1DP9A

Crystal structure of imidazole-bound fixl heme domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp9A00
1XFQA 3NHQA 5HD5A 5HDCA 2WKQA 1LSXA 2VEAA 1DP6A 4EEUA 2A24A 2OOLA 3H7WA 4EW7A 2QKPA 5J7EA 4HNBA 1XJ2A 3IS2A 3NJAA 2VV8A 3HJIA 2OWJA 3P7NA 4HHDA 5HZHA 1EW0A 1T19A 2V0UA 4F3LB 1GSVA 2PHYA 5IU1A 5TBMB 4HH3A 2HV1A 4R70A 1MZUA 4R38A 3SW1A 5TBMA 1BYWA 1S4RA 2QWSA 3LUQA 3PHYA 5AVFA 3E4QA 1OJGA 2H28A 2PYRA 2I9VA 4R6LA 1TS7A 1DP9A 3G6OA 1S4SA 2JN7A 3H82B 1T18A 3FC7A 3IS2B 2VV7A 2KDKA 1ODVA 1KOUA 1S66L 4EQ1A 1GSXA 3NOUC 2GJ3A 2VLGA 1OTEA 1G28A 3LIFA 4GS9A 4WL9A 1N9OA 1V9YA 1WA9A 4HJ3A 1OTDA 3T50A 3RTYA 3VE4A 2ZBBA 3LIBA 2D02A 4WLAA 4PKYA 4H6JA 1OTBA 2V9AA 4R3AA 4EETB 2INWA 4KUOA 3A0SA 1V9ZA 4JGPA 4GHIA 4NXBA 4PKYG 3K3DA 5F5YA 2PDRA 1OTAA 4NXGA 4JGRA 4NXEA 3A0RA 4LPZA 5EFWA 5J3WA 2QHKA 1TS8A 1JNUA 1VB6A 3BWLA 3GECA 3H82A 3LIEA 4HQAA 2M1CA 1S67L 3BY8A 1UGUA 2W27A 3MXQA 3H9WA 4I3AA 4LRXC 4RQ9A 2B02A 4I5SA 2JHEA 2R78A 3CWFA 3D72A 5J4EA 3MFXA 1T1AA 5AVEA 5G4ZA 3UB8A 4B9OA 4BBUA 3E4OA 4EERA 5HSQA 5DKLA 2CMNA 1UWPX 1OT9A 2Z6CA 2ZOIA 2L4RA 3UB6A 1S1YA 4WF0A 3NOPC 5HWTA 5HWVA 3LIAA 4JGOA 3ULFA 1XFNA 1TS0A 2A24B 2L1MA 2VV6A 3FG8A 2KX6A 3ICYA 5DJTA 5HDDA 3UMDA 4LLOB 1TS6A 4L9FA 2J80A 3F1PB 4DJ2A 3KX0X 4BBVA 4HOIA 3LIDA 3F1OA 5G4YA 4DJ3A 4H6JB 3RH8B 2K7SA 2V1BA 4K08A 1OT6A 3LYXA 4BBTA 3UE6A 1N9LA 4EXOA 2WKPA 1OJ5A 2PD7A 2P7JA 3BY9A 2V1AA 4KUKA 4XT2B 2QJ7A 1UWNX 3LI8A 4KQDA 2YKFA 3CLOA 4HIAA 1T1BA 2EA9A 1LSVA 5DKKA 4L9GA 1X0OA 2PYPA 4L9EA 5F69A 5KIZA 4YWZA 3EWKA 2WKRA 2OWHA 4M4XA 5DJUA 3VE3A 4MN6A 3UB7A 4F3LA 1XJ4A 3PYPA 1P97A 3LI9A 4I38A 4JGQA 1LT0A 2D01A 1Y28A 2V0WA 5A8BA 1NWZA 3MQOA 2BASA 4EEPA 3GDIA 3MQQA 1XJ6A 4HJ4A 2QJ5A 4GS9B 2PD8A 3LICA 4HJ6A 1S1ZA 3MR0A 2PR6A 4LRYC 3A0VA 4HI4A 1GSWA 3UMEA 4WUJA 3CAXA 4NXFA 4WN5A 1DRMA 1OTIA 3HJKA 4HH2A 3E4PA 4LRZE 4MN5A 1P0ZA 3NOTC 2Z6DA 5F68A 2YKHA 3EEHA 1N9NA 5IS1A 5F6AA 5HWWA 2ZOHA 2L0WA 2W0NA 5HD3A 1F9IA 1T1CA 4EESA 3C8CA 4I39A 1XJ3A 2PR5A 4I3JA 5HDSA 3VOLA 4GCZA 1D7EA 3IBRA 1LSWA 4GHIB 4GW9A 4I3IA 4HP9A 3UB9A 4HP4A 3H7WB 4HY8A 3K3CA 3F1OB 3ZQ5A 4E04A 1D06A 3C2WA 5I5LA 3MJQA 1DP8A 1F98A 3OLOA 3F1NB 4XT2A 3F1NA 3B33A 3F1PA 1LL8A
chains in the Genus database with same CATH superfamily
1G5UA 1DP6A 1PNEA 3VMAA 2PU4A 3BYDA 1CI9A 4OVDA 3V3RA 5TBMB 4CLCA 3D9YA 3W4PA 3G6OA 1S4SA 3OZHA 3IS2B 2VV7A 2VKSA 1N9OA 3MMHA 2D02A 3U4LP 3W4QA 3MZDA 1RGYA 1XPBA 4CQHA 3UE1A 2J3TC 2O99A 3K3DA 4H8RA 1O07A 2P08A 1HTZA 1KDWA 4A5RA 4BL3A 4IHQA 1BUEA 4I5SA 3M2JA 2ZC5B 1JVJA 4X1MA 3B47A 2JKTM 4HBUA 1NZOA 4IBXA 2J7VA 1MKMA 1ES3A 1I2SA 5E2FA 2ZMVA 2ZQ9A 5G4YA 3RXXA 1ES2A 4H6JB 2X71A 1H5XA 3LI8A 3GMWA 3TSGA 1LSVA 4CJNA 3D4FA 1XJ4A 4S2JA 5DFXA 4G3KA 3MQQA 1XJ6A 4R23A 1G6AA 2HF6A 2Y2HA 1S1ZA 3BQAA 3K2NA 3HJKA 4O01A 1E4DA 3NOTC 3IWOA 4OQ0A 4KG2A 3EEHA 4HEFA 2X02A 4S2IA 5AQ9A 4I3JA 1W63M 3H7WB 3DTIA 5CGWA 4EBLA 1CI8A 4P6ZM 4LV2A 1LSXA 2NUTC 1KGFA 2VEAA 5TR7A 5J7EA 2JKRM 5GL9A 3PTEA 3OOVA 4UHUA 3IT9A 2V0UA 3PBRA 5HAPA 2CC1A 1K56A 5TGFA 2QMIA 1S4RA 3LUQA 3IXGA 5CTNA 1PWDA 3BEBA 1XGIA 4Q8IA 1V9YA 1JWPA 4K0WA 3PXPA 2E8JA 4DXBA 4F94A 2ZC6B 3KO6A 2ZM8A 4DE0A 3TOIA 5E2GA 5J4EA 3LR5A 1K54A 3ZG9B 1IYPA 1MC0A 5HDDA 3UMDA 3SS5A 2WKIA 4DF6A 1IYSA 4FCFA 1E3UA 3IF6A 4G3VA 4BBTA 4ZBEA 1N9LA 2WKPA 2V1AA 5F1FA 3IWQA 2V20A 3CUEA 1TDGA 4L9EA 1K54C 5CGSA 1M6KA 5JYOA 4JGQA 1AXBA 2DRWA 4HJ4A 3GR2A 4YOFA 3UO9A 3BECA 4E3IA 2P9VA 1OTIA 1YQSA 5L8MA 3C38A 1ERQA 2DNSA 1XJ3A 4KENB 2K2NA 2P04A 1MWRA 3ZFZA 3MBZA 4CPKA 3F1NA 3A3FA 4P87A 5GLCA 2WKQA 4KZ3A 1MPLA 5DF9A 1VEUB 2OOLA 3G34A 1ALQA 2RCXA 4BMWA 1ZG4A 2QZ6A 1PW1A 4WYYA 5KSHA 2Q9NA 2I9VA 4R6LA 2Y8HA 1KGGA 5AQBA 1FILA 1KOUA 3LR0A 3UN7A 3S4XA 2OSUA 2Y2GA 4U3TA 3A0SA 2PDRA 1KE3A 4NXGA 5L2FA 3EQUA 2J9OA 2A49A 4GD6A 2FH5A 3FPVA 2B02A 4JKTA 4FSFA 4YNRA 4DKIA 1UWPX 1M40A 2ZC4B 1MKIA 4QWOA 4CLCB 5FAOA 1XP4A 3DWKA 2XRNA 1FCNA 1RP5A 3FZCA 5G18A 3ZHHA 3A3IA 2K7SA 1OT6A 2NUPC 1MWSA 2QJ7A 1J3WA 4HIAA 1X0OA 3IH8A 3V67A 3PYPA 3KYQA 2V0WA 5A8BA 2WGVA 5GLAA 2Y2IA 3G32A 1ZHHB 4X56A 2EX2A 5DF7A 3MXSA 4GJ4A 1YLYA 3TG9A 1P0ZA 2EXBA 2P74A 5HWWA 2L0WA 3FKWA 3V39A 4EW7A 3IF6C 4O7DA 1YLPA 2G2UA 3HVFA 4E6WA 5I5LA 5CEDA 1Q2QA 3O87A 1WE4A 1LL8A 3LGOA 4EEUA 4HNBA 5EV0A 5CEBA 3NC8A 5IU1A 3C4OA 1PI4A 1BYWA 1FIKA 1KVLA 4BD0A 3IF5A 5A92A 1W79A 4PKYA 2VGJA 3A0RA 4FOFA 3GV9A 1KE0A 1JNUA 3O5YA 1YSQA 2WK0A 2W1TB 3C30A 3MXQA 4I3AA 5I94A 1CEFA 2M7UA 2P9VB 5AVEA 4B9OA 5DKLA 3IX3A 2UWXA 3PAEA 3UB6A 4P85A 5GHZA 4OP8A 1MXOA 3ICYA 4QY5A 4MBHA 1PWCA 3T4JA 1PYYA 4CLCD 3S7PA 3NECA 4NEED 4N92A 4L9GA 2EFXA 4QJGA 2H5SA 4PPRA 3MQOA 1K4FA 3GDIA 1GHPA 3JVUA 3LICA 2PAVP 4UEYA 1VHMA 3R4KA 4KZ4A 4MN5A 2Y2NA 4JLFA 4Z9QA 5CHMA 2ZL1B 3OC2A 1W7FA 2GZAA 2PRFA 4N1XA 1IFQA 4E04A 5FQ9A 1XFQA 1E25A 1NRFA 2J3TD 4OKPA 3CHWP 2Y2OA 2QKPA 1YMSA 3T4TA 2OWJA 3AGDA 4XUXA 5AVFA 5EVIA 5FSRA 1T18A 4E3JA 3O86A 2HPBA 4BLMA 2ZBBA 2XQZA 4KUOA 1IOUA 4Y13A 4FTXA 2Y79A 5EFWA 4NXEA 3BFGA 4QB8A 3ZG5A 1S67L 2OAQ1 4AFIA 1PFLA 4ZDXA 4JGOA 2Y2KA 1XFNA 2L1MA 2A24B 2KX6A 1KE4A 4ZJ2A 3NY4A 3F1OA 4DJ3A 4KZ5A 2V1BA 3GTCA 1O7EA 5FI7A 4X55A 4KQQA 1OJ5A 2PD7A 3BFEA 3CG5A 5FI6A 1LLBA 4KQDA 5F69A 2Y59A 2BLSA 2OLUA 4F3LA 4OP5A 4ZTKA 2BASA 5HX9A 1L0EA 1F2KA 4LRYC 1GSWA 5HAIA 4EWFA 2XD5A 2Z6DA 3CJMA 1OPXA 3WRTA 4S2KA 1JTGA 5L10A 4MEZA 3DW0A 3K3CA 4OOLA 1H0MA 2KLIA 3LFVA 1L3LA 3M6BA 3BQ8A 3IS2A 3IWIA 2WZZA 3L9KA 3VP0A 4WEJA 2K31A 4R38A 3P98A 2W3EA 5TBMA 2PYRA 1YLJA 2PT7A 1TS7A 4IEDA 4QY6A 2FFYA 2J9PA 2V2FF 3W2ZA 1S66L 5HPIA 1GSXA 4QHCA 2B18A 4GS9A 3EOIA 4HJ3A 5DTSA 4ME4A 5FDHA 1U60A 4NETA 5CHUA 2XF3A 2Y2JA 3OCLA 1KGEA 2HP6A 4GDBA 4GOGA 4S2LA 1T1AA 3EQVA 1W8YA 1OT9A 1YT4A 1RCJA 1SHVA 1BLHA 4R3BA 4DJ2A 5FAPA 2ZM0A 4Y5FA 4E3NA 3P09A 4E6XA 4GN2A 2JKGA 4JXVA 1Y4OA 1MY8A 1SZVA 1UWNX 4KZ7A 2WADA 3ZG0A 5DKKA 2PYPA 1LI9A 4Y3IA 1Y54A 3LI9A 3GVBA 2HP9A 5BOHA 4OLDA 1I5QA 2J3WA 4X53A 1SDEA 5FAQA 4JF6A 2PR6A 4OQHA 4ETXA 3QP6A 3S22A 1KVMA 3BLMA 4X69A 3R7WA 3E4PA 5GHYA 4U0XA 5KMWA 5CXWA 2ZJ9A 4IVIA 4UAAA 4WM9A 1D7EA 2JKTI 2Z2MB 3NHQA 3UDIA 2WZXA 4KZ8A 5HZHA 3S7OA 4XXRA 3ZYTA 4Q0JA 2HV1A 4KZ6A 3VOZA 3Q81A 5HW3A 3BFCA 4E3LA 1HLUP 3LEZA 3LIFA 2FFFB 1MWUA 2LB9A 4R4SA 1FR6A 5F1GA 2V8FA 1YAXA 2V9AA 4R3AA 5EVID 1PRQA 3CMZA 2IWDA 4NXBA 3ZNYA 1AWIA 1OTAA 3NDGA 1TS8A 3T1QB 2JHEA 3FWLA 3MKFA 4PM8A 2A2LA 5K5BA 1CK3A 3Q07A 3C4PA 2ZC7A 3JYIA 3PBOA 3JVVA 2XLNA 3A3EA 1P9RA 1PIOA 1MWTA 3DTMA 4EBNA 3QP8A 4PM7A 5A90A 3LYXA 3SZTA 1H8MA 4NG2A 4JXWA 5DFYA 3CI6A 2HGVA 1HVBA 4IUKA 1N4OA 3T12B 4KG6A 3P01A 1NYYA 5AQAA 4D2OA 3MQ0A 5M18A 4E3MA 3A0VA 3CAXA 2V8CA 3ITAA 3UE3A 2WYXA 1VETB 2ACGA 1L2SA 4ZAMA 3F1OB 1XX2A 3SH9A 3N6IA 2A24A 1XJ2A 1IYOA 3HJIA 4OH0A 5FEFA 4HHDA 1EW0A 2ZQDA 3QNBA 3VP2A 1L0FA 1GHIA 2IWBA 3T4OA 5FQJA 2O9AA 3HL9A 5U47A 1L0GA 1NJ4A 2VLGA 1OTEA 2JKRI 1NLZA 2PBYA 3DBAA 1XKZA 1OTBA 2INWA 4GHIA 1K6RA 3IHAA 1CEGA 4UQIS 3VP1A 4C75A 5EVIB 1VB6A 1LI0A 1TEMA 2DMWA 1UGUA 1VQQA 3Q82A 4EERA 2E8IA 3N7WA 2KOIA 2Q9MA 3VV4A 2XDMA 4WF0A 3LIAA 3PR6A 4JPMA 2W3GA 3G2ZA 2RL3A 2Y2PA 3E0YA 3VFHA 4DDYA 3Q1FA 1W63Q 1I2WA 5CHJA 1IELA 2EWWA 4M3KA 4EU0A 3G31A 2ZM2A 3IH9A 3ZCZA 1ESIA 4B4ZA 2QJ5A 1BT5A 3NBLA 3CPTA 2HJ9C 2JC7A 5A91A 3V50A 4EV4A 1K38A 3RFBA 4LRZE 5EOEA 1S0WA 1Z6FA 1EWZA 5HL1A 4GZBA 5JYPA 3IHBA 3NDEA 1YLWA 4DXCA 1FOFA 4ARZB 3U2AA 3RXWA 4HY8A 2DCFA 2GDNA 4XT2A 3SH8A 5HDCA 5GLDA 2VA0A 5CTMA 3KYEA 5HPFA 3HLBA 2PHYA 3KSFA 3PAGA 1SKOA 2QWSA 4KQRA 4X68A 5TFQA 4KG5A 4LCLA 2GJ3A 4FD8A 3OCNA 3RTYA 3LIBA 1YLTA 3IF6B 2XD1A 5EM0A 5FA7A 4BJPA 1G6OA 4LPZA 3JPUA 3CPTB 3H9WA 5A93A 5F82A 1DY6A 3E4OA 4LCMA 3A3JA 2L4RA 1NZUA 1S1YA 4OONA 4CLCE 5HWVA 3E98A 3PBTA 1TS0A 4KZAA 2VV6A 3N8RA 2H10A 4FH2A 3IBJA 4RVAA 2ZC3B 1K56D 2HP5A 2XEPA 1T1BA 2W3FA 4E3OA 2XROA 3A3DA 3EGXC 2Y2QA 4P0MA 2LB5A 4GS9B 3LR3A 1HD8A 3GQZA 5HFOA 3E2KA 4JF4A 1YM1A 4NXFA 4DE1A 5IT5A 2OAP1 1FSWA 1TVFA 4DE3A 2W0NA 4K91A 4GW9A 4II7A 4B93A 5DTTA 3OBFA 1DP8A 4D60A 4ETZA 1GA9A 1K4EA 4BQMA 3G2YA 1GSVA 1MZUA 4C3QA 3AGEA 1W8QA 1ESUA 4Y7PA 2KDKA 5FASA 3OPLA 3M2KA 3N8LA 1KDSA 5LBRA 4WLAA 4H6JA 4L0LA 5L09A 3QP4A 4JGRA 5J3WA 3LIEA 3RH8B 3GECA 3N8SA 4GLQA 4LRXC 2H0YA 4ID4A 3CWFA 3T4KA 3N4IA 1ZG6A 2ZOIA 3TW8A 3NOPC 4S2NC 1TD5A 5FEGA 1LL5A 5MC7A 1VEUA 3TJZC 4K0XA 3OPPA 2M7VA 3LIDA 3LY3A 4Z1WA 3I7JA 2QPNA 3BJNA 3VFFA 4IBRA 3KYZA 3O88A 4I38A 2D01A 3MZEA 4EEPA 4Q0HA 2Y55A 5CERA 3G35A 1K57A 3VOYA 1TDLA 1BULA 3MSHA 4UA7A 1LSWA 2XH9A 5FQMA 2V1ZA 3VSLA 1DJAA 2ZLYA 4PM9A 2OV5A 4MBKA 3HLDA 4EUVA 1YLZA 3NCKA 2ZQ7A 3SH7A 1CF0A 5E2HA 3UPNA 3E4QA 1SCWA 4OPRA 3C7UA 2R9XA 2VZWA 4WL9A 2IWCA 3QHYA 5E2EA 1PZPA 5KSCA 3T1XA 2FZ0A 4N9KA 3T1RA 1ES4A 3R7WB 4DN0A 2PBDP 4O0PA 2VGLS 2WGWB 2QHKA 4HQAA 3BY8A 1WYCA 1DJBA 5FDSA 5HARA 2R78A 3D72A 3IXDA 2XFTA 4DDSA 4EQIA 5DJTA 2Q0OA 4HOIA 3PBSA 1EI5A 4UQIM 3WS2A 4K08A 1STZA 5EUAA 1VM1A 3BY9A 4XT2B 1RGZA 1SKOB 4X1LA 3S7QA 4PHTA 3UE0A 4IVKA 2J8YA 4OPZA 2WKHA 1SDNA 4GKUA 5DTKA 3VP4A 1LL9A 3EGDC 4OOMA 3UNWA 4WEKA 2XGNA 3S1YA 4LV0A 5DVAA 3WRZA 2XSSA 1DJCA 3LEQA 4X6TA 1F9IA 1ZC2A 2WUQA 2PR5A 3HBRA 3TE8A 4ESPA 2GX5A 3OLOA 4BENA 1PW8A 1FR1A 3NJAA 1FCMA 3HUOA 3SS4A 2O9CA 1GA0A 3CZDA 1NXYA 3MF0A 1A0KA 1DP9A 1H3QA 2OLVA 4RX3A 4Y15A 3M6HA 1ODVA 4GB7A 3KSGA 1BLCA 3T50A 2EX8A 1ES5A 3BRMA 1NY0A 3TRCA 4P6BA 3LCEA 3DAVA 2EFUA 1XA1A 4QPRA 3EEAA 5CX7A 1IYQA 4JBFA 4WBGA 3V3SA 1WYBA 5G4ZA 3CUEC 1JWZA 3IXHA 2Z6CA 1YPRA 4E3KA 2ZQAA 4Y2FA 2UV0E 5HWTA 3T1SA 2ZMFA 3UDXA 3AGFA 3SS3A 3KX0X 4MNRA 3NI9A 1K6SA 1ONHA 3UE6A 3FKVA 4DMZA 3IX8A 3ZVWA 2Y4AA 4YWZA 1NYMA 4M4XA 3VE3A 2ZQ8A 2WAEA 1P97A 1LT0A 2HJEA 3DTEA 4C6YA 3HLCA 3LR4A 3MR0A 3QP1A 4O8GA 3HLWA 3HLGA 3MXRA 3FPWA 1JTDA 3L7HA 2ZOHA 3PBNA 1VETA 2JCHA 5EE8A 5HDSA 4HESA 4HP4A 4JXSA 2JKFA 3BW6A 4PM5A 5FQQA 3F1NB 3HLEA 1N9BA 2VX8A 3DWZA 2WKEA 4FH4A 1T19A 4MBFA 4HH3A 2HDQA 3WS4A 3ZNTA 1OJGA 4Y17A 3H82B 1NLYA 1C3BA 4EQ1A 5FATA 4WMCD 1IKGA 2ZL1A 2VGKA 4OQIA 5AJGA 4JGPA 4PKYG 5F5YA 4ZJ1A 3W4OA 3QP2A 1BTLA 1K55C 4KZBA 4PMAA 3C5AA 3GRJA 4PAUA 4QD4A 3Q7ZA 4KQOA 4Y0OA 3E2LA 4GD8A 3LY4A 1NRJA 1XXMA 4LFUA 4OOYA 2GNXA 2P7JA 3BLSA 2WGIA 3MZFA 3UB7A 3QP5A 4WELA 1NWZA 3IX4A 3HLFA 2W1TA 2W3DA 4JF5A 3ZVTA 5FL3A 5M1AA 2G2WA 5CRFA 4ZJ3A 5IS1A 3LO7A 3C8CA 2ZQCA 3ZDJA 4I3IA 2EWVA 3HUNA 3S7NA 3UB9A 1G68A 4R0QA 3C2WA 5GLBA 3V5MA 3B33A 3F1PA 4MDZA 5HD5A 2VK3A 3OPRA 3Q7VA 3H7WA 2WGWA 5FQIA 1ONGA 3P7NA 3HREA 1L0DA 5EM1A 1W5DA 3C7VA 4N1HA 1ACFA 1MBLA 4Q0IA 2H28A 5EOOA 2JN7A 2B5RA 4GNUA 2Y91A 4R3JA 1FQGA 3FYZA 1OTDA 1IEMA 4YFMA 2Y2MA 4R1GA 3NULA 4EUZA 4QU3A 1YSPA 2I72A 2M1CA 4RYEA 2XK1A 5FQKA 4Y0TA 3MFXA 4CLCC 4BBUA 3UB8A 3RJUA 1TF1A 3T4SA 2EX9A 2EXAA 5GHXA 5L07A 4BBVA 4S2PA 2JBFA 3G4PA 4RA7A 1K57C 4MN7A 4JXGA 1OMEA 4KUKA 3CITA 4WZ4A 2YKFA 2EA9A 3MKEA 5KIZA 4MCWA 2OWHA 1E3UD 1K55A 4MN6A 4RQ9A 1PWGA 2IA2A 4BL2A 4HBTA 2PD8A 1GHMA 3ITBA 4HI4A 1XA7A 4HH2A 4DRTA 3MS6A 2VJWA 4UA9A 2XR0A 1N9NA 5HD3A 3OPHA 2G7UA 4GHIB 2C6WB 5EVIC 5HAQA 3MJQA 3BM6A 4OLGA 3BFFA 3ISGA 5TJJA 5F83A 3VSKA 1CJFA 2PU2A 1H8ZA 1H8YA 1FCOA 4F3LB 4YINA 2HDSA 4R70A 3W8KA 5EVLA 3PBQA 3HCYA 5M19A 1PZOA 4S2NA 1BLPA 3QNCA 1J9MA 3FC7A 3DTKA 3WS0A 3NOUC 5C5KA 4XUZA 4NKPA 2C5WB 4PM6A 1JWVA 4IUHA 1BZAA 1V9ZA 2O9BA 3BFDA 3BWLA 3G30A 4FUWA 4Y0UA 4GDNA 3KSIA 5DF8A 5AQ7A 2O0YA 1LHYA 1GCEA 2CMNA 3T4QA 5FI2A 4WZ5A 3D3OA 1ZTUA 3WS5A 4RX2A 3Q7VB 3FG8A 4LGWA 2J80A 3F1PB 4R4RA 4BWIA 4S2MA 3T4LA 1IKIA 4OPQA 3UY6A 2XA7S 3WS1A 5KZHA 4LV3A 4KZ9A 4B88A 4NK3A 4WMCA 3EWKA 4WZ5C 1EROA 3SOIA 1Y28A 1K25A 1YMXA 3WWXA 2X01A 4HJ6A 5CGXA 3UDFA 3B3XA 2BG1A 2VGLM 2HDUA 4WN5A 1DRMA 1F5MA 2AVXA 3IQAA 2H0TA 5J8XA 5F68A 2YKHA 5F6AA 4EESA 1QMEA 1T1CA 4GCZA 3IBRA 1PI5A 1QMFA 1S6RA 1YKDA 2Y2LA 4UA6A 2QYBA 2XA7M 2XFSA 3GSGA 2VV8A 1Q2PA 3MFDA 1HZOA 2R9WA 3SW1A 4LV1A 5EPHA 3PHYA 3VP3A 5EVEA 3UPOA 3UB5P 4S2OA 3NIAA 1G28A 3ZGAB 3FV7A 4P6ZS 1WA9A 1XGJA 3KSHA 4DE2A 2Z2LB 4EETB 3O3VA 3B42A 4B4XA 2ZD8A 1K0KA 3HUMA 3VE4A 3H82A 4OPYA 2W27A 1BSGA 4U0TA 5HSQA 4MLLA 4ARZA 2W3HA 5D3OA 3ULFA 4LLOB 4X25A 4OQGA 1TS6A 2WAFA 3IXBA 4L9FA 3ZG7B 2HDRA 2W1RA 1D1JA 1BLSA 4EXOA 1ERMA 4LENA 3CLOA 2BTFP 3ZG8B 1CQAA 2WKRA 4IJGA 5DJUA 2JE5A 2HZ5A 5HL6A 4ZRRA 2A3UA 1P9WA 5CECA 4BD1A 5EECA 5IHVA 2EX6A 3UMEA 4WUJA 4MMNA 4N9LA 2ZMAA 3UPPA 4I39A 3VOLA 1SKFA 4EBPA 4HP9A 1ZKJA 3ZQ5A 5E43A 1D06A 1FSYA 2B95A 1F98A 1Z09A 4G3WA 2MJ6A
chains in the Genus database with same CATH topology
1XFQA 2J3TD 5HDCA 1DP6A 2VX8A 2QKPA 2VA0A 3T4TA 2OWJA 5HPFA 1T19A 2PHYA 4CLCA 5TBMB 3KSFA 4HH3A 2QWSA 5AVFA 1OJGA 3G6OA 3H82B 1S4SA 1T18A 3IS2B 1NLYA 2VV7A 4EQ1A 2GJ3A 2VKSA 1N9OA 3OCNA 3RTYA 3MMHA 2ZBBA 3LIBA 2D02A 4CQHA 4KUOA 5AJGA 2J3TC 2O99A 4JGPA 4PKYG 5F5YA 1IOUA 3K3DA 2Y79A 5EFWA 4BJPA 4NXEA 1G6OA 4LPZA 2P08A 4IHQA 1S67L 3H9WA 2OAQ1 4I5SA 4AFIA 4PAUA 3B47A 3E4OA 4KQOA 2L4RA 1S1YA 4CLCE 2JKTM 5HWVA 3E98A 4JGOA 3PBTA 1NRJA 1XFNA 1TS0A 1MKMA 2A24B 2L1MA 2VV6A 2KX6A 2ZMVA 2GNXA 3F1OA 5G4YA 4DJ3A 3IBJA 4H6JB 2V1BA 1OJ5A 2PD7A 2P7JA 3LI8A 4KQDA 1T1BA 1LSVA 2W3FA 5F69A 2XROA 3UB7A 4F3LA 3EGXC 1XJ4A 5DFXA 4G3KA 4WELA 1NWZA 2BASA 2LB5A 3MQQA 1XJ6A 2HF6A 4GS9B 2W1TA 3LR3A 1S1ZA 2W3DA 3BQAA 4LRYC 3K2NA 1GSWA 4NXFA 5FL3A 3HJKA 4O01A 5IT5A 3NOTC 2OAP1 2Z6DA 1OPXA 3EEHA 5IS1A 2W0NA 3C8CA 4I3JA 4GW9A 1W63M 2EWVA 4I3IA 3S7NA 3UB9A 3H7WB 3K3CA 4II7A 4OOLA 4B93A 3C2WA 3OBFA 1DP8A 4P6ZM 3B33A 3F1PA 4MDZA 4ETZA 2KLIA 5HD5A 1LSXA 2NUTC 3LFVA 2VEAA 3H7WA 5J7EA 3BQ8A 2JKRM 3IS2A 3OOVA 3P7NA 2V0UA 3PBRA 1GSVA 4WEJA 1MZUA 2K31A 4R38A 2W3EA 5TBMA 1S4RA 3LUQA 4Q0IA 2H28A 2PYRA 2PT7A 1TS7A 2JN7A 3W2ZA 2KDKA 1S66L 5HPIA 1GSXA 2B18A 4GS9A 1V9YA 3EOIA 4HJ3A 1OTDA 5LBRA 4WLAA 4H6JA 4L0LA 3PXPA 4ME4A 4JGRA 5J3WA 3KO6A 3OCLA 3LIEA 3RH8B 3GECA 1YSPA 2M1CA 4GLQA 4LRXC 3T4KA 3CWFA 5J4EA 3MFXA 1T1AA 4CLCC 4BBUA 3EQVA 3UB8A 3LR5A 1OT9A 2ZOIA 1TF1A 3TW8A 3NOPC 3T4SA 1TD5A 5MC7A 1MC0A 5HDDA 3TJZC 3UMDA 4DJ2A 4Y5FA 4BBVA 2M7VA 3LIDA 4Z1WA 4G3VA 4BBTA 3BJNA 1N9LA 4MN7A 2WKPA 4KUKA 2V1AA 3CITA 1UWNX 2YKFA 2EA9A 3CUEA 5DKKA 2PYPA 4L9EA 5KIZA 4MCWA 2OWHA 4Y3IA 4MN6A 3KYZA 4RQ9A 4I38A 3LI9A 4JGQA 2D01A 2IA2A 4EEPA 2J3WA 4HJ4A 4Q0HA 2PD8A 4YOFA 4ETXA 2PR6A 4HI4A 3R7WA 1OTIA 4HH2A 3E4PA 5L8MA 3C38A 2VJWA 1N9NA 5HD3A 1XJ3A 2K2NA 2G7UA 1D7EA 2P04A 1LSWA 4GHIB 2JKTI 3MJQA 3F1NA 5TJJA 3NHQA 2WKQA 5DF9A 2OOLA 4BMWA 5HZHA 3S7OA 4EUVA 4F3LB 3ZYTA 4Q0JA 2HV1A 4R70A 5KSHA 3PBQA 3E4QA 3HCYA 2I9VA 4R6LA 2Y8HA 3FC7A 1KOUA 3LR0A 3NOUC 2VZWA 5C5KA 4WL9A 3LIFA 2LB9A 4NKPA 3VE4A 4IUHA 1YAXA 2V9AA 4R3AA 2FZ0A 3A0SA 1V9ZA 4NXBA 2PDRA 2O9BA 4DN0A 1OTAA 3R7WB 4NXGA 4O0PA 2VGLS 3EQUA 2QHKA 1TS8A 3BWLA 4HQAA 3BY8A 2FH5A 3FPVA 2B02A 3KSIA 2JHEA 2R78A 3D72A 4FSFA 2A2LA 4YNRA 2O0YA 5K5BA 1UWPX 2CMNA 3T4QA 3D3OA 1ZTUA 3PBOA 3JVVA 4CLCB 3FG8A 5DJTA 2J80A 3F1PB 4BWIA 1P9RA 2XRNA 4HOIA 3PBSA 3T4LA 4UQIM 2K7SA 4K08A 1OT6A 3LYXA 2NUPC 1STZA 2XA7S 3BY9A 4XT2B 2QJ7A 1H8MA 4HIAA 3S7QA 5DFYA 4PHTA 3CI6A 1X0OA 2HGVA 3V67A 3EWKA 4IUKA 3PYPA 3KYQA 1Y28A 2V0WA 5A8BA 1ZHHB 3P01A 3EGDC 4HJ6A 4OOMA 3MQ0A 3A0VA 4WEKA 2VGLM 3CAXA 4GJ4A 4WN5A 1DRMA 1F5MA 1P0ZA 2XSSA 5F68A 2YKHA 3UE3A 5F6AA 5HWWA 2L0WA 4EW7A 4EESA 1F9IA 1T1CA 2PR5A 2MJ6A 4GCZA 3TE8A 3IBRA 2GX5A 3F1OB 5I5LA 3OLOA 1LL8A 1YKDA 4EEUA 2A24A 4HNBA 1XJ2A 2QYBA 2XA7M 3NJAA 2VV8A 3HJIA 4HHDA 1EW0A 2O9CA 5IU1A 3SW1A 3MF0A 1BYWA 3PHYA 1DP9A 1H3QA 3T4OA 2O9AA 1ODVA 2VLGA 3KSGA 1OTEA 1G28A 2JKRI 1NLZA 4P6ZS 1WA9A 3T50A 3DBAA 4PKYA 3KSHA 1OTBA 4EETB 2INWA 3B42A 4GHIA 3TRCA 3A0RA 4FOFA 4UQIS 1YSQA 1JNUA 1VB6A 3O5YA 3EEAA 3H82A 2DMWA 2W1TB 3C30A 3MXQA 4QPRA 1UGUA 2W27A 4I3AA 2M7UA 4EERA 5AVEA 5G4ZA 4B9OA 3CUEC 2KOIA 5HSQA 5DKLA 2Z6CA 4ARZA 3VV4A 2W3HA 4Y2FA 3UB6A 4WF0A 5HWTA 3LIAA 3PR6A 3ULFA 2W3GA 2ZMFA 3ICYA 3E0YA 4LLOB 1TS6A 4L9FA 3KX0X 2W1RA 3T4JA 4CLCD 3UE6A 1W63Q 4EXOA 3S7PA 4DMZA 3CLOA 4NEED 5CX7A 2EWWA 4L9GA 4YWZA 4EU0A 2WKRA 4IJGA 4M4XA 5DJUA 3VE3A 1P97A 1LT0A 2HJEA 4ZRRA 5HL6A 3MQOA 3GDIA 1P9WA 2QJ5A 3JVUA 3LICA 3LR4A 2HJ9C 3MR0A 4UEYA 3UMEA 1VHMA 4O8GA 4WUJA 3RFBA 3R4KA 4MN5A 4LRZE 4MMNA 3FPWA 2ZOHA 3PBNA 4I39A 3OC2A 5HDSA 3VOLA 4HP9A 2GZAA 4HP4A 4ARZB 3U2AA 4HY8A 1IFQA 3ZQ5A 4E04A 1D06A 3BW6A 1F98A 4XT2A 4G3WA 3F1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFQ A;  3NHQ A;  5HD5 A;  5HDC A;  2WKQ A;  1LSX A;  2VEA A;  1DP6 A;  4EEU A;  2A24 A;  2OOL A;  3H7W A;  4EW7 A;  2QKP A;  5J7E A;  4HNB A;  1XJ2 A;  3IS2 A;  3NJA A;  2VV8 A;  3HJI A;  2OWJ A;  3P7N A;  4HHD A;  5HZH A;  1EW0 A;  1T19 A;  2V0U A;  4F3L B;  1GSV A;  2PHY A;  5IU1 A;  5TBM B;  4HH3 A;  2HV1 A;  4R70 A;  1MZU A;  4R38 A;  3SW1 A;  5TBM A;  1BYW A;  1S4R A;  2QWS A;  3LUQ A;  3PHY A;  5AVF A;  3E4Q A;  1OJG A;  2H28 A;  2PYR A;  2I9V A;  4R6L A;  1TS7 A;  1DP9 A;  3G6O A;  1S4S A;  2JN7 A;  3H82 B;  1T18 A;  3FC7 A;  3IS2 B;  2VV7 A;  2KDK A;  1ODV A;  1KOU A;  1S66 L;  4EQ1 A;  1GSX A;  3NOU C;  2GJ3 A;  2VLG A;  1OTE A;  1G28 A;  3LIF A;  4GS9 A;  4WL9 A;  1N9O A;  1V9Y A;  1WA9 A;  4HJ3 A;  1OTD A;  3T50 A;  3RTY A;  3VE4 A;  2ZBB A;  3LIB A;  2D02 A;  4WLA A;  4PKY A;  4H6J A;  1OTB A;  2V9A A;  4R3A A;  4EET B;  2INW A;  4KUO A;  3A0S A;  1V9Z A;  4JGP A;  4GHI A;  4NXB A;  4PKY G;  3K3D A;  5F5Y A;  2PDR A;  1OTA A;  4NXG A;  4JGR A;  4NXE A;  3A0R A;  4LPZ A;  5EFW A;  5J3W A;  2QHK A;  1TS8 A;  1JNU A;  1VB6 A;  3BWL A;  3GEC A;  3H82 A;  3LIE A;  4HQA A;  2M1C A;  1S67 L;  3BY8 A;  1UGU A;  2W27 A;  3MXQ A;  3H9W A;  4I3A A;  4LRX C;  4RQ9 A;  2B02 A;  4I5S A;  2JHE A;  2R78 A;  3CWF A;  3D72 A;  5J4E A;  3MFX A;  1T1A A;  5AVE A;  5G4Z A;  3UB8 A;  4B9O A;  4BBU A;  3E4O A;  4EER A;  5HSQ A;  5DKL A;  2CMN A;  1UWP X;  1OT9 A;  2Z6C A;  2ZOI A;  2L4R A;  3UB6 A;  1S1Y A;  4WF0 A;  3NOP C;  5HWT A;  5HWV A;  3LIA A;  4JGO A;  3ULF A;  1XFN A;  1TS0 A;  2A24 B;  2L1M A;  2VV6 A;  3FG8 A;  2KX6 A;  3ICY A;  5DJT A;  5HDD A;  3UMD A;  4LLO B;  1TS6 A;  4L9F A;  2J80 A;  3F1P B;  4DJ2 A;  3KX0 X;  4BBV A;  4HOI A;  3LID A;  3F1O A;  5G4Y A;  4DJ3 A;  4H6J B;  3RH8 B;  2K7S A;  2V1B A;  4K08 A;  1OT6 A;  3LYX A;  4BBT A;  3UE6 A;  1N9L A;  4EXO A;  2WKP A;  1OJ5 A;  2PD7 A;  2P7J A;  3BY9 A;  2V1A A;  4KUK A;  4XT2 B;  2QJ7 A;  1UWN X;  3LI8 A;  4KQD A;  2YKF A;  3CLO A;  4HIA A;  1T1B A;  2EA9 A;  1LSV A;  5DKK A;  4L9G A;  1X0O A;  2PYP A;  4L9E A;  5F69 A;  5KIZ A;  4YWZ A;  3EWK A;  2WKR A;  2OWH A;  4M4X A;  5DJU A;  3VE3 A;  4MN6 A;  3UB7 A;  4F3L A;  1XJ4 A;  3PYP A;  1P97 A;  3LI9 A;  4I38 A;  4JGQ A;  1LT0 A;  2D01 A;  1Y28 A;  2V0W A;  5A8B A;  1NWZ A;  3MQO A;  2BAS A;  4EEP A;  3GDI A;  3MQQ A;  1XJ6 A;  4HJ4 A;  2QJ5 A;  4GS9 B;  2PD8 A;  3LIC A;  4HJ6 A;  1S1Z A;  3MR0 A;  2PR6 A;  4LRY C;  3A0V A;  4HI4 A;  1GSW A;  3UME A;  4WUJ A;  3CAX A;  4NXF A;  4WN5 A;  1DRM A;  1OTI A;  3HJK A;  4HH2 A;  3E4P A;  4LRZ E;  4MN5 A;  1P0Z A;  3NOT C;  2Z6D A;  5F68 A;  2YKH A;  3EEH A;  1N9N A;  5IS1 A;  5F6A A;  5HWW A;  2ZOH A;  2L0W A;  2W0N A;  5HD3 A;  1F9I A;  1T1C A;  4EES A;  3C8C A;  4I39 A;  1XJ3 A;  2PR5 A;  4I3J A;  5HDS A;  3VOL A;  4GCZ A;  1D7E A;  3IBR A;  1LSW A;  4GHI B;  4GW9 A;  4I3I A;  4HP9 A;  3UB9 A;  4HP4 A;  3H7W B;  4HY8 A;  3K3C A;  3F1O B;  3ZQ5 A;  4E04 A;  1D06 A;  3C2W A;  5I5L A;  3MJQ A;  1DP8 A;  1F98 A;  3OLO A;  3F1N B;  4XT2 A;  3F1N A;  3B33 A;  3F1P A;  1LL8 A; 
#chains in the Genus database with same CATH topology
 1G5U A;  1DP6 A;  1PNE A;  3VMA A;  2PU4 A;  3BYD A;  1CI9 A;  4OVD A;  3V3R A;  5TBM B;  4CLC A;  3D9Y A;  3W4P A;  3G6O A;  1S4S A;  3OZH A;  3IS2 B;  2VV7 A;  2VKS A;  1N9O A;  3MMH A;  2D02 A;  3U4L P;  3W4Q A;  3MZD A;  1RGY A;  1XPB A;  4CQH A;  3UE1 A;  2J3T C;  2O99 A;  3K3D A;  4H8R A;  1O07 A;  2P08 A;  1HTZ A;  1KDW A;  4A5R A;  4BL3 A;  4IHQ A;  1BUE A;  4I5S A;  3M2J A;  2ZC5 B;  1JVJ A;  4X1M A;  3B47 A;  2JKT M;  4HBU A;  1NZO A;  4IBX A;  2J7V A;  1MKM A;  1ES3 A;  1I2S A;  5E2F A;  2ZMV A;  2ZQ9 A;  5G4Y A;  3RXX A;  1ES2 A;  4H6J B;  2X71 A;  1H5X A;  3LI8 A;  3GMW A;  3TSG A;  1LSV A;  4CJN A;  3D4F A;  1XJ4 A;  4S2J A;  5DFX A;  4G3K A;  3MQQ A;  1XJ6 A;  4R23 A;  1G6A A;  2HF6 A;  2Y2H A;  1S1Z A;  3BQA A;  3K2N A;  3HJK A;  4O01 A;  1E4D A;  3NOT C;  3IWO A;  4OQ0 A;  4KG2 A;  3EEH A;  4HEF A;  2X02 A;  4S2I A;  5AQ9 A;  4I3J A;  1W63 M;  3H7W B;  3DTI A;  5CGW A;  4EBL A;  1CI8 A;  4P6Z M;  4LV2 A;  1LSX A;  2NUT C;  1KGF A;  2VEA A;  5TR7 A;  5J7E A;  2JKR M;  5GL9 A;  3PTE A;  3OOV A;  4UHU A;  3IT9 A;  2V0U A;  3PBR A;  5HAP A;  2CC1 A;  1K56 A;  5TGF A;  2QMI A;  1S4R A;  3LUQ A;  3IXG A;  5CTN A;  1PWD A;  3BEB A;  1XGI A;  4Q8I A;  1V9Y A;  1JWP A;  4K0W A;  3PXP A;  2E8J A;  4DXB A;  4F94 A;  2ZC6 B;  3KO6 A;  2ZM8 A;  4DE0 A;  3TOI A;  5E2G A;  5J4E A;  3LR5 A;  1K54 A;  3ZG9 B;  1IYP A;  1MC0 A;  5HDD A;  3UMD A;  3SS5 A;  2WKI A;  4DF6 A;  1IYS A;  4FCF A;  1E3U A;  3IF6 A;  4G3V A;  4BBT A;  4ZBE A;  1N9L A;  2WKP A;  2V1A A;  5F1F A;  3IWQ A;  2V20 A;  3CUE A;  1TDG A;  4L9E A;  1K54 C;  5CGS A;  1M6K A;  5JYO A;  4JGQ A;  1AXB A;  2DRW A;  4HJ4 A;  3GR2 A;  4YOF A;  3UO9 A;  3BEC A;  4E3I A;  2P9V A;  1OTI A;  1YQS A;  5L8M A;  3C38 A;  1ERQ A;  2DNS A;  1XJ3 A;  4KEN B;  2K2N A;  2P04 A;  1MWR A;  3ZFZ A;  3MBZ A;  4CPK A;  3F1N A;  3A3F A;  4P87 A;  5GLC A;  2WKQ A;  4KZ3 A;  1MPL A;  5DF9 A;  1VEU B;  2OOL A;  3G34 A;  1ALQ A;  2RCX A;  4BMW A;  1ZG4 A;  2QZ6 A;  1PW1 A;  4WYY A;  5KSH A;  2Q9N A;  2I9V A;  4R6L A;  2Y8H A;  1KGG A;  5AQB A;  1FIL A;  1KOU A;  3LR0 A;  3UN7 A;  3S4X A;  2OSU A;  2Y2G A;  4U3T A;  3A0S A;  2PDR A;  1KE3 A;  4NXG A;  5L2F A;  3EQU A;  2J9O A;  2A49 A;  4GD6 A;  2FH5 A;  3FPV A;  2B02 A;  4JKT A;  4FSF A;  4YNR A;  4DKI A;  1UWP X;  1M40 A;  2ZC4 B;  1MKI A;  4QWO A;  4CLC B;  5FAO A;  1XP4 A;  3DWK A;  2XRN A;  1FCN A;  1RP5 A;  3FZC A;  5G18 A;  3ZHH A;  3A3I A;  2K7S A;  1OT6 A;  2NUP C;  1MWS A;  2QJ7 A;  1J3W A;  4HIA A;  1X0O A;  3IH8 A;  3V67 A;  3PYP A;  3KYQ A;  2V0W A;  5A8B A;  2WGV A;  5GLA A;  2Y2I A;  3G32 A;  1ZHH B;  4X56 A;  2EX2 A;  5DF7 A;  3MXS A;  4GJ4 A;  1YLY A;  3TG9 A;  1P0Z A;  2EXB A;  2P74 A;  5HWW A;  2L0W A;  3FKW A;  3V39 A;  4EW7 A;  3IF6 C;  4O7D A;  1YLP A;  2G2U A;  3HVF A;  4E6W A;  5I5L A;  5CED A;  1Q2Q A;  3O87 A;  1WE4 A;  1LL8 A;  3LGO A;  4EEU A;  4HNB A;  5EV0 A;  5CEB A;  3NC8 A;  5IU1 A;  3C4O A;  1PI4 A;  1BYW A;  1FIK A;  1KVL A;  4BD0 A;  3IF5 A;  5A92 A;  1W79 A;  4PKY A;  2VGJ A;  3A0R A;  4FOF A;  3GV9 A;  1KE0 A;  1JNU A;  3O5Y A;  1YSQ A;  2WK0 A;  2W1T B;  3C30 A;  3MXQ A;  4I3A A;  5I94 A;  1CEF A;  2M7U A;  2P9V B;  5AVE A;  4B9O A;  5DKL A;  3IX3 A;  2UWX A;  3PAE A;  3UB6 A;  4P85 A;  5GHZ A;  4OP8 A;  1MXO A;  3ICY A;  4QY5 A;  4MBH A;  1PWC A;  3T4J A;  1PYY A;  4CLC D;  3S7P A;  3NEC A;  4NEE D;  4N92 A;  4L9G A;  2EFX A;  4QJG A;  2H5S A;  4PPR A;  3MQO A;  1K4F A;  3GDI A;  1GHP A;  3JVU A;  3LIC A;  2PAV P;  4UEY A;  1VHM A;  3R4K A;  4KZ4 A;  4MN5 A;  2Y2N A;  4JLF A;  4Z9Q A;  5CHM A;  2ZL1 B;  3OC2 A;  1W7F A;  2GZA A;  2PRF A;  4N1X A;  1IFQ A;  4E04 A;  5FQ9 A;  1XFQ A;  1E25 A;  1NRF A;  2J3T D;  4OKP A;  3CHW P;  2Y2O A;  2QKP A;  1YMS A;  3T4T A;  2OWJ A;  3AGD A;  4XUX A;  5AVF A;  5EVI A;  5FSR A;  1T18 A;  4E3J A;  3O86 A;  2HPB A;  4BLM A;  2ZBB A;  2XQZ A;  4KUO A;  1IOU A;  4Y13 A;  4FTX A;  2Y79 A;  5EFW A;  4NXE A;  3BFG A;  4QB8 A;  3ZG5 A;  1S67 L;  2OAQ 1;  4AFI A;  1PFL A;  4ZDX A;  4JGO A;  2Y2K A;  1XFN A;  2L1M A;  2A24 B;  2KX6 A;  1KE4 A;  4ZJ2 A;  3NY4 A;  3F1O A;  4DJ3 A;  4KZ5 A;  2V1B A;  3GTC A;  1O7E A;  5FI7 A;  4X55 A;  4KQQ A;  1OJ5 A;  2PD7 A;  3BFE A;  3CG5 A;  5FI6 A;  1LLB A;  4KQD A;  5F69 A;  2Y59 A;  2BLS A;  2OLU A;  4F3L A;  4OP5 A;  4ZTK A;  2BAS A;  5HX9 A;  1L0E A;  1F2K A;  4LRY C;  1GSW A;  5HAI A;  4EWF A;  2XD5 A;  2Z6D A;  3CJM A;  1OPX A;  3WRT A;  4S2K A;  1JTG A;  5L10 A;  4MEZ A;  3DW0 A;  3K3C A;  4OOL A;  1H0M A;  2KLI A;  3LFV A;  1L3L A;  3M6B A;  3BQ8 A;  3IS2 A;  3IWI A;  2WZZ A;  3L9K A;  3VP0 A;  4WEJ A;  2K31 A;  4R38 A;  3P98 A;  2W3E A;  5TBM A;  2PYR A;  1YLJ A;  2PT7 A;  1TS7 A;  4IED A;  4QY6 A;  2FFY A;  2J9P A;  2V2F F;  3W2Z A;  1S66 L;  5HPI A;  1GSX A;  4QHC A;  2B18 A;  4GS9 A;  3EOI A;  4HJ3 A;  5DTS A;  4ME4 A;  5FDH A;  1U60 A;  4NET A;  5CHU A;  2XF3 A;  2Y2J A;  3OCL A;  1KGE A;  2HP6 A;  4GDB A;  4GOG A;  4S2L A;  1T1A A;  3EQV A;  1W8Y A;  1OT9 A;  1YT4 A;  1RCJ A;  1SHV A;  1BLH A;  4R3B A;  4DJ2 A;  5FAP A;  2ZM0 A;  4Y5F A;  4E3N A;  3P09 A;  4E6X A;  4GN2 A;  2JKG A;  4JXV A;  1Y4O A;  1MY8 A;  1SZV A;  1UWN X;  4KZ7 A;  2WAD A;  3ZG0 A;  5DKK A;  2PYP A;  1LI9 A;  4Y3I A;  1Y54 A;  3LI9 A;  3GVB A;  2HP9 A;  5BOH A;  4OLD A;  1I5Q A;  2J3W A;  4X53 A;  1SDE A;  5FAQ A;  4JF6 A;  2PR6 A;  4OQH A;  4ETX A;  3QP6 A;  3S22 A;  1KVM A;  3BLM A;  4X69 A;  3R7W A;  3E4P A;  5GHY A;  4U0X A;  5KMW A;  5CXW A;  2ZJ9 A;  4IVI A;  4UAA A;  4WM9 A;  1D7E A;  2JKT I;  2Z2M B;  3NHQ A;  3UDI A;  2WZX A;  4KZ8 A;  5HZH A;  3S7O A;  4XXR A;  3ZYT A;  4Q0J A;  2HV1 A;  4KZ6 A;  3VOZ A;  3Q81 A;  5HW3 A;  3BFC A;  4E3L A;  1HLU P;  3LEZ A;  3LIF A;  2FFF B;  1MWU A;  2LB9 A;  4R4S A;  1FR6 A;  5F1G A;  2V8F A;  1YAX A;  2V9A A;  4R3A A;  5EVI D;  1PRQ A;  3CMZ A;  2IWD A;  4NXB A;  3ZNY A;  1AWI A;  1OTA A;  3NDG A;  1TS8 A;  3T1Q B;  2JHE A;  3FWL A;  3MKF A;  4PM8 A;  2A2L A;  5K5B A;  1CK3 A;  3Q07 A;  3C4P A;  2ZC7 A;  3JYI A;  3PBO A;  3JVV A;  2XLN A;  3A3E A;  1P9R A;  1PIO A;  1MWT A;  3DTM A;  4EBN A;  3QP8 A;  4PM7 A;  5A90 A;  3LYX A;  3SZT A;  1H8M A;  4NG2 A;  4JXW A;  5DFY A;  3CI6 A;  2HGV A;  1HVB A;  4IUK A;  1N4O A;  3T12 B;  4KG6 A;  3P01 A;  1NYY A;  5AQA A;  4D2O A;  3MQ0 A;  5M18 A;  4E3M A;  3A0V A;  3CAX A;  2V8C A;  3ITA A;  3UE3 A;  2WYX A;  1VET B;  2ACG A;  1L2S A;  4ZAM A;  3F1O B;  1XX2 A;  3SH9 A;  3N6I A;  2A24 A;  1XJ2 A;  1IYO A;  3HJI A;  4OH0 A;  5FEF A;  4HHD A;  1EW0 A;  2ZQD A;  3QNB A;  3VP2 A;  1L0F A;  1GHI A;  2IWB A;  3T4O A;  5FQJ A;  2O9A A;  3HL9 A;  5U47 A;  1L0G A;  1NJ4 A;  2VLG A;  1OTE A;  2JKR I;  1NLZ A;  2PBY A;  3DBA A;  1XKZ A;  1OTB A;  2INW A;  4GHI A;  1K6R A;  3IHA A;  1CEG A;  4UQI S;  3VP1 A;  4C75 A;  5EVI B;  1VB6 A;  1LI0 A;  1TEM A;  2DMW A;  1UGU A;  1VQQ A;  3Q82 A;  4EER A;  2E8I A;  3N7W A;  2KOI A;  2Q9M A;  3VV4 A;  2XDM A;  4WF0 A;  3LIA A;  3PR6 A;  4JPM A;  2W3G A;  3G2Z A;  2RL3 A;  2Y2P A;  3E0Y A;  3VFH A;  4DDY A;  3Q1F A;  1W63 Q;  1I2W A;  5CHJ A;  1IEL A;  2EWW A;  4M3K A;  4EU0 A;  3G31 A;  2ZM2 A;  3IH9 A;  3ZCZ A;  1ESI A;  4B4Z A;  2QJ5 A;  1BT5 A;  3NBL A;  3CPT A;  2HJ9 C;  2JC7 A;  5A91 A;  3V50 A;  4EV4 A;  1K38 A;  3RFB A;  4LRZ E;  5EOE A;  1S0W A;  1Z6F A;  1EWZ A;  5HL1 A;  4GZB A;  5JYP A;  3IHB A;  3NDE A;  1YLW A;  4DXC A;  1FOF A;  4ARZ B;  3U2A A;  3RXW A;  4HY8 A;  2DCF A;  2GDN A;  4XT2 A;  3SH8 A;  5HDC A;  5GLD A;  2VA0 A;  5CTM A;  3KYE A;  5HPF A;  3HLB A;  2PHY A;  3KSF A;  3PAG A;  1SKO A;  2QWS A;  4KQR A;  4X68 A;  5TFQ A;  4KG5 A;  4LCL A;  2GJ3 A;  4FD8 A;  3OCN A;  3RTY A;  3LIB A;  1YLT A;  3IF6 B;  2XD1 A;  5EM0 A;  5FA7 A;  4BJP A;  1G6O A;  4LPZ A;  3JPU A;  3CPT B;  3H9W A;  5A93 A;  5F82 A;  1DY6 A;  3E4O A;  4LCM A;  3A3J A;  2L4R A;  1NZU A;  1S1Y A;  4OON A;  4CLC E;  5HWV A;  3E98 A;  3PBT A;  1TS0 A;  4KZA A;  2VV6 A;  3N8R A;  2H10 A;  4FH2 A;  3IBJ A;  4RVA A;  2ZC3 B;  1K56 D;  2HP5 A;  2XEP A;  1T1B A;  2W3F A;  4E3O A;  2XRO A;  3A3D A;  3EGX C;  2Y2Q A;  4P0M A;  2LB5 A;  4GS9 B;  3LR3 A;  1HD8 A;  3GQZ A;  5HFO A;  3E2K A;  4JF4 A;  1YM1 A;  4NXF A;  4DE1 A;  5IT5 A;  2OAP 1;  1FSW A;  1TVF A;  4DE3 A;  2W0N A;  4K91 A;  4GW9 A;  4II7 A;  4B93 A;  5DTT A;  3OBF A;  1DP8 A;  4D60 A;  4ETZ A;  1GA9 A;  1K4E A;  4BQM A;  3G2Y A;  1GSV A;  1MZU A;  4C3Q A;  3AGE A;  1W8Q A;  1ESU A;  4Y7P A;  2KDK A;  5FAS A;  3OPL A;  3M2K A;  3N8L A;  1KDS A;  5LBR A;  4WLA A;  4H6J A;  4L0L A;  5L09 A;  3QP4 A;  4JGR A;  5J3W A;  3LIE A;  3RH8 B;  3GEC A;  3N8S A;  4GLQ A;  4LRX C;  2H0Y A;  4ID4 A;  3CWF A;  3T4K A;  3N4I A;  1ZG6 A;  2ZOI A;  3TW8 A;  3NOP C;  4S2N C;  1TD5 A;  5FEG A;  1LL5 A;  5MC7 A;  1VEU A;  3TJZ C;  4K0X A;  3OPP A;  2M7V A;  3LID A;  3LY3 A;  4Z1W A;  3I7J A;  2QPN A;  3BJN A;  3VFF A;  4IBR A;  3KYZ A;  3O88 A;  4I38 A;  2D01 A;  3MZE A;  4EEP A;  4Q0H A;  2Y55 A;  5CER A;  3G35 A;  1K57 A;  3VOY A;  1TDL A;  1BUL A;  3MSH A;  4UA7 A;  1LSW A;  2XH9 A;  5FQM A;  2V1Z A;  3VSL A;  1DJA A;  2ZLY A;  4PM9 A;  2OV5 A;  4MBK A;  3HLD A;  4EUV A;  1YLZ A;  3NCK A;  2ZQ7 A;  3SH7 A;  1CF0 A;  5E2H A;  3UPN A;  3E4Q A;  1SCW A;  4OPR A;  3C7U A;  2R9X A;  2VZW A;  4WL9 A;  2IWC A;  3QHY A;  5E2E A;  1PZP A;  5KSC A;  3T1X A;  2FZ0 A;  4N9K A;  3T1R A;  1ES4 A;  3R7W B;  4DN0 A;  2PBD P;  4O0P A;  2VGL S;  2WGW B;  2QHK A;  4HQA A;  3BY8 A;  1WYC A;  1DJB A;  5FDS A;  5HAR A;  2R78 A;  3D72 A;  3IXD A;  2XFT A;  4DDS A;  4EQI A;  5DJT A;  2Q0O A;  4HOI A;  3PBS A;  1EI5 A;  4UQI M;  3WS2 A;  4K08 A;  1STZ A;  5EUA A;  1VM1 A;  3BY9 A;  4XT2 B;  1RGZ A;  1SKO B;  4X1L A;  3S7Q A;  4PHT A;  3UE0 A;  4IVK A;  2J8Y A;  4OPZ A;  2WKH A;  1SDN A;  4GKU A;  5DTK A;  3VP4 A;  1LL9 A;  3EGD C;  4OOM A;  3UNW A;  4WEK A;  2XGN A;  3S1Y A;  4LV0 A;  5DVA A;  3WRZ A;  2XSS A;  1DJC A;  3LEQ A;  4X6T A;  1F9I A;  1ZC2 A;  2WUQ A;  2PR5 A;  3HBR A;  3TE8 A;  4ESP A;  2GX5 A;  3OLO A;  4BEN A;  1PW8 A;  1FR1 A;  3NJA A;  1FCM A;  3HUO A;  3SS4 A;  2O9C A;  1GA0 A;  3CZD A;  1NXY A;  3MF0 A;  1A0K A;  1DP9 A;  1H3Q A;  2OLV A;  4RX3 A;  4Y15 A;  3M6H A;  1ODV A;  4GB7 A;  3KSG A;  1BLC A;  3T50 A;  2EX8 A;  1ES5 A;  3BRM A;  1NY0 A;  3TRC A;  4P6B A;  3LCE A;  3DAV A;  2EFU A;  1XA1 A;  4QPR A;  3EEA A;  5CX7 A;  1IYQ A;  4JBF A;  4WBG A;  3V3S A;  1WYB A;  5G4Z A;  3CUE C;  1JWZ A;  3IXH A;  2Z6C A;  1YPR A;  4E3K A;  2ZQA A;  4Y2F A;  2UV0 E;  5HWT A;  3T1S A;  2ZMF A;  3UDX A;  3AGF A;  3SS3 A;  3KX0 X;  4MNR A;  3NI9 A;  1K6S A;  1ONH A;  3UE6 A;  3FKV A;  4DMZ A;  3IX8 A;  3ZVW A;  2Y4A A;  4YWZ A;  1NYM A;  4M4X A;  3VE3 A;  2ZQ8 A;  2WAE A;  1P97 A;  1LT0 A;  2HJE A;  3DTE A;  4C6Y A;  3HLC A;  3LR4 A;  3MR0 A;  3QP1 A;  4O8G A;  3HLW A;  3HLG A;  3MXR A;  3FPW A;  1JTD A;  3L7H A;  2ZOH A;  3PBN A;  1VET A;  2JCH A;  5EE8 A;  5HDS A;  4HES A;  4HP4 A;  4JXS A;  2JKF A;  3BW6 A;  4PM5 A;  5FQQ A;  3F1N B;  3HLE A;  1N9B A;  2VX8 A;  3DWZ A;  2WKE A;  4FH4 A;  1T19 A;  4MBF A;  4HH3 A;  2HDQ A;  3WS4 A;  3ZNT A;  1OJG A;  4Y17 A;  3H82 B;  1NLY A;  1C3B A;  4EQ1 A;  5FAT A;  4WMC D;  1IKG A;  2ZL1 A;  2VGK A;  4OQI A;  5AJG A;  4JGP A;  4PKY G;  5F5Y A;  4ZJ1 A;  3W4O A;  3QP2 A;  1BTL A;  1K55 C;  4KZB A;  4PMA A;  3C5A A;  3GRJ A;  4PAU A;  4QD4 A;  3Q7Z A;  4KQO A;  4Y0O A;  3E2L A;  4GD8 A;  3LY4 A;  1NRJ A;  1XXM A;  4LFU A;  4OOY A;  2GNX A;  2P7J A;  3BLS A;  2WGI A;  3MZF A;  3UB7 A;  3QP5 A;  4WEL A;  1NWZ A;  3IX4 A;  3HLF A;  2W1T A;  2W3D A;  4JF5 A;  3ZVT A;  5FL3 A;  5M1A A;  2G2W A;  5CRF A;  4ZJ3 A;  5IS1 A;  3LO7 A;  3C8C A;  2ZQC A;  3ZDJ A;  4I3I A;  2EWV A;  3HUN A;  3S7N A;  3UB9 A;  1G68 A;  4R0Q A;  3C2W A;  5GLB A;  3V5M A;  3B33 A;  3F1P A;  4MDZ A;  5HD5 A;  2VK3 A;  3OPR A;  3Q7V A;  3H7W A;  2WGW A;  5FQI A;  1ONG A;  3P7N A;  3HRE A;  1L0D A;  5EM1 A;  1W5D A;  3C7V A;  4N1H A;  1ACF A;  1MBL A;  4Q0I A;  2H28 A;  5EOO A;  2JN7 A;  2B5R A;  4GNU A;  2Y91 A;  4R3J A;  1FQG A;  3FYZ A;  1OTD A;  1IEM A;  4YFM A;  2Y2M A;  4R1G A;  3NUL A;  4EUZ A;  4QU3 A;  1YSP A;  2I72 A;  2M1C A;  4RYE A;  2XK1 A;  5FQK A;  4Y0T A;  3MFX A;  4CLC C;  4BBU A;  3UB8 A;  3RJU A;  1TF1 A;  3T4S A;  2EX9 A;  2EXA A;  5GHX A;  5L07 A;  4BBV A;  4S2P A;  2JBF A;  3G4P A;  4RA7 A;  1K57 C;  4MN7 A;  4JXG A;  1OME A;  4KUK A;  3CIT A;  4WZ4 A;  2YKF A;  2EA9 A;  3MKE A;  5KIZ A;  4MCW A;  2OWH A;  1E3U D;  1K55 A;  4MN6 A;  4RQ9 A;  1PWG A;  2IA2 A;  4BL2 A;  4HBT A;  2PD8 A;  1GHM A;  3ITB A;  4HI4 A;  1XA7 A;  4HH2 A;  4DRT A;  3MS6 A;  2VJW A;  4UA9 A;  2XR0 A;  1N9N A;  5HD3 A;  3OPH A;  2G7U A;  4GHI B;  2C6W B;  5EVI C;  5HAQ A;  3MJQ A;  3BM6 A;  4OLG A;  3BFF A;  3ISG A;  5TJJ A;  5F83 A;  3VSK A;  1CJF A;  2PU2 A;  1H8Z A;  1H8Y A;  1FCO A;  4F3L B;  4YIN A;  2HDS A;  4R70 A;  3W8K A;  5EVL A;  3PBQ A;  3HCY A;  5M19 A;  1PZO A;  4S2N A;  1BLP A;  3QNC A;  1J9M A;  3FC7 A;  3DTK A;  3WS0 A;  3NOU C;  5C5K A;  4XUZ A;  4NKP A;  2C5W B;  4PM6 A;  1JWV A;  4IUH A;  1BZA A;  1V9Z A;  2O9B A;  3BFD A;  3BWL A;  3G30 A;  4FUW A;  4Y0U A;  4GDN A;  3KSI A;  5DF8 A;  5AQ7 A;  2O0Y A;  1LHY A;  1GCE A;  2CMN A;  3T4Q A;  5FI2 A;  4WZ5 A;  3D3O A;  1ZTU A;  3WS5 A;  4RX2 A;  3Q7V B;  3FG8 A;  4LGW A;  2J80 A;  3F1P B;  4R4R A;  4BWI A;  4S2M A;  3T4L A;  1IKI A;  4OPQ A;  3UY6 A;  2XA7 S;  3WS1 A;  5KZH A;  4LV3 A;  4KZ9 A;  4B88 A;  4NK3 A;  4WMC A;  3EWK A;  4WZ5 C;  1ERO A;  3SOI A;  1Y28 A;  1K25 A;  1YMX A;  3WWX A;  2X01 A;  4HJ6 A;  5CGX A;  3UDF A;  3B3X A;  2BG1 A;  2VGL M;  2HDU A;  4WN5 A;  1DRM A;  1F5M A;  2AVX A;  3IQA A;  2H0T A;  5J8X A;  5F68 A;  2YKH A;  5F6A A;  4EES A;  1QME A;  1T1C A;  4GCZ A;  3IBR A;  1PI5 A;  1QMF A;  1S6R A;  1YKD A;  2Y2L A;  4UA6 A;  2QYB A;  2XA7 M;  2XFS A;  3GSG A;  2VV8 A;  1Q2P A;  3MFD A;  1HZO A;  2R9W A;  3SW1 A;  4LV1 A;  5EPH A;  3PHY A;  3VP3 A;  5EVE A;  3UPO A;  3UB5 P;  4S2O A;  3NIA A;  1G28 A;  3ZGA B;  3FV7 A;  4P6Z S;  1WA9 A;  1XGJ A;  3KSH A;  4DE2 A;  2Z2L B;  4EET B;  3O3V A;  3B42 A;  4B4X A;  2ZD8 A;  1K0K A;  3HUM A;  3VE4 A;  3H82 A;  4OPY A;  2W27 A;  1BSG A;  4U0T A;  5HSQ A;  4MLL A;  4ARZ A;  2W3H A;  5D3O A;  3ULF A;  4LLO B;  4X25 A;  4OQG A;  1TS6 A;  2WAF A;  3IXB A;  4L9F A;  3ZG7 B;  2HDR A;  2W1R A;  1D1J A;  1BLS A;  4EXO A;  1ERM A;  4LEN A;  3CLO A;  2BTF P;  3ZG8 B;  1CQA A;  2WKR A;  4IJG A;  5DJU A;  2JE5 A;  2HZ5 A;  5HL6 A;  4ZRR A;  2A3U A;  1P9W A;  5CEC A;  4BD1 A;  5EEC A;  5IHV A;  2EX6 A;  3UME A;  4WUJ A;  4MMN A;  4N9L A;  2ZMA A;  3UPP A;  4I39 A;  3VOL A;  1SKF A;  4EBP A;  4HP9 A;  1ZKJ A;  3ZQ5 A;  5E43 A;  1D06 A;  1FSY A;  2B95 A;  1F98 A;  1Z09 A;  4G3W A;  2MJ6 A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2J3T D;  5HDC A;  1DP6 A;  2VX8 A;  2QKP A;  2VA0 A;  3T4T A;  2OWJ A;  5HPF A;  1T19 A;  2PHY A;  4CLC A;  5TBM B;  3KSF A;  4HH3 A;  2QWS A;  5AVF A;  1OJG A;  3G6O A;  3H82 B;  1S4S A;  1T18 A;  3IS2 B;  1NLY A;  2VV7 A;  4EQ1 A;  2GJ3 A;  2VKS A;  1N9O A;  3OCN A;  3RTY A;  3MMH A;  2ZBB A;  3LIB A;  2D02 A;  4CQH A;  4KUO A;  5AJG A;  2J3T C;  2O99 A;  4JGP A;  4PKY G;  5F5Y A;  1IOU A;  3K3D A;  2Y79 A;  5EFW A;  4BJP A;  4NXE A;  1G6O A;  4LPZ A;  2P08 A;  4IHQ A;  1S67 L;  3H9W A;  2OAQ 1;  4I5S A;  4AFI A;  4PAU A;  3B47 A;  3E4O A;  4KQO A;  2L4R A;  1S1Y A;  4CLC E;  2JKT M;  5HWV A;  3E98 A;  4JGO A;  3PBT A;  1NRJ A;  1XFN A;  1TS0 A;  1MKM A;  2A24 B;  2L1M A;  2VV6 A;  2KX6 A;  2ZMV A;  2GNX A;  3F1O A;  5G4Y A;  4DJ3 A;  3IBJ A;  4H6J B;  2V1B A;  1OJ5 A;  2PD7 A;  2P7J A;  3LI8 A;  4KQD A;  1T1B A;  1LSV A;  2W3F A;  5F69 A;  2XRO A;  3UB7 A;  4F3L A;  3EGX C;  1XJ4 A;  5DFX A;  4G3K A;  4WEL A;  1NWZ A;  2BAS A;  2LB5 A;  3MQQ A;  1XJ6 A;  2HF6 A;  4GS9 B;  2W1T A;  3LR3 A;  1S1Z A;  2W3D A;  3BQA A;  4LRY C;  3K2N A;  1GSW A;  4NXF A;  5FL3 A;  3HJK A;  4O01 A;  5IT5 A;  3NOT C;  2OAP 1;  2Z6D A;  1OPX A;  3EEH A;  5IS1 A;  2W0N A;  3C8C A;  4I3J A;  4GW9 A;  1W63 M;  2EWV A;  4I3I A;  3S7N A;  3UB9 A;  3H7W B;  3K3C A;  4II7 A;  4OOL A;  4B93 A;  3C2W A;  3OBF A;  1DP8 A;  4P6Z M;  3B33 A;  3F1P A;  4MDZ A;  4ETZ A;  2KLI A;  5HD5 A;  1LSX A;  2NUT C;  3LFV A;  2VEA A;  3H7W A;  5J7E A;  3BQ8 A;  2JKR M;  3IS2 A;  3OOV A;  3P7N A;  2V0U A;  3PBR A;  1GSV A;  4WEJ A;  1MZU A;  2K31 A;  4R38 A;  2W3E A;  5TBM A;  1S4R A;  3LUQ A;  4Q0I A;  2H28 A;  2PYR A;  2PT7 A;  1TS7 A;  2JN7 A;  3W2Z A;  2KDK A;  1S66 L;  5HPI A;  1GSX A;  2B18 A;  4GS9 A;  1V9Y A;  3EOI A;  4HJ3 A;  1OTD A;  5LBR A;  4WLA A;  4H6J A;  4L0L A;  3PXP A;  4ME4 A;  4JGR A;  5J3W A;  3KO6 A;  3OCL A;  3LIE A;  3RH8 B;  3GEC A;  1YSP A;  2M1C A;  4GLQ A;  4LRX C;  3T4K A;  3CWF A;  5J4E A;  3MFX A;  1T1A A;  4CLC C;  4BBU A;  3EQV A;  3UB8 A;  3LR5 A;  1OT9 A;  2ZOI A;  1TF1 A;  3TW8 A;  3NOP C;  3T4S A;  1TD5 A;  5MC7 A;  1MC0 A;  5HDD A;  3TJZ C;  3UMD A;  4DJ2 A;  4Y5F A;  4BBV A;  2M7V A;  3LID A;  4Z1W A;  4G3V A;  4BBT A;  3BJN A;  1N9L A;  4MN7 A;  2WKP A;  4KUK A;  2V1A A;  3CIT A;  1UWN X;  2YKF A;  2EA9 A;  3CUE A;  5DKK A;  2PYP A;  4L9E A;  5KIZ A;  4MCW A;  2OWH A;  4Y3I A;  4MN6 A;  3KYZ A;  4RQ9 A;  4I38 A;  3LI9 A;  4JGQ A;  2D01 A;  2IA2 A;  4EEP A;  2J3W A;  4HJ4 A;  4Q0H A;  2PD8 A;  4YOF A;  4ETX A;  2PR6 A;  4HI4 A;  3R7W A;  1OTI A;  4HH2 A;  3E4P A;  5L8M A;  3C38 A;  2VJW A;  1N9N A;  5HD3 A;  1XJ3 A;  2K2N A;  2G7U A;  1D7E A;  2P04 A;  1LSW A;  4GHI B;  2JKT I;  3MJQ A;  3F1N A;  5TJJ A;  3NHQ A;  2WKQ A;  5DF9 A;  2OOL A;  4BMW A;  5HZH A;  3S7O A;  4EUV A;  4F3L B;  3ZYT A;  4Q0J A;  2HV1 A;  4R70 A;  5KSH A;  3PBQ A;  3E4Q A;  3HCY A;  2I9V A;  4R6L A;  2Y8H A;  3FC7 A;  1KOU A;  3LR0 A;  3NOU C;  2VZW A;  5C5K A;  4WL9 A;  3LIF A;  2LB9 A;  4NKP A;  3VE4 A;  4IUH A;  1YAX A;  2V9A A;  4R3A A;  2FZ0 A;  3A0S A;  1V9Z A;  4NXB A;  2PDR A;  2O9B A;  4DN0 A;  1OTA A;  3R7W B;  4NXG A;  4O0P A;  2VGL S;  3EQU A;  2QHK A;  1TS8 A;  3BWL A;  4HQA A;  3BY8 A;  2FH5 A;  3FPV A;  2B02 A;  3KSI A;  2JHE A;  2R78 A;  3D72 A;  4FSF A;  2A2L A;  4YNR A;  2O0Y A;  5K5B A;  1UWP X;  2CMN A;  3T4Q A;  3D3O A;  1ZTU A;  3PBO A;  3JVV A;  4CLC B;  3FG8 A;  5DJT A;  2J80 A;  3F1P B;  4BWI A;  1P9R A;  2XRN A;  4HOI A;  3PBS A;  3T4L A;  4UQI M;  2K7S A;  4K08 A;  1OT6 A;  3LYX A;  2NUP C;  1STZ A;  2XA7 S;  3BY9 A;  4XT2 B;  2QJ7 A;  1H8M A;  4HIA A;  3S7Q A;  5DFY A;  4PHT A;  3CI6 A;  1X0O A;  2HGV A;  3V67 A;  3EWK A;  4IUK A;  3PYP A;  3KYQ A;  1Y28 A;  2V0W A;  5A8B A;  1ZHH B;  3P01 A;  3EGD C;  4HJ6 A;  4OOM A;  3MQ0 A;  3A0V A;  4WEK A;  2VGL M;  3CAX A;  4GJ4 A;  4WN5 A;  1DRM A;  1F5M A;  1P0Z A;  2XSS A;  5F68 A;  2YKH A;  3UE3 A;  5F6A A;  5HWW A;  2L0W A;  4EW7 A;  4EES A;  1F9I A;  1T1C A;  2PR5 A;  2MJ6 A;  4GCZ A;  3TE8 A;  3IBR A;  2GX5 A;  3F1O B;  5I5L A;  3OLO A;  1LL8 A;  1YKD A;  4EEU A;  2A24 A;  4HNB A;  1XJ2 A;  2QYB A;  2XA7 M;  3NJA A;  2VV8 A;  3HJI A;  4HHD A;  1EW0 A;  2O9C A;  5IU1 A;  3SW1 A;  3MF0 A;  1BYW A;  3PHY A;  1DP9 A;  1H3Q A;  3T4O A;  2O9A A;  1ODV A;  2VLG A;  3KSG A;  1OTE A;  1G28 A;  2JKR I;  1NLZ A;  4P6Z S;  1WA9 A;  3T50 A;  3DBA A;  4PKY A;  3KSH A;  1OTB A;  4EET B;  2INW A;  3B42 A;  4GHI A;  3TRC A;  3A0R A;  4FOF A;  4UQI S;  1YSQ A;  1JNU A;  1VB6 A;  3O5Y A;  3EEA A;  3H82 A;  2DMW A;  2W1T B;  3C30 A;  3MXQ A;  4QPR A;  1UGU A;  2W27 A;  4I3A A;  2M7U A;  4EER A;  5AVE A;  5G4Z A;  4B9O A;  3CUE C;  2KOI A;  5HSQ A;  5DKL A;  2Z6C A;  4ARZ A;  3VV4 A;  2W3H A;  4Y2F A;  3UB6 A;  4WF0 A;  5HWT A;  3LIA A;  3PR6 A;  3ULF A;  2W3G A;  2ZMF A;  3ICY A;  3E0Y A;  4LLO B;  1TS6 A;  4L9F A;  3KX0 X;  2W1R A;  3T4J A;  4CLC D;  3UE6 A;  1W63 Q;  4EXO A;  3S7P A;  4DMZ A;  3CLO A;  4NEE D;  5CX7 A;  2EWW A;  4L9G A;  4YWZ A;  4EU0 A;  2WKR A;  4IJG A;  4M4X A;  5DJU A;  3VE3 A;  1P97 A;  1LT0 A;  2HJE A;  4ZRR A;  5HL6 A;  3MQO A;  3GDI A;  1P9W A;  2QJ5 A;  3JVU A;  3LIC A;  3LR4 A;  2HJ9 C;  3MR0 A;  4UEY A;  3UME A;  1VHM A;  4O8G A;  4WUJ A;  3RFB A;  3R4K A;  4MN5 A;  4LRZ E;  4MMN A;  3FPW A;  2ZOH A;  3PBN A;  4I39 A;  3OC2 A;  5HDS A;  3VOL A;  4HP9 A;  2GZA A;  4HP4 A;  4ARZ B;  3U2A A;  4HY8 A;  1IFQ A;  3ZQ5 A;  4E04 A;  1D06 A;  3BW6 A;  1F98 A;  4XT2 A;  4G3W A;  3F1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...