1DP7P

Cocrystal structure of rfx-dbd in complex with its cognate x-box binding site
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*(BRU)P*TP*AP*CP*CP*AP*(BRU)P*GP*GP*TP*AP*AP
publication title Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dp7P00
3MQ0A 3FM5A 2CFXA 5L3GA 2HEOA 2IPQX 1O3RA 4LLLA 2XKPA 4HLXA 2NYXA 1FLIA 5E8IA 3ELKA 1IN4A 1TW3A 4UV9A 2NAZA 1D8KA 2EV0A 2FSWA 4ESBA 5HS7A 5E20A 3CO7C 1FSHA 2EFNA 5D6FA 1HKSA 1PP7U 1LEBA 4MNUA 2F5EA 3SZPA 4UUVA 2EJRA 1WKMA 3CJNA 3K1MA 2PFBA 1USSA 2P7CB 4WCGA 4HF2A 1CGPA 4EQQA 4RGRA 3HHHA 4YIFA 3D0SA 2NS0A 1JHFA 1YYVA 2XASA 3SFZA 2FU4A 3ULQB 2P6TA 4EM2A 3ZN0A 2LF7A 3TOBA 3FZVA 3TDZC 3TO7A 2XV4S 4M73A 4HF0A 4HW0A 3EETA 1B6AA 5D6EA 1C0WA 4FX0A 3KP4A 3BOQA 2ZCWA 5J8CA 2LDUA 2XKOA 4HF1A 2W24A 3MEXA 5D8KB 2HFHA 2PQ8A 2BE5F 3KP3A 2HS5A 2WV0A 3JAMZ 3HSRA 4JQFA 1R22A 4L0ZB 2RDPA 4HX8A 3LAJA 3RTRA 1YFHA 3F21A 1ZH5A 2O03A 1V3FA 3RYPA 4ZYDA 2FRHA 2QWWA 3C7JA 1F5TA 4HOBA 2VBZA 4MTDA 3E5QA 3K2ZA 1R00A 4Q48A 5E1WA 1IRGA 1B9NA 3GF2A 2FXAA 4L9VA 3ZMDA 4L5IA 1T38A 3R60A 4UXNA 3O6BB 1U2WA 2XRNA 1R1TA 1SMYF 1G3TA 2PN6A 2NNYA 2Y75A 2OAZA 5J8FA 1J0RA 3RKWA 3JSOA 4LLNA 5D5VB 2QLZA 2D1VA 2DFIA 1YG2A 2GQQA 3GFJA 1YW7A 3HTUA 5JI6A 4M72A 1HW1A 3R0JA 3K1PA 2ZNZA 2QBYA 2DAOA 2HKXA 2V1UA 4LG0B 1DPRA 2AXLA 4RS8A 5D4RA 1KYZA 3GFLA 3BPVA 2ZBKA 2FBIA 3MZYA 2LNBA 2V9VA 1KU2A 3L00A 1ZRFA 4ZYHA 2W25A 1DDNA 2Z3YA 3ABUA 3HSEA 1XGSA 1O3TA 1D5VA 1ZN2A 2VT2A 1S8NA 3R0AA 5DUKA 4G94A 3P9IA 3HRTA 2KIUA 3I0TA 2VOPA 2W85A 3I58A 4I0BA 4AD9A 1H9GA 1TBXA 2HTSA 4ENMA 2GXGA 5FD5A 2K86A 2Q8KA 2P8TA 4F7ZA 2ZMEB 1R36A 5CVUA 4KN4X 3FMSA 2F5FA 2GA2A 1SD7A 3SZTA 4FT8A 4KMUX 3CUQC 4ZYEA 4RAZA 4CGZA 2FF4A 1T98A 2ZO4A 3O2PE 1OYWA 3SXYA 3ECHA 1IXSB 3JW4A 3RYRA 2STWA 1VTNC 2F2EA 1ZLKA 1P4WA 2LSOA 3IKVA 2PG4A 4DNCA 2UZKA 2XAJA 3U9GA 5HDNA 4P5OA 3BPXA 4OIPF 3BROA 3LWFA 4D0PA 5D5WB 1DUXC 3K0LA 2WWYA 1YW8A 4P96A 3CTAA 5L3BA 3GUDA 5IT3A 1ZRCA 1FY7A 3KEQA 1KQ8A 4CYDA 2H6BA 3U1DA 3C3WA 1QZYA 4NHJA 1A04A 1FYLA 4G9YA 2A3SA 4WXCA 3W6KB 1PDNC 2X0LA 4H0EA 3H3UA 1T2KA 2DW4A 3IL2A 5BQTA 5BPDA 1LDKB 5FB2A 2QM3A 2ZXJA 1HXDA 1IN7A 5D4SA 1HW5A 3LA7A 1WI9A 1XMAA 3WODF 3IKTA 4HQMA 4G8XA 3KP5A 4AWXB 5HDGA 4YIIA 3C18A 5LBQA 1R1VA 1U5TA 4AIHA 1TTYA 1Y0UA 2VC0A 2Q2EA 1FBQA 2JRTA 5A2QK 4L9JA 2DU9A 4Y17A 2CO5A 1IRFA 4K2EA 5JHUA 3V8LA 1MD0A 3GYHX 4HAMA 2VE9A 5FD6A 1JE8A 1I27A 2HDCA 2OBPA 6PAXA 5KVRA 2HTJA 4KDPA 1Q1HA 3TO9A 1LJ9A 2PJPA 4ESJA 1XDSA 1ON2A 3KFWX 1G6NA 3SQNA 3GFMA 1RI7A 2RKHA 1KYWA 2O6GE 5AIPA 5BMZA 2ISZA 2E7XA 1STZA 2QVOA 3WTUC 1GXPA 3MZHA 2ETHA 1YTYA 2F5DA 2CGPA 1IN6A 3ZMVA 1P2FA 5HS8A 4OMYA 2W84A 2DLLA 5IT9K 4WX9A 4KN7X 1FOKA 2IA0A 4KT5C 5HLIA 1HW2A 3QAHA 1Z91A 5DCFA 3MFKA 3N4MA 4WWCA 1SFUA 1Z9CA 4UV8A 1QNTA 4L9TA 1P4XA 3VFZA 3I59A 4RGUA 1OYYA 3L09A 3L9FA 2O0YA 2AS5F 1OR7A 3F8NA 2OA4A 1YO5C 1OKRA 3LQRA 5D8LB 3E5XA 4M9XA 5DDGA 3H3ZA 1ZLJA 3MCZA 3K1NA 1RIOH 1FPQA 1G3SA 3R4KA 2EFOA 4WK8F 4HV5A 2CG4A 3ZPLA 4M9ZA 3LQQA 1ODDA 2OZUA 1FP2A 3M8EA 4AVPA 1TW2A 2D45A 3IRRA 2E7WA 2A07F 1O3SA 1U8RA 5DD4A 4LB5A 2RN7A 1RZ4A 3L7WA 2PMHA 3LA3A 1KU3A 1T39A 2PBIA 2RGVA 1TLHB 4IRIA 5ILUA 3RKXA 3DFGA 3J80K 4P9UA 4CZZA 4KYWA 5ED4A 4DQ2A 1G3WA 1QZZA 1O57A 1TNTA 2V6CA 2ELHA 2ZNYA 2QBYB 2HGCA 2YX4A 1L3LA 3I4PA 2DI3A 4ZYGA 5L3FA 4IHTA 2DPDA 1O7LA 4MEYF 1F1ZA 3VODA 5E1XA 3ZMUA 1BIBA 2VODA 2MLGA 4NQWA 2IA1A 2XAQA 3VB2A 3HRSA 5HOOA 2L4AA 1S3JA 5HLHA 3HHGA 3HSFA 1XSDA 3GFIA 2EB7A 2A6EF 2WC2A 2BEOA 2JTVA 4B8XA 3WTZA 4GXOA 2G7HA 3G73A 3TGNA 2JPCA 4PGGA 1GVJA 1HBXG 1W5TA 3EYIA 2BV6A 5K5OA 4LK0F 4HYEA 5BS6A 1I5ZA 1GHCA 1KGSA 3IC7A 4O3MA 4EGYA 1R58A 3WTWC 3VEPA 3F8FA 4WXHA 3WG9A 1YLFA 4R79A 2GIVA 2KIFA 5K5RA 3F3XA 1LDDA 3WU0A 4IVNA 2P7VB 1T6SA 2PI0A 2XROA 1RUOA 3DEUA 4R8HA 3DPLC 4KNYA 4A0XA 1ZGJA 2FQ3A 1FT9A 2M87A 4R1HA 2EA4A 3BWGA 4G7ZF 3IWZA 5JVTA 4M6YA 3WGHA 2D2WA 3DF8A 3GW2A 4O6JA 3N97A 1MJ9A 2JPBA 4P9FA 1IF1A 2Z5UA 5FFXA 1SD6A 2E1NA 3ZQ7A 3BJAA 3DPTA 2MH2A 3HOTA 1JGSA 2RQPA 5ERIA 3WGIA 1EV7A 5F1RA 4HV6A 3BDDA 3E97A 1GXQA 4BXUA 1MGTA 2XAHA 2KKOA 1BC8C 4EJWA 2XAGA 3GEZA 1QGPA 4RB2C 5E1ZB 3FM3A 3M7GA 4I7HA 2BGCA 1MDMB 4GYGA 1TNSA 2MLKA 2FBKA 2M30A 1SFXA 1F4KA 4MTEA 3GWZA 1U5TC 1OYIA 4U88A 3CO6C 1YQAA 3GXOA 4U0YA 1K7AA 1RNLA 2EA2A 5A2QZ 3LFKA 3I5UA 5HLGA 2R3SA 2ZJ2A 4G7OF 3B02A 3J81K 1HKTA 5LEKA 4L9NA 4M6XA 3FHZA 1QO0D 1XMKA 3CUQB 4E70A 1BBYA 1YW9A 3F8CA 5LRSA 4O5VA 2VC1A 3HRMA 3D5LA 3DKWA 5LHHA 4MQ9F 4S05A 3ZMSA 1B4AA 2HOEA 3RIRA 3V7CA 1BIAA 1REPC 1XSXA 2DPUA 3KCCA 3QP6A 4M9SA 1Z6TA 1DPUA 4EMSA 5F64A 3TKYA 2DTRA 1FYMA 2RVCA 4L0YB 3QU3A 1LNWA 3FXRA 5IT9Z 1PP8F 1SAXA 2L4MA 3LA2A 3TOAA 2HWVA 3IWFA 4IF4A 5CVVA 4YFXF 1CF7B 1ON1A 3QRFF 2WTEA 3V7SA 1LEAA 4ENKA 2UWMA 4CDGA 3REOA 4YFNF 2L01A 4IRHA 2UXNA 3M8FA 3L2CA 1B9MA 1W7PD 3ROUA 1G4DA 3MAJA 1XB4A 1XD7A 4FX4A 2JSCA 3I59B 1QPMA 1W4MA 4I0AA 5CVJA 3V8KA 4LG0A 2OQGA 2IVMA 2G7UA 2X4HA 2ZKZA 4RGXA 1UB9A 2J5OA 2M8EA 1QQIA 1J7KA 4B09A 2YX7A 4EJOA 1MJAA 3E6DA 3ZMTA 3RKYA 2K4BA 4OU0A 2H6CA 3WTSC 4UVBA 3BY6A 2DO7A 1V4RA 2NNNA 2H94A 2MH9A 1Z05A 5L3DA 2Z33A 2K7LA 1BC7C 1R23A 5DCMA 4AIKA 3EQLF 1FNNA 1B59A 1ZGAA 1TQMA 3BP8A 1Z7UA 3G3ZA 3OV8A 3WTYC 4PCQA 5ILSA 1TQPA 4U0VA 2CSOA 3T0YA 4IXAA 4GYIA 4MGRA 4LB6B 3JTGA 2HR3A 4L18B 2YSRA 5CVIA 1IN8A 2A5YB 3KETA 2OZ6A 3EUHA 4GGGA 3J80Z 4KMFA 2P5KA 4BQAA 4Y13A 4A6DA 1AWCA 1YIOA 2Z9OA 2XIGA 2CWEA 5AONA 1W7PA 2TDXA 5LRRA 2VONA 1KQ0A 4KIBA 3E5UA 2KIMA 3B73A 4ON0A 3QOPA 4OIRF 2IW5A 3K9TA 2IJLA 3DXJF 5TJJA 1I1SA 1E17A 2J5PA 1FX7A 4WXDA 1WRJA 3IRQA 2XGXA 3Q9VA 3ABTA 1ZG5A 4EGZA 3DQVC 5FLXK 2P5LC 4LLGF 4TV7A 3S2WA 1SMTA 3NQOA 1MJBA 2V1XA 1P92A 2D1HA 3F6OA 3HYIA 2ISYA 5CYVA 3F8BA 3NRVA 4U7BA 1XGNA 3EDPA 4WF2A 3WU1B 1YS7A 5E17F 2DT5A 5LHGA 5HS9A 4OINF 3C1DA 3IHUA 3I64A 1IXCA 2K27A 4OMZA 3WTXC 2QZ8A 4RB1A 3RPUA 1IW7F 3HRUA 1R5HA 4ENNA 5DEQA 1EH7A 2VOOA 3KEOA 3M1EA 2ACJA 4LD5A 1ZAOA 2RV8A 4KA4A 4GCVA 1LDJA 4BHBA 4N9IA 2HZTA 2MD5A 4I09A 1KU7A 3Q5FA 3R61A 3P7NA 4XBFA 3F23A 3LSTA 3TQNA 1D8JA 2RC4A 3KZYA 3ERED 4A6EA 2Y0MA 2OU2A 3P9KA 4XSXF 4ZZLA 2H27A 3KP7A 4OIQF 5BOXA 4U0WA 4M74A 4PZJA 3HIFA 2DK5A 3F72A 1XGMA 2DK8A 1KQ9A 3P9CA 2FNPA 2YU3A 3LAPA 2VBWA 2C6YA 1BI0A 2EWNA 3I53A 2O8XA 5DUIA 1I1GA 1J59A 4BYYA 2LKPA 3BJ6A 4EV0A 2QQAA 2Y48A 3O3KA 4HX4A 3KP6A 2QQ9A 1DP7P 2STTA 4G6QA 3KLNA 4CXFA 4HA8A 1AOYA 1UFMA 1O7FA 4BAYA 1IUYA 2A68F 5LGNA 1SD5A 2H09A 5LGTA 2P4WA 5EEGA 3PFIA 1FWZA 2O3FA 1B1BA 1EH6A 5ICEA 1XGOA 5H6QA 5JFRA 4PGHA 4HZFA 3KZZA 4EJTA 1K78A 3SHFA 4EM0B 5LGUA 2EV6A 3ISPA 2VBYA 3QP5A 1J9IA 5F6FA 5K5QA 3K69A 2FA5A 2G9WA 1HSJA 3E6MA 2QQBA 3RDIA 1XCVA 3J81Z 1KU9A 2IA2A 5BPIA 2NRAC 2VN2A 1K6OA 1S29A 2Z99A 4EVIA 3T5XA 1P6RA 4I2OA 5J6XA 1U3EM 1XN7A 2EFWA 1UHWA 2DBBA 4HDUA 4UVCA 2QENA 1EH8A 1YS6A 3H92A 1ONVA 5FO5A 4IJAA 4N9HA 2VE8A 4Z2YA 3DP7A 2HQRA 1FSEA 2VT3A 4A5MA 1UCRA 2HKOA 2YPRA 2FOKA 4MHGA 2F5CA 2CW0F 4QWQA 2E1CA 1IXRC 1P4AA 2PLYA 2XHKA 1G3YA 1NHAA 3U2RA 1OPCA 2K4JA 3E3VA 2EV5A 2OQRA 5KK1A 2M1BA 5H6RA 3HOSA 1FZPB 5CJ9A 1R7JA 1QBJA 5LEJA 2KJBA 1U6GA 1Z1DA 1U78A 1I6XA 1LQ1A 2MBFA 1BI1A 4BNCA 4A12A 3QU6A 1KA8A 4KIFA 5E18F 3TO6A 3JSPA 2ESNA 4OIOF 1FBUA 2L02A 3BJOA 3WTTC 2HYGD 4S04A 1SD4A 3Q9SA 4PDKA 3NEUA 3I71A 3FXQA 2KRFA 2EFPA 1R5GA 1BI3A 5HDKA 3ZN1A 1J75A 5DV5A 4YFKF 4G7HF 5D5XB 4HLYA 2EFQA 4ENJA 4Q47A 2CYYA 4KICA 3GVAA 4KUMA 3F22A 1ZRDA 1SFEA 1U5TB 3V8JA 3ECOA 3RPQA 3E6CC 3T8RA 5DCMB 3GX4X 2V1DA 4L5JA 3W6JB 3GZ5A 4LJZF 4BHPA 1ZHFA 3J7AO 4HX7A 1XSVA 1S7OA 1OMIA 4JK1X 1X3UA 5FGMA 3CDHA 4N0BA 3HTSB 4HBLA 4I98B 2MC3A 4RAYA 2FEZA 1FBSA 3RI4A 3BZ6A 1J2XA 4LK1F 1JHHA 2PEXA 3ML6A 1W7PB 3KE2A 1ULYA 3JAMK 5E8GA 4BH9A 2FMYA 5CLSA 1E2XA 4UNOA 1PUEE 1J5YA 3T1BA 4MQVA 5FLXZ 3FXUA 4U7DA 2CQKA 3V4GA 4CO8A 4YG2F 1BOAA 4KFCA 3ZMZA 2O61A 3WTVC 4LFUA 3RJPA 3KLOA 5TRDA 2XVCA 3KP2A 2XAFA 5H20A 4ETSA 1LB2A 5DD8A 2HQNA 1ZG3A 3PQKA 3R6SA 4IRGA 3V7RA 3QPHA 4LMYA 5CVRA 2ADUA 4ZZDA 4HDVA 2P6SA 1TQIA 4A2UA 3E6BA 5K1YA 2GWRA 1HQCA 3FF5A 1UHMA 2XUBA 1IAWA 4ASNA 1R1UA 2HYFA 2M5WA 3HUGA 5ILVA 2JZYA 2P5VA 1XDUA 4A0ZA 2FBHA 3CUOA 1XCBA 4KIGA 1FC3A 1H9TA 4UVAA 2YR2A 2R7DA 3GZ6A 1MDMA 3JTHA 5FFZA 5AIQA 2K02A 2Q0OA 3FMQA 2KJCA 2DQLA 5D5UB 3CLOA 4RGSA 1BI2A 3PQJA 3COAC 3EYYA 1O3QA 2GXBA 5EEHA 1S7AA 4UHTA 1BN5A 4XLNF 4A5NA 4ZH4F 4XRFA 4GO1A 2IT0A 2ZMEA 4QLCU 4XLPF 1IZ1A 2BBYA 5ICFA 4LGWA 2IP2A 3WE2A 4EJVA 2FMLA 3MWMA 3F6VA 1K79A 3CUQA 2IRFG 2ZFWA 4I01A 1ZREA 1HSTA 1ZYRF 2RNJA 1T0FA 3WGGA 5L3EA 2VXZA 2W57A 2M45A 3DV8A 2FE3A 1WSUA 2GA1A 4JBAA 5HVQC 2COMA 2OD5A 1HKQA 2GAUA 2EK5A 4OOIA 1RUNA 1ZARA 1MKMA 3FWEA 2L54A 1USTA 1ZG1A 3T8TA 5LLQA 3GLXA 4XSZF 2GZWA 3WE3A 5ICCA 3AAFA 4I02A 1D3YA 1Z6RA 2R7FA 1WWXA 3GO5A 1CF7A 4Q4ZF 1H0MA 2VBXA 1IN5A 3I54A 4CICA 4HQEA 3TDUC 1BJAA 3VOEA 5LHIA 2JT1A 4G6DA 4IPAA 5JR3A 1FP1D 1L0OC 2A69F 1K78B 3QPTA 2L3DA 2PMUA 1LVAA 4NB5A 2A6HF 4IHSA 4M71A 4Q5SF 3FX3A 2QYOA 3F8MA 2QUFA 1JXSA 2ESHA 2V79A 4RB0A 5ICGA 1WQ2A 1BM9A 2DQRA 4BHCA 4MEXF 2MA3A 1FYKA 4P55A 1S6LA 4ESFA 4EM1A 3FMRA 2A61A 3M9AA 5L3CA 2B0LA 3ZP5A 4CHUA 2BYVE 2UXXA 4RB3C 4A0YA 4Y15A 1F9NA 1MZBA 4FHTA 2FNAA 2LF8A 4EJUA 5DYMA 4AIJA 3OOPA 1W5SA
chains in the Genus database with same CATH superfamily
3MQ0A 3FM5A 2CFXA 5L3GA 2HEOA 4XKCA 2IPQX 1UELB 1O3RA 4LLLA 4JOMA 2XKPA 4HLXA 2NYXA 1FLIA 2E5NA 5E8IA 1RR7A 4HRIA 4F91B 1VQ6I 3ELKA 4AUXA 1IO2A 2DMTA 3DTEA 5F0CA 1IN4A 2BVLA 3HL2A 4BACA 4A3LJ 1TW3A 2XF5A 4UV9A 2NAZA 1D8KA 1JTYA 2X6YA 1I50J 2EV0A 2FSWA 4ESBA 4XLEA 5K7HA 4E7SA 5HS7A 4BY1J 5E20A 3CO7C 4XR6A 2BY1A 2R5YA 4RAFA 4C30A 1FSHA 1X58A 4BDZA 2E1MB 2EFNA 5D6FA 1HKSA 1PP7U 1LEBA 4MNUA 1MSFC 2F5EA 3SZPA 1LVKA 4UUVA 1DGWY 2EJRA 1X1DA 2I10A 1WKMA 2F5VA 3CJNA 3RCOA 1MMNA 3K1MA 1ZKGA 2PFBA 5KCMA 4RBOA 3JRIA 1USSA 2PMZN 2P7CB 1S7EA 2PMZA 5J1UA 1YITI 1SC7A 1W0UA 1ZK8A 2DJIA 4M3BA 4WCGA 3W2AA 4HF2A 1UZCA 1OCTC 2NVXJ 1CGPA 4EQQA 2R7UA 3OWTA 1RESA 4RGRA 4D5CA 3HHHA 4YIFA 3D0SA 1JKRC 2NS0A 1HCRA 1JHFA 3LFUA 1YYVA 2XASA 1JUPA 3SFZA 5C44J 1AKHA 2QCOA 3JCUC 1VI0A 2FU4A 1WH5A 5JVGF 3ULQB 2DT7B 2P6TA 4EM2A 3ZN0A 1VQ5I 2LF7A 3TOBA 3FZVA 4DZPA 2LD5A 3TDZC 4GDFA 1IDYA 3HXLA 3TO7A 2M2EA 2XV4S 1TZLA 3QWLA 3BTCA 4M73A 3AL0B 3DKXA 4U87A 4HF0A 4CYCA 4HW0A 4KISA 3EETA 1B6AA 5D6EA 1QHGA 1C0WA 3LSRA 3OYFA 4FX0A 2PX9A 3KP4A 2JA7J 2EINH 5M5WJ 2NVYJ 3BOQA 1YIJI 2HOTA 2ZCWA 1OISA 3W2VA 5J8CA 2LDUA 4PJMA 4Y4RA 3ZRGA 2XKOA 3ASOH 4HF1A 2W24A 2K5CA 5CQEA 3MEXA 5D8KB 2HFHA 2PQ8A 2BE5F 3KP3A 4BDYA 2HS5A 2NVUB 4AU7A 2WV0A 4BXFA 3JAMZ 3HSRA 3HB9A 1SVOA 4AYBN 4JQFA 4AYBA 5DM7F 3GBGA 1R22A 3AG3H 4L0ZB 2LK2A 2RDPA 4HX8A 3LAJA 3M4OJ 3RTRA 1YFHA 3F21A 1ZH5A 2O03A 1V3FA 3KZIC 2RAEA 3ZR8X 3ZQIA 2BW3A 3RYPA 2CQQA 3S3MA 3DKYA 2Y30A 2JWTA 4ZYDA 2FRHA 2QWWA 3C7JA 2GIZA 2LLKA 1F5TA 2JA6J 3DLAA 2K40A 4BGDA 5H2FC 4HOBA 3BR6A 2VBZA 1DQUA 4MTDA 3QQAA 3E5QA 1R71A 3K2ZA 1R00A 3CMAI 1NG6A 4Q48A 5E1WA 2IS2A 1IG7A 1IRGA 1B9NA 3BCBA 3GF2A 2WAQN 4C3JJ 2FXAA 2RNGA 2WAQA 1JTXA 4L9VA 3ZMDA 4L5IA 5GADJ 1T38A 2FJ1A 3BR5A 2DTZA 2V6EA 3R60A 1NK2P 3OS1A 2DA1A 4UXNA 3O6BB 3HKZN 3S1MJ 1U2WA 2XRNA 1R1TA 3HKZA 1SMYF 1G3TA 2PN6A 3K6GA 2NNYA 2Y75A 2OAZA 1P7IA 5FRNA 3G1MA 3C2HA 5J8FA 1J0RA 3RKWA 3JSOA 4LLNA 5D5VB 2QLZA 2DA7A 2D1VA 2DFIA 1OCOH 4M3DA 1YG2A 2GQQA 3F0CA 3OIQA 2YUSA 3GFJA 4RAGA 1YW7A 3A2KA 3HTUA 3BR2A 5JI6A 4M72A 4A3FJ 1O4XA 2IS4A 2WADA 1Z3XA 1HW1A 4IO9F 2CUEA 3R0JA 3K1PA 4XRSA 2GLOA 2ZNZA 2QBYA 2DAOA 2HKXA 2V1UA 4LG0B 1DPRA 2R5ZB 3JRDA 2AXLA 4DYRA 2M7AA 3A0BC 3DCFA 2V7FA 4RS8A 2E34A 5LFAA 5D4RA 1KYZA 3GFLA 3BPVA 1OJLA 1Y0NA 2ZBKA 2FBIA 2VI6A 3MZYA 3CCRI 2LNBA 1BL0A 2V9VA 1HDDC 1V5EA 3PO2J 4XIDA 4XOTA 2VPLA 3AFHA 1KU2A 3L00A 5EG0B 1X3ZB 3DBRB 1ZRFA 4ZYHA 3A01A 1WJCA 1X19A 3CF5F 2W25A 2HPMA 1DDNA 2Z3YA 2CW8A 3M3YJ 3ABUA 3HSEA 2G0EA 4V19K 3MVPA 1XGSA 2IXSA 1VQMI 1O3TA 1D5VA 1ZN2A 3MKWB 2VT2A 1S8NA 3R0AA 5DUKA 4G94A 1RR8C 2EZLA 4MFEA 3P9IA 3ZQFA 3CD6I 3HRTA 4G12A 3ERMA 2KIUA 2UUZA 3I0TA 1MMSA 1MBFA 3DEEA 2VOPA 2W85A 3I58A 4I0BA 1WJ5A 4AD9A 1ETYA 1H9GA 1LPQA 3DEWA 1GLNA 1TBXA 1IRZA 2HTSA 4ENMA 2GXGA 3GCMA 5FD5A 4PK4A 2K86A 3KYDB 3OYBA 5HLTA 2Q8KA 1D5YA 2P8TA 4F7ZA 2ZMEB 1R36A 5CVUA 3CCJI 4KN4X 3PNTA 1MMGA 2JA5J 4QSHA 2KHMA 1SAUA 3FMSA 3S15J 2QA4I 1YRNA 4E7JA 2F5FA 2GA2A 1SD7A 2E36A 2WB1N 3SZTA 3HOYJ 2WB1A 1X1BA 4JX4A 4FT8A 4KMUX 3CUQC 3MN2A 4ZYEA 4RAZA 4CGZA 4V2GA 2FF4A 1T98A 2ZO4A 3O2PE 1OYWA 2V26A 1T0FC 3SXYA 3ECHA 1IXSB 3JW4A 4UUSA 4IHXA 1N25A 3RYRA 2STWA 3ZGKA 2XPVA 4OAZA 1UJ8A 1QPIA 1VTNC 2F2EA 2IBDA 1P4WA 1ZLKA 2LSOA 3IKVA 1FIPA 3H36A 2PG4A 3L2QA 3I4MJ 1K61A 4DNCA 1TT5B 2X51A 2UZKA 2XAJA 3U9GA 1WCMJ 4XLAA 5HDNA 3ZOBA 2LBFB 2OUMA 4P5OA 3BPXA 5GPCA 4OIPF 3OYIA 5J3LA 1H89C 3BROA 3LWFA 4D0PA 5D5WB 3SDGA 4JYKA 4F55A 1XG1A 4X6AJ 1DUXC 3K0LA 2WWYA 1YW8A 2KT0A 4P96A 3CTAA 3GMEA 5L3BA 1JKOC 4BJTA 4HNUA 3OYMA 1YJWI 4Y33A 3RSNA 3GUDA 5IT3A 3HJEA 1ZRCA 4QPOA 1FY7A 3KEQA 2HVRA 3OR2C 1KQ8A 4UUTA 4XORA 4CYDA 2H6BA 2NXNB 3U1DA 1Y39A 3C3WA 3PUBA 1QZYA 3QPSA 4PUSA 5K7FA 4II3A 3PM1A 1PUFA 1F36A 5GTHC 5CQGA 1W5SA 4IOAF 3H0GJ 2Y9ZA 1P7JA 4W97A 4NHJA 2HDDA 1A04A 1FYLA 4M3GA 4G9YA 2A3SA 4WXCA 2BOLA 5GAGJ 2EH3A 3W6KB 2LFBA 1FJLA 1R4MB 1N75A 1PDNC 1YJNI 2X0LA 3RZOJ 1MMDA 3H9GA 4H0EA 3H3UA 1T2KA 2DW4A 2AXTC 2Q1ZB 2OC6A 1ZR4A 1LUJB 4HG2A 5BQTA 3IL2A 5BPDA 2I5UA 1LDKB 4XL9A 5FB2A 2QM3A 2XB0X 2ZXJA 1HXDA 1Z0XA 5F27A 5DM6F 1OCCH 2DA4A 3K4MA 3MMYB 1IN7A 5D4SA 3A4CA 1HW5A 3LA7A 3K7AJ 4XLFA 1WI9A 1XMAA 3WODF 1GDTA 4E7KA 2XPWA 1I3AA 2YU9J 3IKTA 1I6HJ 2K3FA 4HQMA 4G8XA 3KP5A 4AWXB 5HDGA 4YIIA 3C18A 4ZDLA 4AVZA 5LBQA 1R1VA 1U5TA 4AIHA 1TTYA 2NOJB 2AHQA 1Y0UA 2EIKH 1ZELA 2VC0A 3BTJA 2Q2EA 1FBQA 2JRTA 5EYRA 3CLQA 5A2QK 2ZJPF 2MW8A 4L9JA 5LD2C 2DU9A 2HNHA 4Y17A 1JJ8C 3NWSA 3OY9A 1VNDA 4CUGA 2CO5A 2AO9A 1IRFA 4K2EA 5JHUA 3V8LA 1IV8A 4YRVA 1MD0A 1NH3A 3Q0WA 3GYHX 4HAMA 2VE9A 5FD6A 1JE8A 1D1AA 1I27A 1GV2A 2HDCA 3I4NJ 2OBPA 3G1OA 6PAXA 3JRGA 5KVRA 2HTJA 4KDPA 1CQTA 1Q1HA 3TO9A 1LJ9A 2L5QA 1YX3A 1T8IA 4C2MJ 1TL8A 2PJPA 4ESJA 1XDSA 4QIWN 1ON2A 3SEZA 4GFBA 3KFWX 1G6NA 3SQNA 3GFMA 4LITA 1RI7A 4FASD 5C3EJ 3S1RJ 2XSDC 2RKHA 1KYWA 2DOFA 3K4JA 1MH4A 3PSFA 4ABZA 5AIPA 2O6GE 5BMZA 2MD0A 3BT9A 5F1JA 3F9KA 2ISZA 2E7XA 1STZA 2R5YB 1X2NA 2QVOA 3RQIA 1OCRH 3WTUC 1GXPA 3GTMJ 2XB5A 5TISC 5E3OA 3MZHA 2ETHA 2E60A 1YTYA 2F5DA 1R4NB 2CGPA 1IN6A 3ZMVA 4ZTFA 1P2FA 3OMYA 2MG4A 5HS8A 4OMYA 3W2WA 2QKLB 2BHZA 2TCTA 3K4NA 4DJAA 2W84A 5GAEJ 2DLLA 2NOGA 5IT9K 4WX9A 5FJ8J 3LL7A 4KN7X 1FOKA 2IA0A 4KT5C 5HLIA 2R7ZJ 4ZJZA 1HW2A 3QAHA 2DYSH 2EPFA 1AKHB 1Z91A 3NWTA 2M3AA 5DCFA 3WU2C 1Y1VJ 3MFKA 3N4MA 4WWCA 1SFUA 3BG7A 2E2HJ 3G1LA 1WH7A 1Z9CA 4UV8A 2IS1A 2HOAA 4IEJA 1IUFA 1QNTA 4L9TA 5IOZA 1P4XA 3VFZA 3I59A 4BU2A 2K85A 4CSWA 4RGUA 1OYYA 3L09A 3L9FA 3N05A 4CYCB 5IY5H 2O0YA 2AS5F 3CC4I 1OR7A 1XTAA 4XKBA 1FMVA 1A31A 3F8NA 5IYDJ 2OA4A 3H1CA 3EPZA 2ZXHA 1YO5C 4QPQA 4Y7NJ 1OKRA 3LQRA 2DMNA 5D8LB 2CJJA 2KISA 1HLVA 1VQNI 1W36C 3E5XA 2IGNA 1Y8QB 1X4OA 4IL6C 4M9XA 3SJMA 3M8JA 2CQXA 2DMPA 5DDGA 2DMUA 3H3ZA 1ZLJA 2H1LA 3MCZA 3K1NA 2VKHA 1M1EB 1XX5A 1RIOH 1FPQA 3ABLH 1Z21A 1G3SA 3R4KA 2EFOA 5DS9A 3OYHA 3EUKL 4XOPA 4WK8F 2JVGA 4HV5A 2CG4A 1QA6A 4A3BJ 2Z16A 3ZPLA 2CUFA 4M9ZA 1TT0A 3LQQA 1ODDA 2OZUA 2E2IJ 1FP2A 2OCEA 3M8EA 4AVPA 1TW2A 2D45A 4NC7A 5EGOA 1LKXA 2BW3B 3GLLA 5HNFA 1NG7A 2BXYA 3IRRA 2E7WA 4IX7A 2A07F 1O3SA 2R7WA 5DD4A 1U8RA 2A05A 3S3OA 1RC9A 2LREA 2VQCA 4LB5A 2EQRA 2RN7A 2LY9A 3L2RA 1H88C 3QYFA 4C3HJ 1RZ4A 3L7WA 4HEA2 4I76A 1TP4A 1V55H 5F0HA 2PMHA 2O8KA 3LA3A 1KU3A 3B6CA 1T39A 2PBIA 3LSPA 2RGVA 1TLHB 4IRIA 1IGNA 5EEAA 5FLMJ 5ILUA 1YX5A 3RKXA 4HSTA 3DFGA 1BR1A 3HZJA 3J80K 5J47A 4P9UA 2VKDA 2LKSA 1W36D 4CZZA 2MFZA 4KYWA 5ED4A 4NUBA 4DQ2A 2W82A 4LG3A 5EF6A 1G3WA 3RQ4A 1QZZA 4H4KC 1Y6IA 1IDZA 5JLWA 2R7TA 3KX2A 2XAUA 5HODA 3L2UA 4YIRX 2ZNYA 1O57A 1TNTA 2ELHA 2V6CA 3TW7A 2QBYB 2HGCA 5M5YJ 3UNGC 3G6EI 2YX4A 1L3LA 3I4PA 1FTTA 2DI3A 1GVDA 3VDXA 4NDLA 4ZYGA 1X3WB 5L3FA 2DPDA 2TRTA 4IHTA 1O7LA 1A35A 4MEYF 1F1ZA 3VODA 1LE8A 2R7VA 5E1XA 4X1EA 3ZMUA 1BIBA 2MC4A 2X6OA 2VODA 2MLGA 3Q0VA 4NQWA 2F4OB 1D0XA 2K3PA 2HOSA 2IA1A 1B8IA 2XAQA 3VB2A 3HRSA 3H9JA 1K83J 1V5FA 3TP0A 3BG3A 5HOOA 2L4AA 4B1RA 5FRMA 3ONQA 1S3JA 2HZDA 5HLHA 2B63J 3HHGA 4S0HB 3HSFA 3OSGA 1XSDA 3GFIA 2EB7A 2A6EF 2WC2A 2BEOA 2JTVA 2DDBA 2JJ7A 4B8XA 3GTPJ 5B1AH 3WTZA 2VIXA 3E0JB 5CKTA 4GXOA 2G7HA 3G73A 3TGNA 2QGUA 1XMXA 2JPCA 5IPAA 4PGGA 3DPUA 2KFDA 1YRNB 1GVJA 1HBXG 4EATA 1W5TA 2F6CA 2HQAA 3EYIA 3HOVJ 2BV6A 5K5OA 1HC8A 1GV5A 4LK0F 4HYEA 5BS6A 2DYRH 4CCNA 1I5ZA 1TWGJ 1GHCA 1KGSA 1APLC 3TMOA 3BR3A 3GTJJ 4XMYA 3CCSI 3IC7A 4O3MA 4BY7J 3HGYA 4EGYA 2O5RA 1R58A 1MBJA 4NC8A 2VJIA 2HYJA 3WTWC 3VEPA 3F8FA 4WXHA 3WG9A 1YLFA 4R79A 1JI8A 2KMUA 2R93J 2GIVA 2CU7A 2KIFA 1WVRA 4C2UA 5K5RA 3F3XA 1LDDA 1V5GA 3WU0A 2NVTJ 4IVNA 2O9LA 2P7VB 4OWRB 3IH4A 2HXOA 1T6SA 4OAYA 3JRCA 2PI0A 3FISA 3TW6A 2XROA 1RUOA 3DEUA 3DU6A 4R8HA 4LIUA 3DPLC 1MW7A 1ZR2A 5IP9J 4KNYA 1GUUA 2CMPA 5BNGA 3K2AA 3I3LA 5C4XJ 4A0XA 4B43A 1ZGJA 1ETOA 3IV5A 2FQ3A 1FT9A 2L0KA 2M87A 4EEFG 4R1HA 2EA4A 4RA2A 3BWGA 4JX6A 4G7ZF 3IWZA 2ECBA 2ZC2A 1Q1VA 4M6YA 3WGHA 5JVTA 2D2WA 3DF8A 3GW2A 4O6JA 3N97A 1UMQA 1MJ9A 2JPBA 4P9FA 1SEUA 1IF1A 1MIJA 2Z5UA 5FFXA 2R7OA 3BC8A 1SD6A 2E1NA 4RLQA 3ZQ7A 3BG9A 1PUFB 1R9TJ 3FHNA 3LSMA 3LSJA 3BJAA 3FK6A 4ANJA 3DPTA 4BE1A 1OCPA 2MH2A 4A3JJ 2R7RA 3HOTA 1JGSA 1T95A 2RQPA 3PL8A 2GBYA 5ERIA 3WGIA 1EV7A 2JK3A 5F1RA 4A3KJ 4HV6A 2VQLA 3HUGB 3S1QJ 2KDOA 3BDDA 3E97A 1GXQA 1MNEA 4UB6C 5GTIC 4BXUA 1MGTA 2XAHA 2KKOA 1BC8C 4EJWA 2XAGA 3GEZA 1QGPA 5FKOA 1U8BA 3S93A 4RB2C 3M1CA 3HOZJ 5E1ZB 5J1YA 3FM3A 3M7GA 4I7HA 2BGCA 1MDMB 4GYGA 4W1UA 1V54H 1TNSA 2MLKA 4J19A 1X1PA 3WHCA 2FBKA 2M30A 1WHUA 3H5RA 2K9SA 2E35A 4BBSJ 5DTDA 3K10A 4XQFA 2Y0SN 1W0TA 2Y0SA 1SFXA 2ID6A 1F4KA 5HNHA 2LOOA 1YE9A 4MTEA 1Y1WJ 1WJBA 3GWZA 2PJRA 3ZCOA 1U5TC 1OYIA 4U88A 4G6TB 1YQAA 3CO6C 3GXOA 4U0YA 1K7AA 1RNLA 3H3VK 4AM3A 3BCAA 2EA2A 3OYNA 5A2QZ 2QQ8A 1LFBA 4LIVA 3LFKA 1ETXA 3MKYB 1TWCJ 2OV7A 1WJFA 1MH3A 3I5UA 5HLGA 2R3SA 2ZJ2A 1D0YA 2LKXA 4G7OF 3MZ8A 1VZ0A 2OTJI 3B02A 3J81K 1HKTA 5LEKA 4L9NA 1IC8A 2FD5A 3CCLI 4M6XA 3H35A 3FHZA 2L7MP 1QO0D 1XMKA 4UB8C 5FROA 4D7NA 1XC5A 3CUQB 4XLHA 3L2VA 4E70A 3CMEI 1BBYA 4IHYA 1B72A 1YW9A 4BL0B 3F8CA 3L2WA 4PJLA 5LRSA 4M3FA 2VC1A 2XDVA 4O5VA 3HRMA 3D5LA 2WY8Q 3DKWA 5LHHA 2CH0A 2X6WA 5E3LA 4MQ9F 4S05A 3ZMSA 2ELKA 3EUAA 1B4AA 2F4MB 2HOEA 3RIRA 3V7CA 1BIAA 1KZHA 2MABA 1REPC 1QVUA 1I3QJ 3HC7A 9ANTA 1XSXA 2DPUA 2ZJRF 3KCCA 3LSIA 4BEHA 3QP6A 2B9SA 4M9SA 2DFHA 3CP8A 1Z6TA 1DPUA 4FE7A 5KAFC 4X0GA 2GM4A 4EMSA 5F64A 1OFCX 2X1EA 2DTRA 3TKYA 1FYMA 2RVCA 5FKLA 4L0YB 3E1SA 3QU3A 4BQNA 5FLVA 1LNWA 3FXRA 4CA0A 5IT9Z 1PP8F 1SAXA 2FOWA 2L4MA 2ZJQF 1JGGA 3OS0A 3LA2A 3TOAA 2AQFA 2HWVA 3IWFA 2R7QA 4IF4A 2KRCA 5CVVA 4YFXF 1CF7B 3I56I 5IYBJ 1ON1A 1FOWA 3CJTB 3VSKA 4BXXJ 3QRFF 1T33A 5J1RA 2WTEA 3V7SA 1LEAA 1MBEA 4ENKA 3GZNB 3CMYA 3G71I 2DN0A 2UWMA 4CDGA 3REOA 3BTLA 4YFNF 2DJNA 3HG9A 2L01A 3LSGA 4IRHA 2UXNA 3WG7H 3CCMI 3M8FA 1LFPA 3OYCA 2DMQA 3A02A 3S8PA 3ZXSA 1YJ9I 3L2CA 3PSIA 1B9MA 2VJJA 1W7PD 3ROUA 1G4DA 3ASNH 3MAJA 1XB4A 1XD7A 3OL4A 4C3IJ 3CCQI 1OR7C 4FX4A 1WZ2A 3GTOJ 2JSCA 2XF6A 3I59B 1QPMA 1W4MA 4I0AA 5CVJA 3V8KA 4LG0A 3BR0A 2OQGA 2Y69H 3CCYA 2Y2ZA 2FX0A 2MGQA 3BLYA 2IVMA 2G7UA 2X4HA 2ZKZA 1ZGWA 2XC7A 4RGXA 1UB9A 4CCMA 3S2DJ 2J5OA 4B3AA 2BHYA 2M8EA 2JA8J 1QQIA 1J7KA 1Y56A 1DU0A 2JRMA 4B09A 1Z77A 3TBIA 2L9SA 2L9VA 2YX7A 4EJOA 1MJAA 1T08B 3E6DA 3ZMTA 3RKYA 5IP7J 2IAIA 2KL4A 1TWHJ 2K4BA 3OIOA 4OU0A 2R4GA 2H6CA 3WTSC 4UVBA 2VQGA 3BY6A 2DO7A 1V4RA 2NNNA 2H94A 3OYGA 2A6TA 1VF9A 2MH9A 3BG5A 1A6IA 3LNQA 2R92J 1Z05A 5L3DA 2Z33A 2K7LA 1BC7C 1R23A 5CPRB 5DCMA 1Z67A 4AIKA 3EQLF 3FXMA 1FNNA 1B59A 3VYTB 3OYAA 3VYRB 4KT6A 1ZGAA 1TQMA 2IGMA 3BP8A 2XF7A 1U9OA 2LRDA 2LR8A 5EGOB 1Z7UA 3G3ZA 3OV8A 3OYKA 3WTYC 2LVSA 4PCQA 3O8GA 5ILSA 1XPXA 1TQPA 4E7ZA 4U0VA 2CSOA 3T0YA 2FUG2 4IXAA 4GYIA 4MGRA 1WJEA 4LB6B 3JTGA 2HR3A 3A1YA 4L18B 3DBHB 2YSRA 2WA0A 5CVIA 2KZVA 3IP4B 1IN8A 2A5YB 2JVHA 1FIAA 3QODA 2HQ5A 2OZ6A 2BXZA 3KETA 3EUHA 4GGGA 2ICWG 4UY8I 3CCEI 3J80Z 4N4OB 3BZKA 1A6QA 4KMFA 2P5KA 3CCVI 4BQAA 4Y13A 4A6DA 1AWCA 1YIOA 1J09A 2D5VA 4M6VA 2Z9OA 2CUJA 2XIGA 2CWEA 5AONA 2HI3A 1W7PA 2IS6A 2TDXA 2EZIA 5LRRA 3HPHA 3HOUJ 5M3FJ 2VONA 1KQ0A 4QTRA 1H8AC 4KIBA 3E5UA 2KIMA 3B73A 4ON0A 2L7KA 2M0MA 4DOZA 3I55I 4CCOA 3QOPA 4OIRF 1E3PA 2IW5A 3K9TA 4HNVA 4FE4A 1X1CA 4XN3A 2IJLA 1SANA 1MMAA 3DLLF 4BE2A 1ETVA 3DXJF 3FXOA 2M34A 1X1AA 2LBFA 5TJJA 1I1SA 3CJQB 3CC2I 2WAFA 3ESWB 1E17A 2J5PA 3VWBA 1FX7A 4WXDA 1OQYA 5EZHA 1RPWA 2CW7A 1WRJA 3P5JA 3ZQQA 3LSHA 3IRQA 2XGXA 3Q9VA 3ABTA 1RKWA 1ZG5A 1X2MA 4EGZA 5GP9A 3DQVC 5FLXK 2P5LC 3NARA 4F3QA 4LLGF 2ZSHB 4TV7A 3JRAA 3S2WA 2DA2A 2E2JJ 1MNDA 3UKGA 2W4SA 1ETQA 2IGOA 3K4KA 4NNJA 1VQ4I 4AC0A 1SMTA 3NQOA 1MJBA 1T56A 4NQWB 3RZDJ 2H8RA 2R0QC 1E3HA 1NTCA 2V1XA 2JUCA 3VPRA 1P92A 2D1HA 2X1DA 3F6OA 4BJ5C 3HYIA 3FKIJ 2XGEA 3L1PA 2ELJA 2ISYA 1SFKA 5CYVA 4GRIA 3U1KA 3F8BA 3NRVA 4U7BA 1XGNA 1WJDA 1EJ9A 2HU9A 2F4IA 4FQGA 3EDPA 4WF2A 3WU1B 4DYQA 4KITB 1BOBA 4ZTJA 1YS7A 4DW6A 3CDIA 5E17F 2DT5A 5LHGA 5HS9A 4OINF 2COBA 3AKZA 3C1DA 2K9NA 3IHUA 3I64A 4CCKA 1IXCA 4CZCA 2K27A 1ENHA 2M8GX 4OMZA 4B48A 3WTXC 2QZ8A 4YELA 3AG4H 3S17J 4RB1A 4P1WA 1F43A 1FMWA 3RPUA 1IW7F 3HRUA 2ECCA 4D7MA 1R5HA 2QKMB 4ENNA 5DEQA 1G59A 1R49A 2BY3A 3CC7I 1EH7A 1HDPA 2VOOA 3KEOA 3M1EA 2ACJA 4LD5A 1ZAOA 2RV8A 4J00A 4KA4A 2V1NA 4GCVA 3ZQHA 1TC3C 1LDJA 4BHBA 2OTLI 4N9IA 1ZTRA 2HZTA 2MD5A 2MYSA 3LOCA 2R7SA 2GOMA 4I09A 3Q5FA 3R61A 1KU7A 3P7NA 2QSGX 4XBFA 3F23A 2CQ7A 1SFOJ 3H5NA 3LSTA 3TQNA 2LP0A 1PVEA 2EZKA 3KPHA 1D8JA 2RC4A 3KZYA 3OYDA 3ERED 4A6EA 2DFFA 3FIWA 2Y0MA 2OU2A 3OR1C 2H1KA 3P9KA 4XSXF 2I8DA 3O8HA 4ZZLA 4D1QA 2H27A 2LMDA 4RLFA 3KP7A 2RQQA 4OIQF 2E71A 1ORKA 5BOXA 2LY2A 4U0WA 2HVQA 4M74A 4PZJA 3HOXJ 3HIFA 2DK5A 3F72A 3OOUA 1JUMA 1HA8A 2H8WA 1XGMA 4Y3OA 2DK8A 1KQ9A 3P9CA 5FKNA 2FNPA 2YU3A 3LAPA 2XGCA 2RREA 2VBWA 2C6YA 4CH7A 1BI0A 2EWNA 1K6YA 4BQQA 3I53A 3QPLA 1FTZA 3H0DA 2O8XA 5DUIA 2W1OA 1A5JA 1I1GA 4HNTA 1J59A 4BYYA 3KIOA 4BJ6C 2LKPA 3BJ6A 4EV0A 2QQAA 2V9KA 5GPAA 4FTHA 2Y48A 4ZC3A 1IRXA 3O3KA 1R5ID 4HX4A 4B4CA 3KP6A 2GXAA 4FETA 3JRFA 1PJRA 1WFXA 1D1BA 1U9NA 2E1MC 2ZSIB 1BJZA 1DU6A 2QQ9A 4F52A 1ITYA 1DP7P 2STTA 4G6QA 2L7ZA 3KLNA 4CXFA 3WHBA 2DOAA 2LYCA 1TWAJ 3MD2A 4HA8A 4MIMA 3AG1H 1AOYA 1UFMA 4BKXA 4IZZA 3PNYA 1O7FA 4BAYA 1IUYA 2L7FP 2A68F 2YS9A 5FKMA 3IAS2 3A01B 4II2A 4N4NB 2MSYA 5LGNA 2L9NA 1SD5A 2H09A 5LGTA 2P4WA 5EEGA 3PFIA 1VQKI 1FWZA 2O3FA 1B1BA 1EH6A 5ICEA 3HEFA 1XGOA 2XPUA 3OS2A 2A5WA 5H6QA 5JFRA 4PGHA 4HZFA 2CUZA 3HOWJ 1IJWC 3KZZA 4EJTA 1K78A 2DT6A 3SHFA 1VQ8I 4EM0B 2DDAA 2EIJH 5LGUA 2PJRB 5M3MJ 2EV6A 2OF7A 3ISPA 2VBYA 3QP5A 1QRYA 1G2HA 2VUMJ 1J9IA 3AL0C 5F6FA 4A69C 5K5QA 3JR9A 3K69A 1D1CA 2FA5A 2G9WA 1HSJA 3E6MA 2QQBA 2GOXB 3RDIA 1XCVA 2O7OA 3J81Z 4FCYA 3IUOA 4RM2A 1KU9A 4CCLA 1D0ZA 4IHWA 4RM3A 1VQOI 2IA2A 3JRBA 3ZQLA 2M9HA 1JKPC 1AA7A 3CJRB 3SDBA 3B6AA 3X2QH 4XRMA 5BPIA 2NRAC 2VN2A 4DIQA 3A03A 1K6OA 3ABKH 1S29A 2QF7A 1QHHD 2Z99A 4EVIA 5EJCA 1X4PA 3T5XA 2NS8A 1P6RA 3FBNB 4I2OA 2VKEA 1Y8RB 2UV1A 4UUSB 4BQOA 3VYSB 2KRHA 1B72B 1LFUP 5J6XA 3TP3A 1MBGA 4C9YA 2KZGA 1U3EM 1XN7A 2EFWA 1QVTA 1UHWA 2DBBA 4HDUA 4UVCA 2QENA 2IGKA 1E3OC 1EH8A 1YS6A 3H92A 4DBRA 1ONVA 5FO5A 4IJAA 4N9HA 2VE8A 4PSXA 4Z2YA 5C4JJ 3DP7A 3FXLA 2HQRA 1XS9A 4IHVA 1FSEA 3CQZJ 2VT3A 2R7XA 5E3NA 4A5MA 3H9QA 1UCRA 2HKOA 2YPRA 4BEHB 2FOKA 1UG2A 4MHGA 3BG6A 3BZCA 2F5CA 3C2BA 2DCEA 5F04A 2CW0F 4IQ4A 1JT6A 3RKQA 4QWQA 2QSFX 2E1CA 1IXRC 1P4AA 2PLYA 2XHKA 1G3YA 1NHAA 3U2RA 1UAAA 1OPCA 2K4JA 5GAHJ 3E3VA 2EV5A 3KEYA 1SVMA 2OQRA 3FXJA 5KK1A 2M1BA 5H6RA 3HOSA 1FZPB 1AHDP 5CJ9A 1R7JA 3K4BA 1QBJA 2E1OA 2P0WA 2XSJC 5LEJA 2ID3A 2KJBA 1YHQI 3IAM2 1U6GA 1BR4A 1Z1DA 2NS7A 1U78A 4DYCA 4XN0A 1I6XA 2KQRA 3OSFA 1LQ1A 2MBFA 3ABMH 1BI1A 3D1NI 1MSEC 4BNCA 2LC2A 4A12A 1VQ9I 1JT0A 4V2FA 2V9PA 3QU6A 3UR3C 3C2GA 1KA8A 4HSRA 4KIFA 5E18F 3TO6A 1ETKA 3JSPA 5E3MA 2ESNA 2ME0A 4PFOA 1FBUA 2L02A 4OIOF 3BJOA 2DXIA 3LMMA 2ZXWH 3WTTC 2HYGD 4KJZA 4S04A 3MKLA 1R6RA 4XK4A 4ITVA 4ZDPA 3K4CA 3JREA 1SD4A 2KLOA 2F48A 3Q9SA 4PDKA 3GTQJ 3NEUA 2Z1DA 3FK7A 2M0CA 1HOMA 3I71A 3FXQA 1WGXA 2KRFA 1K4TA 5F0FA 3SZGA 2EFPA 3VSLA 4E7IA 1R5GA 2K9MA 3PFYA 1BI3A 5HDKA 3ZN1A 1J75A 2EILH 4A3MJ 3CDLA 5KHDA 2CFOA 1POGA 4MFDA 3SFIA 5DV5A 2EIMH 4YFKF 4G7HF 5D5XB 4HLYA 5EDNA 2EFQA 2ZB9A 4ENJA 4Q47A 2CYYA 5FKKA 4KICA 3GVAA 4BUPA 4KUMA 3F22A 1ZRDA 1JJ6C 3S32A 1SFEA 1U5TB 3V8JA 3ECOA 3RPQA 3FDYA 1DP3A 3SYTA 3E6CC 3T8RA 1N78A 3W6VA 2EZHA 5DCMB 5IYCJ 3GX4X 2Q2EB 2V1DA 4L5JA 3K4LA 2M4GA 3HBLA 3W6JB 3K70C 2NVQJ 3GZ5A 3GTGJ 1EF4A 4LJZF 4JX5A 2ZMEC 1JKQC 4BHPA 1ZHFA 2DA6A 4B3XA 3J7AO 4HX7A 1XSVA 1S7OA 2VKVA 1ERDA 3DBLB 1OMIA 4JK1X 3PIPF 3EUHC 1PYVA 2K9QA 2KIQA 1X3UA 4L5EA 5FGMA 5JHFA 3CDHA 4N0BA 3HTSB 4HBLA 4I98B 3DU5A 2X48A 4E7HA 1BA5A 4PJ0C 3DWLE 2MC3A 2P81A 2FEZA 4RAYA 1FBSA 3RI4A 3BZ6A 3IH3A 1N77A 3AG2H 2VPRA 4BE0A 4JP0A 2W48A 1J2XA 1HF0A 4LK1F 1JHHA 2PEXA 2ZXIA 3ML6A 2LTPA 1W7PB 3KE2A 1ULYA 3JAMK 5E8GA 2DA5A 2IEKA 4LOCA 4BH9A 2FMYA 3PJRA 5CLSA 5K7ZA 1E2XA 3HPGA 3CZ6A 1PUEE 4NC6A 4UNOA 1RRJA 1J5YA 2KPMA 3Q0UA 3T1BA 4MQVA 3OL3A 4CCJA 4XNFA 1K4SA 4D5FA 5B1BH 4FISA 1JUSA 4IOCF 5FLXZ 3FXUA 4U7DA 1VQLI 2CQKA 2JMWA 4M3EA 4E7LA 3V4GA 4CO8A 4YG2F 2DOEA 3E7LA 1BOAA 4KFCA 3ZMZA 4DZJA 1I39A 3J7AY 2O61A 3OYJA 3WTVC 4DBQA 3K70D 4LFUA 3RJPA 3BQYA 3KLOA 2XVCA 5TRDA 3IH2A 3KP2A 2XAFA 3D5RC 5H20A 4C2TA 4ETSA 1LB2A 5DD8A 2HQNA 2CRGA 1ZG3A 2VJ4A 3FKJA 1BW6A 3PQKA 1P9QC 4IRGA 2VQHA 3R6SA 3V7RA 2DODA 3QPHA 4LMYA 5CVRA 2ADUA 4ZZDA 5B66C 4HDVA 2P6SA 3SEQA 2L9RA 3BQZA 1VQ7I 2M4KA 3S1NJ 2VXDA 4A3IJ 4XONA 4AIDA 1TQIA 4HPQA 4A2UA 3HM5A 4Z6YA 3E6BA 5K1YA 2GWRA 3KYLA 5EZGA 2LH9A 1HQCA 4I6ZA 3G2BA 1TWFJ 3FF5A 1UHMA 2XUBA 1IAWA 4F92B 4ASNA 2BY0A 1R1UA 2VASA 2HYFA 2M5WA 5JLXA 3U21A 3HUGA 2R5ZA 5ILVA 2QSHX 1S72I 2KDZA 1EA3A 1NK3P 2JZYA 2P5VA 4PJNA 2AQEA 1XDUA 3G4SI 2XRLA 4A0ZA 2B7EA 2FBHA 3JRHA 3CUOA 1XCBA 1G8XA 4KIGA 1FC3A 1H9TA 4UVAA 2YR2A 5E79C 3BR1A 2R7DA 5EG0A 3GZ6A 1MDMA 3JTHA 5TGTA 3HGGA 5FFZA 5AIQA 3S2HJ 2K02A 1WPKA 3TL4X 2Q0OA 4BBRJ 3FMQA 2KJCA 2DQLA 2CV0A 5D5UB 1EKEA 1FEXA 3CLOA 3GTLJ 4XKVA 3CF2A 3MKZA 4RGSA 1BI2A 3J7ZI 3PQJA 4PFPA 3COAC 1QZEA 3EYYA 1O3QA 2GXBA 3VYUB 5EEHA 3V42A 1S7AA 2OJED 4UHTA 5IP6A 2VL8A 2M7BA 1BN5A 4XLNF 2V4JC 4A5NA 3H5AA 4ZH4F 3DTIA 2CV2A 1ACIA 1U0JA 4NBQA 4XRFA 3CMMA 4GO1A 5IOYA 2IT0A 2ZMEA 4B44A 2BVMA 4RDUA 4QLCU 4XLPF 2CS3A 1IZ1A 2BBYA 5ICFA 4RMNA 2WAEA 3QYBA 4LGWA 1VFCA 2IP2A 1RKTA 3ZQGA 2WBMA 3WE2A 4EJVA 2FMLA 1QU3A 2BZTA 4A3GJ 3MWMA 4Y52J 2DFEA 3F6VA 1K79A 2VJ5A 4MO7A 4YEJA 3CUQA 2IRFG 2ZFWA 4I01A 3RPUD 1BR2A 1ZREA 3I9V2 3FXKA 1HSTA 1ZYRF 2RNJA 5J40A 2WY7Q 5M5XJ 3DTKA 1T0FA 3WGGA 5L3EA 1FOYA 2VXZA 3S14J 1WJAA 1W5CC 2W57A 2M45A 3DV8A 1UG0A 3TEDA 3Q3SA 2FE3A 1WSUA 3QYEA 2GA1A 3LSKA 3PIOF 2HVSA 4IKFA 4JBAA 1IV6A 5HVQC 4A3DJ 2COMA 2X1CA 3PUFA 2OD5A 1HKQA 2X85A 4XRSG 1SVLA 2GAUA 1OLTA 1MNMC 2EK5A 4OOIA 5KAIC 1RUNA 1ZARA 2QEXI 1MKMA 2Y9YA 2L54A 3FWEA 3QOEA 1USTA 1ZG1A 4MLOA 3T8TA 4BS9A 5LLQA 4XLCA 3NAUA 3GLXA 4XSZF 2JSPA 1DGRM 4PSWA 1RETA 1UHSA 4E6KG 1BW5A 2GZWA 3WE3A 1LE8B 5ICCA 2Y31A 3AAFA 2L2OA 4I02A 1D3YA 1Z6RA 2KP6A 4XM3A 4PJJA 1YI2I 2R7FA 1WWXA 2X6XA 3GO5A 3CP2A 3BTIA 1B8IB 1CF7A 4Q4ZF 1H0MA 2BY2A 2JN6A 2VBXA 1IN5A 1YOVB 3I54A 3S3NA 4CICA 2E5ZA 2HPIA 4E4HA 3A0HC 5KNLA 4HQEA 3TDUC 5B5EC 3CCUI 1BJAA 2E19A 3VOEA 1GT0C 2EBIA 5LHIA 2JT1A 4G6DA 4IPAA 5JR3A 1FP1D 1L0OC 2A69F 1K78B 3ZQCA 4B47A 3QPTA 2W7NA 2L3DA 2PMUA 1LVAA 2Z2SB 4NB5A 5F08A 2JQ7A 2A6HF 5J4YA 1VQPI 2CV1A 4ZYAA 4IHSA 1MBKA 3M07A 4A3CJ 3HDDA 4M71A 4Q5SF 4J01A 3FX3A 3W3CA 2QYOA 3F8MA 1OCZH 2QUFA 4IQJA 1E0EA 3KYCB 1JXSA 2ESHA 1AU7A 2V79A 3D5SC 3GTKJ 4RB0A 5J4VA 5ICGA 2LY1A 1WQ2A 2FQ4A 2JA2A 1BM9A 4XICA 1MBHA 3J7YJ 4A93J 1A36A 3S16J 2DQRA 3OYEA 5B3SH 1ETWA 4XKWA 4BHCA 4MEXF 2MA3A 1FYKA 4P55A 1S6LA 4ESFA 4EM1A 2ME6A 2CQNA 2OPTA 3FMRA 2LG4A 1ZQ3P 2HDWA 2A61A 2XGDA 3M9AA 1FOXA 1Z7LA 1WI3A 4F93B 5L3CA 3OYLA 1S9HA 3CESA 1S5LC 1Z3YA 2ZFUA 2B0LA 3ZP5A 4DGWB 1KONA 2HXIA 4CHUA 2DA3A 4ZDOA 2BYVE 2UXXA 4I99C 4RB3C 4D9JA 2VLAA 4A0YA 4Y15A 2JUGA 3PNVA 2OCCH 3FBIB 4A3EJ 2VB6A 1F9NA 1MZBA 4FHTA 2FNAA 2LF8A 1W1WE 2W00A 4EJUA 3OIPA 3PO3J 5DYMA 2X9DA 2K9LA 4AIJA 2N8GA 3OOPA 2WV1A
chains in the Genus database with same CATH topology
3MQ0A 3FM5A 2CFXA 5L3GA 2HEOA 2IPQX 1O3RA 4LLLA 2XKPA 4HLXA 2NYXA 1FLIA 5E8IA 3ELKA 1IN4A 1TW3A 4UV9A 2NAZA 1D8KA 2EV0A 2FSWA 4ESBA 5HS7A 5E20A 3CO7C 1FSHA 2EFNA 5D6FA 1HKSA 1PP7U 1LEBA 4MNUA 2F5EA 3SZPA 4UUVA 2EJRA 1WKMA 3CJNA 3K1MA 2PFBA 1USSA 2P7CB 4WCGA 4HF2A 1CGPA 4EQQA 4RGRA 3HHHA 4YIFA 3D0SA 2NS0A 1JHFA 1YYVA 2XASA 3SFZA 2FU4A 3ULQB 2P6TA 4EM2A 3ZN0A 2LF7A 3TOBA 3FZVA 3TDZC 3TO7A 2XV4S 4M73A 4HF0A 4HW0A 3EETA 1B6AA 5D6EA 1C0WA 4FX0A 3KP4A 3BOQA 2ZCWA 5J8CA 2LDUA 2XKOA 4HF1A 2W24A 3MEXA 5D8KB 2HFHA 2PQ8A 2BE5F 3KP3A 2HS5A 2WV0A 3JAMZ 3HSRA 4JQFA 1R22A 4L0ZB 2RDPA 4HX8A 3LAJA 3RTRA 1YFHA 3F21A 1ZH5A 2O03A 1V3FA 3RYPA 4ZYDA 2FRHA 2QWWA 3C7JA 1F5TA 4HOBA 2VBZA 4MTDA 3E5QA 3K2ZA 1R00A 4Q48A 5E1WA 1IRGA 1B9NA 3GF2A 2FXAA 4L9VA 3ZMDA 4L5IA 1T38A 3R60A 4UXNA 3O6BB 1U2WA 2XRNA 1R1TA 1SMYF 1G3TA 2PN6A 2NNYA 2Y75A 2OAZA 5J8FA 1J0RA 3RKWA 3JSOA 4LLNA 5D5VB 2QLZA 2D1VA 2DFIA 1YG2A 2GQQA 3GFJA 1YW7A 3HTUA 5JI6A 4M72A 1HW1A 3R0JA 3K1PA 2ZNZA 2QBYA 2DAOA 2HKXA 2V1UA 4LG0B 1DPRA 2AXLA 4RS8A 5D4RA 1KYZA 3GFLA 3BPVA 2ZBKA 2FBIA 3MZYA 2LNBA 2V9VA 1KU2A 3L00A 1ZRFA 4ZYHA 2W25A 1DDNA 2Z3YA 3ABUA 3HSEA 1XGSA 1O3TA 1D5VA 1ZN2A 2VT2A 1S8NA 3R0AA 5DUKA 4G94A 3P9IA 3HRTA 2KIUA 3I0TA 2VOPA 2W85A 3I58A 4I0BA 4AD9A 1H9GA 1TBXA 2HTSA 4ENMA 2GXGA 5FD5A 2K86A 2Q8KA 2P8TA 4F7ZA 2ZMEB 1R36A 5CVUA 4KN4X 3FMSA 2F5FA 2GA2A 1SD7A 3SZTA 4FT8A 4KMUX 3CUQC 4ZYEA 4RAZA 4CGZA 2FF4A 1T98A 2ZO4A 3O2PE 1OYWA 3SXYA 3ECHA 1IXSB 3JW4A 3RYRA 2STWA 1VTNC 2F2EA 1ZLKA 1P4WA 2LSOA 3IKVA 2PG4A 4DNCA 2UZKA 2XAJA 3U9GA 5HDNA 4P5OA 3BPXA 4OIPF 3BROA 3LWFA 4D0PA 5D5WB 1DUXC 3K0LA 2WWYA 1YW8A 4P96A 3CTAA 5L3BA 3GUDA 5IT3A 1ZRCA 1FY7A 3KEQA 1KQ8A 4CYDA 2H6BA 3U1DA 3C3WA 1QZYA 4NHJA 1A04A 1FYLA 4G9YA 2A3SA 4WXCA 3W6KB 1PDNC 2X0LA 4H0EA 3H3UA 1T2KA 2DW4A 3IL2A 5BQTA 5BPDA 1LDKB 5FB2A 2QM3A 2ZXJA 1HXDA 1IN7A 5D4SA 1HW5A 3LA7A 1WI9A 1XMAA 3WODF 3IKTA 4HQMA 4G8XA 3KP5A 4AWXB 5HDGA 4YIIA 3C18A 5LBQA 1R1VA 1U5TA 4AIHA 1TTYA 1Y0UA 2VC0A 2Q2EA 1FBQA 2JRTA 5A2QK 4L9JA 2DU9A 4Y17A 2CO5A 1IRFA 4K2EA 5JHUA 3V8LA 1MD0A 3GYHX 4HAMA 2VE9A 5FD6A 1JE8A 1I27A 2HDCA 2OBPA 6PAXA 5KVRA 2HTJA 4KDPA 1Q1HA 3TO9A 1LJ9A 2PJPA 4ESJA 1XDSA 1ON2A 3KFWX 1G6NA 3SQNA 3GFMA 1RI7A 2RKHA 1KYWA 2O6GE 5AIPA 5BMZA 2ISZA 2E7XA 1STZA 2QVOA 3WTUC 1GXPA 3MZHA 2ETHA 1YTYA 2F5DA 2CGPA 1IN6A 3ZMVA 1P2FA 5HS8A 4OMYA 2W84A 2DLLA 5IT9K 4WX9A 4KN7X 1FOKA 2IA0A 4KT5C 5HLIA 1HW2A 3QAHA 1Z91A 5DCFA 3MFKA 3N4MA 4WWCA 1SFUA 1Z9CA 4UV8A 1QNTA 4L9TA 1P4XA 3VFZA 3I59A 4RGUA 1OYYA 3L09A 3L9FA 2O0YA 2AS5F 1OR7A 3F8NA 2OA4A 1YO5C 1OKRA 3LQRA 5D8LB 3E5XA 4M9XA 5DDGA 3H3ZA 1ZLJA 3MCZA 3K1NA 1RIOH 1FPQA 1G3SA 3R4KA 2EFOA 4WK8F 4HV5A 2CG4A 3ZPLA 4M9ZA 3LQQA 1ODDA 2OZUA 1FP2A 3M8EA 4AVPA 1TW2A 2D45A 3IRRA 2E7WA 2A07F 1O3SA 1U8RA 5DD4A 4LB5A 2RN7A 1RZ4A 3L7WA 2PMHA 3LA3A 1KU3A 1T39A 2PBIA 2RGVA 1TLHB 4IRIA 5ILUA 3RKXA 3DFGA 3J80K 4P9UA 4CZZA 4KYWA 5ED4A 4DQ2A 1G3WA 1QZZA 1O57A 1TNTA 2V6CA 2ELHA 2ZNYA 2QBYB 2HGCA 2YX4A 1L3LA 3I4PA 2DI3A 4ZYGA 5L3FA 4IHTA 2DPDA 1O7LA 4MEYF 1F1ZA 3VODA 5E1XA 3ZMUA 1BIBA 2VODA 2MLGA 4NQWA 2IA1A 2XAQA 3VB2A 3HRSA 5HOOA 2L4AA 1S3JA 5HLHA 3HHGA 3HSFA 1XSDA 3GFIA 2EB7A 2A6EF 2WC2A 2BEOA 2JTVA 4B8XA 3WTZA 4GXOA 2G7HA 3G73A 3TGNA 2JPCA 4PGGA 1GVJA 1HBXG 1W5TA 3EYIA 2BV6A 5K5OA 4LK0F 4HYEA 5BS6A 1I5ZA 1GHCA 1KGSA 3IC7A 4O3MA 4EGYA 1R58A 3WTWC 3VEPA 3F8FA 4WXHA 3WG9A 1YLFA 4R79A 2GIVA 2KIFA 5K5RA 3F3XA 1LDDA 3WU0A 4IVNA 2P7VB 1T6SA 2PI0A 2XROA 1RUOA 3DEUA 4R8HA 3DPLC 4KNYA 4A0XA 1ZGJA 2FQ3A 1FT9A 2M87A 4R1HA 2EA4A 3BWGA 4G7ZF 3IWZA 5JVTA 4M6YA 3WGHA 2D2WA 3DF8A 3GW2A 4O6JA 3N97A 1MJ9A 2JPBA 4P9FA 1IF1A 2Z5UA 5FFXA 1SD6A 2E1NA 3ZQ7A 3BJAA 3DPTA 2MH2A 3HOTA 1JGSA 2RQPA 5ERIA 3WGIA 1EV7A 5F1RA 4HV6A 3BDDA 3E97A 1GXQA 4BXUA 1MGTA 2XAHA 2KKOA 1BC8C 4EJWA 2XAGA 3GEZA 1QGPA 4RB2C 5E1ZB 3FM3A 3M7GA 4I7HA 2BGCA 1MDMB 4GYGA 1TNSA 2MLKA 2FBKA 2M30A 1SFXA 1F4KA 4MTEA 3GWZA 1U5TC 1OYIA 4U88A 3CO6C 1YQAA 3GXOA 4U0YA 1K7AA 1RNLA 2EA2A 5A2QZ 3LFKA 3I5UA 5HLGA 2R3SA 2ZJ2A 4G7OF 3B02A 3J81K 1HKTA 5LEKA 4L9NA 4M6XA 3FHZA 1QO0D 1XMKA 3CUQB 4E70A 1BBYA 1YW9A 3F8CA 5LRSA 4O5VA 2VC1A 3HRMA 3D5LA 3DKWA 5LHHA 4MQ9F 4S05A 3ZMSA 1B4AA 2HOEA 3RIRA 3V7CA 1BIAA 1REPC 1XSXA 2DPUA 3KCCA 3QP6A 4M9SA 1Z6TA 1DPUA 4EMSA 5F64A 3TKYA 2DTRA 1FYMA 2RVCA 4L0YB 3QU3A 1LNWA 3FXRA 5IT9Z 1PP8F 1SAXA 2L4MA 3LA2A 3TOAA 2HWVA 3IWFA 4IF4A 5CVVA 4YFXF 1CF7B 1ON1A 3QRFF 2WTEA 3V7SA 1LEAA 4ENKA 2UWMA 4CDGA 3REOA 4YFNF 2L01A 4IRHA 2UXNA 3M8FA 3L2CA 1B9MA 1W7PD 3ROUA 1G4DA 3MAJA 1XB4A 1XD7A 4FX4A 2JSCA 3I59B 1QPMA 1W4MA 4I0AA 5CVJA 3V8KA 4LG0A 2OQGA 2IVMA 2G7UA 2X4HA 2ZKZA 4RGXA 1UB9A 2J5OA 2M8EA 1QQIA 1J7KA 4B09A 2YX7A 4EJOA 1MJAA 3E6DA 3ZMTA 3RKYA 2K4BA 4OU0A 2H6CA 3WTSC 4UVBA 3BY6A 2DO7A 1V4RA 2NNNA 2H94A 2MH9A 1Z05A 5L3DA 2Z33A 2K7LA 1BC7C 1R23A 5DCMA 4AIKA 3EQLF 1FNNA 1B59A 1ZGAA 1TQMA 3BP8A 1Z7UA 3G3ZA 3OV8A 3WTYC 4PCQA 5ILSA 1TQPA 4U0VA 2CSOA 3T0YA 4IXAA 4GYIA 4MGRA 4LB6B 3JTGA 2HR3A 4L18B 2YSRA 5CVIA 1IN8A 2A5YB 3KETA 2OZ6A 3EUHA 4GGGA 3J80Z 4KMFA 2P5KA 4BQAA 4Y13A 4A6DA 1AWCA 1YIOA 2Z9OA 2XIGA 2CWEA 5AONA 1W7PA 2TDXA 5LRRA 2VONA 1KQ0A 4KIBA 3E5UA 2KIMA 3B73A 4ON0A 3QOPA 4OIRF 2IW5A 3K9TA 2IJLA 3DXJF 5TJJA 1I1SA 1E17A 2J5PA 1FX7A 4WXDA 1WRJA 3IRQA 2XGXA 3Q9VA 3ABTA 1ZG5A 4EGZA 3DQVC 5FLXK 2P5LC 4LLGF 4TV7A 3S2WA 1SMTA 3NQOA 1MJBA 2V1XA 1P92A 2D1HA 3F6OA 3HYIA 2ISYA 5CYVA 3F8BA 3NRVA 4U7BA 1XGNA 3EDPA 4WF2A 3WU1B 1YS7A 5E17F 2DT5A 5LHGA 5HS9A 4OINF 3C1DA 3IHUA 3I64A 1IXCA 2K27A 4OMZA 3WTXC 2QZ8A 4RB1A 3RPUA 1IW7F 3HRUA 1R5HA 4ENNA 5DEQA 1EH7A 2VOOA 3KEOA 3M1EA 2ACJA 4LD5A 1ZAOA 2RV8A 4KA4A 4GCVA 1LDJA 4BHBA 4N9IA 2HZTA 2MD5A 4I09A 1KU7A 3Q5FA 3R61A 3P7NA 4XBFA 3F23A 3LSTA 3TQNA 1D8JA 2RC4A 3KZYA 3ERED 4A6EA 2Y0MA 2OU2A 3P9KA 4XSXF 4ZZLA 2H27A 3KP7A 4OIQF 5BOXA 4U0WA 4M74A 4PZJA 3HIFA 2DK5A 3F72A 1XGMA 2DK8A 1KQ9A 3P9CA 2FNPA 2YU3A 3LAPA 2VBWA 2C6YA 1BI0A 2EWNA 3I53A 2O8XA 5DUIA 1I1GA 1J59A 4BYYA 2LKPA 3BJ6A 4EV0A 2QQAA 2Y48A 3O3KA 4HX4A 3KP6A 2QQ9A 1DP7P 2STTA 4G6QA 3KLNA 4CXFA 4HA8A 1AOYA 1UFMA 1O7FA 4BAYA 1IUYA 2A68F 5LGNA 1SD5A 2H09A 5LGTA 2P4WA 5EEGA 3PFIA 1FWZA 2O3FA 1B1BA 1EH6A 5ICEA 1XGOA 5H6QA 5JFRA 4PGHA 4HZFA 3KZZA 4EJTA 1K78A 3SHFA 4EM0B 5LGUA 2EV6A 3ISPA 2VBYA 3QP5A 1J9IA 5F6FA 5K5QA 3K69A 2FA5A 2G9WA 1HSJA 3E6MA 2QQBA 3RDIA 1XCVA 3J81Z 1KU9A 2IA2A 5BPIA 2NRAC 2VN2A 1K6OA 1S29A 2Z99A 4EVIA 3T5XA 1P6RA 4I2OA 5J6XA 1U3EM 1XN7A 2EFWA 1UHWA 2DBBA 4HDUA 4UVCA 2QENA 1EH8A 1YS6A 3H92A 1ONVA 5FO5A 4IJAA 4N9HA 2VE8A 4Z2YA 3DP7A 2HQRA 1FSEA 2VT3A 4A5MA 1UCRA 2HKOA 2YPRA 2FOKA 4MHGA 2F5CA 2CW0F 4QWQA 2E1CA 1IXRC 1P4AA 2PLYA 2XHKA 1G3YA 1NHAA 3U2RA 1OPCA 2K4JA 3E3VA 2EV5A 2OQRA 5KK1A 2M1BA 5H6RA 3HOSA 1FZPB 5CJ9A 1R7JA 1QBJA 5LEJA 2KJBA 1U6GA 1Z1DA 1U78A 1I6XA 1LQ1A 2MBFA 1BI1A 4BNCA 4A12A 3QU6A 1KA8A 4KIFA 5E18F 3TO6A 3JSPA 2ESNA 4OIOF 1FBUA 2L02A 3BJOA 3WTTC 2HYGD 4S04A 1SD4A 3Q9SA 4PDKA 3NEUA 3I71A 3FXQA 2KRFA 2EFPA 1R5GA 1BI3A 5HDKA 3ZN1A 1J75A 5DV5A 4YFKF 4G7HF 5D5XB 4HLYA 2EFQA 4ENJA 4Q47A 2CYYA 4KICA 3GVAA 4KUMA 3F22A 1ZRDA 1SFEA 1U5TB 3V8JA 3ECOA 3RPQA 3E6CC 3T8RA 5DCMB 3GX4X 2V1DA 4L5JA 3W6JB 3GZ5A 4LJZF 4BHPA 1ZHFA 3J7AO 4HX7A 1XSVA 1S7OA 1OMIA 4JK1X 1X3UA 5FGMA 3CDHA 4N0BA 3HTSB 4HBLA 4I98B 2MC3A 4RAYA 2FEZA 1FBSA 3RI4A 3BZ6A 1J2XA 4LK1F 1JHHA 2PEXA 3ML6A 1W7PB 3KE2A 1ULYA 3JAMK 5E8GA 4BH9A 2FMYA 5CLSA 1E2XA 4UNOA 1PUEE 1J5YA 3T1BA 4MQVA 5FLXZ 3FXUA 4U7DA 2CQKA 3V4GA 4CO8A 4YG2F 1BOAA 4KFCA 3ZMZA 2O61A 3WTVC 4LFUA 3RJPA 3KLOA 5TRDA 2XVCA 3KP2A 2XAFA 5H20A 4ETSA 1LB2A 5DD8A 2HQNA 1ZG3A 3PQKA 3R6SA 4IRGA 3V7RA 3QPHA 4LMYA 5CVRA 2ADUA 4ZZDA 4HDVA 2P6SA 1TQIA 4A2UA 3E6BA 5K1YA 2GWRA 1HQCA 3FF5A 1UHMA 2XUBA 1IAWA 4ASNA 1R1UA 2HYFA 2M5WA 3HUGA 5ILVA 2JZYA 2P5VA 1XDUA 4A0ZA 2FBHA 3CUOA 1XCBA 4KIGA 1FC3A 1H9TA 4UVAA 2YR2A 2R7DA 3GZ6A 1MDMA 3JTHA 5FFZA 5AIQA 2K02A 2Q0OA 3FMQA 2KJCA 2DQLA 5D5UB 3CLOA 4RGSA 1BI2A 3PQJA 3COAC 3EYYA 1O3QA 2GXBA 5EEHA 1S7AA 4UHTA 1BN5A 4XLNF 4A5NA 4ZH4F 4XRFA 4GO1A 2IT0A 2ZMEA 4QLCU 4XLPF 1IZ1A 2BBYA 5ICFA 4LGWA 2IP2A 3WE2A 4EJVA 2FMLA 3MWMA 3F6VA 1K79A 3CUQA 2IRFG 2ZFWA 4I01A 1ZREA 1HSTA 1ZYRF 2RNJA 1T0FA 3WGGA 5L3EA 2VXZA 2W57A 2M45A 3DV8A 2FE3A 1WSUA 2GA1A 4JBAA 5HVQC 2COMA 2OD5A 1HKQA 2GAUA 2EK5A 4OOIA 1RUNA 1ZARA 1MKMA 3FWEA 2L54A 1USTA 1ZG1A 3T8TA 5LLQA 3GLXA 4XSZF 2GZWA 3WE3A 5ICCA 3AAFA 4I02A 1D3YA 1Z6RA 2R7FA 1WWXA 3GO5A 1CF7A 4Q4ZF 1H0MA 2VBXA 1IN5A 3I54A 4CICA 4HQEA 3TDUC 1BJAA 3VOEA 5LHIA 2JT1A 4G6DA 4IPAA 5JR3A 1FP1D 1L0OC 2A69F 1K78B 3QPTA 2L3DA 2PMUA 1LVAA 4NB5A 2A6HF 4IHSA 4M71A 4Q5SF 3FX3A 2QYOA 3F8MA 2QUFA 1JXSA 2ESHA 2V79A 4RB0A 5ICGA 1WQ2A 1BM9A 2DQRA 4BHCA 4MEXF 2MA3A 1FYKA 4P55A 1S6LA 4ESFA 4EM1A 3FMRA 2A61A 3M9AA 5L3CA 2B0LA 3ZP5A 4CHUA 2BYVE 2UXXA 4RB3C 4A0YA 4Y15A 1F9NA 1MZBA 4FHTA 2FNAA 2LF8A 4EJUA 5DYMA 4AIJA 3OOPA 1W5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQ0 A;  3FM5 A;  2CFX A;  5L3G A;  2HEO A;  2IPQ X;  1O3R A;  4LLL A;  2XKP A;  4HLX A;  2NYX A;  1FLI A;  5E8I A;  3ELK A;  1IN4 A;  1TW3 A;  4UV9 A;  2NAZ A;  1D8K A;  2EV0 A;  2FSW A;  4ESB A;  5HS7 A;  5E20 A;  3CO7 C;  1FSH A;  2EFN A;  5D6F A;  1HKS A;  1PP7 U;  1LEB A;  4MNU A;  2F5E A;  3SZP A;  4UUV A;  2EJR A;  1WKM A;  3CJN A;  3K1M A;  2PFB A;  1USS A;  2P7C B;  4WCG A;  4HF2 A;  1CGP A;  4EQQ A;  4RGR A;  3HHH A;  4YIF A;  3D0S A;  2NS0 A;  1JHF A;  1YYV A;  2XAS A;  3SFZ A;  2FU4 A;  3ULQ B;  2P6T A;  4EM2 A;  3ZN0 A;  2LF7 A;  3TOB A;  3FZV A;  3TDZ C;  3TO7 A;  2XV4 S;  4M73 A;  4HF0 A;  4HW0 A;  3EET A;  1B6A A;  5D6E A;  1C0W A;  4FX0 A;  3KP4 A;  3BOQ A;  2ZCW A;  5J8C A;  2LDU A;  2XKO A;  4HF1 A;  2W24 A;  3MEX A;  5D8K B;  2HFH A;  2PQ8 A;  2BE5 F;  3KP3 A;  2HS5 A;  2WV0 A;  3JAM Z;  3HSR A;  4JQF A;  1R22 A;  4L0Z B;  2RDP A;  4HX8 A;  3LAJ A;  3RTR A;  1YFH A;  3F21 A;  1ZH5 A;  2O03 A;  1V3F A;  3RYP A;  4ZYD A;  2FRH A;  2QWW A;  3C7J A;  1F5T A;  4HOB A;  2VBZ A;  4MTD A;  3E5Q A;  3K2Z A;  1R00 A;  4Q48 A;  5E1W A;  1IRG A;  1B9N A;  3GF2 A;  2FXA A;  4L9V A;  3ZMD A;  4L5I A;  1T38 A;  3R60 A;  4UXN A;  3O6B B;  1U2W A;  2XRN A;  1R1T A;  1SMY F;  1G3T A;  2PN6 A;  2NNY A;  2Y75 A;  2OAZ A;  5J8F A;  1J0R A;  3RKW A;  3JSO A;  4LLN A;  5D5V B;  2QLZ A;  2D1V A;  2DFI A;  1YG2 A;  2GQQ A;  3GFJ A;  1YW7 A;  3HTU A;  5JI6 A;  4M72 A;  1HW1 A;  3R0J A;  3K1P A;  2ZNZ A;  2QBY A;  2DAO A;  2HKX A;  2V1U A;  4LG0 B;  1DPR A;  2AXL A;  4RS8 A;  5D4R A;  1KYZ A;  3GFL A;  3BPV A;  2ZBK A;  2FBI A;  3MZY A;  2LNB A;  2V9V A;  1KU2 A;  3L00 A;  1ZRF A;  4ZYH A;  2W25 A;  1DDN A;  2Z3Y A;  3ABU A;  3HSE A;  1XGS A;  1O3T A;  1D5V A;  1ZN2 A;  2VT2 A;  1S8N A;  3R0A A;  5DUK A;  4G94 A;  3P9I A;  3HRT A;  2KIU A;  3I0T A;  2VOP A;  2W85 A;  3I58 A;  4I0B A;  4AD9 A;  1H9G A;  1TBX A;  2HTS A;  4ENM A;  2GXG A;  5FD5 A;  2K86 A;  2Q8K A;  2P8T A;  4F7Z A;  2ZME B;  1R36 A;  5CVU A;  4KN4 X;  3FMS A;  2F5F A;  2GA2 A;  1SD7 A;  3SZT A;  4FT8 A;  4KMU X;  3CUQ C;  4ZYE A;  4RAZ A;  4CGZ A;  2FF4 A;  1T98 A;  2ZO4 A;  3O2P E;  1OYW A;  3SXY A;  3ECH A;  1IXS B;  3JW4 A;  3RYR A;  2STW A;  1VTN C;  2F2E A;  1ZLK A;  1P4W A;  2LSO A;  3IKV A;  2PG4 A;  4DNC A;  2UZK A;  2XAJ A;  3U9G A;  5HDN A;  4P5O A;  3BPX A;  4OIP F;  3BRO A;  3LWF A;  4D0P A;  5D5W B;  1DUX C;  3K0L A;  2WWY A;  1YW8 A;  4P96 A;  3CTA A;  5L3B A;  3GUD A;  5IT3 A;  1ZRC A;  1FY7 A;  3KEQ A;  1KQ8 A;  4CYD A;  2H6B A;  3U1D A;  3C3W A;  1QZY A;  4NHJ A;  1A04 A;  1FYL A;  4G9Y A;  2A3S A;  4WXC A;  3W6K B;  1PDN C;  2X0L A;  4H0E A;  3H3U A;  1T2K A;  2DW4 A;  3IL2 A;  5BQT A;  5BPD A;  1LDK B;  5FB2 A;  2QM3 A;  2ZXJ A;  1HXD A;  1IN7 A;  5D4S A;  1HW5 A;  3LA7 A;  1WI9 A;  1XMA A;  3WOD F;  3IKT A;  4HQM A;  4G8X A;  3KP5 A;  4AWX B;  5HDG A;  4YII A;  3C18 A;  5LBQ A;  1R1V A;  1U5T A;  4AIH A;  1TTY A;  1Y0U A;  2VC0 A;  2Q2E A;  1FBQ A;  2JRT A;  5A2Q K;  4L9J A;  2DU9 A;  4Y17 A;  2CO5 A;  1IRF A;  4K2E A;  5JHU A;  3V8L A;  1MD0 A;  3GYH X;  4HAM A;  2VE9 A;  5FD6 A;  1JE8 A;  1I27 A;  2HDC A;  2OBP A;  6PAX A;  5KVR A;  2HTJ A;  4KDP A;  1Q1H A;  3TO9 A;  1LJ9 A;  2PJP A;  4ESJ A;  1XDS A;  1ON2 A;  3KFW X;  1G6N A;  3SQN A;  3GFM A;  1RI7 A;  2RKH A;  1KYW A;  2O6G E;  5AIP A;  5BMZ A;  2ISZ A;  2E7X A;  1STZ A;  2QVO A;  3WTU C;  1GXP A;  3MZH A;  2ETH A;  1YTY A;  2F5D A;  2CGP A;  1IN6 A;  3ZMV A;  1P2F A;  5HS8 A;  4OMY A;  2W84 A;  2DLL A;  5IT9 K;  4WX9 A;  4KN7 X;  1FOK A;  2IA0 A;  4KT5 C;  5HLI A;  1HW2 A;  3QAH A;  1Z91 A;  5DCF A;  3MFK A;  3N4M A;  4WWC A;  1SFU A;  1Z9C A;  4UV8 A;  1QNT A;  4L9T A;  1P4X A;  3VFZ A;  3I59 A;  4RGU A;  1OYY A;  3L09 A;  3L9F A;  2O0Y A;  2AS5 F;  1OR7 A;  3F8N A;  2OA4 A;  1YO5 C;  1OKR A;  3LQR A;  5D8L B;  3E5X A;  4M9X A;  5DDG A;  3H3Z A;  1ZLJ A;  3MCZ A;  3K1N A;  1RIO H;  1FPQ A;  1G3S A;  3R4K A;  2EFO A;  4WK8 F;  4HV5 A;  2CG4 A;  3ZPL A;  4M9Z A;  3LQQ A;  1ODD A;  2OZU A;  1FP2 A;  3M8E A;  4AVP A;  1TW2 A;  2D45 A;  3IRR A;  2E7W A;  2A07 F;  1O3S A;  1U8R A;  5DD4 A;  4LB5 A;  2RN7 A;  1RZ4 A;  3L7W A;  2PMH A;  3LA3 A;  1KU3 A;  1T39 A;  2PBI A;  2RGV A;  1TLH B;  4IRI A;  5ILU A;  3RKX A;  3DFG A;  3J80 K;  4P9U A;  4CZZ A;  4KYW A;  5ED4 A;  4DQ2 A;  1G3W A;  1QZZ A;  1O57 A;  1TNT A;  2V6C A;  2ELH A;  2ZNY A;  2QBY B;  2HGC A;  2YX4 A;  1L3L A;  3I4P A;  2DI3 A;  4ZYG A;  5L3F A;  4IHT A;  2DPD A;  1O7L A;  4MEY F;  1F1Z A;  3VOD A;  5E1X A;  3ZMU A;  1BIB A;  2VOD A;  2MLG A;  4NQW A;  2IA1 A;  2XAQ A;  3VB2 A;  3HRS A;  5HOO A;  2L4A A;  1S3J A;  5HLH A;  3HHG A;  3HSF A;  1XSD A;  3GFI A;  2EB7 A;  2A6E F;  2WC2 A;  2BEO A;  2JTV A;  4B8X A;  3WTZ A;  4GXO A;  2G7H A;  3G73 A;  3TGN A;  2JPC A;  4PGG A;  1GVJ A;  1HBX G;  1W5T A;  3EYI A;  2BV6 A;  5K5O A;  4LK0 F;  4HYE A;  5BS6 A;  1I5Z A;  1GHC A;  1KGS A;  3IC7 A;  4O3M A;  4EGY A;  1R58 A;  3WTW C;  3VEP A;  3F8F A;  4WXH A;  3WG9 A;  1YLF A;  4R79 A;  2GIV A;  2KIF A;  5K5R A;  3F3X A;  1LDD A;  3WU0 A;  4IVN A;  2P7V B;  1T6S A;  2PI0 A;  2XRO A;  1RUO A;  3DEU A;  4R8H A;  3DPL C;  4KNY A;  4A0X A;  1ZGJ A;  2FQ3 A;  1FT9 A;  2M87 A;  4R1H A;  2EA4 A;  3BWG A;  4G7Z F;  3IWZ A;  5JVT A;  4M6Y A;  3WGH A;  2D2W A;  3DF8 A;  3GW2 A;  4O6J A;  3N97 A;  1MJ9 A;  2JPB A;  4P9F A;  1IF1 A;  2Z5U A;  5FFX A;  1SD6 A;  2E1N A;  3ZQ7 A;  3BJA A;  3DPT A;  2MH2 A;  3HOT A;  1JGS A;  2RQP A;  5ERI A;  3WGI A;  1EV7 A;  5F1R A;  4HV6 A;  3BDD A;  3E97 A;  1GXQ A;  4BXU A;  1MGT A;  2XAH A;  2KKO A;  1BC8 C;  4EJW A;  2XAG A;  3GEZ A;  1QGP A;  4RB2 C;  5E1Z B;  3FM3 A;  3M7G A;  4I7H A;  2BGC A;  1MDM B;  4GYG A;  1TNS A;  2MLK A;  2FBK A;  2M30 A;  1SFX A;  1F4K A;  4MTE A;  3GWZ A;  1U5T C;  1OYI A;  4U88 A;  3CO6 C;  1YQA A;  3GXO A;  4U0Y A;  1K7A A;  1RNL A;  2EA2 A;  5A2Q Z;  3LFK A;  3I5U A;  5HLG A;  2R3S A;  2ZJ2 A;  4G7O F;  3B02 A;  3J81 K;  1HKT A;  5LEK A;  4L9N A;  4M6X A;  3FHZ A;  1QO0 D;  1XMK A;  3CUQ B;  4E70 A;  1BBY A;  1YW9 A;  3F8C A;  5LRS A;  4O5V A;  2VC1 A;  3HRM A;  3D5L A;  3DKW A;  5LHH A;  4MQ9 F;  4S05 A;  3ZMS A;  1B4A A;  2HOE A;  3RIR A;  3V7C A;  1BIA A;  1REP C;  1XSX A;  2DPU A;  3KCC A;  3QP6 A;  4M9S A;  1Z6T A;  1DPU A;  4EMS A;  5F64 A;  3TKY A;  2DTR A;  1FYM A;  2RVC A;  4L0Y B;  3QU3 A;  1LNW A;  3FXR A;  5IT9 Z;  1PP8 F;  1SAX A;  2L4M A;  3LA2 A;  3TOA A;  2HWV A;  3IWF A;  4IF4 A;  5CVV A;  4YFX F;  1CF7 B;  1ON1 A;  3QRF F;  2WTE A;  3V7S A;  1LEA A;  4ENK A;  2UWM A;  4CDG A;  3REO A;  4YFN F;  2L01 A;  4IRH A;  2UXN A;  3M8F A;  3L2C A;  1B9M A;  1W7P D;  3ROU A;  1G4D A;  3MAJ A;  1XB4 A;  1XD7 A;  4FX4 A;  2JSC A;  3I59 B;  1QPM A;  1W4M A;  4I0A A;  5CVJ A;  3V8K A;  4LG0 A;  2OQG A;  2IVM A;  2G7U A;  2X4H A;  2ZKZ A;  4RGX A;  1UB9 A;  2J5O A;  2M8E A;  1QQI A;  1J7K A;  4B09 A;  2YX7 A;  4EJO A;  1MJA A;  3E6D A;  3ZMT A;  3RKY A;  2K4B A;  4OU0 A;  2H6C A;  3WTS C;  4UVB A;  3BY6 A;  2DO7 A;  1V4R A;  2NNN A;  2H94 A;  2MH9 A;  1Z05 A;  5L3D A;  2Z33 A;  2K7L A;  1BC7 C;  1R23 A;  5DCM A;  4AIK A;  3EQL F;  1FNN A;  1B59 A;  1ZGA A;  1TQM A;  3BP8 A;  1Z7U A;  3G3Z A;  3OV8 A;  3WTY C;  4PCQ A;  5ILS A;  1TQP A;  4U0V A;  2CSO A;  3T0Y A;  4IXA A;  4GYI A;  4MGR A;  4LB6 B;  3JTG A;  2HR3 A;  4L18 B;  2YSR A;  5CVI A;  1IN8 A;  2A5Y B;  3KET A;  2OZ6 A;  3EUH A;  4GGG A;  3J80 Z;  4KMF A;  2P5K A;  4BQA A;  4Y13 A;  4A6D A;  1AWC A;  1YIO A;  2Z9O A;  2XIG A;  2CWE A;  5AON A;  1W7P A;  2TDX A;  5LRR A;  2VON A;  1KQ0 A;  4KIB A;  3E5U A;  2KIM A;  3B73 A;  4ON0 A;  3QOP A;  4OIR F;  2IW5 A;  3K9T A;  2IJL A;  3DXJ F;  5TJJ A;  1I1S A;  1E17 A;  2J5P A;  1FX7 A;  4WXD A;  1WRJ A;  3IRQ A;  2XGX A;  3Q9V A;  3ABT A;  1ZG5 A;  4EGZ A;  3DQV C;  5FLX K;  2P5L C;  4LLG F;  4TV7 A;  3S2W A;  1SMT A;  3NQO A;  1MJB A;  2V1X A;  1P92 A;  2D1H A;  3F6O A;  3HYI A;  2ISY A;  5CYV A;  3F8B A;  3NRV A;  4U7B A;  1XGN A;  3EDP A;  4WF2 A;  3WU1 B;  1YS7 A;  5E17 F;  2DT5 A;  5LHG A;  5HS9 A;  4OIN F;  3C1D A;  3IHU A;  3I64 A;  1IXC A;  2K27 A;  4OMZ A;  3WTX C;  2QZ8 A;  4RB1 A;  3RPU A;  1IW7 F;  3HRU A;  1R5H A;  4ENN A;  5DEQ A;  1EH7 A;  2VOO A;  3KEO A;  3M1E A;  2ACJ A;  4LD5 A;  1ZAO A;  2RV8 A;  4KA4 A;  4GCV A;  1LDJ A;  4BHB A;  4N9I A;  2HZT A;  2MD5 A;  4I09 A;  1KU7 A;  3Q5F A;  3R61 A;  3P7N A;  4XBF A;  3F23 A;  3LST A;  3TQN A;  1D8J A;  2RC4 A;  3KZY A;  3ERE D;  4A6E A;  2Y0M A;  2OU2 A;  3P9K A;  4XSX F;  4ZZL A;  2H27 A;  3KP7 A;  4OIQ F;  5BOX A;  4U0W A;  4M74 A;  4PZJ A;  3HIF A;  2DK5 A;  3F72 A;  1XGM A;  2DK8 A;  1KQ9 A;  3P9C A;  2FNP A;  2YU3 A;  3LAP A;  2VBW A;  2C6Y A;  1BI0 A;  2EWN A;  3I53 A;  2O8X A;  5DUI A;  1I1G A;  1J59 A;  4BYY A;  2LKP A;  3BJ6 A;  4EV0 A;  2QQA A;  2Y48 A;  3O3K A;  4HX4 A;  3KP6 A;  2QQ9 A;  1DP7 P;  2STT A;  4G6Q A;  3KLN A;  4CXF A;  4HA8 A;  1AOY A;  1UFM A;  1O7F A;  4BAY A;  1IUY A;  2A68 F;  5LGN A;  1SD5 A;  2H09 A;  5LGT A;  2P4W A;  5EEG A;  3PFI A;  1FWZ A;  2O3F A;  1B1B A;  1EH6 A;  5ICE A;  1XGO A;  5H6Q A;  5JFR A;  4PGH A;  4HZF A;  3KZZ A;  4EJT A;  1K78 A;  3SHF A;  4EM0 B;  5LGU A;  2EV6 A;  3ISP A;  2VBY A;  3QP5 A;  1J9I A;  5F6F A;  5K5Q A;  3K69 A;  2FA5 A;  2G9W A;  1HSJ A;  3E6M A;  2QQB A;  3RDI A;  1XCV A;  3J81 Z;  1KU9 A;  2IA2 A;  5BPI A;  2NRA C;  2VN2 A;  1K6O A;  1S29 A;  2Z99 A;  4EVI A;  3T5X A;  1P6R A;  4I2O A;  5J6X A;  1U3E M;  1XN7 A;  2EFW A;  1UHW A;  2DBB A;  4HDU A;  4UVC A;  2QEN A;  1EH8 A;  1YS6 A;  3H92 A;  1ONV A;  5FO5 A;  4IJA A;  4N9H A;  2VE8 A;  4Z2Y A;  3DP7 A;  2HQR A;  1FSE A;  2VT3 A;  4A5M A;  1UCR A;  2HKO A;  2YPR A;  2FOK A;  4MHG A;  2F5C A;  2CW0 F;  4QWQ A;  2E1C A;  1IXR C;  1P4A A;  2PLY A;  2XHK A;  1G3Y A;  1NHA A;  3U2R A;  1OPC A;  2K4J A;  3E3V A;  2EV5 A;  2OQR A;  5KK1 A;  2M1B A;  5H6R A;  3HOS A;  1FZP B;  5CJ9 A;  1R7J A;  1QBJ A;  5LEJ A;  2KJB A;  1U6G A;  1Z1D A;  1U78 A;  1I6X A;  1LQ1 A;  2MBF A;  1BI1 A;  4BNC A;  4A12 A;  3QU6 A;  1KA8 A;  4KIF A;  5E18 F;  3TO6 A;  3JSP A;  2ESN A;  4OIO F;  1FBU A;  2L02 A;  3BJO A;  3WTT C;  2HYG D;  4S04 A;  1SD4 A;  3Q9S A;  4PDK A;  3NEU A;  3I71 A;  3FXQ A;  2KRF A;  2EFP A;  1R5G A;  1BI3 A;  5HDK A;  3ZN1 A;  1J75 A;  5DV5 A;  4YFK F;  4G7H F;  5D5X B;  4HLY A;  2EFQ A;  4ENJ A;  4Q47 A;  2CYY A;  4KIC A;  3GVA A;  4KUM A;  3F22 A;  1ZRD A;  1SFE A;  1U5T B;  3V8J A;  3ECO A;  3RPQ A;  3E6C C;  3T8R A;  5DCM B;  3GX4 X;  2V1D A;  4L5J A;  3W6J B;  3GZ5 A;  4LJZ F;  4BHP A;  1ZHF A;  3J7A O;  4HX7 A;  1XSV A;  1S7O A;  1OMI A;  4JK1 X;  1X3U A;  5FGM A;  3CDH A;  4N0B A;  3HTS B;  4HBL A;  4I98 B;  2MC3 A;  4RAY A;  2FEZ A;  1FBS A;  3RI4 A;  3BZ6 A;  1J2X A;  4LK1 F;  1JHH A;  2PEX A;  3ML6 A;  1W7P B;  3KE2 A;  1ULY A;  3JAM K;  5E8G A;  4BH9 A;  2FMY A;  5CLS A;  1E2X A;  4UNO A;  1PUE E;  1J5Y A;  3T1B A;  4MQV A;  5FLX Z;  3FXU A;  4U7D A;  2CQK A;  3V4G A;  4CO8 A;  4YG2 F;  1BOA A;  4KFC A;  3ZMZ A;  2O61 A;  3WTV C;  4LFU A;  3RJP A;  3KLO A;  5TRD A;  2XVC A;  3KP2 A;  2XAF A;  5H20 A;  4ETS A;  1LB2 A;  5DD8 A;  2HQN A;  1ZG3 A;  3PQK A;  3R6S A;  4IRG A;  3V7R A;  3QPH A;  4LMY A;  5CVR A;  2ADU A;  4ZZD A;  4HDV A;  2P6S A;  1TQI A;  4A2U A;  3E6B A;  5K1Y A;  2GWR A;  1HQC A;  3FF5 A;  1UHM A;  2XUB A;  1IAW A;  4ASN A;  1R1U A;  2HYF A;  2M5W A;  3HUG A;  5ILV A;  2JZY A;  2P5V A;  1XDU A;  4A0Z A;  2FBH A;  3CUO A;  1XCB A;  4KIG A;  1FC3 A;  1H9T A;  4UVA A;  2YR2 A;  2R7D A;  3GZ6 A;  1MDM A;  3JTH A;  5FFZ A;  5AIQ A;  2K02 A;  2Q0O A;  3FMQ A;  2KJC A;  2DQL A;  5D5U B;  3CLO A;  4RGS A;  1BI2 A;  3PQJ A;  3COA C;  3EYY A;  1O3Q A;  2GXB A;  5EEH A;  1S7A A;  4UHT A;  1BN5 A;  4XLN F;  4A5N A;  4ZH4 F;  4XRF A;  4GO1 A;  2IT0 A;  2ZME A;  4QLC U;  4XLP F;  1IZ1 A;  2BBY A;  5ICF A;  4LGW A;  2IP2 A;  3WE2 A;  4EJV A;  2FML A;  3MWM A;  3F6V A;  1K79 A;  3CUQ A;  2IRF G;  2ZFW A;  4I01 A;  1ZRE A;  1HST A;  1ZYR F;  2RNJ A;  1T0F A;  3WGG A;  5L3E A;  2VXZ A;  2W57 A;  2M45 A;  3DV8 A;  2FE3 A;  1WSU A;  2GA1 A;  4JBA A;  5HVQ C;  2COM A;  2OD5 A;  1HKQ A;  2GAU A;  2EK5 A;  4OOI A;  1RUN A;  1ZAR A;  1MKM A;  3FWE A;  2L54 A;  1UST A;  1ZG1 A;  3T8T A;  5LLQ A;  3GLX A;  4XSZ F;  2GZW A;  3WE3 A;  5ICC A;  3AAF A;  4I02 A;  1D3Y A;  1Z6R A;  2R7F A;  1WWX A;  3GO5 A;  1CF7 A;  4Q4Z F;  1H0M A;  2VBX A;  1IN5 A;  3I54 A;  4CIC A;  4HQE A;  3TDU C;  1BJA A;  3VOE A;  5LHI A;  2JT1 A;  4G6D A;  4IPA A;  5JR3 A;  1FP1 D;  1L0O C;  2A69 F;  1K78 B;  3QPT A;  2L3D A;  2PMU A;  1LVA A;  4NB5 A;  2A6H F;  4IHS A;  4M71 A;  4Q5S F;  3FX3 A;  2QYO A;  3F8M A;  2QUF A;  1JXS A;  2ESH A;  2V79 A;  4RB0 A;  5ICG A;  1WQ2 A;  1BM9 A;  2DQR A;  4BHC A;  4MEX F;  2MA3 A;  1FYK A;  4P55 A;  1S6L A;  4ESF A;  4EM1 A;  3FMR A;  2A61 A;  3M9A A;  5L3C A;  2B0L A;  3ZP5 A;  4CHU A;  2BYV E;  2UXX A;  4RB3 C;  4A0Y A;  4Y15 A;  1F9N A;  1MZB A;  4FHT A;  2FNA A;  2LF8 A;  4EJU A;  5DYM A;  4AIJ A;  3OOP A;  1W5S A; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  3FM5 A;  2CFX A;  5L3G A;  2HEO A;  4XKC A;  2IPQ X;  1UEL B;  1O3R A;  4LLL A;  4JOM A;  2XKP A;  4HLX A;  2NYX A;  1FLI A;  2E5N A;  5E8I A;  1RR7 A;  4HRI A;  4F91 B;  1VQ6 I;  3ELK A;  4AUX A;  1IO2 A;  2DMT A;  3DTE A;  5F0C A;  1IN4 A;  2BVL A;  3HL2 A;  4BAC A;  4A3L J;  1TW3 A;  2XF5 A;  4UV9 A;  2NAZ A;  1D8K A;  1JTY A;  2X6Y A;  1I50 J;  2EV0 A;  2FSW A;  4ESB A;  4XLE A;  5K7H A;  4E7S A;  5HS7 A;  4BY1 J;  5E20 A;  3CO7 C;  4XR6 A;  2BY1 A;  2R5Y A;  4RAF A;  4C30 A;  1FSH A;  1X58 A;  4BDZ A;  2E1M B;  2EFN A;  5D6F A;  1HKS A;  1PP7 U;  1LEB A;  4MNU A;  1MSF C;  2F5E A;  3SZP A;  1LVK A;  4UUV A;  1DGW Y;  2EJR A;  1X1D A;  2I10 A;  1WKM A;  2F5V A;  3CJN A;  3RCO A;  1MMN A;  3K1M A;  1ZKG A;  2PFB A;  5KCM A;  4RBO A;  3JRI A;  1USS A;  2PMZ N;  2P7C B;  1S7E A;  2PMZ A;  5J1U A;  1YIT I;  1SC7 A;  1W0U A;  1ZK8 A;  2DJI A;  4M3B A;  4WCG A;  3W2A A;  4HF2 A;  1UZC A;  1OCT C;  2NVX J;  1CGP A;  4EQQ A;  2R7U A;  3OWT A;  1RES A;  4RGR A;  4D5C A;  3HHH A;  4YIF A;  3D0S A;  1JKR C;  2NS0 A;  1HCR A;  1JHF A;  3LFU A;  1YYV A;  2XAS A;  1JUP A;  3SFZ A;  5C44 J;  1AKH A;  2QCO A;  3JCU C;  1VI0 A;  2FU4 A;  1WH5 A;  5JVG F;  3ULQ B;  2DT7 B;  2P6T A;  4EM2 A;  3ZN0 A;  1VQ5 I;  2LF7 A;  3TOB A;  3FZV A;  4DZP A;  2LD5 A;  3TDZ C;  4GDF A;  1IDY A;  3HXL A;  3TO7 A;  2M2E A;  2XV4 S;  1TZL A;  3QWL A;  3BTC A;  4M73 A;  3AL0 B;  3DKX A;  4U87 A;  4HF0 A;  4CYC A;  4HW0 A;  4KIS A;  3EET A;  1B6A A;  5D6E A;  1QHG A;  1C0W A;  3LSR A;  3OYF A;  4FX0 A;  2PX9 A;  3KP4 A;  2JA7 J;  2EIN H;  5M5W J;  2NVY J;  3BOQ A;  1YIJ I;  2HOT A;  2ZCW A;  1OIS A;  3W2V A;  5J8C A;  2LDU A;  4PJM A;  4Y4R A;  3ZRG A;  2XKO A;  3ASO H;  4HF1 A;  2W24 A;  2K5C A;  5CQE A;  3MEX A;  5D8K B;  2HFH A;  2PQ8 A;  2BE5 F;  3KP3 A;  4BDY A;  2HS5 A;  2NVU B;  4AU7 A;  2WV0 A;  4BXF A;  3JAM Z;  3HSR A;  3HB9 A;  1SVO A;  4AYB N;  4JQF A;  4AYB A;  5DM7 F;  3GBG A;  1R22 A;  3AG3 H;  4L0Z B;  2LK2 A;  2RDP A;  4HX8 A;  3LAJ A;  3M4O J;  3RTR A;  1YFH A;  3F21 A;  1ZH5 A;  2O03 A;  1V3F A;  3KZI C;  2RAE A;  3ZR8 X;  3ZQI A;  2BW3 A;  3RYP A;  2CQQ A;  3S3M A;  3DKY A;  2Y30 A;  2JWT A;  4ZYD A;  2FRH A;  2QWW A;  3C7J A;  2GIZ A;  2LLK A;  1F5T A;  2JA6 J;  3DLA A;  2K40 A;  4BGD A;  5H2F C;  4HOB A;  3BR6 A;  2VBZ A;  1DQU A;  4MTD A;  3QQA A;  3E5Q A;  1R71 A;  3K2Z A;  1R00 A;  3CMA I;  1NG6 A;  4Q48 A;  5E1W A;  2IS2 A;  1IG7 A;  1IRG A;  1B9N A;  3BCB A;  3GF2 A;  2WAQ N;  4C3J J;  2FXA A;  2RNG A;  2WAQ A;  1JTX A;  4L9V A;  3ZMD A;  4L5I A;  5GAD J;  1T38 A;  2FJ1 A;  3BR5 A;  2DTZ A;  2V6E A;  3R60 A;  1NK2 P;  3OS1 A;  2DA1 A;  4UXN A;  3O6B B;  3HKZ N;  3S1M J;  1U2W A;  2XRN A;  1R1T A;  3HKZ A;  1SMY F;  1G3T A;  2PN6 A;  3K6G A;  2NNY A;  2Y75 A;  2OAZ A;  1P7I A;  5FRN A;  3G1M A;  3C2H A;  5J8F A;  1J0R A;  3RKW A;  3JSO A;  4LLN A;  5D5V B;  2QLZ A;  2DA7 A;  2D1V A;  2DFI A;  1OCO H;  4M3D A;  1YG2 A;  2GQQ A;  3F0C A;  3OIQ A;  2YUS A;  3GFJ A;  4RAG A;  1YW7 A;  3A2K A;  3HTU A;  3BR2 A;  5JI6 A;  4M72 A;  4A3F J;  1O4X A;  2IS4 A;  2WAD A;  1Z3X A;  1HW1 A;  4IO9 F;  2CUE A;  3R0J A;  3K1P A;  4XRS A;  2GLO A;  2ZNZ A;  2QBY A;  2DAO A;  2HKX A;  2V1U A;  4LG0 B;  1DPR A;  2R5Z B;  3JRD A;  2AXL A;  4DYR A;  2M7A A;  3A0B C;  3DCF A;  2V7F A;  4RS8 A;  2E34 A;  5LFA A;  5D4R A;  1KYZ A;  3GFL A;  3BPV A;  1OJL A;  1Y0N A;  2ZBK A;  2FBI A;  2VI6 A;  3MZY A;  3CCR I;  2LNB A;  1BL0 A;  2V9V A;  1HDD C;  1V5E A;  3PO2 J;  4XID A;  4XOT A;  2VPL A;  3AFH A;  1KU2 A;  3L00 A;  5EG0 B;  1X3Z B;  3DBR B;  1ZRF A;  4ZYH A;  3A01 A;  1WJC A;  1X19 A;  3CF5 F;  2W25 A;  2HPM A;  1DDN A;  2Z3Y A;  2CW8 A;  3M3Y J;  3ABU A;  3HSE A;  2G0E A;  4V19 K;  3MVP A;  1XGS A;  2IXS A;  1VQM I;  1O3T A;  1D5V A;  1ZN2 A;  3MKW B;  2VT2 A;  1S8N A;  3R0A A;  5DUK A;  4G94 A;  1RR8 C;  2EZL A;  4MFE A;  3P9I A;  3ZQF A;  3CD6 I;  3HRT A;  4G12 A;  3ERM A;  2KIU A;  2UUZ A;  3I0T A;  1MMS A;  1MBF A;  3DEE A;  2VOP A;  2W85 A;  3I58 A;  4I0B A;  1WJ5 A;  4AD9 A;  1ETY A;  1H9G A;  1LPQ A;  3DEW A;  1GLN A;  1TBX A;  1IRZ A;  2HTS A;  4ENM A;  2GXG A;  3GCM A;  5FD5 A;  4PK4 A;  2K86 A;  3KYD B;  3OYB A;  5HLT A;  2Q8K A;  1D5Y A;  2P8T A;  4F7Z A;  2ZME B;  1R36 A;  5CVU A;  3CCJ I;  4KN4 X;  3PNT A;  1MMG A;  2JA5 J;  4QSH A;  2KHM A;  1SAU A;  3FMS A;  3S15 J;  2QA4 I;  1YRN A;  4E7J A;  2F5F A;  2GA2 A;  1SD7 A;  2E36 A;  2WB1 N;  3SZT A;  3HOY J;  2WB1 A;  1X1B A;  4JX4 A;  4FT8 A;  4KMU X;  3CUQ C;  3MN2 A;  4ZYE A;  4RAZ A;  4CGZ A;  4V2G A;  2FF4 A;  1T98 A;  2ZO4 A;  3O2P E;  1OYW A;  2V26 A;  1T0F C;  3SXY A;  3ECH A;  1IXS B;  3JW4 A;  4UUS A;  4IHX A;  1N25 A;  3RYR A;  2STW A;  3ZGK A;  2XPV A;  4OAZ A;  1UJ8 A;  1QPI A;  1VTN C;  2F2E A;  2IBD A;  1P4W A;  1ZLK A;  2LSO A;  3IKV A;  1FIP A;  3H36 A;  2PG4 A;  3L2Q A;  3I4M J;  1K61 A;  4DNC A;  1TT5 B;  2X51 A;  2UZK A;  2XAJ A;  3U9G A;  1WCM J;  4XLA A;  5HDN A;  3ZOB A;  2LBF B;  2OUM A;  4P5O A;  3BPX A;  5GPC A;  4OIP F;  3OYI A;  5J3L A;  1H89 C;  3BRO A;  3LWF A;  4D0P A;  5D5W B;  3SDG A;  4JYK A;  4F55 A;  1XG1 A;  4X6A J;  1DUX C;  3K0L A;  2WWY A;  1YW8 A;  2KT0 A;  4P96 A;  3CTA A;  3GME A;  5L3B A;  1JKO C;  4BJT A;  4HNU A;  3OYM A;  1YJW I;  4Y33 A;  3RSN A;  3GUD A;  5IT3 A;  3HJE A;  1ZRC A;  4QPO A;  1FY7 A;  3KEQ A;  2HVR A;  3OR2 C;  1KQ8 A;  4UUT A;  4XOR A;  4CYD A;  2H6B A;  2NXN B;  3U1D A;  1Y39 A;  3C3W A;  3PUB A;  1QZY A;  3QPS A;  4PUS A;  5K7F A;  4II3 A;  3PM1 A;  1PUF A;  1F36 A;  5GTH C;  5CQG A;  1W5S A;  4IOA F;  3H0G J;  2Y9Z A;  1P7J A;  4W97 A;  4NHJ A;  2HDD A;  1A04 A;  1FYL A;  4M3G A;  4G9Y A;  2A3S A;  4WXC A;  2BOL A;  5GAG J;  2EH3 A;  3W6K B;  2LFB A;  1FJL A;  1R4M B;  1N75 A;  1PDN C;  1YJN I;  2X0L A;  3RZO J;  1MMD A;  3H9G A;  4H0E A;  3H3U A;  1T2K A;  2DW4 A;  2AXT C;  2Q1Z B;  2OC6 A;  1ZR4 A;  1LUJ B;  4HG2 A;  5BQT A;  3IL2 A;  5BPD A;  2I5U A;  1LDK B;  4XL9 A;  5FB2 A;  2QM3 A;  2XB0 X;  2ZXJ A;  1HXD A;  1Z0X A;  5F27 A;  5DM6 F;  1OCC H;  2DA4 A;  3K4M A;  3MMY B;  1IN7 A;  5D4S A;  3A4C A;  1HW5 A;  3LA7 A;  3K7A J;  4XLF A;  1WI9 A;  1XMA A;  3WOD F;  1GDT A;  4E7K A;  2XPW A;  1I3A A;  2YU9 J;  3IKT A;  1I6H J;  2K3F A;  4HQM A;  4G8X A;  3KP5 A;  4AWX B;  5HDG A;  4YII A;  3C18 A;  4ZDL A;  4AVZ A;  5LBQ A;  1R1V A;  1U5T A;  4AIH A;  1TTY A;  2NOJ B;  2AHQ A;  1Y0U A;  2EIK H;  1ZEL A;  2VC0 A;  3BTJ A;  2Q2E A;  1FBQ A;  2JRT A;  5EYR A;  3CLQ A;  5A2Q K;  2ZJP F;  2MW8 A;  4L9J A;  5LD2 C;  2DU9 A;  2HNH A;  4Y17 A;  1JJ8 C;  3NWS A;  3OY9 A;  1VND A;  4CUG A;  2CO5 A;  2AO9 A;  1IRF A;  4K2E A;  5JHU A;  3V8L A;  1IV8 A;  4YRV A;  1MD0 A;  1NH3 A;  3Q0W A;  3GYH X;  4HAM A;  2VE9 A;  5FD6 A;  1JE8 A;  1D1A A;  1I27 A;  1GV2 A;  2HDC A;  3I4N J;  2OBP A;  3G1O A;  6PAX A;  3JRG A;  5KVR A;  2HTJ A;  4KDP A;  1CQT A;  1Q1H A;  3TO9 A;  1LJ9 A;  2L5Q A;  1YX3 A;  1T8I A;  4C2M J;  1TL8 A;  2PJP A;  4ESJ A;  1XDS A;  4QIW N;  1ON2 A;  3SEZ A;  4GFB A;  3KFW X;  1G6N A;  3SQN A;  3GFM A;  4LIT A;  1RI7 A;  4FAS D;  5C3E J;  3S1R J;  2XSD C;  2RKH A;  1KYW A;  2DOF A;  3K4J A;  1MH4 A;  3PSF A;  4ABZ A;  5AIP A;  2O6G E;  5BMZ A;  2MD0 A;  3BT9 A;  5F1J A;  3F9K A;  2ISZ A;  2E7X A;  1STZ A;  2R5Y B;  1X2N A;  2QVO A;  3RQI A;  1OCR H;  3WTU C;  1GXP A;  3GTM J;  2XB5 A;  5TIS C;  5E3O A;  3MZH A;  2ETH A;  2E60 A;  1YTY A;  2F5D A;  1R4N B;  2CGP A;  1IN6 A;  3ZMV A;  4ZTF A;  1P2F A;  3OMY A;  2MG4 A;  5HS8 A;  4OMY A;  3W2W A;  2QKL B;  2BHZ A;  2TCT A;  3K4N A;  4DJA A;  2W84 A;  5GAE J;  2DLL A;  2NOG A;  5IT9 K;  4WX9 A;  5FJ8 J;  3LL7 A;  4KN7 X;  1FOK A;  2IA0 A;  4KT5 C;  5HLI A;  2R7Z J;  4ZJZ A;  1HW2 A;  3QAH A;  2DYS H;  2EPF A;  1AKH B;  1Z91 A;  3NWT A;  2M3A A;  5DCF A;  3WU2 C;  1Y1V J;  3MFK A;  3N4M A;  4WWC A;  1SFU A;  3BG7 A;  2E2H J;  3G1L A;  1WH7 A;  1Z9C A;  4UV8 A;  2IS1 A;  2HOA A;  4IEJ A;  1IUF A;  1QNT A;  4L9T A;  5IOZ A;  1P4X A;  3VFZ A;  3I59 A;  4BU2 A;  2K85 A;  4CSW A;  4RGU A;  1OYY A;  3L09 A;  3L9F A;  3N05 A;  4CYC B;  5IY5 H;  2O0Y A;  2AS5 F;  3CC4 I;  1OR7 A;  1XTA A;  4XKB A;  1FMV A;  1A31 A;  3F8N A;  5IYD J;  2OA4 A;  3H1C A;  3EPZ A;  2ZXH A;  1YO5 C;  4QPQ A;  4Y7N J;  1OKR A;  3LQR A;  2DMN A;  5D8L B;  2CJJ A;  2KIS A;  1HLV A;  1VQN I;  1W36 C;  3E5X A;  2IGN A;  1Y8Q B;  1X4O A;  4IL6 C;  4M9X A;  3SJM A;  3M8J A;  2CQX A;  2DMP A;  5DDG A;  2DMU A;  3H3Z A;  1ZLJ A;  2H1L A;  3MCZ A;  3K1N A;  2VKH A;  1M1E B;  1XX5 A;  1RIO H;  1FPQ A;  3ABL H;  1Z21 A;  1G3S A;  3R4K A;  2EFO A;  5DS9 A;  3OYH A;  3EUK L;  4XOP A;  4WK8 F;  2JVG A;  4HV5 A;  2CG4 A;  1QA6 A;  4A3B J;  2Z16 A;  3ZPL A;  2CUF A;  4M9Z A;  1TT0 A;  3LQQ A;  1ODD A;  2OZU A;  2E2I J;  1FP2 A;  2OCE A;  3M8E A;  4AVP A;  1TW2 A;  2D45 A;  4NC7 A;  5EGO A;  1LKX A;  2BW3 B;  3GLL A;  5HNF A;  1NG7 A;  2BXY A;  3IRR A;  2E7W A;  4IX7 A;  2A07 F;  1O3S A;  2R7W A;  5DD4 A;  1U8R A;  2A05 A;  3S3O A;  1RC9 A;  2LRE A;  2VQC A;  4LB5 A;  2EQR A;  2RN7 A;  2LY9 A;  3L2R A;  1H88 C;  3QYF A;  4C3H J;  1RZ4 A;  3L7W A;  4HEA 2;  4I76 A;  1TP4 A;  1V55 H;  5F0H A;  2PMH A;  2O8K A;  3LA3 A;  1KU3 A;  3B6C A;  1T39 A;  2PBI A;  3LSP A;  2RGV A;  1TLH B;  4IRI A;  1IGN A;  5EEA A;  5FLM J;  5ILU A;  1YX5 A;  3RKX A;  4HST A;  3DFG A;  1BR1 A;  3HZJ A;  3J80 K;  5J47 A;  4P9U A;  2VKD A;  2LKS A;  1W36 D;  4CZZ A;  2MFZ A;  4KYW A;  5ED4 A;  4NUB A;  4DQ2 A;  2W82 A;  4LG3 A;  5EF6 A;  1G3W A;  3RQ4 A;  1QZZ A;  4H4K C;  1Y6I A;  1IDZ A;  5JLW A;  2R7T A;  3KX2 A;  2XAU A;  5HOD A;  3L2U A;  4YIR X;  2ZNY A;  1O57 A;  1TNT A;  2ELH A;  2V6C A;  3TW7 A;  2QBY B;  2HGC A;  5M5Y J;  3UNG C;  3G6E I;  2YX4 A;  1L3L A;  3I4P A;  1FTT A;  2DI3 A;  1GVD A;  3VDX A;  4NDL A;  4ZYG A;  1X3W B;  5L3F A;  2DPD A;  2TRT A;  4IHT A;  1O7L A;  1A35 A;  4MEY F;  1F1Z A;  3VOD A;  1LE8 A;  2R7V A;  5E1X A;  4X1E A;  3ZMU A;  1BIB A;  2MC4 A;  2X6O A;  2VOD A;  2MLG A;  3Q0V A;  4NQW A;  2F4O B;  1D0X A;  2K3P A;  2HOS A;  2IA1 A;  1B8I A;  2XAQ A;  3VB2 A;  3HRS A;  3H9J A;  1K83 J;  1V5F A;  3TP0 A;  3BG3 A;  5HOO A;  2L4A A;  4B1R A;  5FRM A;  3ONQ A;  1S3J A;  2HZD A;  5HLH A;  2B63 J;  3HHG A;  4S0H B;  3HSF A;  3OSG A;  1XSD A;  3GFI A;  2EB7 A;  2A6E F;  2WC2 A;  2BEO A;  2JTV A;  2DDB A;  2JJ7 A;  4B8X A;  3GTP J;  5B1A H;  3WTZ A;  2VIX A;  3E0J B;  5CKT A;  4GXO A;  2G7H A;  3G73 A;  3TGN A;  2QGU A;  1XMX A;  2JPC A;  5IPA A;  4PGG A;  3DPU A;  2KFD A;  1YRN B;  1GVJ A;  1HBX G;  4EAT A;  1W5T A;  2F6C A;  2HQA A;  3EYI A;  3HOV J;  2BV6 A;  5K5O A;  1HC8 A;  1GV5 A;  4LK0 F;  4HYE A;  5BS6 A;  2DYR H;  4CCN A;  1I5Z A;  1TWG J;  1GHC A;  1KGS A;  1APL C;  3TMO A;  3BR3 A;  3GTJ J;  4XMY A;  3CCS I;  3IC7 A;  4O3M A;  4BY7 J;  3HGY A;  4EGY A;  2O5R A;  1R58 A;  1MBJ A;  4NC8 A;  2VJI A;  2HYJ A;  3WTW C;  3VEP A;  3F8F A;  4WXH A;  3WG9 A;  1YLF A;  4R79 A;  1JI8 A;  2KMU A;  2R93 J;  2GIV A;  2CU7 A;  2KIF A;  1WVR A;  4C2U A;  5K5R A;  3F3X A;  1LDD A;  1V5G A;  3WU0 A;  2NVT J;  4IVN A;  2O9L A;  2P7V B;  4OWR B;  3IH4 A;  2HXO A;  1T6S A;  4OAY A;  3JRC A;  2PI0 A;  3FIS A;  3TW6 A;  2XRO A;  1RUO A;  3DEU A;  3DU6 A;  4R8H A;  4LIU A;  3DPL C;  1MW7 A;  1ZR2 A;  5IP9 J;  4KNY A;  1GUU A;  2CMP A;  5BNG A;  3K2A A;  3I3L A;  5C4X J;  4A0X A;  4B43 A;  1ZGJ A;  1ETO A;  3IV5 A;  2FQ3 A;  1FT9 A;  2L0K A;  2M87 A;  4EEF G;  4R1H A;  2EA4 A;  4RA2 A;  3BWG A;  4JX6 A;  4G7Z F;  3IWZ A;  2ECB A;  2ZC2 A;  1Q1V A;  4M6Y A;  3WGH A;  5JVT A;  2D2W A;  3DF8 A;  3GW2 A;  4O6J A;  3N97 A;  1UMQ A;  1MJ9 A;  2JPB A;  4P9F A;  1SEU A;  1IF1 A;  1MIJ A;  2Z5U A;  5FFX A;  2R7O A;  3BC8 A;  1SD6 A;  2E1N A;  4RLQ A;  3ZQ7 A;  3BG9 A;  1PUF B;  1R9T J;  3FHN A;  3LSM A;  3LSJ A;  3BJA A;  3FK6 A;  4ANJ A;  3DPT A;  4BE1 A;  1OCP A;  2MH2 A;  4A3J J;  2R7R A;  3HOT A;  1JGS A;  1T95 A;  2RQP A;  3PL8 A;  2GBY A;  5ERI A;  3WGI A;  1EV7 A;  2JK3 A;  5F1R A;  4A3K J;  4HV6 A;  2VQL A;  3HUG B;  3S1Q J;  2KDO A;  3BDD A;  3E97 A;  1GXQ A;  1MNE A;  4UB6 C;  5GTI C;  4BXU A;  1MGT A;  2XAH A;  2KKO A;  1BC8 C;  4EJW A;  2XAG A;  3GEZ A;  1QGP A;  5FKO A;  1U8B A;  3S93 A;  4RB2 C;  3M1C A;  3HOZ J;  5E1Z B;  5J1Y A;  3FM3 A;  3M7G A;  4I7H A;  2BGC A;  1MDM B;  4GYG A;  4W1U A;  1V54 H;  1TNS A;  2MLK A;  4J19 A;  1X1P A;  3WHC A;  2FBK A;  2M30 A;  1WHU A;  3H5R A;  2K9S A;  2E35 A;  4BBS J;  5DTD A;  3K10 A;  4XQF A;  2Y0S N;  1W0T A;  2Y0S A;  1SFX A;  2ID6 A;  1F4K A;  5HNH A;  2LOO A;  1YE9 A;  4MTE A;  1Y1W J;  1WJB A;  3GWZ A;  2PJR A;  3ZCO A;  1U5T C;  1OYI A;  4U88 A;  4G6T B;  1YQA A;  3CO6 C;  3GXO A;  4U0Y A;  1K7A A;  1RNL A;  3H3V K;  4AM3 A;  3BCA A;  2EA2 A;  3OYN A;  5A2Q Z;  2QQ8 A;  1LFB A;  4LIV A;  3LFK A;  1ETX A;  3MKY B;  1TWC J;  2OV7 A;  1WJF A;  1MH3 A;  3I5U A;  5HLG A;  2R3S A;  2ZJ2 A;  1D0Y A;  2LKX A;  4G7O F;  3MZ8 A;  1VZ0 A;  2OTJ I;  3B02 A;  3J81 K;  1HKT A;  5LEK A;  4L9N A;  1IC8 A;  2FD5 A;  3CCL I;  4M6X A;  3H35 A;  3FHZ A;  2L7M P;  1QO0 D;  1XMK A;  4UB8 C;  5FRO A;  4D7N A;  1XC5 A;  3CUQ B;  4XLH A;  3L2V A;  4E70 A;  3CME I;  1BBY A;  4IHY A;  1B72 A;  1YW9 A;  4BL0 B;  3F8C A;  3L2W A;  4PJL A;  5LRS A;  4M3F A;  2VC1 A;  2XDV A;  4O5V A;  3HRM A;  3D5L A;  2WY8 Q;  3DKW A;  5LHH A;  2CH0 A;  2X6W A;  5E3L A;  4MQ9 F;  4S05 A;  3ZMS A;  2ELK A;  3EUA A;  1B4A A;  2F4M B;  2HOE A;  3RIR A;  3V7C A;  1BIA A;  1KZH A;  2MAB A;  1REP C;  1QVU A;  1I3Q J;  3HC7 A;  9ANT A;  1XSX A;  2DPU A;  2ZJR F;  3KCC A;  3LSI A;  4BEH A;  3QP6 A;  2B9S A;  4M9S A;  2DFH A;  3CP8 A;  1Z6T A;  1DPU A;  4FE7 A;  5KAF C;  4X0G A;  2GM4 A;  4EMS A;  5F64 A;  1OFC X;  2X1E A;  2DTR A;  3TKY A;  1FYM A;  2RVC A;  5FKL A;  4L0Y B;  3E1S A;  3QU3 A;  4BQN A;  5FLV A;  1LNW A;  3FXR A;  4CA0 A;  5IT9 Z;  1PP8 F;  1SAX A;  2FOW A;  2L4M A;  2ZJQ F;  1JGG A;  3OS0 A;  3LA2 A;  3TOA A;  2AQF A;  2HWV A;  3IWF A;  2R7Q A;  4IF4 A;  2KRC A;  5CVV A;  4YFX F;  1CF7 B;  3I56 I;  5IYB J;  1ON1 A;  1FOW A;  3CJT B;  3VSK A;  4BXX J;  3QRF F;  1T33 A;  5J1R A;  2WTE A;  3V7S A;  1LEA A;  1MBE A;  4ENK A;  3GZN B;  3CMY A;  3G71 I;  2DN0 A;  2UWM A;  4CDG A;  3REO A;  3BTL A;  4YFN F;  2DJN A;  3HG9 A;  2L01 A;  3LSG A;  4IRH A;  2UXN A;  3WG7 H;  3CCM I;  3M8F A;  1LFP A;  3OYC A;  2DMQ A;  3A02 A;  3S8P A;  3ZXS A;  1YJ9 I;  3L2C A;  3PSI A;  1B9M A;  2VJJ A;  1W7P D;  3ROU A;  1G4D A;  3ASN H;  3MAJ A;  1XB4 A;  1XD7 A;  3OL4 A;  4C3I J;  3CCQ I;  1OR7 C;  4FX4 A;  1WZ2 A;  3GTO J;  2JSC A;  2XF6 A;  3I59 B;  1QPM A;  1W4M A;  4I0A A;  5CVJ A;  3V8K A;  4LG0 A;  3BR0 A;  2OQG A;  2Y69 H;  3CCY A;  2Y2Z A;  2FX0 A;  2MGQ A;  3BLY A;  2IVM A;  2G7U A;  2X4H A;  2ZKZ A;  1ZGW A;  2XC7 A;  4RGX A;  1UB9 A;  4CCM A;  3S2D J;  2J5O A;  4B3A A;  2BHY A;  2M8E A;  2JA8 J;  1QQI A;  1J7K A;  1Y56 A;  1DU0 A;  2JRM A;  4B09 A;  1Z77 A;  3TBI A;  2L9S A;  2L9V A;  2YX7 A;  4EJO A;  1MJA A;  1T08 B;  3E6D A;  3ZMT A;  3RKY A;  5IP7 J;  2IAI A;  2KL4 A;  1TWH J;  2K4B A;  3OIO A;  4OU0 A;  2R4G A;  2H6C A;  3WTS C;  4UVB A;  2VQG A;  3BY6 A;  2DO7 A;  1V4R A;  2NNN A;  2H94 A;  3OYG A;  2A6T A;  1VF9 A;  2MH9 A;  3BG5 A;  1A6I A;  3LNQ A;  2R92 J;  1Z05 A;  5L3D A;  2Z33 A;  2K7L A;  1BC7 C;  1R23 A;  5CPR B;  5DCM A;  1Z67 A;  4AIK A;  3EQL F;  3FXM A;  1FNN A;  1B59 A;  3VYT B;  3OYA A;  3VYR B;  4KT6 A;  1ZGA A;  1TQM A;  2IGM A;  3BP8 A;  2XF7 A;  1U9O A;  2LRD A;  2LR8 A;  5EGO B;  1Z7U A;  3G3Z A;  3OV8 A;  3OYK A;  3WTY C;  2LVS A;  4PCQ A;  3O8G A;  5ILS A;  1XPX A;  1TQP A;  4E7Z A;  4U0V A;  2CSO A;  3T0Y A;  2FUG 2;  4IXA A;  4GYI A;  4MGR A;  1WJE A;  4LB6 B;  3JTG A;  2HR3 A;  3A1Y A;  4L18 B;  3DBH B;  2YSR A;  2WA0 A;  5CVI A;  2KZV A;  3IP4 B;  1IN8 A;  2A5Y B;  2JVH A;  1FIA A;  3QOD A;  2HQ5 A;  2OZ6 A;  2BXZ A;  3KET A;  3EUH A;  4GGG A;  2ICW G;  4UY8 I;  3CCE I;  3J80 Z;  4N4O B;  3BZK A;  1A6Q A;  4KMF A;  2P5K A;  3CCV I;  4BQA A;  4Y13 A;  4A6D A;  1AWC A;  1YIO A;  1J09 A;  2D5V A;  4M6V A;  2Z9O A;  2CUJ A;  2XIG A;  2CWE A;  5AON A;  2HI3 A;  1W7P A;  2IS6 A;  2TDX A;  2EZI A;  5LRR A;  3HPH A;  3HOU J;  5M3F J;  2VON A;  1KQ0 A;  4QTR A;  1H8A C;  4KIB A;  3E5U A;  2KIM A;  3B73 A;  4ON0 A;  2L7K A;  2M0M A;  4DOZ A;  3I55 I;  4CCO A;  3QOP A;  4OIR F;  1E3P A;  2IW5 A;  3K9T A;  4HNV A;  4FE4 A;  1X1C A;  4XN3 A;  2IJL A;  1SAN A;  1MMA A;  3DLL F;  4BE2 A;  1ETV A;  3DXJ F;  3FXO A;  2M34 A;  1X1A A;  2LBF A;  5TJJ A;  1I1S A;  3CJQ B;  3CC2 I;  2WAF A;  3ESW B;  1E17 A;  2J5P A;  3VWB A;  1FX7 A;  4WXD A;  1OQY A;  5EZH A;  1RPW A;  2CW7 A;  1WRJ A;  3P5J A;  3ZQQ A;  3LSH A;  3IRQ A;  2XGX A;  3Q9V A;  3ABT A;  1RKW A;  1ZG5 A;  1X2M A;  4EGZ A;  5GP9 A;  3DQV C;  5FLX K;  2P5L C;  3NAR A;  4F3Q A;  4LLG F;  2ZSH B;  4TV7 A;  3JRA A;  3S2W A;  2DA2 A;  2E2J J;  1MND A;  3UKG A;  2W4S A;  1ETQ A;  2IGO A;  3K4K A;  4NNJ A;  1VQ4 I;  4AC0 A;  1SMT A;  3NQO A;  1MJB A;  1T56 A;  4NQW B;  3RZD J;  2H8R A;  2R0Q C;  1E3H A;  1NTC A;  2V1X A;  2JUC A;  3VPR A;  1P92 A;  2D1H A;  2X1D A;  3F6O A;  4BJ5 C;  3HYI A;  3FKI J;  2XGE A;  3L1P A;  2ELJ A;  2ISY A;  1SFK A;  5CYV A;  4GRI A;  3U1K A;  3F8B A;  3NRV A;  4U7B A;  1XGN A;  1WJD A;  1EJ9 A;  2HU9 A;  2F4I A;  4FQG A;  3EDP A;  4WF2 A;  3WU1 B;  4DYQ A;  4KIT B;  1BOB A;  4ZTJ A;  1YS7 A;  4DW6 A;  3CDI A;  5E17 F;  2DT5 A;  5LHG A;  5HS9 A;  4OIN F;  2COB A;  3AKZ A;  3C1D A;  2K9N A;  3IHU A;  3I64 A;  4CCK A;  1IXC A;  4CZC A;  2K27 A;  1ENH A;  2M8G X;  4OMZ A;  4B48 A;  3WTX C;  2QZ8 A;  4YEL A;  3AG4 H;  3S17 J;  4RB1 A;  4P1W A;  1F43 A;  1FMW A;  3RPU A;  1IW7 F;  3HRU A;  2ECC A;  4D7M A;  1R5H A;  2QKM B;  4ENN A;  5DEQ A;  1G59 A;  1R49 A;  2BY3 A;  3CC7 I;  1EH7 A;  1HDP A;  2VOO A;  3KEO A;  3M1E A;  2ACJ A;  4LD5 A;  1ZAO A;  2RV8 A;  4J00 A;  4KA4 A;  2V1N A;  4GCV A;  3ZQH A;  1TC3 C;  1LDJ A;  4BHB A;  2OTL I;  4N9I A;  1ZTR A;  2HZT A;  2MD5 A;  2MYS A;  3LOC A;  2R7S A;  2GOM A;  4I09 A;  3Q5F A;  3R61 A;  1KU7 A;  3P7N A;  2QSG X;  4XBF A;  3F23 A;  2CQ7 A;  1SFO J;  3H5N A;  3LST A;  3TQN A;  2LP0 A;  1PVE A;  2EZK A;  3KPH A;  1D8J A;  2RC4 A;  3KZY A;  3OYD A;  3ERE D;  4A6E A;  2DFF A;  3FIW A;  2Y0M A;  2OU2 A;  3OR1 C;  2H1K A;  3P9K A;  4XSX F;  2I8D A;  3O8H A;  4ZZL A;  4D1Q A;  2H27 A;  2LMD A;  4RLF A;  3KP7 A;  2RQQ A;  4OIQ F;  2E71 A;  1ORK A;  5BOX A;  2LY2 A;  4U0W A;  2HVQ A;  4M74 A;  4PZJ A;  3HOX J;  3HIF A;  2DK5 A;  3F72 A;  3OOU A;  1JUM A;  1HA8 A;  2H8W A;  1XGM A;  4Y3O A;  2DK8 A;  1KQ9 A;  3P9C A;  5FKN A;  2FNP A;  2YU3 A;  3LAP A;  2XGC A;  2RRE A;  2VBW A;  2C6Y A;  4CH7 A;  1BI0 A;  2EWN A;  1K6Y A;  4BQQ A;  3I53 A;  3QPL A;  1FTZ A;  3H0D A;  2O8X A;  5DUI A;  2W1O A;  1A5J A;  1I1G A;  4HNT A;  1J59 A;  4BYY A;  3KIO A;  4BJ6 C;  2LKP A;  3BJ6 A;  4EV0 A;  2QQA A;  2V9K A;  5GPA A;  4FTH A;  2Y48 A;  4ZC3 A;  1IRX A;  3O3K A;  1R5I D;  4HX4 A;  4B4C A;  3KP6 A;  2GXA A;  4FET A;  3JRF A;  1PJR A;  1WFX A;  1D1B A;  1U9N A;  2E1M C;  2ZSI B;  1BJZ A;  1DU6 A;  2QQ9 A;  4F52 A;  1ITY A;  1DP7 P;  2STT A;  4G6Q A;  2L7Z A;  3KLN A;  4CXF A;  3WHB A;  2DOA A;  2LYC A;  1TWA J;  3MD2 A;  4HA8 A;  4MIM A;  3AG1 H;  1AOY A;  1UFM A;  4BKX A;  4IZZ A;  3PNY A;  1O7F A;  4BAY A;  1IUY A;  2L7F P;  2A68 F;  2YS9 A;  5FKM A;  3IAS 2;  3A01 B;  4II2 A;  4N4N B;  2MSY A;  5LGN A;  2L9N A;  1SD5 A;  2H09 A;  5LGT A;  2P4W A;  5EEG A;  3PFI A;  1VQK I;  1FWZ A;  2O3F A;  1B1B A;  1EH6 A;  5ICE A;  3HEF A;  1XGO A;  2XPU A;  3OS2 A;  2A5W A;  5H6Q A;  5JFR A;  4PGH A;  4HZF A;  2CUZ A;  3HOW J;  1IJW C;  3KZZ A;  4EJT A;  1K78 A;  2DT6 A;  3SHF A;  1VQ8 I;  4EM0 B;  2DDA A;  2EIJ H;  5LGU A;  2PJR B;  5M3M J;  2EV6 A;  2OF7 A;  3ISP A;  2VBY A;  3QP5 A;  1QRY A;  1G2H A;  2VUM J;  1J9I A;  3AL0 C;  5F6F A;  4A69 C;  5K5Q A;  3JR9 A;  3K69 A;  1D1C A;  2FA5 A;  2G9W A;  1HSJ A;  3E6M A;  2QQB A;  2GOX B;  3RDI A;  1XCV A;  2O7O A;  3J81 Z;  4FCY A;  3IUO A;  4RM2 A;  1KU9 A;  4CCL A;  1D0Z A;  4IHW A;  4RM3 A;  1VQO I;  2IA2 A;  3JRB A;  3ZQL A;  2M9H A;  1JKP C;  1AA7 A;  3CJR B;  3SDB A;  3B6A A;  3X2Q H;  4XRM A;  5BPI A;  2NRA C;  2VN2 A;  4DIQ A;  3A03 A;  1K6O A;  3ABK H;  1S29 A;  2QF7 A;  1QHH D;  2Z99 A;  4EVI A;  5EJC A;  1X4P A;  3T5X A;  2NS8 A;  1P6R A;  3FBN B;  4I2O A;  2VKE A;  1Y8R B;  2UV1 A;  4UUS B;  4BQO A;  3VYS B;  2KRH A;  1B72 B;  1LFU P;  5J6X A;  3TP3 A;  1MBG A;  4C9Y A;  2KZG A;  1U3E M;  1XN7 A;  2EFW A;  1QVT A;  1UHW A;  2DBB A;  4HDU A;  4UVC A;  2QEN A;  2IGK A;  1E3O C;  1EH8 A;  1YS6 A;  3H92 A;  4DBR A;  1ONV A;  5FO5 A;  4IJA A;  4N9H A;  2VE8 A;  4PSX A;  4Z2Y A;  5C4J J;  3DP7 A;  3FXL A;  2HQR A;  1XS9 A;  4IHV A;  1FSE A;  3CQZ J;  2VT3 A;  2R7X A;  5E3N A;  4A5M A;  3H9Q A;  1UCR A;  2HKO A;  2YPR A;  4BEH B;  2FOK A;  1UG2 A;  4MHG A;  3BG6 A;  3BZC A;  2F5C A;  3C2B A;  2DCE A;  5F04 A;  2CW0 F;  4IQ4 A;  1JT6 A;  3RKQ A;  4QWQ A;  2QSF X;  2E1C A;  1IXR C;  1P4A A;  2PLY A;  2XHK A;  1G3Y A;  1NHA A;  3U2R A;  1UAA A;  1OPC A;  2K4J A;  5GAH J;  3E3V A;  2EV5 A;  3KEY A;  1SVM A;  2OQR A;  3FXJ A;  5KK1 A;  2M1B A;  5H6R A;  3HOS A;  1FZP B;  1AHD P;  5CJ9 A;  1R7J A;  3K4B A;  1QBJ A;  2E1O A;  2P0W A;  2XSJ C;  5LEJ A;  2ID3 A;  2KJB A;  1YHQ I;  3IAM 2;  1U6G A;  1BR4 A;  1Z1D A;  2NS7 A;  1U78 A;  4DYC A;  4XN0 A;  1I6X A;  2KQR A;  3OSF A;  1LQ1 A;  2MBF A;  3ABM H;  1BI1 A;  3D1N I;  1MSE C;  4BNC A;  2LC2 A;  4A12 A;  1VQ9 I;  1JT0 A;  4V2F A;  2V9P A;  3QU6 A;  3UR3 C;  3C2G A;  1KA8 A;  4HSR A;  4KIF A;  5E18 F;  3TO6 A;  1ETK A;  3JSP A;  5E3M A;  2ESN A;  2ME0 A;  4PFO A;  1FBU A;  2L02 A;  4OIO F;  3BJO A;  2DXI A;  3LMM A;  2ZXW H;  3WTT C;  2HYG D;  4KJZ A;  4S04 A;  3MKL A;  1R6R A;  4XK4 A;  4ITV A;  4ZDP A;  3K4C A;  3JRE A;  1SD4 A;  2KLO A;  2F48 A;  3Q9S A;  4PDK A;  3GTQ J;  3NEU A;  2Z1D A;  3FK7 A;  2M0C A;  1HOM A;  3I71 A;  3FXQ A;  1WGX A;  2KRF A;  1K4T A;  5F0F A;  3SZG A;  2EFP A;  3VSL A;  4E7I A;  1R5G A;  2K9M A;  3PFY A;  1BI3 A;  5HDK A;  3ZN1 A;  1J75 A;  2EIL H;  4A3M J;  3CDL A;  5KHD A;  2CFO A;  1POG A;  4MFD A;  3SFI A;  5DV5 A;  2EIM H;  4YFK F;  4G7H F;  5D5X B;  4HLY A;  5EDN A;  2EFQ A;  2ZB9 A;  4ENJ A;  4Q47 A;  2CYY A;  5FKK A;  4KIC A;  3GVA A;  4BUP A;  4KUM A;  3F22 A;  1ZRD A;  1JJ6 C;  3S32 A;  1SFE A;  1U5T B;  3V8J A;  3ECO A;  3RPQ A;  3FDY A;  1DP3 A;  3SYT A;  3E6C C;  3T8R A;  1N78 A;  3W6V A;  2EZH A;  5DCM B;  5IYC J;  3GX4 X;  2Q2E B;  2V1D A;  4L5J A;  3K4L A;  2M4G A;  3HBL A;  3W6J B;  3K70 C;  2NVQ J;  3GZ5 A;  3GTG J;  1EF4 A;  4LJZ F;  4JX5 A;  2ZME C;  1JKQ C;  4BHP A;  1ZHF A;  2DA6 A;  4B3X A;  3J7A O;  4HX7 A;  1XSV A;  1S7O A;  2VKV A;  1ERD A;  3DBL B;  1OMI A;  4JK1 X;  3PIP F;  3EUH C;  1PYV A;  2K9Q A;  2KIQ A;  1X3U A;  4L5E A;  5FGM A;  5JHF A;  3CDH A;  4N0B A;  3HTS B;  4HBL A;  4I98 B;  3DU5 A;  2X48 A;  4E7H A;  1BA5 A;  4PJ0 C;  3DWL E;  2MC3 A;  2P81 A;  2FEZ A;  4RAY A;  1FBS A;  3RI4 A;  3BZ6 A;  3IH3 A;  1N77 A;  3AG2 H;  2VPR A;  4BE0 A;  4JP0 A;  2W48 A;  1J2X A;  1HF0 A;  4LK1 F;  1JHH A;  2PEX A;  2ZXI A;  3ML6 A;  2LTP A;  1W7P B;  3KE2 A;  1ULY A;  3JAM K;  5E8G A;  2DA5 A;  2IEK A;  4LOC A;  4BH9 A;  2FMY A;  3PJR A;  5CLS A;  5K7Z A;  1E2X A;  3HPG A;  3CZ6 A;  1PUE E;  4NC6 A;  4UNO A;  1RRJ A;  1J5Y A;  2KPM A;  3Q0U A;  3T1B A;  4MQV A;  3OL3 A;  4CCJ A;  4XNF A;  1K4S A;  4D5F A;  5B1B H;  4FIS A;  1JUS A;  4IOC F;  5FLX Z;  3FXU A;  4U7D A;  1VQL I;  2CQK A;  2JMW A;  4M3E A;  4E7L A;  3V4G A;  4CO8 A;  4YG2 F;  2DOE A;  3E7L A;  1BOA A;  4KFC A;  3ZMZ A;  4DZJ A;  1I39 A;  3J7A Y;  2O61 A;  3OYJ A;  3WTV C;  4DBQ A;  3K70 D;  4LFU A;  3RJP A;  3BQY A;  3KLO A;  2XVC A;  5TRD A;  3IH2 A;  3KP2 A;  2XAF A;  3D5R C;  5H20 A;  4C2T A;  4ETS A;  1LB2 A;  5DD8 A;  2HQN A;  2CRG A;  1ZG3 A;  2VJ4 A;  3FKJ A;  1BW6 A;  3PQK A;  1P9Q C;  4IRG A;  2VQH A;  3R6S A;  3V7R A;  2DOD A;  3QPH A;  4LMY A;  5CVR A;  2ADU A;  4ZZD A;  5B66 C;  4HDV A;  2P6S A;  3SEQ A;  2L9R A;  3BQZ A;  1VQ7 I;  2M4K A;  3S1N J;  2VXD A;  4A3I J;  4XON A;  4AID A;  1TQI A;  4HPQ A;  4A2U A;  3HM5 A;  4Z6Y A;  3E6B A;  5K1Y A;  2GWR A;  3KYL A;  5EZG A;  2LH9 A;  1HQC A;  4I6Z A;  3G2B A;  1TWF J;  3FF5 A;  1UHM A;  2XUB A;  1IAW A;  4F92 B;  4ASN A;  2BY0 A;  1R1U A;  2VAS A;  2HYF A;  2M5W A;  5JLX A;  3U21 A;  3HUG A;  2R5Z A;  5ILV A;  2QSH X;  1S72 I;  2KDZ A;  1EA3 A;  1NK3 P;  2JZY A;  2P5V A;  4PJN A;  2AQE A;  1XDU A;  3G4S I;  2XRL A;  4A0Z A;  2B7E A;  2FBH A;  3JRH A;  3CUO A;  1XCB A;  1G8X A;  4KIG A;  1FC3 A;  1H9T A;  4UVA A;  2YR2 A;  5E79 C;  3BR1 A;  2R7D A;  5EG0 A;  3GZ6 A;  1MDM A;  3JTH A;  5TGT A;  3HGG A;  5FFZ A;  5AIQ A;  3S2H J;  2K02 A;  1WPK A;  3TL4 X;  2Q0O A;  4BBR J;  3FMQ A;  2KJC A;  2DQL A;  2CV0 A;  5D5U B;  1EKE A;  1FEX A;  3CLO A;  3GTL J;  4XKV A;  3CF2 A;  3MKZ A;  4RGS A;  1BI2 A;  3J7Z I;  3PQJ A;  4PFP A;  3COA C;  1QZE A;  3EYY A;  1O3Q A;  2GXB A;  3VYU B;  5EEH A;  3V42 A;  1S7A A;  2OJE D;  4UHT A;  5IP6 A;  2VL8 A;  2M7B A;  1BN5 A;  4XLN F;  2V4J C;  4A5N A;  3H5A A;  4ZH4 F;  3DTI A;  2CV2 A;  1ACI A;  1U0J A;  4NBQ A;  4XRF A;  3CMM A;  4GO1 A;  5IOY A;  2IT0 A;  2ZME A;  4B44 A;  2BVM A;  4RDU A;  4QLC U;  4XLP F;  2CS3 A;  1IZ1 A;  2BBY A;  5ICF A;  4RMN A;  2WAE A;  3QYB A;  4LGW A;  1VFC A;  2IP2 A;  1RKT A;  3ZQG A;  2WBM A;  3WE2 A;  4EJV A;  2FML A;  1QU3 A;  2BZT A;  4A3G J;  3MWM A;  4Y52 J;  2DFE A;  3F6V A;  1K79 A;  2VJ5 A;  4MO7 A;  4YEJ A;  3CUQ A;  2IRF G;  2ZFW A;  4I01 A;  3RPU D;  1BR2 A;  1ZRE A;  3I9V 2;  3FXK A;  1HST A;  1ZYR F;  2RNJ A;  5J40 A;  2WY7 Q;  5M5X J;  3DTK A;  1T0F A;  3WGG A;  5L3E A;  1FOY A;  2VXZ A;  3S14 J;  1WJA A;  1W5C C;  2W57 A;  2M45 A;  3DV8 A;  1UG0 A;  3TED A;  3Q3S A;  2FE3 A;  1WSU A;  3QYE A;  2GA1 A;  3LSK A;  3PIO F;  2HVS A;  4IKF A;  4JBA A;  1IV6 A;  5HVQ C;  4A3D J;  2COM A;  2X1C A;  3PUF A;  2OD5 A;  1HKQ A;  2X85 A;  4XRS G;  1SVL A;  2GAU A;  1OLT A;  1MNM C;  2EK5 A;  4OOI A;  5KAI C;  1RUN A;  1ZAR A;  2QEX I;  1MKM A;  2Y9Y A;  2L54 A;  3FWE A;  3QOE A;  1UST A;  1ZG1 A;  4MLO A;  3T8T A;  4BS9 A;  5LLQ A;  4XLC A;  3NAU A;  3GLX A;  4XSZ F;  2JSP A;  1DGR M;  4PSW A;  1RET A;  1UHS A;  4E6K G;  1BW5 A;  2GZW A;  3WE3 A;  1LE8 B;  5ICC A;  2Y31 A;  3AAF A;  2L2O A;  4I02 A;  1D3Y A;  1Z6R A;  2KP6 A;  4XM3 A;  4PJJ A;  1YI2 I;  2R7F A;  1WWX A;  2X6X A;  3GO5 A;  3CP2 A;  3BTI A;  1B8I B;  1CF7 A;  4Q4Z F;  1H0M A;  2BY2 A;  2JN6 A;  2VBX A;  1IN5 A;  1YOV B;  3I54 A;  3S3N A;  4CIC A;  2E5Z A;  2HPI A;  4E4H A;  3A0H C;  5KNL A;  4HQE A;  3TDU C;  5B5E C;  3CCU I;  1BJA A;  2E19 A;  3VOE A;  1GT0 C;  2EBI A;  5LHI A;  2JT1 A;  4G6D A;  4IPA A;  5JR3 A;  1FP1 D;  1L0O C;  2A69 F;  1K78 B;  3ZQC A;  4B47 A;  3QPT A;  2W7N A;  2L3D A;  2PMU A;  1LVA A;  2Z2S B;  4NB5 A;  5F08 A;  2JQ7 A;  2A6H F;  5J4Y A;  1VQP I;  2CV1 A;  4ZYA A;  4IHS A;  1MBK A;  3M07 A;  4A3C J;  3HDD A;  4M71 A;  4Q5S F;  4J01 A;  3FX3 A;  3W3C A;  2QYO A;  3F8M A;  1OCZ H;  2QUF A;  4IQJ A;  1E0E A;  3KYC B;  1JXS A;  2ESH A;  1AU7 A;  2V79 A;  3D5S C;  3GTK J;  4RB0 A;  5J4V A;  5ICG A;  2LY1 A;  1WQ2 A;  2FQ4 A;  2JA2 A;  1BM9 A;  4XIC A;  1MBH A;  3J7Y J;  4A93 J;  1A36 A;  3S16 J;  2DQR A;  3OYE A;  5B3S H;  1ETW A;  4XKW A;  4BHC A;  4MEX F;  2MA3 A;  1FYK A;  4P55 A;  1S6L A;  4ESF A;  4EM1 A;  2ME6 A;  2CQN A;  2OPT A;  3FMR A;  2LG4 A;  1ZQ3 P;  2HDW A;  2A61 A;  2XGD A;  3M9A A;  1FOX A;  1Z7L A;  1WI3 A;  4F93 B;  5L3C A;  3OYL A;  1S9H A;  3CES A;  1S5L C;  1Z3Y A;  2ZFU A;  2B0L A;  3ZP5 A;  4DGW B;  1KON A;  2HXI A;  4CHU A;  2DA3 A;  4ZDO A;  2BYV E;  2UXX A;  4I99 C;  4RB3 C;  4D9J A;  2VLA A;  4A0Y A;  4Y15 A;  2JUG A;  3PNV A;  2OCC H;  3FBI B;  4A3E J;  2VB6 A;  1F9N A;  1MZB A;  4FHT A;  2FNA A;  2LF8 A;  1W1W E;  2W00 A;  4EJU A;  3OIP A;  3PO3 J;  5DYM A;  2X9D A;  2K9L A;  4AIJ A;  2N8G A;  3OOP A;  2WV1 A; 
#chains in the Genus database with same CATH homology
 3MQ0 A;  3FM5 A;  2CFX A;  5L3G A;  2HEO A;  2IPQ X;  1O3R A;  4LLL A;  2XKP A;  4HLX A;  2NYX A;  1FLI A;  5E8I A;  3ELK A;  1IN4 A;  1TW3 A;  4UV9 A;  2NAZ A;  1D8K A;  2EV0 A;  2FSW A;  4ESB A;  5HS7 A;  5E20 A;  3CO7 C;  1FSH A;  2EFN A;  5D6F A;  1HKS A;  1PP7 U;  1LEB A;  4MNU A;  2F5E A;  3SZP A;  4UUV A;  2EJR A;  1WKM A;  3CJN A;  3K1M A;  2PFB A;  1USS A;  2P7C B;  4WCG A;  4HF2 A;  1CGP A;  4EQQ A;  4RGR A;  3HHH A;  4YIF A;  3D0S A;  2NS0 A;  1JHF A;  1YYV A;  2XAS A;  3SFZ A;  2FU4 A;  3ULQ B;  2P6T A;  4EM2 A;  3ZN0 A;  2LF7 A;  3TOB A;  3FZV A;  3TDZ C;  3TO7 A;  2XV4 S;  4M73 A;  4HF0 A;  4HW0 A;  3EET A;  1B6A A;  5D6E A;  1C0W A;  4FX0 A;  3KP4 A;  3BOQ A;  2ZCW A;  5J8C A;  2LDU A;  2XKO A;  4HF1 A;  2W24 A;  3MEX A;  5D8K B;  2HFH A;  2PQ8 A;  2BE5 F;  3KP3 A;  2HS5 A;  2WV0 A;  3JAM Z;  3HSR A;  4JQF A;  1R22 A;  4L0Z B;  2RDP A;  4HX8 A;  3LAJ A;  3RTR A;  1YFH A;  3F21 A;  1ZH5 A;  2O03 A;  1V3F A;  3RYP A;  4ZYD A;  2FRH A;  2QWW A;  3C7J A;  1F5T A;  4HOB A;  2VBZ A;  4MTD A;  3E5Q A;  3K2Z A;  1R00 A;  4Q48 A;  5E1W A;  1IRG A;  1B9N A;  3GF2 A;  2FXA A;  4L9V A;  3ZMD A;  4L5I A;  1T38 A;  3R60 A;  4UXN A;  3O6B B;  1U2W A;  2XRN A;  1R1T A;  1SMY F;  1G3T A;  2PN6 A;  2NNY A;  2Y75 A;  2OAZ A;  5J8F A;  1J0R A;  3RKW A;  3JSO A;  4LLN A;  5D5V B;  2QLZ A;  2D1V A;  2DFI A;  1YG2 A;  2GQQ A;  3GFJ A;  1YW7 A;  3HTU A;  5JI6 A;  4M72 A;  1HW1 A;  3R0J A;  3K1P A;  2ZNZ A;  2QBY A;  2DAO A;  2HKX A;  2V1U A;  4LG0 B;  1DPR A;  2AXL A;  4RS8 A;  5D4R A;  1KYZ A;  3GFL A;  3BPV A;  2ZBK A;  2FBI A;  3MZY A;  2LNB A;  2V9V A;  1KU2 A;  3L00 A;  1ZRF A;  4ZYH A;  2W25 A;  1DDN A;  2Z3Y A;  3ABU A;  3HSE A;  1XGS A;  1O3T A;  1D5V A;  1ZN2 A;  2VT2 A;  1S8N A;  3R0A A;  5DUK A;  4G94 A;  3P9I A;  3HRT A;  2KIU A;  3I0T A;  2VOP A;  2W85 A;  3I58 A;  4I0B A;  4AD9 A;  1H9G A;  1TBX A;  2HTS A;  4ENM A;  2GXG A;  5FD5 A;  2K86 A;  2Q8K A;  2P8T A;  4F7Z A;  2ZME B;  1R36 A;  5CVU A;  4KN4 X;  3FMS A;  2F5F A;  2GA2 A;  1SD7 A;  3SZT A;  4FT8 A;  4KMU X;  3CUQ C;  4ZYE A;  4RAZ A;  4CGZ A;  2FF4 A;  1T98 A;  2ZO4 A;  3O2P E;  1OYW A;  3SXY A;  3ECH A;  1IXS B;  3JW4 A;  3RYR A;  2STW A;  1VTN C;  2F2E A;  1ZLK A;  1P4W A;  2LSO A;  3IKV A;  2PG4 A;  4DNC A;  2UZK A;  2XAJ A;  3U9G A;  5HDN A;  4P5O A;  3BPX A;  4OIP F;  3BRO A;  3LWF A;  4D0P A;  5D5W B;  1DUX C;  3K0L A;  2WWY A;  1YW8 A;  4P96 A;  3CTA A;  5L3B A;  3GUD A;  5IT3 A;  1ZRC A;  1FY7 A;  3KEQ A;  1KQ8 A;  4CYD A;  2H6B A;  3U1D A;  3C3W A;  1QZY A;  4NHJ A;  1A04 A;  1FYL A;  4G9Y A;  2A3S A;  4WXC A;  3W6K B;  1PDN C;  2X0L A;  4H0E A;  3H3U A;  1T2K A;  2DW4 A;  3IL2 A;  5BQT A;  5BPD A;  1LDK B;  5FB2 A;  2QM3 A;  2ZXJ A;  1HXD A;  1IN7 A;  5D4S A;  1HW5 A;  3LA7 A;  1WI9 A;  1XMA A;  3WOD F;  3IKT A;  4HQM A;  4G8X A;  3KP5 A;  4AWX B;  5HDG A;  4YII A;  3C18 A;  5LBQ A;  1R1V A;  1U5T A;  4AIH A;  1TTY A;  1Y0U A;  2VC0 A;  2Q2E A;  1FBQ A;  2JRT A;  5A2Q K;  4L9J A;  2DU9 A;  4Y17 A;  2CO5 A;  1IRF A;  4K2E A;  5JHU A;  3V8L A;  1MD0 A;  3GYH X;  4HAM A;  2VE9 A;  5FD6 A;  1JE8 A;  1I27 A;  2HDC A;  2OBP A;  6PAX A;  5KVR A;  2HTJ A;  4KDP A;  1Q1H A;  3TO9 A;  1LJ9 A;  2PJP A;  4ESJ A;  1XDS A;  1ON2 A;  3KFW X;  1G6N A;  3SQN A;  3GFM A;  1RI7 A;  2RKH A;  1KYW A;  2O6G E;  5AIP A;  5BMZ A;  2ISZ A;  2E7X A;  1STZ A;  2QVO A;  3WTU C;  1GXP A;  3MZH A;  2ETH A;  1YTY A;  2F5D A;  2CGP A;  1IN6 A;  3ZMV A;  1P2F A;  5HS8 A;  4OMY A;  2W84 A;  2DLL A;  5IT9 K;  4WX9 A;  4KN7 X;  1FOK A;  2IA0 A;  4KT5 C;  5HLI A;  1HW2 A;  3QAH A;  1Z91 A;  5DCF A;  3MFK A;  3N4M A;  4WWC A;  1SFU A;  1Z9C A;  4UV8 A;  1QNT A;  4L9T A;  1P4X A;  3VFZ A;  3I59 A;  4RGU A;  1OYY A;  3L09 A;  3L9F A;  2O0Y A;  2AS5 F;  1OR7 A;  3F8N A;  2OA4 A;  1YO5 C;  1OKR A;  3LQR A;  5D8L B;  3E5X A;  4M9X A;  5DDG A;  3H3Z A;  1ZLJ A;  3MCZ A;  3K1N A;  1RIO H;  1FPQ A;  1G3S A;  3R4K A;  2EFO A;  4WK8 F;  4HV5 A;  2CG4 A;  3ZPL A;  4M9Z A;  3LQQ A;  1ODD A;  2OZU A;  1FP2 A;  3M8E A;  4AVP A;  1TW2 A;  2D45 A;  3IRR A;  2E7W A;  2A07 F;  1O3S A;  1U8R A;  5DD4 A;  4LB5 A;  2RN7 A;  1RZ4 A;  3L7W A;  2PMH A;  3LA3 A;  1KU3 A;  1T39 A;  2PBI A;  2RGV A;  1TLH B;  4IRI A;  5ILU A;  3RKX A;  3DFG A;  3J80 K;  4P9U A;  4CZZ A;  4KYW A;  5ED4 A;  4DQ2 A;  1G3W A;  1QZZ A;  1O57 A;  1TNT A;  2V6C A;  2ELH A;  2ZNY A;  2QBY B;  2HGC A;  2YX4 A;  1L3L A;  3I4P A;  2DI3 A;  4ZYG A;  5L3F A;  4IHT A;  2DPD A;  1O7L A;  4MEY F;  1F1Z A;  3VOD A;  5E1X A;  3ZMU A;  1BIB A;  2VOD A;  2MLG A;  4NQW A;  2IA1 A;  2XAQ A;  3VB2 A;  3HRS A;  5HOO A;  2L4A A;  1S3J A;  5HLH A;  3HHG A;  3HSF A;  1XSD A;  3GFI A;  2EB7 A;  2A6E F;  2WC2 A;  2BEO A;  2JTV A;  4B8X A;  3WTZ A;  4GXO A;  2G7H A;  3G73 A;  3TGN A;  2JPC A;  4PGG A;  1GVJ A;  1HBX G;  1W5T A;  3EYI A;  2BV6 A;  5K5O A;  4LK0 F;  4HYE A;  5BS6 A;  1I5Z A;  1GHC A;  1KGS A;  3IC7 A;  4O3M A;  4EGY A;  1R58 A;  3WTW C;  3VEP A;  3F8F A;  4WXH A;  3WG9 A;  1YLF A;  4R79 A;  2GIV A;  2KIF A;  5K5R A;  3F3X A;  1LDD A;  3WU0 A;  4IVN A;  2P7V B;  1T6S A;  2PI0 A;  2XRO A;  1RUO A;  3DEU A;  4R8H A;  3DPL C;  4KNY A;  4A0X A;  1ZGJ A;  2FQ3 A;  1FT9 A;  2M87 A;  4R1H A;  2EA4 A;  3BWG A;  4G7Z F;  3IWZ A;  5JVT A;  4M6Y A;  3WGH A;  2D2W A;  3DF8 A;  3GW2 A;  4O6J A;  3N97 A;  1MJ9 A;  2JPB A;  4P9F A;  1IF1 A;  2Z5U A;  5FFX A;  1SD6 A;  2E1N A;  3ZQ7 A;  3BJA A;  3DPT A;  2MH2 A;  3HOT A;  1JGS A;  2RQP A;  5ERI A;  3WGI A;  1EV7 A;  5F1R A;  4HV6 A;  3BDD A;  3E97 A;  1GXQ A;  4BXU A;  1MGT A;  2XAH A;  2KKO A;  1BC8 C;  4EJW A;  2XAG A;  3GEZ A;  1QGP A;  4RB2 C;  5E1Z B;  3FM3 A;  3M7G A;  4I7H A;  2BGC A;  1MDM B;  4GYG A;  1TNS A;  2MLK A;  2FBK A;  2M30 A;  1SFX A;  1F4K A;  4MTE A;  3GWZ A;  1U5T C;  1OYI A;  4U88 A;  3CO6 C;  1YQA A;  3GXO A;  4U0Y A;  1K7A A;  1RNL A;  2EA2 A;  5A2Q Z;  3LFK A;  3I5U A;  5HLG A;  2R3S A;  2ZJ2 A;  4G7O F;  3B02 A;  3J81 K;  1HKT A;  5LEK A;  4L9N A;  4M6X A;  3FHZ A;  1QO0 D;  1XMK A;  3CUQ B;  4E70 A;  1BBY A;  1YW9 A;  3F8C A;  5LRS A;  4O5V A;  2VC1 A;  3HRM A;  3D5L A;  3DKW A;  5LHH A;  4MQ9 F;  4S05 A;  3ZMS A;  1B4A A;  2HOE A;  3RIR A;  3V7C A;  1BIA A;  1REP C;  1XSX A;  2DPU A;  3KCC A;  3QP6 A;  4M9S A;  1Z6T A;  1DPU A;  4EMS A;  5F64 A;  3TKY A;  2DTR A;  1FYM A;  2RVC A;  4L0Y B;  3QU3 A;  1LNW A;  3FXR A;  5IT9 Z;  1PP8 F;  1SAX A;  2L4M A;  3LA2 A;  3TOA A;  2HWV A;  3IWF A;  4IF4 A;  5CVV A;  4YFX F;  1CF7 B;  1ON1 A;  3QRF F;  2WTE A;  3V7S A;  1LEA A;  4ENK A;  2UWM A;  4CDG A;  3REO A;  4YFN F;  2L01 A;  4IRH A;  2UXN A;  3M8F A;  3L2C A;  1B9M A;  1W7P D;  3ROU A;  1G4D A;  3MAJ A;  1XB4 A;  1XD7 A;  4FX4 A;  2JSC A;  3I59 B;  1QPM A;  1W4M A;  4I0A A;  5CVJ A;  3V8K A;  4LG0 A;  2OQG A;  2IVM A;  2G7U A;  2X4H A;  2ZKZ A;  4RGX A;  1UB9 A;  2J5O A;  2M8E A;  1QQI A;  1J7K A;  4B09 A;  2YX7 A;  4EJO A;  1MJA A;  3E6D A;  3ZMT A;  3RKY A;  2K4B A;  4OU0 A;  2H6C A;  3WTS C;  4UVB A;  3BY6 A;  2DO7 A;  1V4R A;  2NNN A;  2H94 A;  2MH9 A;  1Z05 A;  5L3D A;  2Z33 A;  2K7L A;  1BC7 C;  1R23 A;  5DCM A;  4AIK A;  3EQL F;  1FNN A;  1B59 A;  1ZGA A;  1TQM A;  3BP8 A;  1Z7U A;  3G3Z A;  3OV8 A;  3WTY C;  4PCQ A;  5ILS A;  1TQP A;  4U0V A;  2CSO A;  3T0Y A;  4IXA A;  4GYI A;  4MGR A;  4LB6 B;  3JTG A;  2HR3 A;  4L18 B;  2YSR A;  5CVI A;  1IN8 A;  2A5Y B;  3KET A;  2OZ6 A;  3EUH A;  4GGG A;  3J80 Z;  4KMF A;  2P5K A;  4BQA A;  4Y13 A;  4A6D A;  1AWC A;  1YIO A;  2Z9O A;  2XIG A;  2CWE A;  5AON A;  1W7P A;  2TDX A;  5LRR A;  2VON A;  1KQ0 A;  4KIB A;  3E5U A;  2KIM A;  3B73 A;  4ON0 A;  3QOP A;  4OIR F;  2IW5 A;  3K9T A;  2IJL A;  3DXJ F;  5TJJ A;  1I1S A;  1E17 A;  2J5P A;  1FX7 A;  4WXD A;  1WRJ A;  3IRQ A;  2XGX A;  3Q9V A;  3ABT A;  1ZG5 A;  4EGZ A;  3DQV C;  5FLX K;  2P5L C;  4LLG F;  4TV7 A;  3S2W A;  1SMT A;  3NQO A;  1MJB A;  2V1X A;  1P92 A;  2D1H A;  3F6O A;  3HYI A;  2ISY A;  5CYV A;  3F8B A;  3NRV A;  4U7B A;  1XGN A;  3EDP A;  4WF2 A;  3WU1 B;  1YS7 A;  5E17 F;  2DT5 A;  5LHG A;  5HS9 A;  4OIN F;  3C1D A;  3IHU A;  3I64 A;  1IXC A;  2K27 A;  4OMZ A;  3WTX C;  2QZ8 A;  4RB1 A;  3RPU A;  1IW7 F;  3HRU A;  1R5H A;  4ENN A;  5DEQ A;  1EH7 A;  2VOO A;  3KEO A;  3M1E A;  2ACJ A;  4LD5 A;  1ZAO A;  2RV8 A;  4KA4 A;  4GCV A;  1LDJ A;  4BHB A;  4N9I A;  2HZT A;  2MD5 A;  4I09 A;  1KU7 A;  3Q5F A;  3R61 A;  3P7N A;  4XBF A;  3F23 A;  3LST A;  3TQN A;  1D8J A;  2RC4 A;  3KZY A;  3ERE D;  4A6E A;  2Y0M A;  2OU2 A;  3P9K A;  4XSX F;  4ZZL A;  2H27 A;  3KP7 A;  4OIQ F;  5BOX A;  4U0W A;  4M74 A;  4PZJ A;  3HIF A;  2DK5 A;  3F72 A;  1XGM A;  2DK8 A;  1KQ9 A;  3P9C A;  2FNP A;  2YU3 A;  3LAP A;  2VBW A;  2C6Y A;  1BI0 A;  2EWN A;  3I53 A;  2O8X A;  5DUI A;  1I1G A;  1J59 A;  4BYY A;  2LKP A;  3BJ6 A;  4EV0 A;  2QQA A;  2Y48 A;  3O3K A;  4HX4 A;  3KP6 A;  2QQ9 A;  1DP7 P;  2STT A;  4G6Q A;  3KLN A;  4CXF A;  4HA8 A;  1AOY A;  1UFM A;  1O7F A;  4BAY A;  1IUY A;  2A68 F;  5LGN A;  1SD5 A;  2H09 A;  5LGT A;  2P4W A;  5EEG A;  3PFI A;  1FWZ A;  2O3F A;  1B1B A;  1EH6 A;  5ICE A;  1XGO A;  5H6Q A;  5JFR A;  4PGH A;  4HZF A;  3KZZ A;  4EJT A;  1K78 A;  3SHF A;  4EM0 B;  5LGU A;  2EV6 A;  3ISP A;  2VBY A;  3QP5 A;  1J9I A;  5F6F A;  5K5Q A;  3K69 A;  2FA5 A;  2G9W A;  1HSJ A;  3E6M A;  2QQB A;  3RDI A;  1XCV A;  3J81 Z;  1KU9 A;  2IA2 A;  5BPI A;  2NRA C;  2VN2 A;  1K6O A;  1S29 A;  2Z99 A;  4EVI A;  3T5X A;  1P6R A;  4I2O A;  5J6X A;  1U3E M;  1XN7 A;  2EFW A;  1UHW A;  2DBB A;  4HDU A;  4UVC A;  2QEN A;  1EH8 A;  1YS6 A;  3H92 A;  1ONV A;  5FO5 A;  4IJA A;  4N9H A;  2VE8 A;  4Z2Y A;  3DP7 A;  2HQR A;  1FSE A;  2VT3 A;  4A5M A;  1UCR A;  2HKO A;  2YPR A;  2FOK A;  4MHG A;  2F5C A;  2CW0 F;  4QWQ A;  2E1C A;  1IXR C;  1P4A A;  2PLY A;  2XHK A;  1G3Y A;  1NHA A;  3U2R A;  1OPC A;  2K4J A;  3E3V A;  2EV5 A;  2OQR A;  5KK1 A;  2M1B A;  5H6R A;  3HOS A;  1FZP B;  5CJ9 A;  1R7J A;  1QBJ A;  5LEJ A;  2KJB A;  1U6G A;  1Z1D A;  1U78 A;  1I6X A;  1LQ1 A;  2MBF A;  1BI1 A;  4BNC A;  4A12 A;  3QU6 A;  1KA8 A;  4KIF A;  5E18 F;  3TO6 A;  3JSP A;  2ESN A;  4OIO F;  1FBU A;  2L02 A;  3BJO A;  3WTT C;  2HYG D;  4S04 A;  1SD4 A;  3Q9S A;  4PDK A;  3NEU A;  3I71 A;  3FXQ A;  2KRF A;  2EFP A;  1R5G A;  1BI3 A;  5HDK A;  3ZN1 A;  1J75 A;  5DV5 A;  4YFK F;  4G7H F;  5D5X B;  4HLY A;  2EFQ A;  4ENJ A;  4Q47 A;  2CYY A;  4KIC A;  3GVA A;  4KUM A;  3F22 A;  1ZRD A;  1SFE A;  1U5T B;  3V8J A;  3ECO A;  3RPQ A;  3E6C C;  3T8R A;  5DCM B;  3GX4 X;  2V1D A;  4L5J A;  3W6J B;  3GZ5 A;  4LJZ F;  4BHP A;  1ZHF A;  3J7A O;  4HX7 A;  1XSV A;  1S7O A;  1OMI A;  4JK1 X;  1X3U A;  5FGM A;  3CDH A;  4N0B A;  3HTS B;  4HBL A;  4I98 B;  2MC3 A;  4RAY A;  2FEZ A;  1FBS A;  3RI4 A;  3BZ6 A;  1J2X A;  4LK1 F;  1JHH A;  2PEX A;  3ML6 A;  1W7P B;  3KE2 A;  1ULY A;  3JAM K;  5E8G A;  4BH9 A;  2FMY A;  5CLS A;  1E2X A;  4UNO A;  1PUE E;  1J5Y A;  3T1B A;  4MQV A;  5FLX Z;  3FXU A;  4U7D A;  2CQK A;  3V4G A;  4CO8 A;  4YG2 F;  1BOA A;  4KFC A;  3ZMZ A;  2O61 A;  3WTV C;  4LFU A;  3RJP A;  3KLO A;  5TRD A;  2XVC A;  3KP2 A;  2XAF A;  5H20 A;  4ETS A;  1LB2 A;  5DD8 A;  2HQN A;  1ZG3 A;  3PQK A;  3R6S A;  4IRG A;  3V7R A;  3QPH A;  4LMY A;  5CVR A;  2ADU A;  4ZZD A;  4HDV A;  2P6S A;  1TQI A;  4A2U A;  3E6B A;  5K1Y A;  2GWR A;  1HQC A;  3FF5 A;  1UHM A;  2XUB A;  1IAW A;  4ASN A;  1R1U A;  2HYF A;  2M5W A;  3HUG A;  5ILV A;  2JZY A;  2P5V A;  1XDU A;  4A0Z A;  2FBH A;  3CUO A;  1XCB A;  4KIG A;  1FC3 A;  1H9T A;  4UVA A;  2YR2 A;  2R7D A;  3GZ6 A;  1MDM A;  3JTH A;  5FFZ A;  5AIQ A;  2K02 A;  2Q0O A;  3FMQ A;  2KJC A;  2DQL A;  5D5U B;  3CLO A;  4RGS A;  1BI2 A;  3PQJ A;  3COA C;  3EYY A;  1O3Q A;  2GXB A;  5EEH A;  1S7A A;  4UHT A;  1BN5 A;  4XLN F;  4A5N A;  4ZH4 F;  4XRF A;  4GO1 A;  2IT0 A;  2ZME A;  4QLC U;  4XLP F;  1IZ1 A;  2BBY A;  5ICF A;  4LGW A;  2IP2 A;  3WE2 A;  4EJV A;  2FML A;  3MWM A;  3F6V A;  1K79 A;  3CUQ A;  2IRF G;  2ZFW A;  4I01 A;  1ZRE A;  1HST A;  1ZYR F;  2RNJ A;  1T0F A;  3WGG A;  5L3E A;  2VXZ A;  2W57 A;  2M45 A;  3DV8 A;  2FE3 A;  1WSU A;  2GA1 A;  4JBA A;  5HVQ C;  2COM A;  2OD5 A;  1HKQ A;  2GAU A;  2EK5 A;  4OOI A;  1RUN A;  1ZAR A;  1MKM A;  3FWE A;  2L54 A;  1UST A;  1ZG1 A;  3T8T A;  5LLQ A;  3GLX A;  4XSZ F;  2GZW A;  3WE3 A;  5ICC A;  3AAF A;  4I02 A;  1D3Y A;  1Z6R A;  2R7F A;  1WWX A;  3GO5 A;  1CF7 A;  4Q4Z F;  1H0M A;  2VBX A;  1IN5 A;  3I54 A;  4CIC A;  4HQE A;  3TDU C;  1BJA A;  3VOE A;  5LHI A;  2JT1 A;  4G6D A;  4IPA A;  5JR3 A;  1FP1 D;  1L0O C;  2A69 F;  1K78 B;  3QPT A;  2L3D A;  2PMU A;  1LVA A;  4NB5 A;  2A6H F;  4IHS A;  4M71 A;  4Q5S F;  3FX3 A;  2QYO A;  3F8M A;  2QUF A;  1JXS A;  2ESH A;  2V79 A;  4RB0 A;  5ICG A;  1WQ2 A;  1BM9 A;  2DQR A;  4BHC A;  4MEX F;  2MA3 A;  1FYK A;  4P55 A;  1S6L A;  4ESF A;  4EM1 A;  3FMR A;  2A61 A;  3M9A A;  5L3C A;  2B0L A;  3ZP5 A;  4CHU A;  2BYV E;  2UXX A;  4RB3 C;  4A0Y A;  4Y15 A;  1F9N A;  1MZB A;  4FHT A;  2FNA A;  2LF8 A;  4EJU A;  5DYM A;  4AIJ A;  3OOP A;  1W5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...