1DP9A

Crystal structure of imidazole-bound fixl heme domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp9A00
5IS1A 4BBUA 2QJ5A 3K3CA 2VV6A 4I39A 3NHQA 4I3AA 4L9FA 3VE4A 2PDRA 3MJQA 4F3LB 4EW7A 3LI9A 4LRZE 1OT9A 1F98A 1S4SA 4HOIA 4EERA 4HY8A 4PKYG 3NJAA 4NXGA 1UWNX 2ZOHA 3B33A 3HJKA 1S1YA 2QHKA 1T19A 2D02A 3F1PB 4DJ2A 5AVFA 2BASA 3C2WA 1OJ5A 3GECA 5HDCA 3VOLA 3E4PA 2EA9A 3A0SA 1XFQA 3OLOA 3MFXA 2I9VA 3H9WA 1JNUA 2R78A 3G6OA 2JHEA 2QJ7A 3CWFA 3H7WA 1OTAA 1P0ZA 1T1CA 3F1NB 1OTEA 4EETB 1X0OA 3UMEA 5J3WA 3GDIA 3BY8A 2Z6DA 4KUKA 4WUJA 5DJTA 4H6JB 1S4RA 4KQDA 5G4ZA 5HD5A 2QKPA 3E4QA 3K3DA 5F68A 2WKPA 2PYRA 1TS0A 4NXBA 3SW1A 1OTDA 5DKLA 1BYWA 2K7SA 2A24B 2KX6A 3F1OA 1T1AA 1Y28A 2M1CA 4XT2A 1GSWA 3C8CA 4F3LA 4HI4A 1GSXA 3F1OB 3MQQA 4PKYA 4HIAA 3UE6A 3IS2A 2CMNA 4HP9A 3D72A 4GW9A 4R38A 5J7EA 4HQAA 4R6LA 2V1BA 2V0UA 1OT6A 1XJ2A 3ICYA 5HD3A 1LSWA 1S1ZA 3UB7A 3EEHA 4HHDA 4R70A 1NWZA 3ULFA 3NOUC 2P7JA 3BY9A 2PHYA 1UWPX 4LPZA 3MQOA 1OJGA 2GJ3A 3FG8A 3MXQA 3NOTC 3UB9A 4EEPA 2V9AA 4HNBA 4I3IA 1OTIA 3RH8B 4I38A 5HSQA 3A0RA 4E04A 4L9EA 5TBMA 3CAXA 3H82A 4GHIB 3HJIA 4RQ9A 3RTYA 3FC7A 4KUOA 2KDKA 1T1BA 5F5YA 5TBMB 1XJ4A 4BBTA 3H82B 3ZQ5A 4DJ3A 4EESA 2PR6A 4MN6A 4NXFA 1S66L 4HH2A 2J80A 1WA9A 2A24A 1D06A 4HJ3A 1XJ3A 1DP8A 3A0VA 1ODVA 3IS2B 5F6AA 1LSVA 1EW0A 2OWJA 3E4OA 5IU1A 2QWSA 4YWZA 3UB6A 1XFNA 3PHYA 1LSXA 5DKKA 1LL8A 2WKQA 3H7WB 2YKHA 3KX0X 4JGQA 3LI8A 3P7NA 4WF0A 4EXOA 5HWVA 1N9NA 2OOLA 5G4YA 1N9LA 4K08A 2INWA 2L1MA 3UB8A 2V0WA 3EWKA 3BWLA 2W0NA 2PD7A 3IBRA 3LIEA 3LIFA 1V9YA 4GHIA 4LRXC 4JGRA 2PR5A 4WL9A 1TS7A 1DRMA 1DP9A 1DP6A 1VB6A 3LIBA 3T50A 5AVEA 4B9OA 5EFWA 3LIDA 1D7EA 2JN7A 4WLAA 4XT2B 4LRYC 2Z6CA 2ZOIA 5HZHA 1S67L 1V9ZA 1TS6A 4GS9B 2PD8A 4I3JA 4R3AA 1T18A 4I5SA 2ZBBA 4EQ1A 5HDDA 2B02A 5A8BA 4HJ6A 4JGPA 4GS9A 4WN5A 4MN5A 1MZUA 4HH3A 5F69A 1KOUA 1UGUA 2L4RA 1OTBA 4HP4A 3CLOA 3PYPA 4HJ4A 4LLOB 2H28A 2VLGA 2V1AA 2VV7A 3F1PA 4NXEA 5HWTA 3LUQA 1N9OA 5HDSA 3VE3A 5KIZA 1F9IA 1XJ6A 2YKFA 3LICA 2OWHA 4L9GA 3LYXA 3LIAA 2W27A 4JGOA 5I5LA 3UMDA 1GSVA 1TS8A 3NOPC 2L0WA 4EEUA 2WKRA 2D01A 5HWWA 2VEAA 3F1NA 5J4EA 4GCZA 1LT0A 1P97A 2PYPA 4H6JA 4M4XA 5DJUA 4BBVA 1G28A 2HV1A 2VV8A 3MR0A
chains in the Genus database with same CATH superfamily
5JYOA 2QJ5A 3HJKA 4EUVA 2QHKA 5D3OA 3C2WA 3V39A 3IHAA 2A2LA 4E3JA 1DJCA 3NDEA 3FWLA 4FOFA 3UMEA 3IX3A 1XKZA 1U60A 1MC0A 3BFDA 4PMAA 3ZHHA 3MF0A 1GSWA 4UHUA 1K54A 5HWVA 5KMWA 5HPFA 4Z1WA 3NOUC 3SS5A 3ZNYA 2GJ3A 3UB9A 3DW0A 1W8QA 4S2IA 4Y13A 1A0KA 1QMEA 4BBTA 4YINA 3PR6A 4QB8A 1WA9A 2A24A 3IS2B 4GD8A 4LFUA 3KSHA 4WZ5A 2V2FF 3MSHA 5TFQA 3HLWA 3LR3A 4WF0A 1PZPA 3FKVA 3ZG8B 3KYQA 3N8SA 1IFQA 5F83A 3VP4A 4WMCA 4H8RA 5EE8A 2HP6A 4WEJA 2Z6CA 5FQ9A 1S67L 1TS6A 3HLEA 4N9KA 5A8BA 1N4OA 3BLMA 4ZTKA 2XGNA 3VE3A 4KQOA 4DXBA 3BLSA 4OPZA 4BWIA 5E2EA 3E0YA 1SCWA 3F1NA 3FKWA 2VA0A 4BBUA 2W3HA 3MS6A 3EOIA 2WZZA 3UO9A 4RX2A 2E8JA 1CK3A 3M2JA 3MKEA 3RXWA 1E3UD 4GB7A 3WRZA 2KOIA 3OLOA 3A3DA 1LI9A 3SH8A 2HDSA 4X68A 1Q2QA 3IXGA 5CEBA 1MKIA 2H0TA 3N8LA 2B5RA 3P98A 5HPIA 1OTDA 2VKSA 2PU2A 2KX6A 3B47A 5HX9A 5K5BA 4DF6A 5TR7A 3IF6B 4F3LA 5M1AA 5KSCA 1F5MA 1I2SA 1CEFA 5CRFA 1H0MA 1PW1A 1OJGA 5U47A 1FQGA 4UA6A 4UQIS 4LV3A 4OKPA 4Y0TA 1FSWA 5F5YA 4E3NA 3H82B 2J80A 2ZQ7A 4O8GA 1YT4A 1IYQA 3G32A 4K0XA 1XFNA 3N6IA 1LL8A 4K0WA 3L9KA 2PBYA 1PI4A 2EX6A 3L7HA 4HEFA 2JC7A 3PBTA 3EWKA 4FH4A 4WEKA 2PD7A 2V20A 3SS4A 5HAQA 4S2JA 2VGLS 2PD8A 4HJ6A 1W7FA 3D9YA 4WN5A 3CUEA 3EGDC 1VEUB 4Q0IA 5CGSA 5CX7A 2WGIA 1K55A 1H3QA 3LIAA 3CI6A 2L0WA 4JXVA 3LY4A 2PYPA 1NXYA 4BBVA 4ID4A 2EFUA 5IS1A 3IX8A 3TRCA 2XFSA 2W1TB 5EM0A 4HY8A 2UV0E 5EVEA 1UWNX 3B33A 2J7VA 1VETA 4B4ZA 1YAXA 3F1PB 1ALQA 4Z9QA 3IH8A 2XF3A 2ZC6B 4WBGA 1KVMA 4WMCD 3HL9A 5E43A 4MLLA 2Z6DA 3PAGA 1JWPA 3E4QA 4F94A 4BENA 4HI4A 4ARZA 2J9OA 5FEFA 4CPKA 3D72A 3GRJA 4R6LA 4DMZA 1YM1A 2J8YA 4X55A 4GD6A 3O87A 4HHDA 1IEMA 3NOTC 1MY8A 1FCMA 4BD0A 5TBMA 3H82A 3V50A 4DJ3A 4QY5A 3CG5A 4D60A 1D06A 1LSVA 1E3UA 1ONGA 2OWJA 1W63Q 2EWWA 2X01A 3DTEA 1L0GA 3C38A 3VOYA 4N1HA 3KX0X 3T4KA 3HUOA 1BSGA 2G2UA 4IVIA 1KVLA 3EGXC 4U3TA 1V9YA 5FQMA 4KQRA 4L0LA 2ZOIA 1VEUA 1G68A 4MNRA 3ZVWA 3W4QA 4WM9A 1OMEA 2B95A 1K56A 3E2LA 1NJ4A 4LENA 5DJUA 4S2OA 5DTSA 1PWCA 4L9FA 1OPXA 3O86A 4CLCB 4KZ8A 3JVVA 2Z2MB 4S2PA 4QJGA 5CECA 2Y79A 5HARA 3CITA 4OQ0A 4P0MA 1PYYA 4Y0OA 1VHMA 4Y5FA 2XH9A 4G3VA 4M3KA 4JF6A 1BLCA 1BULA 3HJIA 5EPHA 4OLDA 5KSHA 5DFYA 5FAPA 2XDMA 3K3DA 1Y28A 4HESA 1YMSA 3HUMA 3ZG7B 2CMNA 3JPUA 1CI9A 1Y4OA 3M6BA 3MXQA 3OZHA 4FD8A 4I3IA 3V3SA 5GLAA 3OPHA 1W5DA 4BL3A 5FAOA 3B3XA 5E2GA 2Y2JA 2Y2QA 3T4OA 1MPLA 5DF9A 3CHWP 5LBRA 4HBUA 5A93A 3MFDA 2EX8A 3Q1FA 3LGOA 2H5SA 3GMWA 1QMFA 2G2WA 1N9LA 2K2NA 2XEPA 2Y2NA 5G4YA 3FV7A 3UY6A 1GA0A 4JGRA 2X02A 2V8CA 1DP6A 4KZ4A 2ZC4B 3IF6A 4LRYC 3G30A 4MBFA 5EV0A 1ESIA 3ZG0A 3HLCA 2IA2A 2JBFA 4EBNA 4UAAA 1HVBA 2VLGA 1ES2A 4CQHA 1F9IA 3BYDA 3BEBA 2WKRA 3NECA 1H5XA 4RA7A 5GLCA 1LT0A 2P74A 5CTMA 3D4FA 5AVFA 3CMZA 4GLQA 2P04A 4QPRA 4EERA 3PBRA 2WADA 5FA7A 3AGDA 3WS1A 3A0SA 1ACFA 3CWFA 3H7WA 5J3WA 4H6JB 3VMAA 4R0QA 2WKEA 2PYRA 2A24B 1C3BA 3NCKA 5C5KA 4PAUA 4GW9A 4HQAA 4NEED 3KYZA 3CAXA 4BD1A 3E2KA 5GHZA 2PR6A 1K6RA 4GJ4A 2EX2A 1ODVA 1PW8A 1CF0A 3QHYA 3GTCA 4E3OA 2ZM2A 4KENB 2ZQ8A 1W63M 2L1MA 3T4JA 3W2ZA 2PR5A 2AVXA 2V8FA 2G7UA 1K54C 2PT7A 1T18A 3ZG9B 4OP5A 4JGPA 2DRWA 5CTNA 1CJFA 2L4RA 1OTBA 2Y59A 1NLZA 2CC1A 4HJ4A 4EWFA 3Q82A 3LICA 3QP8A 1GSVA 1TS8A 3ZG5A 1P97A 3BFGA 1LL9A 3NHQA 5M18A 2Y2GA 2XRNA 4F3LB 1KGFA 2B18A 4X69A 5F1FA 1PI5A 5EVIB 4ZAMA 4EBLA 1TDLA 4WZ4A 1LLBA 1OTAA 4QD4A 4E3LA 3HREA 1BTLA 2XSSA 3BY8A 4KZ3A 4E3MA 4YFMA 4CLCC 4B4XA 4II7A 5AQ7A 3K2NA 2PHYA 5GLBA 2X71A 4XUXA 4MDZA 1PRQA 3A0RA 3VFHA 4RQ9A 3FC7A 5TBMB 3FPWA 3M2KA 3N7WA 3ZQ5A 4P87A 4MN6A 4NXFA 3T1SA 1SDNA 5CHUA 4UQIM 2OAP1 5DKKA 3CZDA 3DWKA 3PHYA 2WKQA 4PM5A 2IWDA 4UEYA 2OLVA 4AFIA 4OOYA 2VX8A 4KZAA 4PM9A 2W1TA 3DBAA 4EQ1A 2MJ6A 1PNEA 4OP8A 1KOUA 4X6TA 3UDXA 3RXXA 5I5LA 3LYXA 4JGOA 4OONA 5JYPA 2VEAA 2A3UA 1SKOB 1YLZA 5E2HA 4ZDXA 2VK3A 3TG9A 1FOFA 4I39A 1BLHA 1YLJA 3O3VA 1S4SA 4ARZB 1RGZA 2Y91A 2ZOHA 1MWTA 1Y54A 4DJ2A 1FCOA 3KO6A 4KZ7A 3VOLA 1H8YA 2ZMFA 3ITBA 2JHEA 3GSGA 3SW1A 2WKPA 4O0PA 1H8ZA 2Y55A 1ZHHB 4PM8A 5I94A 2VGKA 2IWBA 2HPBA 5MC7A 3T1RA 3RFBA 3NC8A 3O88A 4YNRA 1KGEA 5J7EA 3TOIA 4LV1A 2O9AA 3QP2A 1LSWA 1S1ZA 1RCJA 1GA9A 2V9AA 4QU3A 3IWQA 4R23A 5FI6A 2XA7M 4EESA 2XD5A 4IVKA 4FSFA 4HJ3A 2ZL1A 1XJ3A 5TJJA 1J3WA 3GQZA 5FQKA 4LCMA 3B42A 4N1XA 4S2NC 3H7WB 2YKHA 1KDSA 4EXOA 3N8RA 1G6AA 2OOLA 2P9VB 2LB5A 5HZHA 4OQHA 5HDDA 1E25A 2ACGA 2E8IA 4GS9B 5F1GA 4GZBA 5HAIA 5FDSA 3W4OA 4IJGA 2ZD8A 3T4SA 3SH9A 2XK1A 3NBLA 5E2FA 5AJGA 5M19A 5EM1A 4X1LA 1BLPA 4GCZA 1YLYA 2XQZA 4BMWA 2WZXA 4X53A 3C7VA 4DDSA 2XLNA 2DCFA 1EWZA 1CI8A 2BASA 2EA9A 1Q2PA 3G6OA 3UB6A 1P0ZA 4Y3IA 1XGJA 1OTEA 3LFVA 3QP5A 4KUKA 1G5UA 2EFXA 5FI7A 2Y4AA 3VV4A 2K7SA 3ISGA 1EROA 2A49A 2PAVP 5EVIC 1AXBA 2BLSA 5GLDA 3VFFA 1NWZA 4CLCE 4UA7A 3MQOA 2WAFA 2WGWA 2O0YA 3IT9A 3Q81A 3DAVA 4GHIB 1K56D 3RTYA 4KUOA 3V3RA 4IBXA 3UE3A 1TDGA 1FIKA 1ZG6A 4CJNA 5F82A 5EOOA 3EEAA 3UB8A 4JBFA 3LIEA 4P6ZS 5HD3A 1XA7A 3LIBA 3HLGA 3S7OA 4I3JA 3AGEA 3AGFA 3EQUA 1KE4A 2B02A 4ESPA 1UGUA 3PYPA 1CEGA 5HDSA 2QZ6A 2OLUA 2M7VA 5G18A 3BFFA 5AQ9A 4QWOA 4H6JA 4R4SA 3MXSA 5DTTA 4LV0A 2HV1A 4LV2A 4N92A 4U0TA 3K3CA 2VV6A 4S2LA 2GX5A 4GN2A 3BRMA 4MMNA 3LCEA 2JKGA 4GNUA 3D3OA 3IXBA 1S1YA 3W8KA 3C7UA 1PIOA 3U4LP 3VSKA 3E4PA 1K57A 3MFXA 2O99A 1JVJA 4ETXA 4PHTA 4E6WA 5G4ZA 5HD5A 2HZ5A 5L09A 2P08A 3OCLA 3F1OA 1SDEA 3V67A 2Y2IA 3IHBA 3OPRA 4Y17A 1Z09A 3MXRA 3P09A 3IWOA 3P01A 1UWPX 5DFXA 1S6RA 2J3TC 1P9WA 1JTDA 2ZC5B 1W8YA 1OTIA 4X56A 3OBFA 3GV9A 3G2YA 3E4OA 4R1GA 1IOUA 5CGXA 1GHPA 3QNCA 1N9NA 1E4DA 4WL9A 1TS7A 4O01A 1CQAA 1V9ZA 2WGVA 3JYIA 3NULA 1TEMA 3UPOA 1ES4A 1H8MA 5FDHA 2VV7A 3T4QA 3QP4A 4OOMA 4HBTA 2WKHA 2WAEA 3UDIA 2OWHA 4D2OA 4FCFA 4M4XA 1GHIA 1ESUA 1SKOA 3VE4A 1M6KA 1F98A 3T4TA 4Q8IA 4JXWA 1GCEA 1FILA 1BLSA 2BTFP 5HAPA 4NETA 4RYEA 5HDCA 1XFQA 4KZ6A 4IUKA 1JNUA 1D1JA 3IBJA 1HD8A 4WUJA 2QPNA 4IHQA 1TS0A 2I72A 2VGLM 2JKRM 3MQ0A 1EI5A 4XT2A 2WUQA 1XXMA 3NIAA 1K4FA 2Y2PA 2V1BA 1OT6A 3BQAA 4KG5A 4DDYA 3Q07A 3KYEA 3IX4A 4QY6A 2H10A 4NK3A 1LI0A 3Q7ZA 3HLBA 5FQIA 3ZFZA 4B88A 1S66L 4HH2A 3A0VA 1L0EA 1I2WA 4FH2A 1ZKJA 2V1ZA 3LR5A 1KE3A 3UE1A 3LI8A 5EVID 3UPNA 3DTMA 3LIFA 2QMIA 2HJ9C 2FFYA 4YOFA 4WZ5C 3OOVA 4RVAA 2PBDP 3KSGA 3S1YA 4DRTA 1PFLA 1XGIA 4GS9A 4HH3A 2C6WB 2ZM8A 5AQAA 2ZM0A 2HP9A 2JKTM 2HGVA 4OOLA 4R3BA 1P9RA 2JKTI 5HWWA 1BT5A 2W3EA 1HTZA 4C3QA 3HLDA 4OQGA 2GDNA 4DE1A 4E6XA 3NJAA 4PM7A 1MWRA 5FL3A 1WE4A 4ME4A 3H9WA 3C4PA 3GR2A 2R78A 4JKTA 3WS4A 4NKPA 3F1NB 2ZQDA 1SHVA 1X0OA 4ZJ1A 5J8XA 5GL9A 5F68A 2IWCA 2K31A 5GHXA 2ZQCA 3TJZC 2V0UA 1XJ2A 4DE2A 5CEDA 3WS2A 1XA1A 4LPZA 2W3FA 4R4RA 3LR4A 4E04A 2VZWA 4KG2A 2KDKA 4G3KA 3UNWA 1EW0A 3LR0A 3MKFA 1MKMA 5EECA 1FCNA 3S22A 4G3WA 3VSLA 4OVDA 5EUAA 2W0NA 2GNXA 2H0YA 4P6BA 1VB6A 5AVEA 1IYSA 2ZBBA 4X25A 4CLCA 2ZQ9A 3BM6A 3OPPA 5F69A 4GOGA 5KIZA 3LUQA 1N9OA 2Q9MA 2NUPC 3A3FA 3TW8A 3UMDA 5FATA 3KSFA 2Y2OA 4OPYA 1G28A 3UE6A 3HCYA 5EVLA 2M7UA 1DY6A 2HDRA 1OT9A 1NZUA 2FH5A 3A3EA 4K91A 1OJ5A 5IHVA 2WGWB 4Y2FA 1JWZA 3ZDJA 3G35A 2QKPA 5HL6A 1VM1A 3MMHA 4OPQA 3ZYTA 1K4EA 4A5RA 3F1OB 5GHYA 3IS2A 4HP9A 4OQIA 3ZNTA 4BL2A 3UB7A 2HDQA 4IBRA 3BW6A 2P7JA 1L3LA 2JKFA 3G31A 1ERMA 2UWXA 3EQVA 3HVFA 2JE5A 1IYPA 4O7DA 4S2MA 2Y2MA 3W4PA 3JVUA 4XUZA 3S7NA 5IU1A 2ZJ9A 4JGQA 4Q0JA 3A3JA 3CPTA 2HDUA 5BOHA 3T50A 1PWDA 1ERQA 4XT2B 1J9MA 2QYBA 4N9LA 3IF5A 3MZEA 2BG1A 3CLOA 2H28A 1BZAA 2R9XA 4BLMA 1ZC2A 2WK0A 4EV4A 3PBNA 1RP5A 2EXAA 2W27A 1ZTUA 3UDFA 4B93A 4EBPA 4MEZA 1W79A 1DJBA 4I3AA 2PDRA 3E98A 4LRZE 4HOIA 5TGFA 4ETZA 1O7EA 3LEZA 2ZLYA 5HW3A 1SZVA 4BQMA 1T19A 1K0KA 3ITAA 3GECA 3DTIA 3MBZA 4KZ9A 1YLWA 5A91A 3NY4A 2QJ7A 1S0WA 4Y7PA 3PXPA 2XR0A 5DKLA 1GHMA 3SZTA 3VP0A 1T1AA 2FFFB 3CUEC 4EQIA 3UB5P 3Q7VB 4WYYA 3MZDA 3T1QB 2C5WB 2OSUA 1ES5A 1IYOA 4HNBA 4NG2A 3QP1A 3KSIA 5DF7A 2VGJA 3BQ8A 1T1BA 3BFEA 4GDBA 5DF8A 3ZVTA 4ZJ3A 5F6AA 1PWGA 2QWSA 2KLIA 1ONHA 1K57C 3PBSA 4C75A 2W3GA 1FR1A 4Q0HA 2Z2LB 3V5MA 3P7NA 3LEQA 3IXDA 3FPVA 4K08A 2R9WA 1PZOA 5FQJA 5FSRA 4GHIA 3WWXA 3IF6C 4OPRA 2XROA 3PAEA 1DP9A 1L2SA 1NYMA 5EFWA 1F2KA 1D7EA 1LL5A 4U0XA 4JPMA 1MWSA 2W3DA 2ZMAA 1K38A 4RX3A 4P85A 1MZUA 3FYZA 4JF4A 1FR6A 1L0FA 3G2ZA 5EVIA 2HP5A 4PPRA 3F1PA 5HWTA 1G6OA 4ZJ2A 3R7WA 4MN7A 3TSGA 2OV5A 4EEUA 1XP4A 5FEGA 4E3KA 4R38A 4DN0A 4ZRRA 3MJQA 3WS5A 2Y2HA 3M6HA 3O5YA 1K25A 5L2FA 3G34A 1I5QA 3MZFA 1NRJA 1JWVA 1VQQA 3IH9A 1ES3A 2Y8HA 3IXHA 3T12B 5DJTA 1S4RA 2XFTA 4KQDA 4NXBA 3LY3A 2LB9A 4Y15A 1NLYA 5CHMA 3MQQA 2ZL1B 4HIAA 5AQBA 3S7QA 3GVBA 5FASA 5IT5A 5HFOA 3HBRA 4R70A 2ZC7A 3BY9A 3OCNA 5FI2A 1K55C 5L07A 3VP2A 3WRTA 4I38A 5EOEA 4IEDA 2HF6A 5L10A 3DTKA 1TVFA 4IUHA 2XA7S 2DNSA 1N9BA 1TF1A 1Z6FA 1L0DA 3N4IA 2O9CA 5DVAA 1YSQA 4YWZA 1YSPA 2OAQ1 2FZ0A 2PRFA 4S2NA 3CJMA 3PBQA 1YPRA 3IQAA 1DRMA 1MXOA 1AWIA 1HZOA 4R3AA 4JXGA 2J3TD 4MN5A 5HL1A 3R7WB 4HP4A 1O07A 4KZ5A 1IKGA 1XJ6A 2YKFA 2EWVA 5L8MA 4JLFA 5J4EA 1NRFA 3SOIA 2VV8A 1MBLA 3SS3A 1NYYA 1SKFA 4FUWA 4UA9A 3RJUA 2JCHA 3LI9A 1YQSA 2ZQAA 4DKIA 4EW7A 1YMXA 4PKYG 1WYBA 4S2KA 3BJNA 4DE0A 1KDWA 4JXSA 3QNBA 4WELA 3OC2A 3U2AA 4EETB 3GDIA 4Y0UA 5DTKA 1HLUP 3IWIA 3DWZA 2J3WA 5A92A 1IELA 2M1CA 1TD5A 2GZAA 2WYXA 3WS0A 2PU4A 4GKUA 3ZCZA 4OLGA 1NY0A 3ULFA 2HJEA 3VOZA 4C6YA 1LHYA 2P9VA 1YLTA 4EEPA 4MCWA 3RH8B 4L9EA 2RCXA 5CGWA 2ZC3B 1XJ4A 5A90A 3BECA 2W1RA 3T1XA 5FAQA 2DMWA 1XPBA 4GDNA 5FQQA 1IKIA 2INWA 3BWLA 4CLCD 4LRXC 3UN7A 3LIDA 4WLAA 2JN7A 2NUTC 4I5SA 4JF5A 4DE3A 2V1AA 3SH7A 4QHCA 3QP6A 4KZBA 1M40A 2D01A 4KQQA 1WYCA 1K6SA 5CERA 3G4PA 4ZBEA 2JKRI 1VETB 4NXGA 3ZGAB 3TE8A 2D02A 2WKIA 1MWUA 3S7PA 1DJAA 3HUNA 2I9VA 3C5AA 4PM6A 1T1CA 3UE0A 3VP1A 3I7JA 3S4XA 2ZMVA 1XX2A 1KE0A 4OH0A 3VP3A 1BYWA 4LCLA 3UPPA 2XD1A 4DXCA 3C8CA 4P6ZM 1GSXA 4E3IA 4PKYA 4BJPA 1STZA 3T4LA 1YLPA 3Q7VA 3ICYA 3C4OA 3EEHA 1NZOA 2O9BA 3PTEA 1FSYA 3FG8A 3CPTB 2VJWA 3BFCA 4LGWA 5HSQA 1JTGA 4EUZA 2RL3A 1ZG4A 3HLFA 5CXWA 4X1MA 2EXBA 5KZHA 1DP8A 3NI9A 3A3IA 1BUEA 4EU0A 1LSXA 4KG6A 3C30A 4MBHA 3OPLA 2V0WA 3IBRA 3R4KA 4XXRA 4B9OA 4FTXA 3LO7A 1YKDA 3NDGA 2Q0OA 1KGGA 3PBOA 4R3JA 5CHJA 2Q9NA 4LLOB 4NXEA 2J9PA 2Y2KA 4L9GA 2EX9A 3NOPC 2Y2LA 4MBKA 1RGYA 3FZCA 3MR0A
chains in the Genus database with same CATH topology
2QJ5A 3K3CA 2VV6A 4I3AA 4GLQA 2PDRA 2GX5A 2P04A 4QPRA 3E98A 4LRZE 4HOIA 4ETZA 4EERA 4MMNA 3PBRA 3HJKA 3D3OA 4EUVA 1S1YA 2QHKA 1T19A 3C2WA 3GECA 3E4PA 3A0SA 2A2LA 3MFXA 2O99A 2QJ7A 3CWFA 3H7WA 4FOFA 3UMEA 4ETXA 4PHTA 5J3WA 3PXPA 1MC0A 4H6JB 5G4ZA 5HD5A 2PYRA 5DKLA 2P08A 3OCLA 2A24B 3F1OA 3MF0A 3V67A 1T1AA 1GSWA 3CUEC 5HWVA 5C5KA 4PAUA 4GW9A 5HPFA 4HQAA 4Z1WA 3NOUC 3P01A 1UWPX 4NEED 5DFXA 2GJ3A 3UB9A 2J3TC 1P9WA 3KYZA 4HNBA 1OTIA 3KSIA 3CAXA 3BQ8A 1T1BA 4BBTA 3OBFA 2PR6A 3PR6A 1WA9A 2A24A 4GJ4A 3IS2B 1ODVA 5F6AA 3KSHA 3E4OA 1IOUA 2QWSA 2KLIA 3PBSA 2W3GA 4Q0HA 3LR3A 3P7NA 4WF0A 1N9NA 3FPVA 1W63M 4K08A 3KYQA 2L1MA 3T4JA 1IFQA 4GHIA 4WL9A 3W2ZA 2PR5A 2XROA 1TS7A 1DP9A 4O01A 4WEJA 5EFWA 1D7EA 2G7UA 2Z6CA 1S67L 1V9ZA 1TS6A 2PT7A 1T18A 2W3DA 5A8BA 4JGPA 1MZUA 1H8MA 2L4RA 1OTBA 1NLZA 4HJ4A 2VV7A 3F1PA 5HWTA 1G6OA 3T4QA 3R7WA 3VE3A 4KQOA 4OOMA 4MN7A 3LICA 2OWHA 4BWIA 1GSVA 1TS8A 4EEUA 3E0YA 3F1NA 1P97A 4M4XA 4R38A 2VA0A 4BBUA 2W3HA 4DN0A 3EOIA 3NHQA 3VE4A 2XRNA 4ZRRA 3MJQA 4F3LB 1F98A 3T4TA 2B18A 3O5YA 5HDCA 1NRJA 2KOIA 1XFQA 3OLOA 4IUKA 1JNUA 3IBJA 1OTAA 2Y8HA 2XSSA 3BY8A 4WUJA 5DJTA 1S4RA 4KQDA 4IHQA 5HPIA 4NXBA 1TS0A 2VGLM 2JKRM 2LB9A 3MQ0A 1OTDA 2VKSA 1NLYA 2KX6A 3B47A 4CLCC 5K5BA 4XT2A 4II7A 4F3LA 3MQQA 3S7QA 4HIAA 1F5MA 2V1BA 1OT6A 5IT5A 3BQAA 4R70A 3BY9A 3K2NA 2PHYA 3OCNA 1OJGA 4MDZA 4UQIS 4I38A 3A0RA 2HF6A 4RQ9A 3FC7A 5F5YA 5TBMB 3FPWA 3H82B 2XA7S 4IUHA 3ZQ5A 4MN6A 4NXFA 1S66L 4HH2A 2J80A 4O8GA 1TF1A 3A0VA 4UQIM 2OAP1 2O9CA 1YSQA 4YWZA 1XFNA 3PHYA 5DKKA 1YSPA 1LL8A 3LR5A 2WKQA 2OAQ1 2FZ0A 3LI8A 4UEYA 3PBQA 3PBTA 3EWKA 4WEKA 3LIFA 4AFIA 2PD7A 2HJ9C 1DRMA 2VX8A 4YOFA 3OOVA 2VGLS 3KSGA 2W1TA 4R3AA 2PD8A 3DBAA 4EQ1A 2MJ6A 4HJ6A 4GS9A 2J3TD 4WN5A 4MN5A 3CUEA 4HH3A 1KOUA 3EGDC 3R7WB 4Q0IA 4HP4A 2JKTM 5CX7A 2HGVA 4OOLA 1H3QA 1XJ6A 2YKFA 2EWVA 5I5LA 3LYXA 3LIAA 1P9RA 4JGOA 5L8MA 2JKTI 3CI6A 2L0WA 5HWWA 2VEAA 5J4EA 2W3EA 2PYPA 4BBVA 2VV8A 5IS1A 3TRCA 4I39A 4EW7A 3LI9A 1S4SA 2W1TB 4ARZB 4HY8A 4PKYG 3NJAA 1UWNX 2ZOHA 3B33A 1YAXA 3F1PB 4DJ2A 3BJNA 3KO6A 3VOLA 5FL3A 4WELA 4ME4A 2ZMFA 3OC2A 3H9WA 2R78A 3U2AA 2JHEA 4NKPA 3F1NB 4EETB 1X0OA 3GDIA 2Z6DA 3E4QA 5F68A 3SW1A 2WKPA 4O0PA 1ZHHB 2K31A 2J3WA 2M1CA 1TD5A 2GZAA 4HI4A 4ARZA 5MC7A 3RFBA 3D72A 4YNRA 5J7EA 4R6LA 3TJZC 4DMZA 2V0UA 2O9AA 1XJ2A 1LSWA 1S1ZA 3ULFA 4HHDA 2HJEA 4LPZA 4EEPA 3NOTC 2W3FA 2V9AA 4MCWA 3RH8B 3LR4A 4E04A 4L9EA 2VZWA 5TBMA 3H82A 2XA7M 2KDKA 1XJ4A 4DJ3A 4EESA 1D06A 4FSFA 2W1RA 4HJ3A 1XJ3A 4G3KA 1LSVA 1EW0A 2OWJA 3LR0A 1W63Q 2EWWA 5TJJA 3B42A 1MKMA 3C38A 3H7WB 2YKHA 3KX0X 4G3WA 3T4KA 2DMWA 4EXOA 2OOLA 3EGXC 2LB5A 2INWA 5HZHA 3BWLA 2W0NA 2GNXA 4LRXC 5HDDA 4CLCD 1V9YA 1VB6A 5AVEA 4L0LA 3LIDA 4WLAA 2JN7A 2ZOIA 4GS9B 2NUTC 4I5SA 2ZBBA 4CLCA 4IJGA 5F69A 3T4SA 2V1AA 5KIZA 3LUQA 1N9OA 5AJGA 2NUPC 3UMDA 3TW8A 2D01A 3KSFA 4GCZA 4BMWA 5DJUA 1G28A 3UE6A 3HCYA 4L9FA 2M7UA 1OPXA 2JKRI 1OT9A 4NXGA 3TE8A 4CLCB 3JVVA 2FH5A 2D02A 5AVFA 2BASA 1OJ5A 2Y79A 2EA9A 3CITA 3S7PA 2I9VA 4Y5FA 1VHMA 3G6OA 3HJIA 4G3VA 3UB6A 4Y2FA 1P0ZA 1T1CA 4Y3IA 1OTEA 3LFVA 5KSHA 5DFYA 4KUKA 2ZMVA 2QKPA 3K3DA 5HL6A 3VV4A 1BYWA 2K7SA 3MMHA 1Y28A 3ZYTA 3C8CA 4P6ZM 1GSXA 3F1OB 4PKYA 3IS2A 2CMNA 4HP9A 4BJPA 1STZA 3T4LA 3UB7A 3ICYA 3EEHA 2O9BA 3BW6A 1NWZA 4CLCE 2P7JA 3MQOA 3FG8A 3MXQA 3EQVA 4I3IA 2VJWA 2O0YA 5HSQA 4GHIB 3RTYA 4KUOA 3UE3A 3JVUA 1DP8A 3S7NA 3T4OA 5IU1A 5DF9A 5LBRA 4EU0A 1LSXA 4JGQA 3C30A 4Q0JA 3EEAA 1N9LA 2K2NA 3UB8A 2V0WA 3IBRA 3LIEA 4P6ZS 5G4YA 5HD3A 4JGRA 3T50A 3R4KA 1DP6A 3LIBA 4B9OA 3S7OA 4XT2B 4LRYC 2QYBA 4I3JA 1YKDA 3EQUA 2B02A 2IA2A 1UGUA 3PBOA 3CLOA 3PYPA 4LLOB 2H28A 2VLGA 4NXEA 5HDSA 4CQHA 1F9IA 3PBNA 4L9GA 2W27A 2M7VA 1ZTUA 3NOPC 2WKRA 1LT0A 4H6JA 4B93A 2HV1A 3MR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IS1 A;  4BBU A;  2QJ5 A;  3K3C A;  2VV6 A;  4I39 A;  3NHQ A;  4I3A A;  4L9F A;  3VE4 A;  2PDR A;  3MJQ A;  4F3L B;  4EW7 A;  3LI9 A;  4LRZ E;  1OT9 A;  1F98 A;  1S4S A;  4HOI A;  4EER A;  4HY8 A;  4PKY G;  3NJA A;  4NXG A;  1UWN X;  2ZOH A;  3B33 A;  3HJK A;  1S1Y A;  2QHK A;  1T19 A;  2D02 A;  3F1P B;  4DJ2 A;  5AVF A;  2BAS A;  3C2W A;  1OJ5 A;  3GEC A;  5HDC A;  3VOL A;  3E4P A;  2EA9 A;  3A0S A;  1XFQ A;  3OLO A;  3MFX A;  2I9V A;  3H9W A;  1JNU A;  2R78 A;  3G6O A;  2JHE A;  2QJ7 A;  3CWF A;  3H7W A;  1OTA A;  1P0Z A;  1T1C A;  3F1N B;  1OTE A;  4EET B;  1X0O A;  3UME A;  5J3W A;  3GDI A;  3BY8 A;  2Z6D A;  4KUK A;  4WUJ A;  5DJT A;  4H6J B;  1S4R A;  4KQD A;  5G4Z A;  5HD5 A;  2QKP A;  3E4Q A;  3K3D A;  5F68 A;  2WKP A;  2PYR A;  1TS0 A;  4NXB A;  3SW1 A;  1OTD A;  5DKL A;  1BYW A;  2K7S A;  2A24 B;  2KX6 A;  3F1O A;  1T1A A;  1Y28 A;  2M1C A;  4XT2 A;  1GSW A;  3C8C A;  4F3L A;  4HI4 A;  1GSX A;  3F1O B;  3MQQ A;  4PKY A;  4HIA A;  3UE6 A;  3IS2 A;  2CMN A;  4HP9 A;  3D72 A;  4GW9 A;  4R38 A;  5J7E A;  4HQA A;  4R6L A;  2V1B A;  2V0U A;  1OT6 A;  1XJ2 A;  3ICY A;  5HD3 A;  1LSW A;  1S1Z A;  3UB7 A;  3EEH A;  4HHD A;  4R70 A;  1NWZ A;  3ULF A;  3NOU C;  2P7J A;  3BY9 A;  2PHY A;  1UWP X;  4LPZ A;  3MQO A;  1OJG A;  2GJ3 A;  3FG8 A;  3MXQ A;  3NOT C;  3UB9 A;  4EEP A;  2V9A A;  4HNB A;  4I3I A;  1OTI A;  3RH8 B;  4I38 A;  5HSQ A;  3A0R A;  4E04 A;  4L9E A;  5TBM A;  3CAX A;  3H82 A;  4GHI B;  3HJI A;  4RQ9 A;  3RTY A;  3FC7 A;  4KUO A;  2KDK A;  1T1B A;  5F5Y A;  5TBM B;  1XJ4 A;  4BBT A;  3H82 B;  3ZQ5 A;  4DJ3 A;  4EES A;  2PR6 A;  4MN6 A;  4NXF A;  1S66 L;  4HH2 A;  2J80 A;  1WA9 A;  2A24 A;  1D06 A;  4HJ3 A;  1XJ3 A;  1DP8 A;  3A0V A;  1ODV A;  3IS2 B;  5F6A A;  1LSV A;  1EW0 A;  2OWJ A;  3E4O A;  5IU1 A;  2QWS A;  4YWZ A;  3UB6 A;  1XFN A;  3PHY A;  1LSX A;  5DKK A;  1LL8 A;  2WKQ A;  3H7W B;  2YKH A;  3KX0 X;  4JGQ A;  3LI8 A;  3P7N A;  4WF0 A;  4EXO A;  5HWV A;  1N9N A;  2OOL A;  5G4Y A;  1N9L A;  4K08 A;  2INW A;  2L1M A;  3UB8 A;  2V0W A;  3EWK A;  3BWL A;  2W0N A;  2PD7 A;  3IBR A;  3LIE A;  3LIF A;  1V9Y A;  4GHI A;  4LRX C;  4JGR A;  2PR5 A;  4WL9 A;  1TS7 A;  1DRM A;  1DP9 A;  1DP6 A;  1VB6 A;  3LIB A;  3T50 A;  5AVE A;  4B9O A;  5EFW A;  3LID A;  1D7E A;  2JN7 A;  4WLA A;  4XT2 B;  4LRY C;  2Z6C A;  2ZOI A;  5HZH A;  1S67 L;  1V9Z A;  1TS6 A;  4GS9 B;  2PD8 A;  4I3J A;  4R3A A;  1T18 A;  4I5S A;  2ZBB A;  4EQ1 A;  5HDD A;  2B02 A;  5A8B A;  4HJ6 A;  4JGP A;  4GS9 A;  4WN5 A;  4MN5 A;  1MZU A;  4HH3 A;  5F69 A;  1KOU A;  1UGU A;  2L4R A;  1OTB A;  4HP4 A;  3CLO A;  3PYP A;  4HJ4 A;  4LLO B;  2H28 A;  2VLG A;  2V1A A;  2VV7 A;  3F1P A;  4NXE A;  5HWT A;  3LUQ A;  1N9O A;  5HDS A;  3VE3 A;  5KIZ A;  1F9I A;  1XJ6 A;  2YKF A;  3LIC A;  2OWH A;  4L9G A;  3LYX A;  3LIA A;  2W27 A;  4JGO A;  5I5L A;  3UMD A;  1GSV A;  1TS8 A;  3NOP C;  2L0W A;  4EEU A;  2WKR A;  2D01 A;  5HWW A;  2VEA A;  3F1N A;  5J4E A;  4GCZ A;  1LT0 A;  1P97 A;  2PYP A;  4H6J A;  4M4X A;  5DJU A;  4BBV A;  1G28 A;  2HV1 A;  2VV8 A;  3MR0 A; 
#chains in the Genus database with same CATH topology
 5JYO A;  2QJ5 A;  3HJK A;  4EUV A;  2QHK A;  5D3O A;  3C2W A;  3V39 A;  3IHA A;  2A2L A;  4E3J A;  1DJC A;  3NDE A;  3FWL A;  4FOF A;  3UME A;  3IX3 A;  1XKZ A;  1U60 A;  1MC0 A;  3BFD A;  4PMA A;  3ZHH A;  3MF0 A;  1GSW A;  4UHU A;  1K54 A;  5HWV A;  5KMW A;  5HPF A;  4Z1W A;  3NOU C;  3SS5 A;  3ZNY A;  2GJ3 A;  3UB9 A;  3DW0 A;  1W8Q A;  4S2I A;  4Y13 A;  1A0K A;  1QME A;  4BBT A;  4YIN A;  3PR6 A;  4QB8 A;  1WA9 A;  2A24 A;  3IS2 B;  4GD8 A;  4LFU A;  3KSH A;  4WZ5 A;  2V2F F;  3MSH A;  5TFQ A;  3HLW A;  3LR3 A;  4WF0 A;  1PZP A;  3FKV A;  3ZG8 B;  3KYQ A;  3N8S A;  1IFQ A;  5F83 A;  3VP4 A;  4WMC A;  4H8R A;  5EE8 A;  2HP6 A;  4WEJ A;  2Z6C A;  5FQ9 A;  1S67 L;  1TS6 A;  3HLE A;  4N9K A;  5A8B A;  1N4O A;  3BLM A;  4ZTK A;  2XGN A;  3VE3 A;  4KQO A;  4DXB A;  3BLS A;  4OPZ A;  4BWI A;  5E2E A;  3E0Y A;  1SCW A;  3F1N A;  3FKW A;  2VA0 A;  4BBU A;  2W3H A;  3MS6 A;  3EOI A;  2WZZ A;  3UO9 A;  4RX2 A;  2E8J A;  1CK3 A;  3M2J A;  3MKE A;  3RXW A;  1E3U D;  4GB7 A;  3WRZ A;  2KOI A;  3OLO A;  3A3D A;  1LI9 A;  3SH8 A;  2HDS A;  4X68 A;  1Q2Q A;  3IXG A;  5CEB A;  1MKI A;  2H0T A;  3N8L A;  2B5R A;  3P98 A;  5HPI A;  1OTD A;  2VKS A;  2PU2 A;  2KX6 A;  3B47 A;  5HX9 A;  5K5B A;  4DF6 A;  5TR7 A;  3IF6 B;  4F3L A;  5M1A A;  5KSC A;  1F5M A;  1I2S A;  1CEF A;  5CRF A;  1H0M A;  1PW1 A;  1OJG A;  5U47 A;  1FQG A;  4UA6 A;  4UQI S;  4LV3 A;  4OKP A;  4Y0T A;  1FSW A;  5F5Y A;  4E3N A;  3H82 B;  2J80 A;  2ZQ7 A;  4O8G A;  1YT4 A;  1IYQ A;  3G32 A;  4K0X A;  1XFN A;  3N6I A;  1LL8 A;  4K0W A;  3L9K A;  2PBY A;  1PI4 A;  2EX6 A;  3L7H A;  4HEF A;  2JC7 A;  3PBT A;  3EWK A;  4FH4 A;  4WEK A;  2PD7 A;  2V20 A;  3SS4 A;  5HAQ A;  4S2J A;  2VGL S;  2PD8 A;  4HJ6 A;  1W7F A;  3D9Y A;  4WN5 A;  3CUE A;  3EGD C;  1VEU B;  4Q0I A;  5CGS A;  5CX7 A;  2WGI A;  1K55 A;  1H3Q A;  3LIA A;  3CI6 A;  2L0W A;  4JXV A;  3LY4 A;  2PYP A;  1NXY A;  4BBV A;  4ID4 A;  2EFU A;  5IS1 A;  3IX8 A;  3TRC A;  2XFS A;  2W1T B;  5EM0 A;  4HY8 A;  2UV0 E;  5EVE A;  1UWN X;  3B33 A;  2J7V A;  1VET A;  4B4Z A;  1YAX A;  3F1P B;  1ALQ A;  4Z9Q A;  3IH8 A;  2XF3 A;  2ZC6 B;  4WBG A;  1KVM A;  4WMC D;  3HL9 A;  5E43 A;  4MLL A;  2Z6D A;  3PAG A;  1JWP A;  3E4Q A;  4F94 A;  4BEN A;  4HI4 A;  4ARZ A;  2J9O A;  5FEF A;  4CPK A;  3D72 A;  3GRJ A;  4R6L A;  4DMZ A;  1YM1 A;  2J8Y A;  4X55 A;  4GD6 A;  3O87 A;  4HHD A;  1IEM A;  3NOT C;  1MY8 A;  1FCM A;  4BD0 A;  5TBM A;  3H82 A;  3V50 A;  4DJ3 A;  4QY5 A;  3CG5 A;  4D60 A;  1D06 A;  1LSV A;  1E3U A;  1ONG A;  2OWJ A;  1W63 Q;  2EWW A;  2X01 A;  3DTE A;  1L0G A;  3C38 A;  3VOY A;  4N1H A;  3KX0 X;  3T4K A;  3HUO A;  1BSG A;  2G2U A;  4IVI A;  1KVL A;  3EGX C;  4U3T A;  1V9Y A;  5FQM A;  4KQR A;  4L0L A;  2ZOI A;  1VEU A;  1G68 A;  4MNR A;  3ZVW A;  3W4Q A;  4WM9 A;  1OME A;  2B95 A;  1K56 A;  3E2L A;  1NJ4 A;  4LEN A;  5DJU A;  4S2O A;  5DTS A;  1PWC A;  4L9F A;  1OPX A;  3O86 A;  4CLC B;  4KZ8 A;  3JVV A;  2Z2M B;  4S2P A;  4QJG A;  5CEC A;  2Y79 A;  5HAR A;  3CIT A;  4OQ0 A;  4P0M A;  1PYY A;  4Y0O A;  1VHM A;  4Y5F A;  2XH9 A;  4G3V A;  4M3K A;  4JF6 A;  1BLC A;  1BUL A;  3HJI A;  5EPH A;  4OLD A;  5KSH A;  5DFY A;  5FAP A;  2XDM A;  3K3D A;  1Y28 A;  4HES A;  1YMS A;  3HUM A;  3ZG7 B;  2CMN A;  3JPU A;  1CI9 A;  1Y4O A;  3M6B A;  3MXQ A;  3OZH A;  4FD8 A;  4I3I A;  3V3S A;  5GLA A;  3OPH A;  1W5D A;  4BL3 A;  5FAO A;  3B3X A;  5E2G A;  2Y2J A;  2Y2Q A;  3T4O A;  1MPL A;  5DF9 A;  3CHW P;  5LBR A;  4HBU A;  5A93 A;  3MFD A;  2EX8 A;  3Q1F A;  3LGO A;  2H5S A;  3GMW A;  1QMF A;  2G2W A;  1N9L A;  2K2N A;  2XEP A;  2Y2N A;  5G4Y A;  3FV7 A;  3UY6 A;  1GA0 A;  4JGR A;  2X02 A;  2V8C A;  1DP6 A;  4KZ4 A;  2ZC4 B;  3IF6 A;  4LRY C;  3G30 A;  4MBF A;  5EV0 A;  1ESI A;  3ZG0 A;  3HLC A;  2IA2 A;  2JBF A;  4EBN A;  4UAA A;  1HVB A;  2VLG A;  1ES2 A;  4CQH A;  1F9I A;  3BYD A;  3BEB A;  2WKR A;  3NEC A;  1H5X A;  4RA7 A;  5GLC A;  1LT0 A;  2P74 A;  5CTM A;  3D4F A;  5AVF A;  3CMZ A;  4GLQ A;  2P04 A;  4QPR A;  4EER A;  3PBR A;  2WAD A;  5FA7 A;  3AGD A;  3WS1 A;  3A0S A;  1ACF A;  3CWF A;  3H7W A;  5J3W A;  4H6J B;  3VMA A;  4R0Q A;  2WKE A;  2PYR A;  2A24 B;  1C3B A;  3NCK A;  5C5K A;  4PAU A;  4GW9 A;  4HQA A;  4NEE D;  3KYZ A;  3CAX A;  4BD1 A;  3E2K A;  5GHZ A;  2PR6 A;  1K6R A;  4GJ4 A;  2EX2 A;  1ODV A;  1PW8 A;  1CF0 A;  3QHY A;  3GTC A;  4E3O A;  2ZM2 A;  4KEN B;  2ZQ8 A;  1W63 M;  2L1M A;  3T4J A;  3W2Z A;  2PR5 A;  2AVX A;  2V8F A;  2G7U A;  1K54 C;  2PT7 A;  1T18 A;  3ZG9 B;  4OP5 A;  4JGP A;  2DRW A;  5CTN A;  1CJF A;  2L4R A;  1OTB A;  2Y59 A;  1NLZ A;  2CC1 A;  4HJ4 A;  4EWF A;  3Q82 A;  3LIC A;  3QP8 A;  1GSV A;  1TS8 A;  3ZG5 A;  1P97 A;  3BFG A;  1LL9 A;  3NHQ A;  5M18 A;  2Y2G A;  2XRN A;  4F3L B;  1KGF A;  2B18 A;  4X69 A;  5F1F A;  1PI5 A;  5EVI B;  4ZAM A;  4EBL A;  1TDL A;  4WZ4 A;  1LLB A;  1OTA A;  4QD4 A;  4E3L A;  3HRE A;  1BTL A;  2XSS A;  3BY8 A;  4KZ3 A;  4E3M A;  4YFM A;  4CLC C;  4B4X A;  4II7 A;  5AQ7 A;  3K2N A;  2PHY A;  5GLB A;  2X71 A;  4XUX A;  4MDZ A;  1PRQ A;  3A0R A;  3VFH A;  4RQ9 A;  3FC7 A;  5TBM B;  3FPW A;  3M2K A;  3N7W A;  3ZQ5 A;  4P87 A;  4MN6 A;  4NXF A;  3T1S A;  1SDN A;  5CHU A;  4UQI M;  2OAP 1;  5DKK A;  3CZD A;  3DWK A;  3PHY A;  2WKQ A;  4PM5 A;  2IWD A;  4UEY A;  2OLV A;  4AFI A;  4OOY A;  2VX8 A;  4KZA A;  4PM9 A;  2W1T A;  3DBA A;  4EQ1 A;  2MJ6 A;  1PNE A;  4OP8 A;  1KOU A;  4X6T A;  3UDX A;  3RXX A;  5I5L A;  3LYX A;  4JGO A;  4OON A;  5JYP A;  2VEA A;  2A3U A;  1SKO B;  1YLZ A;  5E2H A;  4ZDX A;  2VK3 A;  3TG9 A;  1FOF A;  4I39 A;  1BLH A;  1YLJ A;  3O3V A;  1S4S A;  4ARZ B;  1RGZ A;  2Y91 A;  2ZOH A;  1MWT A;  1Y54 A;  4DJ2 A;  1FCO A;  3KO6 A;  4KZ7 A;  3VOL A;  1H8Y A;  2ZMF A;  3ITB A;  2JHE A;  3GSG A;  3SW1 A;  2WKP A;  4O0P A;  1H8Z A;  2Y55 A;  1ZHH B;  4PM8 A;  5I94 A;  2VGK A;  2IWB A;  2HPB A;  5MC7 A;  3T1R A;  3RFB A;  3NC8 A;  3O88 A;  4YNR A;  1KGE A;  5J7E A;  3TOI A;  4LV1 A;  2O9A A;  3QP2 A;  1LSW A;  1S1Z A;  1RCJ A;  1GA9 A;  2V9A A;  4QU3 A;  3IWQ A;  4R23 A;  5FI6 A;  2XA7 M;  4EES A;  2XD5 A;  4IVK A;  4FSF A;  4HJ3 A;  2ZL1 A;  1XJ3 A;  5TJJ A;  1J3W A;  3GQZ A;  5FQK A;  4LCM A;  3B42 A;  4N1X A;  4S2N C;  3H7W B;  2YKH A;  1KDS A;  4EXO A;  3N8R A;  1G6A A;  2OOL A;  2P9V B;  2LB5 A;  5HZH A;  4OQH A;  5HDD A;  1E25 A;  2ACG A;  2E8I A;  4GS9 B;  5F1G A;  4GZB A;  5HAI A;  5FDS A;  3W4O A;  4IJG A;  2ZD8 A;  3T4S A;  3SH9 A;  2XK1 A;  3NBL A;  5E2F A;  5AJG A;  5M19 A;  5EM1 A;  4X1L A;  1BLP A;  4GCZ A;  1YLY A;  2XQZ A;  4BMW A;  2WZX A;  4X53 A;  3C7V A;  4DDS A;  2XLN A;  2DCF A;  1EWZ A;  1CI8 A;  2BAS A;  2EA9 A;  1Q2P A;  3G6O A;  3UB6 A;  1P0Z A;  4Y3I A;  1XGJ A;  1OTE A;  3LFV A;  3QP5 A;  4KUK A;  1G5U A;  2EFX A;  5FI7 A;  2Y4A A;  3VV4 A;  2K7S A;  3ISG A;  1ERO A;  2A49 A;  2PAV P;  5EVI C;  1AXB A;  2BLS A;  5GLD A;  3VFF A;  1NWZ A;  4CLC E;  4UA7 A;  3MQO A;  2WAF A;  2WGW A;  2O0Y A;  3IT9 A;  3Q81 A;  3DAV A;  4GHI B;  1K56 D;  3RTY A;  4KUO A;  3V3R A;  4IBX A;  3UE3 A;  1TDG A;  1FIK A;  1ZG6 A;  4CJN A;  5F82 A;  5EOO A;  3EEA A;  3UB8 A;  4JBF A;  3LIE A;  4P6Z S;  5HD3 A;  1XA7 A;  3LIB A;  3HLG A;  3S7O A;  4I3J A;  3AGE A;  3AGF A;  3EQU A;  1KE4 A;  2B02 A;  4ESP A;  1UGU A;  3PYP A;  1CEG A;  5HDS A;  2QZ6 A;  2OLU A;  2M7V A;  5G18 A;  3BFF A;  5AQ9 A;  4QWO A;  4H6J A;  4R4S A;  3MXS A;  5DTT A;  4LV0 A;  2HV1 A;  4LV2 A;  4N92 A;  4U0T A;  3K3C A;  2VV6 A;  4S2L A;  2GX5 A;  4GN2 A;  3BRM A;  4MMN A;  3LCE A;  2JKG A;  4GNU A;  3D3O A;  3IXB A;  1S1Y A;  3W8K A;  3C7U A;  1PIO A;  3U4L P;  3VSK A;  3E4P A;  1K57 A;  3MFX A;  2O99 A;  1JVJ A;  4ETX A;  4PHT A;  4E6W A;  5G4Z A;  5HD5 A;  2HZ5 A;  5L09 A;  2P08 A;  3OCL A;  3F1O A;  1SDE A;  3V67 A;  2Y2I A;  3IHB A;  3OPR A;  4Y17 A;  1Z09 A;  3MXR A;  3P09 A;  3IWO A;  3P01 A;  1UWP X;  5DFX A;  1S6R A;  2J3T C;  1P9W A;  1JTD A;  2ZC5 B;  1W8Y A;  1OTI A;  4X56 A;  3OBF A;  3GV9 A;  3G2Y A;  3E4O A;  4R1G A;  1IOU A;  5CGX A;  1GHP A;  3QNC A;  1N9N A;  1E4D A;  4WL9 A;  1TS7 A;  4O01 A;  1CQA A;  1V9Z A;  2WGV A;  3JYI A;  3NUL A;  1TEM A;  3UPO A;  1ES4 A;  1H8M A;  5FDH A;  2VV7 A;  3T4Q A;  3QP4 A;  4OOM A;  4HBT A;  2WKH A;  2WAE A;  3UDI A;  2OWH A;  4D2O A;  4FCF A;  4M4X A;  1GHI A;  1ESU A;  1SKO A;  3VE4 A;  1M6K A;  1F98 A;  3T4T A;  4Q8I A;  4JXW A;  1GCE A;  1FIL A;  1BLS A;  2BTF P;  5HAP A;  4NET A;  4RYE A;  5HDC A;  1XFQ A;  4KZ6 A;  4IUK A;  1JNU A;  1D1J A;  3IBJ A;  1HD8 A;  4WUJ A;  2QPN A;  4IHQ A;  1TS0 A;  2I72 A;  2VGL M;  2JKR M;  3MQ0 A;  1EI5 A;  4XT2 A;  2WUQ A;  1XXM A;  3NIA A;  1K4F A;  2Y2P A;  2V1B A;  1OT6 A;  3BQA A;  4KG5 A;  4DDY A;  3Q07 A;  3KYE A;  3IX4 A;  4QY6 A;  2H10 A;  4NK3 A;  1LI0 A;  3Q7Z A;  3HLB A;  5FQI A;  3ZFZ A;  4B88 A;  1S66 L;  4HH2 A;  3A0V A;  1L0E A;  1I2W A;  4FH2 A;  1ZKJ A;  2V1Z A;  3LR5 A;  1KE3 A;  3UE1 A;  3LI8 A;  5EVI D;  3UPN A;  3DTM A;  3LIF A;  2QMI A;  2HJ9 C;  2FFY A;  4YOF A;  4WZ5 C;  3OOV A;  4RVA A;  2PBD P;  3KSG A;  3S1Y A;  4DRT A;  1PFL A;  1XGI A;  4GS9 A;  4HH3 A;  2C6W B;  2ZM8 A;  5AQA A;  2ZM0 A;  2HP9 A;  2JKT M;  2HGV A;  4OOL A;  4R3B A;  1P9R A;  2JKT I;  5HWW A;  1BT5 A;  2W3E A;  1HTZ A;  4C3Q A;  3HLD A;  4OQG A;  2GDN A;  4DE1 A;  4E6X A;  3NJA A;  4PM7 A;  1MWR A;  5FL3 A;  1WE4 A;  4ME4 A;  3H9W A;  3C4P A;  3GR2 A;  2R78 A;  4JKT A;  3WS4 A;  4NKP A;  3F1N B;  2ZQD A;  1SHV A;  1X0O A;  4ZJ1 A;  5J8X A;  5GL9 A;  5F68 A;  2IWC A;  2K31 A;  5GHX A;  2ZQC A;  3TJZ C;  2V0U A;  1XJ2 A;  4DE2 A;  5CED A;  3WS2 A;  1XA1 A;  4LPZ A;  2W3F A;  4R4R A;  3LR4 A;  4E04 A;  2VZW A;  4KG2 A;  2KDK A;  4G3K A;  3UNW A;  1EW0 A;  3LR0 A;  3MKF A;  1MKM A;  5EEC A;  1FCN A;  3S22 A;  4G3W A;  3VSL A;  4OVD A;  5EUA A;  2W0N A;  2GNX A;  2H0Y A;  4P6B A;  1VB6 A;  5AVE A;  1IYS A;  2ZBB A;  4X25 A;  4CLC A;  2ZQ9 A;  3BM6 A;  3OPP A;  5F69 A;  4GOG A;  5KIZ A;  3LUQ A;  1N9O A;  2Q9M A;  2NUP C;  3A3F A;  3TW8 A;  3UMD A;  5FAT A;  3KSF A;  2Y2O A;  4OPY A;  1G28 A;  3UE6 A;  3HCY A;  5EVL A;  2M7U A;  1DY6 A;  2HDR A;  1OT9 A;  1NZU A;  2FH5 A;  3A3E A;  4K91 A;  1OJ5 A;  5IHV A;  2WGW B;  4Y2F A;  1JWZ A;  3ZDJ A;  3G35 A;  2QKP A;  5HL6 A;  1VM1 A;  3MMH A;  4OPQ A;  3ZYT A;  1K4E A;  4A5R A;  3F1O B;  5GHY A;  3IS2 A;  4HP9 A;  4OQI A;  3ZNT A;  4BL2 A;  3UB7 A;  2HDQ A;  4IBR A;  3BW6 A;  2P7J A;  1L3L A;  2JKF A;  3G31 A;  1ERM A;  2UWX A;  3EQV A;  3HVF A;  2JE5 A;  1IYP A;  4O7D A;  4S2M A;  2Y2M A;  3W4P A;  3JVU A;  4XUZ A;  3S7N A;  5IU1 A;  2ZJ9 A;  4JGQ A;  4Q0J A;  3A3J A;  3CPT A;  2HDU A;  5BOH A;  3T50 A;  1PWD A;  1ERQ A;  4XT2 B;  1J9M A;  2QYB A;  4N9L A;  3IF5 A;  3MZE A;  2BG1 A;  3CLO A;  2H28 A;  1BZA A;  2R9X A;  4BLM A;  1ZC2 A;  2WK0 A;  4EV4 A;  3PBN A;  1RP5 A;  2EXA A;  2W27 A;  1ZTU A;  3UDF A;  4B93 A;  4EBP A;  4MEZ A;  1W79 A;  1DJB A;  4I3A A;  2PDR A;  3E98 A;  4LRZ E;  4HOI A;  5TGF A;  4ETZ A;  1O7E A;  3LEZ A;  2ZLY A;  5HW3 A;  1SZV A;  4BQM A;  1T19 A;  1K0K A;  3ITA A;  3GEC A;  3DTI A;  3MBZ A;  4KZ9 A;  1YLW A;  5A91 A;  3NY4 A;  2QJ7 A;  1S0W A;  4Y7P A;  3PXP A;  2XR0 A;  5DKL A;  1GHM A;  3SZT A;  3VP0 A;  1T1A A;  2FFF B;  3CUE C;  4EQI A;  3UB5 P;  3Q7V B;  4WYY A;  3MZD A;  3T1Q B;  2C5W B;  2OSU A;  1ES5 A;  1IYO A;  4HNB A;  4NG2 A;  3QP1 A;  3KSI A;  5DF7 A;  2VGJ A;  3BQ8 A;  1T1B A;  3BFE A;  4GDB A;  5DF8 A;  3ZVT A;  4ZJ3 A;  5F6A A;  1PWG A;  2QWS A;  2KLI A;  1ONH A;  1K57 C;  3PBS A;  4C75 A;  2W3G A;  1FR1 A;  4Q0H A;  2Z2L B;  3V5M A;  3P7N A;  3LEQ A;  3IXD A;  3FPV A;  4K08 A;  2R9W A;  1PZO A;  5FQJ A;  5FSR A;  4GHI A;  3WWX A;  3IF6 C;  4OPR A;  2XRO A;  3PAE A;  1DP9 A;  1L2S A;  1NYM A;  5EFW A;  1F2K A;  1D7E A;  1LL5 A;  4U0X A;  4JPM A;  1MWS A;  2W3D A;  2ZMA A;  1K38 A;  4RX3 A;  4P85 A;  1MZU A;  3FYZ A;  4JF4 A;  1FR6 A;  1L0F A;  3G2Z A;  5EVI A;  2HP5 A;  4PPR A;  3F1P A;  5HWT A;  1G6O A;  4ZJ2 A;  3R7W A;  4MN7 A;  3TSG A;  2OV5 A;  4EEU A;  1XP4 A;  5FEG A;  4E3K A;  4R38 A;  4DN0 A;  4ZRR A;  3MJQ A;  3WS5 A;  2Y2H A;  3M6H A;  3O5Y A;  1K25 A;  5L2F A;  3G34 A;  1I5Q A;  3MZF A;  1NRJ A;  1JWV A;  1VQQ A;  3IH9 A;  1ES3 A;  2Y8H A;  3IXH A;  3T12 B;  5DJT A;  1S4R A;  2XFT A;  4KQD A;  4NXB A;  3LY3 A;  2LB9 A;  4Y15 A;  1NLY A;  5CHM A;  3MQQ A;  2ZL1 B;  4HIA A;  5AQB A;  3S7Q A;  3GVB A;  5FAS A;  5IT5 A;  5HFO A;  3HBR A;  4R70 A;  2ZC7 A;  3BY9 A;  3OCN A;  5FI2 A;  1K55 C;  5L07 A;  3VP2 A;  3WRT A;  4I38 A;  5EOE A;  4IED A;  2HF6 A;  5L10 A;  3DTK A;  1TVF A;  4IUH A;  2XA7 S;  2DNS A;  1N9B A;  1TF1 A;  1Z6F A;  1L0D A;  3N4I A;  2O9C A;  5DVA A;  1YSQ A;  4YWZ A;  1YSP A;  2OAQ 1;  2FZ0 A;  2PRF A;  4S2N A;  3CJM A;  3PBQ A;  1YPR A;  3IQA A;  1DRM A;  1MXO A;  1AWI A;  1HZO A;  4R3A A;  4JXG A;  2J3T D;  4MN5 A;  5HL1 A;  3R7W B;  4HP4 A;  1O07 A;  4KZ5 A;  1IKG A;  1XJ6 A;  2YKF A;  2EWV A;  5L8M A;  4JLF A;  5J4E A;  1NRF A;  3SOI A;  2VV8 A;  1MBL A;  3SS3 A;  1NYY A;  1SKF A;  4FUW A;  4UA9 A;  3RJU A;  2JCH A;  3LI9 A;  1YQS A;  2ZQA A;  4DKI A;  4EW7 A;  1YMX A;  4PKY G;  1WYB A;  4S2K A;  3BJN A;  4DE0 A;  1KDW A;  4JXS A;  3QNB A;  4WEL A;  3OC2 A;  3U2A A;  4EET B;  3GDI A;  4Y0U A;  5DTK A;  1HLU P;  3IWI A;  3DWZ A;  2J3W A;  5A92 A;  1IEL A;  2M1C A;  1TD5 A;  2GZA A;  2WYX A;  3WS0 A;  2PU4 A;  4GKU A;  3ZCZ A;  4OLG A;  1NY0 A;  3ULF A;  2HJE A;  3VOZ A;  4C6Y A;  1LHY A;  2P9V A;  1YLT A;  4EEP A;  4MCW A;  3RH8 B;  4L9E A;  2RCX A;  5CGW A;  2ZC3 B;  1XJ4 A;  5A90 A;  3BEC A;  2W1R A;  3T1X A;  5FAQ A;  2DMW A;  1XPB A;  4GDN A;  5FQQ A;  1IKI A;  2INW A;  3BWL A;  4CLC D;  4LRX C;  3UN7 A;  3LID A;  4WLA A;  2JN7 A;  2NUT C;  4I5S A;  4JF5 A;  4DE3 A;  2V1A A;  3SH7 A;  4QHC A;  3QP6 A;  4KZB A;  1M40 A;  2D01 A;  4KQQ A;  1WYC A;  1K6S A;  5CER A;  3G4P A;  4ZBE A;  2JKR I;  1VET B;  4NXG A;  3ZGA B;  3TE8 A;  2D02 A;  2WKI A;  1MWU A;  3S7P A;  1DJA A;  3HUN A;  2I9V A;  3C5A A;  4PM6 A;  1T1C A;  3UE0 A;  3VP1 A;  3I7J A;  3S4X A;  2ZMV A;  1XX2 A;  1KE0 A;  4OH0 A;  3VP3 A;  1BYW A;  4LCL A;  3UPP A;  2XD1 A;  4DXC A;  3C8C A;  4P6Z M;  1GSX A;  4E3I A;  4PKY A;  4BJP A;  1STZ A;  3T4L A;  1YLP A;  3Q7V A;  3ICY A;  3C4O A;  3EEH A;  1NZO A;  2O9B A;  3PTE A;  1FSY A;  3FG8 A;  3CPT B;  2VJW A;  3BFC A;  4LGW A;  5HSQ A;  1JTG A;  4EUZ A;  2RL3 A;  1ZG4 A;  3HLF A;  5CXW A;  4X1M A;  2EXB A;  5KZH A;  1DP8 A;  3NI9 A;  3A3I A;  1BUE A;  4EU0 A;  1LSX A;  4KG6 A;  3C30 A;  4MBH A;  3OPL A;  2V0W A;  3IBR A;  3R4K A;  4XXR A;  4B9O A;  4FTX A;  3LO7 A;  1YKD A;  3NDG A;  2Q0O A;  1KGG A;  3PBO A;  4R3J A;  5CHJ A;  2Q9N A;  4LLO B;  4NXE A;  2J9P A;  2Y2K A;  4L9G A;  2EX9 A;  3NOP C;  2Y2L A;  4MBK A;  1RGY A;  3FZC A;  3MR0 A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  3K3C A;  2VV6 A;  4I3A A;  4GLQ A;  2PDR A;  2GX5 A;  2P04 A;  4QPR A;  3E98 A;  4LRZ E;  4HOI A;  4ETZ A;  4EER A;  4MMN A;  3PBR A;  3HJK A;  3D3O A;  4EUV A;  1S1Y A;  2QHK A;  1T19 A;  3C2W A;  3GEC A;  3E4P A;  3A0S A;  2A2L A;  3MFX A;  2O99 A;  2QJ7 A;  3CWF A;  3H7W A;  4FOF A;  3UME A;  4ETX A;  4PHT A;  5J3W A;  3PXP A;  1MC0 A;  4H6J B;  5G4Z A;  5HD5 A;  2PYR A;  5DKL A;  2P08 A;  3OCL A;  2A24 B;  3F1O A;  3MF0 A;  3V67 A;  1T1A A;  1GSW A;  3CUE C;  5HWV A;  5C5K A;  4PAU A;  4GW9 A;  5HPF A;  4HQA A;  4Z1W A;  3NOU C;  3P01 A;  1UWP X;  4NEE D;  5DFX A;  2GJ3 A;  3UB9 A;  2J3T C;  1P9W A;  3KYZ A;  4HNB A;  1OTI A;  3KSI A;  3CAX A;  3BQ8 A;  1T1B A;  4BBT A;  3OBF A;  2PR6 A;  3PR6 A;  1WA9 A;  2A24 A;  4GJ4 A;  3IS2 B;  1ODV A;  5F6A A;  3KSH A;  3E4O A;  1IOU A;  2QWS A;  2KLI A;  3PBS A;  2W3G A;  4Q0H A;  3LR3 A;  3P7N A;  4WF0 A;  1N9N A;  3FPV A;  1W63 M;  4K08 A;  3KYQ A;  2L1M A;  3T4J A;  1IFQ A;  4GHI A;  4WL9 A;  3W2Z A;  2PR5 A;  2XRO A;  1TS7 A;  1DP9 A;  4O01 A;  4WEJ A;  5EFW A;  1D7E A;  2G7U A;  2Z6C A;  1S67 L;  1V9Z A;  1TS6 A;  2PT7 A;  1T18 A;  2W3D A;  5A8B A;  4JGP A;  1MZU A;  1H8M A;  2L4R A;  1OTB A;  1NLZ A;  4HJ4 A;  2VV7 A;  3F1P A;  5HWT A;  1G6O A;  3T4Q A;  3R7W A;  3VE3 A;  4KQO A;  4OOM A;  4MN7 A;  3LIC A;  2OWH A;  4BWI A;  1GSV A;  1TS8 A;  4EEU A;  3E0Y A;  3F1N A;  1P97 A;  4M4X A;  4R38 A;  2VA0 A;  4BBU A;  2W3H A;  4DN0 A;  3EOI A;  3NHQ A;  3VE4 A;  2XRN A;  4ZRR A;  3MJQ A;  4F3L B;  1F98 A;  3T4T A;  2B18 A;  3O5Y A;  5HDC A;  1NRJ A;  2KOI A;  1XFQ A;  3OLO A;  4IUK A;  1JNU A;  3IBJ A;  1OTA A;  2Y8H A;  2XSS A;  3BY8 A;  4WUJ A;  5DJT A;  1S4R A;  4KQD A;  4IHQ A;  5HPI A;  4NXB A;  1TS0 A;  2VGL M;  2JKR M;  2LB9 A;  3MQ0 A;  1OTD A;  2VKS A;  1NLY A;  2KX6 A;  3B47 A;  4CLC C;  5K5B A;  4XT2 A;  4II7 A;  4F3L A;  3MQQ A;  3S7Q A;  4HIA A;  1F5M A;  2V1B A;  1OT6 A;  5IT5 A;  3BQA A;  4R70 A;  3BY9 A;  3K2N A;  2PHY A;  3OCN A;  1OJG A;  4MDZ A;  4UQI S;  4I38 A;  3A0R A;  2HF6 A;  4RQ9 A;  3FC7 A;  5F5Y A;  5TBM B;  3FPW A;  3H82 B;  2XA7 S;  4IUH A;  3ZQ5 A;  4MN6 A;  4NXF A;  1S66 L;  4HH2 A;  2J80 A;  4O8G A;  1TF1 A;  3A0V A;  4UQI M;  2OAP 1;  2O9C A;  1YSQ A;  4YWZ A;  1XFN A;  3PHY A;  5DKK A;  1YSP A;  1LL8 A;  3LR5 A;  2WKQ A;  2OAQ 1;  2FZ0 A;  3LI8 A;  4UEY A;  3PBQ A;  3PBT A;  3EWK A;  4WEK A;  3LIF A;  4AFI A;  2PD7 A;  2HJ9 C;  1DRM A;  2VX8 A;  4YOF A;  3OOV A;  2VGL S;  3KSG A;  2W1T A;  4R3A A;  2PD8 A;  3DBA A;  4EQ1 A;  2MJ6 A;  4HJ6 A;  4GS9 A;  2J3T D;  4WN5 A;  4MN5 A;  3CUE A;  4HH3 A;  1KOU A;  3EGD C;  3R7W B;  4Q0I A;  4HP4 A;  2JKT M;  5CX7 A;  2HGV A;  4OOL A;  1H3Q A;  1XJ6 A;  2YKF A;  2EWV A;  5I5L A;  3LYX A;  3LIA A;  1P9R A;  4JGO A;  5L8M A;  2JKT I;  3CI6 A;  2L0W A;  5HWW A;  2VEA A;  5J4E A;  2W3E A;  2PYP A;  4BBV A;  2VV8 A;  5IS1 A;  3TRC A;  4I39 A;  4EW7 A;  3LI9 A;  1S4S A;  2W1T B;  4ARZ B;  4HY8 A;  4PKY G;  3NJA A;  1UWN X;  2ZOH A;  3B33 A;  1YAX A;  3F1P B;  4DJ2 A;  3BJN A;  3KO6 A;  3VOL A;  5FL3 A;  4WEL A;  4ME4 A;  2ZMF A;  3OC2 A;  3H9W A;  2R78 A;  3U2A A;  2JHE A;  4NKP A;  3F1N B;  4EET B;  1X0O A;  3GDI A;  2Z6D A;  3E4Q A;  5F68 A;  3SW1 A;  2WKP A;  4O0P A;  1ZHH B;  2K31 A;  2J3W A;  2M1C A;  1TD5 A;  2GZA A;  4HI4 A;  4ARZ A;  5MC7 A;  3RFB A;  3D72 A;  4YNR A;  5J7E A;  4R6L A;  3TJZ C;  4DMZ A;  2V0U A;  2O9A A;  1XJ2 A;  1LSW A;  1S1Z A;  3ULF A;  4HHD A;  2HJE A;  4LPZ A;  4EEP A;  3NOT C;  2W3F A;  2V9A A;  4MCW A;  3RH8 B;  3LR4 A;  4E04 A;  4L9E A;  2VZW A;  5TBM A;  3H82 A;  2XA7 M;  2KDK A;  1XJ4 A;  4DJ3 A;  4EES A;  1D06 A;  4FSF A;  2W1R A;  4HJ3 A;  1XJ3 A;  4G3K A;  1LSV A;  1EW0 A;  2OWJ A;  3LR0 A;  1W63 Q;  2EWW A;  5TJJ A;  3B42 A;  1MKM A;  3C38 A;  3H7W B;  2YKH A;  3KX0 X;  4G3W A;  3T4K A;  2DMW A;  4EXO A;  2OOL A;  3EGX C;  2LB5 A;  2INW A;  5HZH A;  3BWL A;  2W0N A;  2GNX A;  4LRX C;  5HDD A;  4CLC D;  1V9Y A;  1VB6 A;  5AVE A;  4L0L A;  3LID A;  4WLA A;  2JN7 A;  2ZOI A;  4GS9 B;  2NUT C;  4I5S A;  2ZBB A;  4CLC A;  4IJG A;  5F69 A;  3T4S A;  2V1A A;  5KIZ A;  3LUQ A;  1N9O A;  5AJG A;  2NUP C;  3UMD A;  3TW8 A;  2D01 A;  3KSF A;  4GCZ A;  4BMW A;  5DJU A;  1G28 A;  3UE6 A;  3HCY A;  4L9F A;  2M7U A;  1OPX A;  2JKR I;  1OT9 A;  4NXG A;  3TE8 A;  4CLC B;  3JVV A;  2FH5 A;  2D02 A;  5AVF A;  2BAS A;  1OJ5 A;  2Y79 A;  2EA9 A;  3CIT A;  3S7P A;  2I9V A;  4Y5F A;  1VHM A;  3G6O A;  3HJI A;  4G3V A;  3UB6 A;  4Y2F A;  1P0Z A;  1T1C A;  4Y3I A;  1OTE A;  3LFV A;  5KSH A;  5DFY A;  4KUK A;  2ZMV A;  2QKP A;  3K3D A;  5HL6 A;  3VV4 A;  1BYW A;  2K7S A;  3MMH A;  1Y28 A;  3ZYT A;  3C8C A;  4P6Z M;  1GSX A;  3F1O B;  4PKY A;  3IS2 A;  2CMN A;  4HP9 A;  4BJP A;  1STZ A;  3T4L A;  3UB7 A;  3ICY A;  3EEH A;  2O9B A;  3BW6 A;  1NWZ A;  4CLC E;  2P7J A;  3MQO A;  3FG8 A;  3MXQ A;  3EQV A;  4I3I A;  2VJW A;  2O0Y A;  5HSQ A;  4GHI B;  3RTY A;  4KUO A;  3UE3 A;  3JVU A;  1DP8 A;  3S7N A;  3T4O A;  5IU1 A;  5DF9 A;  5LBR A;  4EU0 A;  1LSX A;  4JGQ A;  3C30 A;  4Q0J A;  3EEA A;  1N9L A;  2K2N A;  3UB8 A;  2V0W A;  3IBR A;  3LIE A;  4P6Z S;  5G4Y A;  5HD3 A;  4JGR A;  3T50 A;  3R4K A;  1DP6 A;  3LIB A;  4B9O A;  3S7O A;  4XT2 B;  4LRY C;  2QYB A;  4I3J A;  1YKD A;  3EQU A;  2B02 A;  2IA2 A;  1UGU A;  3PBO A;  3CLO A;  3PYP A;  4LLO B;  2H28 A;  2VLG A;  4NXE A;  5HDS A;  4CQH A;  1F9I A;  3PBN A;  4L9G A;  2W27 A;  2M7V A;  1ZTU A;  3NOP C;  2WKR A;  1LT0 A;  4H6J A;  4B93 A;  2HV1 A;  3MR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...