A;  4HQE A;  2FQ3 A;  3ZMZ A;  2UZK A;  4Y13 A;  3ULQ B;  1LEA A;  3C7J A;  4HYE A;  4IRH A;  1J0R A;  2VN2 A;  4HW0 A;  1U5T B;  4UNO A;  4QWQ A;  2OQG A;  5FGM A;  3ROU A;  4XLN F;  4XRF A;  1Q1H A;  3ZMT A;  3MWM A;  2XKP A;  2IJL A;  2WWY A;  4RS8 A;  3LQR A;  4KUM A;  2JSC A;  2COM A;  1QZZ A;  2DT5 A;  2VBW A;  2YX4 A;  3EET A;  1S3J A;  4ESJ A;  2PN6 A;  1J7K A;  5IT9 Z;  4RGX A;  2WC2 A;  1DP7 P;  1FBU A;  1Z05 A;  2QQ9 A;  3WU1 B;  3TO6 A;  5ED4 A;  3HOT A;  1KU9 A;  1UB9 A;  4I0A A;  1B59 A;  3RKY A;  5ILU A;  5LGU A;  1W5S A;  4I98 B;  2XIG A;  4ESB A;  3T1B A;  1ZG1 A;  4LG0 B;  3FMQ A;  1FYK A;  2XRO A;  4HF1 A;  2Q8K A;  1HW5 A;  1QO0 D;  1RI7 A;  3HYI A;  3BOQ A;  3F8M A;  4HF2 A;  4KMF A;  2M8E A;  1Z1D A;  3U2R A;  4A5M A;  1FY7 A;  5JVT A;  2Z9O A;  1B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...