1DP9A

Crystal structure of imidazole-bound fixl heme domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIXL PROTEIN
publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp9A00
1S4SA 4JGPA 3LIBA 1LL8A 4MN6A 4JGRA 2L4RA 5G4ZA 2H28A 3PHYA 3A0VA 4EERA 1T1BA 1Y28A 4GHIA 1TS7A 5DKKA 5HWVA 1LSVA 1UWNX 5TBMB 4H6JA 4YWZA 4XT2B 3LYXA 1MZUA 4BBTA 4GCZA 1DRMA 2B02A 2J80A 3LIAA 3IS2B 2L0WA 1KOUA 3OLOA 3FG8A 1EW0A 3D72A 3CAXA 2OWHA 4I39A 3UB7A 3BY8A 1X0OA 4WLAA 4HOIA 3LUQA 4HI4A 5HDDA 3VE4A 1S1YA 4NXFA 4R38A 2P7JA 3B33A 1XFQA 3IBRA 2A24B 1OTAA 3H7WB 2KX6A 4LPZA 1D06A 2EA9A 4R6LA 3LIEA 4EQ1A 4EW7A 1LT0A 3A0SA 5HDSA 5HD3A 2VV8A 2V1AA 4L9GA 3NHQA 4WN5A 2QJ7A 4NXEA 1TS8A 4EESA 2L1MA 4HH2A 2M1CA 1N9OA 4HY8A 3ICYA 2VLGA 1T19A 4XT2A 4HQAA 2PR5A 4EETB 3F1PB 4I38A 2PD8A 4R70A 3H9WA 3IS2A 1OTEA 1OT9A 1GSWA 4KQDA 2YKHA 2INWA 4HJ6A 1GSVA 4HHDA 1S67L 5A8BA 2BASA 3F1NB 3T50A 4F3LA 1LSXA 3UB6A 2V0WA 1OTDA 4I3IA 1F9IA 3E4QA 3MQQA 2PYPA 4LRZE 3HJKA 1S66L 3CWFA 3RH8B 3UB9A 2WKPA 4K08A 5KIZA 2GJ3A 1JNUA 2CMNA 4I3JA 5HD5A 3F1OB 2QKPA 3H82B 4HIAA 4M4XA 4PKYA 2PYRA 5J7EA 1UWPX 5DJTA 2D01A 3NOTC 5I5LA 1OJGA 1F98A 1V9ZA 1GSXA 2OWJA 2QWSA 4JGOA 3VE3A 3MFXA 2D02A 4NXBA 5F6AA 1DP8A 4HJ4A 5DJUA 3GDIA 3F1PA 2W0NA 3E4OA 1P0ZA 1WA9A 2QJ5A 1D7EA 4EEPA 3K3DA 3UMDA 1S4RA 1OJ5A 2PR6A 5HWWA 4WL9A 5AVFA 4GS9A 3F1NA 4GHIB 1NWZA 4GW9A 4H6JB 1DP9A 3EWKA 2KDKA 1XJ4A 3EEHA 4HJ3A 4JGQA 4L9EA 5TBMA 2Z6DA 2OOLA 1N9NA 4KUKA 5F68A 3GECA 4LRXC 1T1AA 5HZHA 1UGUA 3LIDA 3VOLA 3LIFA 3MQOA 1LSWA 4BBVA 2ZBBA 2YKFA 3NOPC 3RTYA 3G6OA 4I3AA 3HJIA 2QHKA 5DKLA 1S1ZA 5AVEA 1OT6A 1XJ6A 4E04A 2V0UA 2A24A 1G28A 2VEAA 3H7WA 2I9VA 2Z6CA 3SW1A 3LICA 3C8CA 2V9AA 1TS6A 1V9YA 5HDCA 3CLOA 4R3AA 4DJ2A 3LI8A 1OTIA 4WF0A 5IU1A 4BBUA 4NXGA 3MXQA 3C2WA 3KX0X 4HP4A 3FC7A 5G4YA 3NJAA 4B9OA 4EEUA 1XJ2A 3BY9A 5J3WA 5F5YA 2HV1A 1XFNA 3BWLA 3LI9A 2JN7A 4DJ3A 4F3LB 2K7SA 2ZOHA 5IS1A 3MJQA 4WUJA 1OTBA 4LLOB 3ZQ5A 4L9FA 4MN5A 3P7NA 2VV7A 2WKQA 3ULFA 5HSQA 4HH3A 2PHYA 5J4EA 1TS0A 5HWTA 3PYPA 4I5SA 3UMEA 3K3CA 4PKYG 4EXOA 3MR0A 3E4PA 2PD7A 4RQ9A 2VV6A 1XJ3A 4HNBA 1N9LA 2V1BA 2WKRA 1DP6A 3F1OA 3H82A 1T1CA 2ZOIA 2JHEA 2R78A 1P97A 5EFWA 1T18A 3UE6A 5F69A 1BYWA 3A0RA 2W27A 4HP9A 1VB6A 1ODVA 3NOUC 4KUOA 4LRYC 3UB8A 2PDRA 4GS9B
chains in the Genus database with same CATH superfamily
4P85A 2HGVA 1HLUP 4CJNA 4R3JA 4MEZA 5CTNA 5FL3A 4DMZA 3PHYA 4WZ5C 4BWIA 3U2AA 5HWVA 3C4OA 1LSVA 1K4FA 3BM6A 4X25A 1SZVA 5L09A 4MDZA 3MZFA 1DRMA 4IUKA 5EV0A 4HBUA 2XA7M 4YINA 1YMXA 3UE3A 4IVIA 4ETXA 3SH8A 1L0DA 3ITBA 5CECA 1EW0A 3OCLA 2OWHA 3EOIA 5HAPA 3JVVA 2ZQ9A 3HLCA 1DJAA 3IXHA 4NEED 4HOIA 1TD5A 4KENB 5HDDA 3VE4A 3OPHA 4R1GA 4R38A 2P7JA 3IBRA 3WRZA 3H7WB 5AQBA 4EUVA 3O86A 4R6LA 3CPTB 4LV2A 4OPRA 3VOZA 3GVBA 1LT0A 3A0SA 4JXWA 1K56D 4KZAA 1Z09A 4NXEA 4PMAA 1TS8A 1K6RA 3PBTA 5HFOA 3KYZA 4QY5A 4OOMA 4HY8A 3P98A 5TFQA 4ME4A 3W4PA 4OPZA 1OMEA 5KSCA 2XROA 2J3WA 4BD0A 3IT9A 1FQGA 5CHMA 3IF5A 1SHVA 3EGXC 3V3SA 2PD8A 2X71A 4R70A 2EX8A 4JF4A 1ZG6A 2J8YA 1NLYA 4P87A 5F1FA 3G2ZA 4HJ6A 3V67A 3TRCA 2WK0A 2P08A 4YOFA 3I7JA 1BLHA 2BASA 3F1NB 1BULA 4F3LA 2OAQ1 4DF6A 1OTDA 1HVBA 2HF6A 3E98A 2Y8HA 1F9IA 3QP5A 3V50A 3M6BA 4L0LA 5L07A 3UN7A 2UV0E 5FAQA 5DFXA 5CGWA 1S66L 4OP5A 2XDMA 4KZ4A 4BD1A 4AFIA 4E6WA 3B47A 2GJ3A 3C5AA 4ZRRA 2IWCA 1JNUA 1VETA 4N1HA 3GR2A 3GTCA 3HLWA 4HIAA 5FQIA 5FQMA 1D1JA 4PKYA 2PYRA 5J7EA 3T4SA 1SDNA 5I5LA 2ZQCA 1GHPA 3MFXA 3QP8A 4N9KA 4Z9QA 2EFXA 3UNWA 5C5KA 5F6AA 3MQ0A 2J3TC 3PBSA 5DJUA 3GDIA 1ACFA 3S22A 1P0ZA 5A92A 5GL9A 3K3DA 1S4RA 3VP3A 4Q0HA 1I5QA 1K54C 4WZ4A 4UEYA 5HWWA 2XSSA 5EVIC 3JPUA 2VGLS 4G3KA 3LCEA 5CGXA 1ES3A 1KE0A 3F1NA 1NWZA 3PAGA 3S7PA 3IH9A 3MBZA 1JTDA 3EWKA 4DDSA 4D2OA 3ZNTA 4ZTKA 3T4KA 1CI9A 3RJUA 4ID4A 4X69A 3T1QB 4JGQA 3C30A 5EUAA 4DE3A 4L9EA 4O0PA 4OVDA 1VHMA 1IOUA 1FILA 1T1AA 3T1SA 3G30A 3TSGA 1UGUA 3GQZA 3LIDA 2H0TA 2WGWB 2V8CA 2ZJ9A 4FH4A 5GLCA 3DBAA 3G35A 1YT4A 2O99A 2ZBBA 2YKFA 5A91A 4OLDA 4FUWA 3Q81A 4WZ5A 3HJIA 3SS4A 1FCNA 5EPHA 2M7UA 4DRTA 1XJ6A 4Y2FA 2K2NA 2XF3A 3GSGA 3ZG9B 2G7UA 3QP4A 5GLBA 2B5RA 1PNEA 2Z6CA 2PU2A 1FOFA 3T4QA 5JYPA 3DTEA 3V3RA 1CK3A 4OOYA 3O88A 3ZFZA 4C75A 3R4KA 4BBUA 4E3OA 3MXQA 2ZQDA 4S2IA 1L3LA 3FC7A 4X6TA 5TJJA 5HW3A 1O07A 4H8RA 4HBTA 4BL3A 4GB7A 3NJAA 2QZ6A 1GHMA 4EEUA 3O3VA 3DTKA 2DCFA 4QD4A 3BWLA 3S7NA 3LI9A 1W7FA 2K7SA 2ZOHA 1WE4A 5IS1A 3W4QA 4EU0A 1E4DA 2ZLYA 3RFBA 4NETA 1IYPA 2Y2GA 3HLBA 4R4SA 2J9OA 1H5XA 4FOFA 4XUXA 2EX6A 5FDHA 1KE4A 2JE5A 2J7VA 3PYPA 1TDLA 2HJ9C 3MF0A 3UB5P 3QP2A 4PKYG 2FFYA 3KSGA 3MKEA 4EXOA 2VZWA 2ZC5B 3E4PA 1YPRA 3DW0A 2A49A 3IF6C 1GA0A 4HNBA 4OLGA 1SCWA 3HLFA 3IH8A 1MWUA 3F1OA 3LEZA 1T1CA 1PYYA 4IBRA 1A0KA 5I94A 2JHEA 2JCHA 5CEBA 3UE0A 1T18A 2X01A 1MWSA 5F69A 3A0RA 2XGNA 4PPRA 1BSGA 2W3FA 1VB6A 2JKGA 3MKFA 5FQKA 3UDFA 1F5MA 4KUOA 5DFYA 4B88A 1XA7A 1RCJA 3GMWA 4EV4A 4MN6A 3D9YA 4JKTA 1BUEA 5G4ZA 5HL1A 1VEUB 1LHYA 4CLCB 3UY6A 3TE8A 3IWIA 2ZMFA 4EERA 1TS7A 1QMFA 5DKKA 3ZYTA 4BJPA 2WUQA 2Q0OA 3LO7A 2HJEA 3BFDA 5TBMB 4YWZA 4KZ6A 5AQ7A 2W3DA 2XQZA 1MZUA 3LYXA 4BBTA 4PM6A 5FAOA 3LIAA 3IS2B 2L0WA 1ONHA 3Q7VA 3QNBA 1K6SA 4Y3IA 3NY4A 3LY4A 3KSIA 2ZMAA 1EROA 2P9VB 4BENA 1NRFA 1KDWA 2IA2A 3BY8A 3PR6A 1X0OA 2EX9A 4LCMA 4K91A 4WLAA 1KE3A 5L8MA 2OSUA 3LUQA 4HI4A 2B95A 1VQQA 4JF6A 3VP4A 1J9MA 2W3EA 4ZBEA 3KYQA 2A24B 3TJZC 5EM1A 5GHYA 3IXDA 5FQJA 3BEBA 4KG5A 2JC7A 4EQ1A 1FIKA 5HD3A 4F94A 4BL2A 3VMAA 1N4OA 4L9GA 4Y5FA 2DRWA 2ZL1B 2XK1A 4GOGA 3RXXA 1VEUA 4EESA 1W63M 3ZG5A 2L1MA 2WGIA 3UO9A 1N9OA 4IHQA 2WAFA 5FI2A 4OH0A 4GJ4A 3T4TA 3UDXA 4X68A 4QWOA 2A2LA 2PR5A 3N7WA 1ZG4A 3BQ8A 3NBLA 1ERQA 4MBFA 4EETB 3F1PB 2PRFA 3PAEA 4I38A 1IEMA 3H9WA 2PBDP 3IS2A 5EOEA 1OTEA 1OT9A 4KG6A 4U0TA 4HHDA 1S67L 4U0XA 2ZM2A 2V0WA 4UQIS 4I3IA 1MC0A 1PWCA 3MQQA 1G6OA 3QNCA 3D4FA 3T12B 4JPMA 2QMIA 3NDGA 3UB9A 4K08A 4S2LA 3MZDA 5KIZA 3IQAA 1PZPA 2XRNA 4KZ5A 4R3BA 4XUZA 3OPRA 1M6KA 5FEFA 1CEGA 1ONGA 4M4XA 4E3JA 3OZHA 3DTMA 4MN7A 3A3IA 2WAEA 3ZG7B 4X56A 3BFCA 3CI6A 1NXYA 2UWXA 5HAIA 1IKGA 4KG2A 5FEGA 3IX8A 4DE1A 2OLVA 4HJ4A 2ZC3B 3F1PA 3LFVA 3E4OA 5KSHA 1PIOA 5FAPA 4EEPA 4QB8A 2VKSA 5FQ9A 1PFLA 3ZCZA 4EUZA 4WL9A 3IF6A 3ISGA 4GS9A 3ZGAB 4GHIB 4KZ3A 4H6JB 3N8RA 3RXWA 4PM9A 3A3EA 3HLDA 3NECA 5F83A 2XFSA 4ARZB 1HD8A 3FPVA 1XP4A 4Q0JA 3E2KA 1N9NA 4KUKA 4RYEA 2HDSA 4DDYA 1MPLA 5FQQA 3HLGA 2VX8A 3LIFA 3E2LA 2PT7A 2H10A 4Y13A 1LSWA 1NRJA 3B3XA 1KVLA 4BBVA 3NOPC 2QPNA 1CQAA 4Y0TA 4X53A 4Y0UA 2J3TD 1E3UD 1TDGA 2FZ0A 3BFGA 5DKLA 2EX2A 3DWZA 2XD5A 2E8JA 2W1TB 2XA7S 1H3QA 4IVKA 2GZAA 2V0UA 4C3QA 5EVID 1G28A 2J9PA 2BG1A 3C4PA 3H7WA 2I9VA 4KZ8A 3BFFA 3WS0A 4B4ZA 3CPTA 4QY6A 4X55A 2V9AA 3R7WB 1K57C 3AGDA 4KQOA 2VGJA 5D3OA 1V9YA 5HDCA 3OPLA 4M3KA 4LGWA 3T4JA 3IHBA 1DJBA 5IU1A 4NXGA 3KSHA 3C2WA 3O87A 3EGDC 3LR0A 4O8GA 3BECA 4S2OA 4O01A 1K4EA 2EWVA 4R4RA 4B9OA 2Y79A 3B42A 3BY9A 2C6WB 1PWDA 2HV1A 2WYXA 3MSHA 3HUNA 1LL5A 4LV0A 2Y2IA 1CJFA 3ZDJA 3TOIA 2ACGA 2CC1A 3A3FA 3VP1A 2P04A 1G5UA 4O7DA 4U3TA 5DVAA 4GN2A 3PTEA 4CQHA 4OP8A 4MN5A 2VV7A 4PAUA 5HSQA 1SKOB 2IWDA 2PHYA 3OC2A 1TS0A 5GHZA 4IBXA 3FYZA 5BOHA 3OOVA 2W1TA 2PBYA 4OPQA 3ZG0A 4WEJA 1ZHHB 3P09A 4KQRA 4RQ9A 2JKTI 1XJ3A 4C6YA 1BLCA 1H8ZA 3FPWA 5LBRA 2HPBA 2VJWA 3VOYA 1PW1A 4HEFA 4X1LA 4WM9A 4CLCC 2ZOIA 1P97A 3G2YA 1YLJA 1JWZA 3ZHHA 3LGOA 1RP5A 1DJCA 3VSLA 1N9BA 3M2JA 1K25A 4OQHA 4HP9A 1ODVA 5CHJA 2GX5A 2HP9A 4LRYC 1F2KA 4DXBA 3CUEA 2HDUA 3UB8A 3UPNA 3VSKA 4WMCA 1JWPA 3IWOA 5HX9A 1IFQA 1M40A 1FR6A 1S4SA 2KOIA 4JGPA 1J3WA 2OAP1 2ZM8A 3GV9A 3VFFA 4Q8IA 2HP6A 1W8YA 1SKFA 1T1BA 3WS1A 5F1GA 1MBLA 2HDQA 1UWNX 1ESIA 5E43A 4JF5A 4Y0OA 3MXSA 2V2FF 4GCZA 2J80A 2QYBA 4E3NA 2KLIA 3LR4A 1XPBA 1KOUA 5EOOA 4IJGA 4WEKA 3NULA 1S6RA 1L0FA 5TGFA 3PBRA 2DMWA 3D72A 3CAXA 2JKRI 2P74A 4WBGA 3NIAA 4GDNA 2MJ6A 3MXRA 5HPFA 2WGWA 3M6HA 4IEDA 3G32A 3BLMA 3FKWA 3VP2A 4EWFA 1S1YA 2WADA 1FCOA 3OBFA 3WS2A 4DE2A 1OTAA 3T4LA 1KGEA 4FSFA 3SH9A 2KX6A 4D60A 1D06A 3L7HA 2A3UA 2EWWA 4DXCA 3GRJA 2G2UA 2Z2MB 3PXPA 5CGSA 2VV8A 5L2FA 3W8KA 2V1AA 1IKIA 4E3KA 2GNXA 2QJ7A 2RCXA 3L9KA 2FFFB 3W2ZA 2M7VA 1O7EA 4LFUA 4FCFA 4P6ZM 3HBRA 4MLLA 2ZC4B 1VM1A 2K31A 1ERMA 3KSFA 4HQAA 3FKVA 2LB9A 2X02A 1W8QA 3CHWP 2Y2JA 4KQDA 1YKDA 2YKHA 2INWA 1GSVA 4KZ9A 4LV3A 5M1AA 3MZEA 3U4LP 4NG2A 4II7A 4BQMA 3T50A 1I2WA 1LSXA 3VFHA 5GLDA 4JLFA 1K57A 4MBKA 1K56A 3DTIA 3C7VA 1SDEA 3E4QA 2Y55A 2ZQAA 1FR1A 2Y2HA 2W3GA 4UHUA 2R9XA 4UA9A 3RH8B 4A5RA 1P9RA 1K38A 2WKPA 2VGKA 2O9BA 4I3JA 5FA7A 4UA6A 2Y2QA 3H82B 5CXWA 1YLYA 4UQIM 1UWPX 2Y2MA 4LV1A 1Z6FA 5A90A 1BZAA 5DJTA 2D01A 3NOTC 1OJGA 3A3DA 4KZ7A 3WS5A 1GSXA 3BLSA 4K0XA 4JGOA 1PI5A 3FZCA 4NXBA 5F82A 3Q7ZA 3WRTA 1LLBA 2ZQ8A 4Y17A 1DP8A 3G34A 3NC8A 2AVXA 5CX7A 2W0NA 1ZC2A 1MWRA 1D7EA 1LI9A 1K55C 1GHIA 1PRQA 2PR6A 3JYIA 5K5BA 4S2NA 5FASA 5A93A 4ZDXA 1YAXA 4P0MA 1GCEA 1PWGA 4CLCA 1JTGA 2KDKA 2ZQ7A 1XJ4A 3LR3A 4RX2A 4Z1WA 3EEHA 4EBLA 3FV7A 1ES4A 5TBMA 1LL9A 1ES2A 3SH7A 1MWTA 1W63Q 1PW8A 2OOLA 4JBFA 5E2FA 1ESUA 4DKIA 5F68A 3GECA 4LRXC 5FSRA 2O9CA 3CG5A 2HZ5A 1IYQA 3MS6A 3MQOA 5L10A 3RTYA 1XA1A 2P9VA 4GLQA 3G6OA 4I3AA 3KO6A 1LI0A 2XFTA 3CZDA 4JXSA 1S1ZA 5AVEA 1YLZA 2H5SA 1OT6A 2JBFA 2A24A 3T1RA 3CUEC 3FWLA 3TG9A 3AGFA 3G4PA 3C8CA 1U60A 2V8FA 1EWZA 1TS6A 1Q2QA 1YM1A 2BLSA 3VP0A 1GA9A 4R3AA 2ZL1A 4E6XA 4N92A 5HPIA 5MC7A 4LENA 3N8LA 3KX0X 1ZKJA 5GHXA 2VA0A 5FI6A 4GKUA 5G4YA 1JWVA 3S7OA 1YQSA 5CHUA 2PAVP 2C5WB 1XJ2A 3N4IA 1TVFA 4Y15A 2Q9NA 1YSQA 2JN7A 3V5MA 4DJ3A 4N9LA 4F3LB 4X1MA 4WUJA 4GDBA 4BLMA 1NY0A 1W5DA 1MKMA 2EXAA 1RGZA 2WZZA 1WYCA 5IHVA 4L9FA 3ULFA 5KZHA 3D3OA 4HH3A 5EVLA 4S2KA 2Y91A 2OLUA 2O0YA 5HWTA 3PBQA 3K3CA 1XX2A 5U47A 2H0YA 3W4OA 3QHYA 3WS4A 1VETB 3DAVA 2XR0A 2PD7A 2VV6A 3BFEA 1N9LA 2V1BA 3HUMA 1DP6A 2HDRA 2VGLM 3BRMA 3G31A 1MKIA 1Q2PA 2Y59A 2XEPA 3HLEA 2EFUA 1L2SA 2W3HA 3IX3A 5J8XA 5AJGA 4KZBA 4OPYA 4YFMA 2NUTC 2E8IA 2PDRA 5E2EA 3K2NA 3UPOA 4FTXA 3LIBA 4DN0A 1LL8A 3C7UA 3IWQA 4RX3A 3UPPA 4JGRA 2L4RA 5E2HA 2H28A 1YLWA 3E0YA 1YLPA 3A0VA 1Y28A 4GHIA 2OV5A 2JKTM 4H6JA 3BQAA 4XXRA 4XT2B 4OKPA 3O5YA 3PBNA 4P6BA 2B02A 3ZVTA 3S1YA 4ARZA 4ZJ3A 2WKIA 2ZC7A 2Z2LB 3OLOA 5DF9A 4EBPA 2Y2KA 5FI7A 3FG8A 4CLCD 4IUHA 1KGFA 1NZOA 2Y2LA 1K55A 4HESA 1PZOA 4I39A 4OQ0A 1ALQA 3UB7A 3EEAA 1K0KA 3JVUA 3V39A 5AQAA 3BW6A 4BMWA 4NXFA 1KDSA 2DNSA 3B33A 1NLZA 1XFQA 3S4XA 2G2WA 1TEMA 4LPZA 2EA9A 2Y2OA 5E2GA 1EI5A 3TW8A 3S7QA 1CI8A 3HL9A 3LIEA 1MXOA 4PM5A 3HVFA 4EW7A 5HDSA 4UAAA 5DTSA 3OCNA 4K0WA 3CITA 3NHQA 2O9AA 3UDIA 4WN5A 4S2NC 5EM0A 4ZJ2A 1E25A 2XLNA 3R7WA 5CERA 1YMSA 3IBJA 4HH2A 2M1CA 3MMHA 3ICYA 2VLGA 1T19A 4S2JA 3HCYA 4LCLA 1FSYA 4XT2A 3ZNYA 1TF1A 2JKRM 1BT5A 4MCWA 1ZTUA 2XH9A 3BYDA 4GD6A 1H0MA 1GSWA 4GNUA 2R9WA 1CF0A 2BTFP 5JYOA 2WGVA 5A8BA 1QMEA 3UB6A 1NYYA 1W79A 2Y2NA 1FCMA 2FH5A 1BTLA 5M18A 1MY8A 2ZM0A 4MNRA 2PYPA 4PHTA 4LRZE 4ESPA 2ZC6B 3HJKA 1YLTA 4NKPA 1SKOA 2WZXA 3CWFA 3AGEA 2ZMVA 1XGIA 1XXMA 4QPRA 3Q82A 3ITAA 4E3LA 3QP6A 4E3MA 2CMNA 4S2MA 2GDNA 4PM8A 5HD5A 3F1OB 2QKPA 1G68A 1H8MA 1NYMA 5CRFA 1JVJA 4S2PA 4GD8A 4MBHA 1F98A 3NCKA 1V9ZA 4Y7PA 3OPPA 2OWJA 2QWSA 1Y4OA 3VE3A 2D02A 4G3VA 4YNRA 2VK3A 3SZTA 2LB5A 1P9WA 4QHCA 1CEFA 3BJNA 3M2KA 1L0EA 5EE8A 1WA9A 2QJ5A 4PM7A 3UMDA 4FH2A 1OJ5A 3SS3A 5DF8A 3Q07A 4B93A 5AVFA 1RGYA 3UE1A 4DE0A 2ZD8A 1L0GA 1S0WA 2RL3A 3DWKA 4GW9A 3IXBA 1DP9A 3MFDA 3N6IA 4RA7A 4G3WA 1NJ4A 5IT5A 3ZVWA 3KYEA 4HJ3A 4ZJ1A 2IWBA 2Z6DA 3Q7VB 4RVAA 4QU3A 3A3JA 5DF7A 5EVIB 5GLAA 5TR7A 2B18A 5HZHA 3PBOA 4KQQA 4OQIA 3VOLA 1XGJA 1BLPA 1PI4A 5CTMA 3ZG8B 4EQIA 5CEDA 1H8YA 2QHKA 2W1RA 3NI9A 1FSWA 2JKFA 4E04A 4EBNA 2VEAA 2I72A 2XD1A 1DY6A 2V1ZA 3SW1A 3LICA 3SS5A 2WKHA 4OONA 5KMWA 4ETZA 3CLOA 3CMZA 2NUPC 4DJ2A 3LI8A 2Q9MA 1OTIA 3HREA 4WF0A 1AXBA 1C3BA 5FATA 5EECA 3CJMA 4HP4A 3T1XA 3LR5A 2HP5A 4OOLA 4OQGA 1IYOA 3VV4A 3C38A 2WKEA 1E3UA 1I2SA 5J3WA 4R0QA 5F5YA 2PU4A 3EQUA 1XFNA 3LY3A 5DTKA 1K54A 4JXGA 4NK3A 4WELA 3NDEA 4N1XA 5EVIA 1IELA 5M19A 5HARA 3MJQA 1OTBA 1OPXA 3SOIA 3HUOA 1NZUA 4LLOB 4QJGA 1WYBA 1ES5A 3ZQ5A 4ZAMA 2V20A 1HTZA 4P6ZS 3P7NA 2WKQA 3WWXA 4E3IA 1XKZA 5J4EA 5AQ9A 4CLCE 1Y54A 2Y4AA 4MMNA 1HZOA 4I5SA 5G18A 1KGGA 4WMCD 3UMEA 4GZBA 1STZA 4R23A 2Y2PA 3MR0A 1G6AA 5HL6A 3Q1FA 4FD8A 2WKRA 4CPKA 2EXBA 3IX4A 5FDSA 3H82A 4B4XA 3N8SA 2R78A 5EFWA 3LEQA 3UE6A 3P01A 1BYWA 1IYSA 2W27A 4Q0IA 3QP1A 1YSPA 3EQVA 3T4OA 5EVEA 1KVMA 3NOUC 5DTTA 4WYYA 4JXVA 4UA7A 3IXGA 1BLSA 5HAQA 3IF6B 3IHAA 1AWIA 4GS9B
chains in the Genus database with same CATH topology
1S4SA 2KOIA 3LIBA 4JGPA 1LL8A 4MN6A 4DN0A 2OAP1 2HGVA 4JGRA 2L4RA 5G4ZA 4CLCB 5FL3A 2H28A 3E0YA 3TE8A 3PHYA 4DMZA 2ZMFA 3A0VA 4EERA 1T1BA 1Y28A 4GHIA 4BWIA 1TS7A 5DKKA 3ZYTA 4BJPA 3U2AA 5HWVA 1LSVA 2HJEA 1UWNX 2JKTM 5TBMB 4H6JA 3BQAA 4YWZA 4XT2B 2W3DA 4MDZA 3LYXA 1MZUA 3O5YA 4BBTA 4GCZA 3PBNA 1DRMA 2B02A 2J80A 4IUKA 2QYBA 2XA7M 4ARZA 3LIAA 2KLIA 3LR4A 3IS2B 2L0WA 1KOUA 3UE3A 4IJGA 4ETXA 4WEKA 3OLOA 5DF9A 3FG8A 4CLCD 4IUHA 4Y3IA 3PBRA 2DMWA 1EW0A 3D72A 3CAXA 2OWHA 3OCLA 3KSIA 2JKRI 4I39A 3UB7A 2IA2A 3BY8A 3EOIA 3PR6A 3JVVA 3EEAA 1X0OA 3JVUA 2MJ6A 5HPFA 4WLAA 4NEED 5L8MA 4HOIA 1TD5A 3BW6A 3LUQA 4HI4A 5HDDA 3VE4A 1S1YA 4BMWA 4NXFA 4R38A 2P7JA 3B33A 1NLZA 1XFQA 2W3EA 3OBFA 3KYQA 3IBRA 2A24B 3TJZC 1OTAA 3T4LA 3H7WB 4FSFA 4EUVA 2KX6A 4LPZA 1D06A 2EA9A 4R6LA 2EWWA 3TW8A 3S7QA 3LIEA 4EQ1A 4EW7A 1LT0A 3A0SA 5HDSA 3PXPA 5HD3A 3OCNA 2VV8A 3CITA 2V1AA 4L9GA 3NHQA 2O9AA 4Y5FA 2GNXA 4WN5A 2QJ7A 4NXEA 1TS8A 3W2ZA 2M7VA 3R7WA 4EESA 1W63M 3IBJA 2L1MA 3PBTA 4HH2A 2M1CA 3KYZA 3MMHA 1N9OA 4IHQA 4OOMA 4HY8A 3ICYA 4P6ZM 2VLGA 4GJ4A 4ME4A 1T19A 3T4TA 2XROA 3HCYA 2J3WA 4XT2A 2K31A 3KSFA 2A2LA 4HQAA 2PR5A 1TF1A 2JKRM 3BQ8A 2LB9A 4MCWA 1ZTUA 3EGXC 3F1PB 4I38A 4EETB 2PD8A 4R70A 3H9WA 3IS2A 1OTEA 1OT9A 1GSWA 1NLYA 4KQDA 1YKDA 2YKHA 2INWA 4HJ6A 1GSVA 4HHDA 3V67A 3TRCA 1S67L 2P08A 4YOFA 4II7A 5A8BA 2BASA 3F1NB 3T50A 4F3LA 1LSXA 2OAQ1 3UB6A 2V0WA 1OTDA 4UQIS 2HF6A 3E98A 2FH5A 2Y8HA 4I3IA 1F9IA 1MC0A 3E4QA 3MQQA 1G6OA 4L0LA 2PYPA 4PHTA 4LRZE 3HJKA 5DFXA 2W3GA 4NKPA 1S66L 3CWFA 3RH8B 1P9RA 2ZMVA 4AFIA 3UB9A 4QPRA 2WKPA 4K08A 3B47A 5KIZA 2GJ3A 2XRNA 4ZRRA 1JNUA 2CMNA 2O9BA 4I3JA 5HD5A 3F1OB 2QKPA 3H82B 4HIAA 1H8MA 4M4XA 4PKYA 4MN7A 4UQIM 2PYRA 5J7EA 1UWPX 5DJTA 2D01A 3NOTC 3T4SA 3CI6A 1OJGA 5I5LA 1F98A 1V9ZA 1GSXA 2OWJA 2QWSA 4JGOA 3VE3A 3MFXA 2D02A 4G3VA 4YNRA 4NXBA 5C5KA 2LB5A 5F6AA 3MQ0A 1DP8A 4HJ4A 1P9WA 2J3TC 3PBSA 3BJNA 3GDIA 5CX7A 5DJUA 3F1PA 2W0NA 3LFVA 3E4OA 1P0ZA 1WA9A 2QJ5A 1D7EA 5KSHA 4EEPA 3K3DA 3UMDA 1S4RA 1OJ5A 2PR6A 4Q0HA 2VKSA 4UEYA 5HWWA 2XSSA 4B93A 2VGLS 4G3KA 4WL9A 5AVFA 5K5BA 4GS9A 3F1NA 4GHIB 1NWZA 4GW9A 3S7PA 4H6JB 1DP9A 1YAXA 3EWKA 4CLCA 2KDKA 4G3WA 3T4KA 1XJ4A 3LR3A 4Z1WA 5IT5A 3EEHA 4HJ3A 4JGQA 3C30A 4ARZB 4L9EA 3FPVA 4O0PA 4Q0JA 5TBMA 2Z6DA 1W63Q 1VHMA 1IOUA 2OOLA 1N9NA 4KUKA 5F68A 3GECA 4LRXC 1T1AA 2O9CA 2B18A 5HZHA 3PBOA 1UGUA 2VX8A 3LIDA 3VOLA 3LIFA 2PT7A 3MQOA 3DBAA 1LSWA 1NRJA 4BBVA 2O99A 2ZBBA 2YKFA 3NOPC 3RTYA 4GLQA 3G6OA 4I3AA 2J3TD 3HJIA 3KO6A 2QHKA 2FZ0A 2W1RA 5DKLA 1S1ZA 5AVEA 2W1TB 2M7UA 2XA7S 1OT6A 1H3QA 1XJ6A 4E04A 4Y2FA 2GZAA 2K2NA 2V0UA 2G7UA 2A24A 1G28A 2VEAA 3H7WA 2I9VA 3CUEC 2Z6CA 3SW1A 3T4QA 3LICA 3C8CA 2V9AA 3R7WB 4KQOA 1TS6A 1V9YA 5HDCA 4ETZA 3CLOA 4R3AA 2NUPC 4DJ2A 3LI8A 1OTIA 3T4JA 4WF0A 5IU1A 5HPIA 3R4KA 4BBUA 4NXGA 5MC7A 3KSHA 3MXQA 3C2WA 3KX0X 3EGDC 4HP4A 2VA0A 3LR5A 3LR0A 4O8GA 3FC7A 5TJJA 4OOLA 5G4YA 4O01A 3VV4A 3S7OA 3C38A 3NJAA 2EWVA 4B9OA 4EEUA 1XJ2A 2Y79A 3B42A 3BY9A 5J3WA 5F5YA 3EQUA 2HV1A 1XFNA 3BWLA 1YSQA 3S7NA 3LI9A 2JN7A 4DJ3A 4F3LB 2K7SA 4WELA 2ZOHA 5IS1A 3MJQA 4WUJA 1OTBA 1OPXA 4EU0A 4LLOB 2P04A 3RFBA 1MKMA 3ZQ5A 4CQHA 4L9FA 4MN5A 4P6ZS 3P7NA 2VV7A 2WKQA 4PAUA 3ULFA 5HSQA 3D3OA 4HH3A 2PHYA 5J4EA 3OC2A 4FOFA 4CLCE 1TS0A 2O0YA 4MMNA 5HWTA 3PYPA 4I5SA 2HJ9C 3UMEA 3MF0A 3OOVA 3PBQA 2W1TA 3K3CA 4PKYG 1STZA 3KSGA 4WEJA 4EXOA 2VZWA 1ZHHB 3MR0A 3E4PA 2PD7A 4RQ9A 2VV6A 5HL6A 2JKTI 1XJ3A 4HNBA 1N9LA 2V1BA 3FPWA 5LBRA 2WKRA 2VJWA 1DP6A 2VGLM 3F1OA 3H82A 1T1CA 4CLCC 2ZOIA 2JHEA 2R78A 1P97A 5EFWA 1T18A 3UE6A 3P01A 2W3HA 5F69A 1BYWA 3A0RA 2W27A 4Q0IA 5AJGA 1YSPA 3EQVA 4HP9A 2W3FA 3T4OA 1VB6A 1ODVA 3NOUC 2GX5A 1F5MA 4KUOA 4LRYC 2NUTC 5DFYA 3CUEA 3UB8A 2PDRA 3K2NA 4GS9B 1IFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4S A;  4JGP A;  3LIB A;  1LL8 A;  4MN6 A;  4JGR A;  2L4R A;  5G4Z A;  2H28 A;  3PHY A;  3A0V A;  4EER A;  1T1B A;  1Y28 A;  4GHI A;  1TS7 A;  5DKK A;  5HWV A;  1LSV A;  1UWN X;  5TBM B;  4H6J A;  4YWZ A;  4XT2 B;  3LYX A;  1MZU A;  4BBT A;  4GCZ A;  1DRM A;  2B02 A;  2J80 A;  3LIA A;  3IS2 B;  2L0W A;  1KOU A;  3OLO A;  3FG8 A;  1EW0 A;  3D72 A;  3CAX A;  2OWH A;  4I39 A;  3UB7 A;  3BY8 A;  1X0O A;  4WLA A;  4HOI A;  3LUQ A;  4HI4 A;  5HDD A;  3VE4 A;  1S1Y A;  4NXF A;  4R38 A;  2P7J A;  3B33 A;  1XFQ A;  3IBR A;  2A24 B;  1OTA A;  3H7W B;  2KX6 A;  4LPZ A;  1D06 A;  2EA9 A;  4R6L A;  3LIE A;  4EQ1 A;  4EW7 A;  1LT0 A;  3A0S A;  5HDS A;  5HD3 A;  2VV8 A;  2V1A A;  4L9G A;  3NHQ A;  4WN5 A;  2QJ7 A;  4NXE A;  1TS8 A;  4EES A;  2L1M A;  4HH2 A;  2M1C A;  1N9O A;  4HY8 A;  3ICY A;  2VLG A;  1T19 A;  4XT2 A;  4HQA A;  2PR5 A;  4EET B;  3F1P B;  4I38 A;  2PD8 A;  4R70 A;  3H9W A;  3IS2 A;  1OTE A;  1OT9 A;  1GSW A;  4KQD A;  2YKH A;  2INW A;  4HJ6 A;  1GSV A;  4HHD A;  1S67 L;  5A8B A;  2BAS A;  3F1N B;  3T50 A;  4F3L A;  1LSX A;  3UB6 A;  2V0W A;  1OTD A;  4I3I A;  1F9I A;  3E4Q A;  3MQQ A;  2PYP A;  4LRZ E;  3HJK A;  1S66 L;  3CWF A;  3RH8 B;  3UB9 A;  2WKP A;  4K08 A;  5KIZ A;  2GJ3 A;  1JNU A;  2CMN A;  4I3J A;  5HD5 A;  3F1O B;  2QKP A;  3H82 B;  4HIA A;  4M4X A;  4PKY A;  2PYR A;  5J7E A;  1UWP X;  5DJT A;  2D01 A;  3NOT C;  5I5L A;  1OJG A;  1F98 A;  1V9Z A;  1GSX A;  2OWJ A;  2QWS A;  4JGO A;  3VE3 A;  3MFX A;  2D02 A;  4NXB A;  5F6A A;  1DP8 A;  4HJ4 A;  5DJU A;  3GDI A;  3F1P A;  2W0N A;  3E4O A;  1P0Z A;  1WA9 A;  2QJ5 A;  1D7E A;  4EEP A;  3K3D A;  3UMD A;  1S4R A;  1OJ5 A;  2PR6 A;  5HWW A;  4WL9 A;  5AVF A;  4GS9 A;  3F1N A;  4GHI B;  1NWZ A;  4GW9 A;  4H6J B;  1DP9 A;  3EWK A;  2KDK A;  1XJ4 A;  3EEH A;  4HJ3 A;  4JGQ A;  4L9E A;  5TBM A;  2Z6D A;  2OOL A;  1N9N A;  4KUK A;  5F68 A;  3GEC A;  4LRX C;  1T1A A;  5HZH A;  1UGU A;  3LID A;  3VOL A;  3LIF A;  3MQO A;  1LSW A;  4BBV A;  2ZBB A;  2YKF A;  3NOP C;  3RTY A;  3G6O A;  4I3A A;  3HJI A;  2QHK A;  5DKL A;  1S1Z A;  5AVE A;  1OT6 A;  1XJ6 A;  4E04 A;  2V0U A;  2A24 A;  1G28 A;  2VEA A;  3H7W A;  2I9V A;  2Z6C A;  3SW1 A;  3LIC A;  3C8C A;  2V9A A;  1TS6 A;  1V9Y A;  5HDC A;  3CLO A;  4R3A A;  4DJ2 A;  3LI8 A;  1OTI A;  4WF0 A;  5IU1 A;  4BBU A;  4NXG A;  3MXQ A;  3C2W A;  3KX0 X;  4HP4 A;  3FC7 A;  5G4Y A;  3NJA A;  4B9O A;  4EEU A;  1XJ2 A;  3BY9 A;  5J3W A;  5F5Y A;  2HV1 A;  1XFN A;  3BWL A;  3LI9 A;  2JN7 A;  4DJ3 A;  4F3L B;  2K7S A;  2ZOH A;  5IS1 A;  3MJQ A;  4WUJ A;  1OTB A;  4LLO B;  3ZQ5 A;  4L9F A;  4MN5 A;  3P7N A;  2VV7 A;  2WKQ A;  3ULF A;  5HSQ A;  4HH3 A;  2PHY A;  5J4E A;  1TS0 A;  5HWT A;  3PYP A;  4I5S A;  3UME A;  3K3C A;  4PKY G;  4EXO A;  3MR0 A;  3E4P A;  2PD7 A;  4RQ9 A;  2VV6 A;  1XJ3 A;  4HNB A;  1N9L A;  2V1B A;  2WKR A;  1DP6 A;  3F1O A;  3H82 A;  1T1C A;  2ZOI A;  2JHE A;  2R78 A;  1P97 A;  5EFW A;  1T18 A;  3UE6 A;  5F69 A;  1BYW A;  3A0R A;  2W27 A;  4HP9 A;  1VB6 A;  1ODV A;  3NOU C;  4KUO A;  4LRY C;  3UB8 A;  2PDR A;  4GS9 B; 
#chains in the Genus database with same CATH topology
 4P85 A;  2HGV A;  1HLU P;  4CJN A;  4R3J A;  4MEZ A;  5CTN A;  5FL3 A;  4DMZ A;  3PHY A;  4WZ5 C;  4BWI A;  3U2A A;  5HWV A;  3C4O A;  1LSV A;  1K4F A;  3BM6 A;  4X25 A;  1SZV A;  5L09 A;  4MDZ A;  3MZF A;  1DRM A;  4IUK A;  5EV0 A;  4HBU A;  2XA7 M;  4YIN A;  1YMX A;  3UE3 A;  4IVI A;  4ETX A;  3SH8 A;  1L0D A;  3ITB A;  5CEC A;  1EW0 A;  3OCL A;  2OWH A;  3EOI A;  5HAP A;  3JVV A;  2ZQ9 A;  3HLC A;  1DJA A;  3IXH A;  4NEE D;  4HOI A;  1TD5 A;  4KEN B;  5HDD A;  3VE4 A;  3OPH A;  4R1G A;  4R38 A;  2P7J A;  3IBR A;  3WRZ A;  3H7W B;  5AQB A;  4EUV A;  3O86 A;  4R6L A;  3CPT B;  4LV2 A;  4OPR A;  3VOZ A;  3GVB A;  1LT0 A;  3A0S A;  4JXW A;  1K56 D;  4KZA A;  1Z09 A;  4NXE A;  4PMA A;  1TS8 A;  1K6R A;  3PBT A;  5HFO A;  3KYZ A;  4QY5 A;  4OOM A;  4HY8 A;  3P98 A;  5TFQ A;  4ME4 A;  3W4P A;  4OPZ A;  1OME A;  5KSC A;  2XRO A;  2J3W A;  4BD0 A;  3IT9 A;  1FQG A;  5CHM A;  3IF5 A;  1SHV A;  3EGX C;  3V3S A;  2PD8 A;  2X71 A;  4R70 A;  2EX8 A;  4JF4 A;  1ZG6 A;  2J8Y A;  1NLY A;  4P87 A;  5F1F A;  3G2Z A;  4HJ6 A;  3V67 A;  3TRC A;  2WK0 A;  2P08 A;  4YOF A;  3I7J A;  1BLH A;  2BAS A;  3F1N B;  1BUL A;  4F3L A;  2OAQ 1;  4DF6 A;  1OTD A;  1HVB A;  2HF6 A;  3E98 A;  2Y8H A;  1F9I A;  3QP5 A;  3V50 A;  3M6B A;  4L0L A;  5L07 A;  3UN7 A;  2UV0 E;  5FAQ A;  5DFX A;  5CGW A;  1S66 L;  4OP5 A;  2XDM A;  4KZ4 A;  4BD1 A;  4AFI A;  4E6W A;  3B47 A;  2GJ3 A;  3C5A A;  4ZRR A;  2IWC A;  1JNU A;  1VET A;  4N1H A;  3GR2 A;  3GTC A;  3HLW A;  4HIA A;  5FQI A;  5FQM A;  1D1J A;  4PKY A;  2PYR A;  5J7E A;  3T4S A;  1SDN A;  5I5L A;  2ZQC A;  1GHP A;  3MFX A;  3QP8 A;  4N9K A;  4Z9Q A;  2EFX A;  3UNW A;  5C5K A;  5F6A A;  3MQ0 A;  2J3T C;  3PBS A;  5DJU A;  3GDI A;  1ACF A;  3S22 A;  1P0Z A;  5A92 A;  5GL9 A;  3K3D A;  1S4R A;  3VP3 A;  4Q0H A;  1I5Q A;  1K54 C;  4WZ4 A;  4UEY A;  5HWW A;  2XSS A;  5EVI C;  3JPU A;  2VGL S;  4G3K A;  3LCE A;  5CGX A;  1ES3 A;  1KE0 A;  3F1N A;  1NWZ A;  3PAG A;  3S7P A;  3IH9 A;  3MBZ A;  1JTD A;  3EWK A;  4DDS A;  4D2O A;  3ZNT A;  4ZTK A;  3T4K A;  1CI9 A;  3RJU A;  4ID4 A;  4X69 A;  3T1Q B;  4JGQ A;  3C30 A;  5EUA A;  4DE3 A;  4L9E A;  4O0P A;  4OVD A;  1VHM A;  1IOU A;  1FIL A;  1T1A A;  3T1S A;  3G30 A;  3TSG A;  1UGU A;  3GQZ A;  3LID A;  2H0T A;  2WGW B;  2V8C A;  2ZJ9 A;  4FH4 A;  5GLC A;  3DBA A;  3G35 A;  1YT4 A;  2O99 A;  2ZBB A;  2YKF A;  5A91 A;  4OLD A;  4FUW A;  3Q81 A;  4WZ5 A;  3HJI A;  3SS4 A;  1FCN A;  5EPH A;  2M7U A;  4DRT A;  1XJ6 A;  4Y2F A;  2K2N A;  2XF3 A;  3GSG A;  3ZG9 B;  2G7U A;  3QP4 A;  5GLB A;  2B5R A;  1PNE A;  2Z6C A;  2PU2 A;  1FOF A;  3T4Q A;  5JYP A;  3DTE A;  3V3R A;  1CK3 A;  4OOY A;  3O88 A;  3ZFZ A;  4C75 A;  3R4K A;  4BBU A;  4E3O A;  3MXQ A;  2ZQD A;  4S2I A;  1L3L A;  3FC7 A;  4X6T A;  5TJJ A;  5HW3 A;  1O07 A;  4H8R A;  4HBT A;  4BL3 A;  4GB7 A;  3NJA A;  2QZ6 A;  1GHM A;  4EEU A;  3O3V A;  3DTK A;  2DCF A;  4QD4 A;  3BWL A;  3S7N A;  3LI9 A;  1W7F A;  2K7S A;  2ZOH A;  1WE4 A;  5IS1 A;  3W4Q A;  4EU0 A;  1E4D A;  2ZLY A;  3RFB A;  4NET A;  1IYP A;  2Y2G A;  3HLB A;  4R4S A;  2J9O A;  1H5X A;  4FOF A;  4XUX A;  2EX6 A;  5FDH A;  1KE4 A;  2JE5 A;  2J7V A;  3PYP A;  1TDL A;  2HJ9 C;  3MF0 A;  3UB5 P;  3QP2 A;  4PKY G;  2FFY A;  3KSG A;  3MKE A;  4EXO A;  2VZW A;  2ZC5 B;  3E4P A;  1YPR A;  3DW0 A;  2A49 A;  3IF6 C;  1GA0 A;  4HNB A;  4OLG A;  1SCW A;  3HLF A;  3IH8 A;  1MWU A;  3F1O A;  3LEZ A;  1T1C A;  1PYY A;  4IBR A;  1A0K A;  5I94 A;  2JHE A;  2JCH A;  5CEB A;  3UE0 A;  1T18 A;  2X01 A;  1MWS A;  5F69 A;  3A0R A;  2XGN A;  4PPR A;  1BSG A;  2W3F A;  1VB6 A;  2JKG A;  3MKF A;  5FQK A;  3UDF A;  1F5M A;  4KUO A;  5DFY A;  4B88 A;  1XA7 A;  1RCJ A;  3GMW A;  4EV4 A;  4MN6 A;  3D9Y A;  4JKT A;  1BUE A;  5G4Z A;  5HL1 A;  1VEU B;  1LHY A;  4CLC B;  3UY6 A;  3TE8 A;  3IWI A;  2ZMF A;  4EER A;  1TS7 A;  1QMF A;  5DKK A;  3ZYT A;  4BJP A;  2WUQ A;  2Q0O A;  3LO7 A;  2HJE A;  3BFD A;  5TBM B;  4YWZ A;  4KZ6 A;  5AQ7 A;  2W3D A;  2XQZ A;  1MZU A;  3LYX A;  4BBT A;  4PM6 A;  5FAO A;  3LIA A;  3IS2 B;  2L0W A;  1ONH A;  3Q7V A;  3QNB A;  1K6S A;  4Y3I A;  3NY4 A;  3LY4 A;  3KSI A;  2ZMA A;  1ERO A;  2P9V B;  4BEN A;  1NRF A;  1KDW A;  2IA2 A;  3BY8 A;  3PR6 A;  1X0O A;  2EX9 A;  4LCM A;  4K91 A;  4WLA A;  1KE3 A;  5L8M A;  2OSU A;  3LUQ A;  4HI4 A;  2B95 A;  1VQQ A;  4JF6 A;  3VP4 A;  1J9M A;  2W3E A;  4ZBE A;  3KYQ A;  2A24 B;  3TJZ C;  5EM1 A;  5GHY A;  3IXD A;  5FQJ A;  3BEB A;  4KG5 A;  2JC7 A;  4EQ1 A;  1FIK A;  5HD3 A;  4F94 A;  4BL2 A;  3VMA A;  1N4O A;  4L9G A;  4Y5F A;  2DRW A;  2ZL1 B;  2XK1 A;  4GOG A;  3RXX A;  1VEU A;  4EES A;  1W63 M;  3ZG5 A;  2L1M A;  2WGI A;  3UO9 A;  1N9O A;  4IHQ A;  2WAF A;  5FI2 A;  4OH0 A;  4GJ4 A;  3T4T A;  3UDX A;  4X68 A;  4QWO A;  2A2L A;  2PR5 A;  3N7W A;  1ZG4 A;  3BQ8 A;  3NBL A;  1ERQ A;  4MBF A;  4EET B;  3F1P B;  2PRF A;  3PAE A;  4I38 A;  1IEM A;  3H9W A;  2PBD P;  3IS2 A;  5EOE A;  1OTE A;  1OT9 A;  4KG6 A;  4U0T A;  4HHD A;  1S67 L;  4U0X A;  2ZM2 A;  2V0W A;  4UQI S;  4I3I A;  1MC0 A;  1PWC A;  3MQQ A;  1G6O A;  3QNC A;  3D4F A;  3T12 B;  4JPM A;  2QMI A;  3NDG A;  3UB9 A;  4K08 A;  4S2L A;  3MZD A;  5KIZ A;  3IQA A;  1PZP A;  2XRN A;  4KZ5 A;  4R3B A;  4XUZ A;  3OPR A;  1M6K A;  5FEF A;  1CEG A;  1ONG A;  4M4X A;  4E3J A;  3OZH A;  3DTM A;  4MN7 A;  3A3I A;  2WAE A;  3ZG7 B;  4X56 A;  3BFC A;  3CI6 A;  1NXY A;  2UWX A;  5HAI A;  1IKG A;  4KG2 A;  5FEG A;  3IX8 A;  4DE1 A;  2OLV A;  4HJ4 A;  2ZC3 B;  3F1P A;  3LFV A;  3E4O A;  5KSH A;  1PIO A;  5FAP A;  4EEP A;  4QB8 A;  2VKS A;  5FQ9 A;  1PFL A;  3ZCZ A;  4EUZ A;  4WL9 A;  3IF6 A;  3ISG A;  4GS9 A;  3ZGA B;  4GHI B;  4KZ3 A;  4H6J B;  3N8R A;  3RXW A;  4PM9 A;  3A3E A;  3HLD A;  3NEC A;  5F83 A;  2XFS A;  4ARZ B;  1HD8 A;  3FPV A;  1XP4 A;  4Q0J A;  3E2K A;  1N9N A;  4KUK A;  4RYE A;  2HDS A;  4DDY A;  1MPL A;  5FQQ A;  3HLG A;  2VX8 A;  3LIF A;  3E2L A;  2PT7 A;  2H10 A;  4Y13 A;  1LSW A;  1NRJ A;  3B3X A;  1KVL A;  4BBV A;  3NOP C;  2QPN A;  1CQA A;  4Y0T A;  4X53 A;  4Y0U A;  2J3T D;  1E3U D;  1TDG A;  2FZ0 A;  3BFG A;  5DKL A;  2EX2 A;  3DWZ A;  2XD5 A;  2E8J A;  2W1T B;  2XA7 S;  1H3Q A;  4IVK A;  2GZA A;  2V0U A;  4C3Q A;  5EVI D;  1G28 A;  2J9P A;  2BG1 A;  3C4P A;  3H7W A;  2I9V A;  4KZ8 A;  3BFF A;  3WS0 A;  4B4Z A;  3CPT A;  4QY6 A;  4X55 A;  2V9A A;  3R7W B;  1K57 C;  3AGD A;  4KQO A;  2VGJ A;  5D3O A;  1V9Y A;  5HDC A;  3OPL A;  4M3K A;  4LGW A;  3T4J A;  3IHB A;  1DJB A;  5IU1 A;  4NXG A;  3KSH A;  3C2W A;  3O87 A;  3EGD C;  3LR0 A;  4O8G A;  3BEC A;  4S2O A;  4O01 A;  1K4E A;  2EWV A;  4R4R A;  4B9O A;  2Y79 A;  3B42 A;  3BY9 A;  2C6W B;  1PWD A;  2HV1 A;  2WYX A;  3MSH A;  3HUN A;  1LL5 A;  4LV0 A;  2Y2I A;  1CJF A;  3ZDJ A;  3TOI A;  2ACG A;  2CC1 A;  3A3F A;  3VP1 A;  2P04 A;  1G5U A;  4O7D A;  4U3T A;  5DVA A;  4GN2 A;  3PTE A;  4CQH A;  4OP8 A;  4MN5 A;  2VV7 A;  4PAU A;  5HSQ A;  1SKO B;  2IWD A;  2PHY A;  3OC2 A;  1TS0 A;  5GHZ A;  4IBX A;  3FYZ A;  5BOH A;  3OOV A;  2W1T A;  2PBY A;  4OPQ A;  3ZG0 A;  4WEJ A;  1ZHH B;  3P09 A;  4KQR A;  4RQ9 A;  2JKT I;  1XJ3 A;  4C6Y A;  1BLC A;  1H8Z A;  3FPW A;  5LBR A;  2HPB A;  2VJW A;  3VOY A;  1PW1 A;  4HEF A;  4X1L A;  4WM9 A;  4CLC C;  2ZOI A;  1P97 A;  3G2Y A;  1YLJ A;  1JWZ A;  3ZHH A;  3LGO A;  1RP5 A;  1DJC A;  3VSL A;  1N9B A;  3M2J A;  1K25 A;  4OQH A;  4HP9 A;  1ODV A;  5CHJ A;  2GX5 A;  2HP9 A;  4LRY C;  1F2K A;  4DXB A;  3CUE A;  2HDU A;  3UB8 A;  3UPN A;  3VSK A;  4WMC A;  1JWP A;  3IWO A;  5HX9 A;  1IFQ A;  1M40 A;  1FR6 A;  1S4S A;  2KOI A;  4JGP A;  1J3W A;  2OAP 1;  2ZM8 A;  3GV9 A;  3VFF A;  4Q8I A;  2HP6 A;  1W8Y A;  1SKF A;  1T1B A;  3WS1 A;  5F1G A;  1MBL A;  2HDQ A;  1UWN X;  1ESI A;  5E43 A;  4JF5 A;  4Y0O A;  3MXS A;  2V2F F;  4GCZ A;  2J80 A;  2QYB A;  4E3N A;  2KLI A;  3LR4 A;  1XPB A;  1KOU A;  5EOO A;  4IJG A;  4WEK A;  3NUL A;  1S6R A;  1L0F A;  5TGF A;  3PBR A;  2DMW A;  3D72 A;  3CAX A;  2JKR I;  2P74 A;  4WBG A;  3NIA A;  4GDN A;  2MJ6 A;  3MXR A;  5HPF A;  2WGW A;  3M6H A;  4IED A;  3G32 A;  3BLM A;  3FKW A;  3VP2 A;  4EWF A;  1S1Y A;  2WAD A;  1FCO A;  3OBF A;  3WS2 A;  4DE2 A;  1OTA A;  3T4L A;  1KGE A;  4FSF A;  3SH9 A;  2KX6 A;  4D60 A;  1D06 A;  3L7H A;  2A3U A;  2EWW A;  4DXC A;  3GRJ A;  2G2U A;  2Z2M B;  3PXP A;  5CGS A;  2VV8 A;  5L2F A;  3W8K A;  2V1A A;  1IKI A;  4E3K A;  2GNX A;  2QJ7 A;  2RCX A;  3L9K A;  2FFF B;  3W2Z A;  2M7V A;  1O7E A;  4LFU A;  4FCF A;  4P6Z M;  3HBR A;  4MLL A;  2ZC4 B;  1VM1 A;  2K31 A;  1ERM A;  3KSF A;  4HQA A;  3FKV A;  2LB9 A;  2X02 A;  1W8Q A;  3CHW P;  2Y2J A;  4KQD A;  1YKD A;  2YKH A;  2INW A;  1GSV A;  4KZ9 A;  4LV3 A;  5M1A A;  3MZE A;  3U4L P;  4NG2 A;  4II7 A;  4BQM A;  3T50 A;  1I2W A;  1LSX A;  3VFH A;  5GLD A;  4JLF A;  1K57 A;  4MBK A;  1K56 A;  3DTI A;  3C7V A;  1SDE A;  3E4Q A;  2Y55 A;  2ZQA A;  1FR1 A;  2Y2H A;  2W3G A;  4UHU A;  2R9X A;  4UA9 A;  3RH8 B;  4A5R A;  1P9R A;  1K38 A;  2WKP A;  2VGK A;  2O9B A;  4I3J A;  5FA7 A;  4UA6 A;  2Y2Q A;  3H82 B;  5CXW A;  1YLY A;  4UQI M;  1UWP X;  2Y2M A;  4LV1 A;  1Z6F A;  5A90 A;  1BZA A;  5DJT A;  2D01 A;  3NOT C;  1OJG A;  3A3D A;  4KZ7 A;  3WS5 A;  1GSX A;  3BLS A;  4K0X A;  4JGO A;  1PI5 A;  3FZC A;  4NXB A;  5F82 A;  3Q7Z A;  3WRT A;  1LLB A;  2ZQ8 A;  4Y17 A;  1DP8 A;  3G34 A;  3NC8 A;  2AVX A;  5CX7 A;  2W0N A;  1ZC2 A;  1MWR A;  1D7E A;  1LI9 A;  1K55 C;  1GHI A;  1PRQ A;  2PR6 A;  3JYI A;  5K5B A;  4S2N A;  5FAS A;  5A93 A;  4ZDX A;  1YAX A;  4P0M A;  1GCE A;  1PWG A;  4CLC A;  1JTG A;  2KDK A;  2ZQ7 A;  1XJ4 A;  3LR3 A;  4RX2 A;  4Z1W A;  3EEH A;  4EBL A;  3FV7 A;  1ES4 A;  5TBM A;  1LL9 A;  1ES2 A;  3SH7 A;  1MWT A;  1W63 Q;  1PW8 A;  2OOL A;  4JBF A;  5E2F A;  1ESU A;  4DKI A;  5F68 A;  3GEC A;  4LRX C;  5FSR A;  2O9C A;  3CG5 A;  2HZ5 A;  1IYQ A;  3MS6 A;  3MQO A;  5L10 A;  3RTY A;  1XA1 A;  2P9V A;  4GLQ A;  3G6O A;  4I3A A;  3KO6 A;  1LI0 A;  2XFT A;  3CZD A;  4JXS A;  1S1Z A;  5AVE A;  1YLZ A;  2H5S A;  1OT6 A;  2JBF A;  2A24 A;  3T1R A;  3CUE C;  3FWL A;  3TG9 A;  3AGF A;  3G4P A;  3C8C A;  1U60 A;  2V8F A;  1EWZ A;  1TS6 A;  1Q2Q A;  1YM1 A;  2BLS A;  3VP0 A;  1GA9 A;  4R3A A;  2ZL1 A;  4E6X A;  4N92 A;  5HPI A;  5MC7 A;  4LEN A;  3N8L A;  3KX0 X;  1ZKJ A;  5GHX A;  2VA0 A;  5FI6 A;  4GKU A;  5G4Y A;  1JWV A;  3S7O A;  1YQS A;  5CHU A;  2PAV P;  2C5W B;  1XJ2 A;  3N4I A;  1TVF A;  4Y15 A;  2Q9N A;  1YSQ A;  2JN7 A;  3V5M A;  4DJ3 A;  4N9L A;  4F3L B;  4X1M A;  4WUJ A;  4GDB A;  4BLM A;  1NY0 A;  1W5D A;  1MKM A;  2EXA A;  1RGZ A;  2WZZ A;  1WYC A;  5IHV A;  4L9F A;  3ULF A;  5KZH A;  3D3O A;  4HH3 A;  5EVL A;  4S2K A;  2Y91 A;  2OLU A;  2O0Y A;  5HWT A;  3PBQ A;  3K3C A;  1XX2 A;  5U47 A;  2H0Y A;  3W4O A;  3QHY A;  3WS4 A;  1VET B;  3DAV A;  2XR0 A;  2PD7 A;  2VV6 A;  3BFE A;  1N9L A;  2V1B A;  3HUM A;  1DP6 A;  2HDR A;  2VGL M;  3BRM A;  3G31 A;  1MKI A;  1Q2P A;  2Y59 A;  2XEP A;  3HLE A;  2EFU A;  1L2S A;  2W3H A;  3IX3 A;  5J8X A;  5AJG A;  4KZB A;  4OPY A;  4YFM A;  2NUT C;  2E8I A;  2PDR A;  5E2E A;  3K2N A;  3UPO A;  4FTX A;  3LIB A;  4DN0 A;  1LL8 A;  3C7U A;  3IWQ A;  4RX3 A;  3UPP A;  4JGR A;  2L4R A;  5E2H A;  2H28 A;  1YLW A;  3E0Y A;  1YLP A;  3A0V A;  1Y28 A;  4GHI A;  2OV5 A;  2JKT M;  4H6J A;  3BQA A;  4XXR A;  4XT2 B;  4OKP A;  3O5Y A;  3PBN A;  4P6B A;  2B02 A;  3ZVT A;  3S1Y A;  4ARZ A;  4ZJ3 A;  2WKI A;  2ZC7 A;  2Z2L B;  3OLO A;  5DF9 A;  4EBP A;  2Y2K A;  5FI7 A;  3FG8 A;  4CLC D;  4IUH A;  1KGF A;  1NZO A;  2Y2L A;  1K55 A;  4HES A;  1PZO A;  4I39 A;  4OQ0 A;  1ALQ A;  3UB7 A;  3EEA A;  1K0K A;  3JVU A;  3V39 A;  5AQA A;  3BW6 A;  4BMW A;  4NXF A;  1KDS A;  2DNS A;  3B33 A;  1NLZ A;  1XFQ A;  3S4X A;  2G2W A;  1TEM A;  4LPZ A;  2EA9 A;  2Y2O A;  5E2G A;  1EI5 A;  3TW8 A;  3S7Q A;  1CI8 A;  3HL9 A;  3LIE A;  1MXO A;  4PM5 A;  3HVF A;  4EW7 A;  5HDS A;  4UAA A;  5DTS A;  3OCN A;  4K0W A;  3CIT A;  3NHQ A;  2O9A A;  3UDI A;  4WN5 A;  4S2N C;  5EM0 A;  4ZJ2 A;  1E25 A;  2XLN A;  3R7W A;  5CER A;  1YMS A;  3IBJ A;  4HH2 A;  2M1C A;  3MMH A;  3ICY A;  2VLG A;  1T19 A;  4S2J A;  3HCY A;  4LCL A;  1FSY A;  4XT2 A;  3ZNY A;  1TF1 A;  2JKR M;  1BT5 A;  4MCW A;  1ZTU A;  2XH9 A;  3BYD A;  4GD6 A;  1H0M A;  1GSW A;  4GNU A;  2R9W A;  1CF0 A;  2BTF P;  5JYO A;  2WGV A;  5A8B A;  1QME A;  3UB6 A;  1NYY A;  1W79 A;  2Y2N A;  1FCM A;  2FH5 A;  1BTL A;  5M18 A;  1MY8 A;  2ZM0 A;  4MNR A;  2PYP A;  4PHT A;  4LRZ E;  4ESP A;  2ZC6 B;  3HJK A;  1YLT A;  4NKP A;  1SKO A;  2WZX A;  3CWF A;  3AGE A;  2ZMV A;  1XGI A;  1XXM A;  4QPR A;  3Q82 A;  3ITA A;  4E3L A;  3QP6 A;  4E3M A;  2CMN A;  4S2M A;  2GDN A;  4PM8 A;  5HD5 A;  3F1O B;  2QKP A;  1G68 A;  1H8M A;  1NYM A;  5CRF A;  1JVJ A;  4S2P A;  4GD8 A;  4MBH A;  1F98 A;  3NCK A;  1V9Z A;  4Y7P A;  3OPP A;  2OWJ A;  2QWS A;  1Y4O A;  3VE3 A;  2D02 A;  4G3V A;  4YNR A;  2VK3 A;  3SZT A;  2LB5 A;  1P9W A;  4QHC A;  1CEF A;  3BJN A;  3M2K A;  1L0E A;  5EE8 A;  1WA9 A;  2QJ5 A;  4PM7 A;  3UMD A;  4FH2 A;  1OJ5 A;  3SS3 A;  5DF8 A;  3Q07 A;  4B93 A;  5AVF A;  1RGY A;  3UE1 A;  4DE0 A;  2ZD8 A;  1L0G A;  1S0W A;  2RL3 A;  3DWK A;  4GW9 A;  3IXB A;  1DP9 A;  3MFD A;  3N6I A;  4RA7 A;  4G3W A;  1NJ4 A;  5IT5 A;  3ZVW A;  3KYE A;  4HJ3 A;  4ZJ1 A;  2IWB A;  2Z6D A;  3Q7V B;  4RVA A;  4QU3 A;  3A3J A;  5DF7 A;  5EVI B;  5GLA A;  5TR7 A;  2B18 A;  5HZH A;  3PBO A;  4KQQ A;  4OQI A;  3VOL A;  1XGJ A;  1BLP A;  1PI4 A;  5CTM A;  3ZG8 B;  4EQI A;  5CED A;  1H8Y A;  2QHK A;  2W1R A;  3NI9 A;  1FSW A;  2JKF A;  4E04 A;  4EBN A;  2VEA A;  2I72 A;  2XD1 A;  1DY6 A;  2V1Z A;  3SW1 A;  3LIC A;  3SS5 A;  2WKH A;  4OON A;  5KMW A;  4ETZ A;  3CLO A;  3CMZ A;  2NUP C;  4DJ2 A;  3LI8 A;  2Q9M A;  1OTI A;  3HRE A;  4WF0 A;  1AXB A;  1C3B A;  5FAT A;  5EEC A;  3CJM A;  4HP4 A;  3T1X A;  3LR5 A;  2HP5 A;  4OOL A;  4OQG A;  1IYO A;  3VV4 A;  3C38 A;  2WKE A;  1E3U A;  1I2S A;  5J3W A;  4R0Q A;  5F5Y A;  2PU4 A;  3EQU A;  1XFN A;  3LY3 A;  5DTK A;  1K54 A;  4JXG A;  4NK3 A;  4WEL A;  3NDE A;  4N1X A;  5EVI A;  1IEL A;  5M19 A;  5HAR A;  3MJQ A;  1OTB A;  1OPX A;  3SOI A;  3HUO A;  1NZU A;  4LLO B;  4QJG A;  1WYB A;  1ES5 A;  3ZQ5 A;  4ZAM A;  2V20 A;  1HTZ A;  4P6Z S;  3P7N A;  2WKQ A;  3WWX A;  4E3I A;  1XKZ A;  5J4E A;  5AQ9 A;  4CLC E;  1Y54 A;  2Y4A A;  4MMN A;  1HZO A;  4I5S A;  5G18 A;  1KGG A;  4WMC D;  3UME A;  4GZB A;  1STZ A;  4R23 A;  2Y2P A;  3MR0 A;  1G6A A;  5HL6 A;  3Q1F A;  4FD8 A;  2WKR A;  4CPK A;  2EXB A;  3IX4 A;  5FDS A;  3H82 A;  4B4X A;  3N8S A;  2R78 A;  5EFW A;  3LEQ A;  3UE6 A;  3P01 A;  1BYW A;  1IYS A;  2W27 A;  4Q0I A;  3QP1 A;  1YSP A;  3EQV A;  3T4O A;  5EVE A;  1KVM A;  3NOU C;  5DTT A;  4WYY A;  4JXV A;  4UA7 A;  3IXG A;  1BLS A;  5HAQ A;  3IF6 B;  3IHA A;  1AWI A;  4GS9 B; 
#chains in the Genus database with same CATH homology
 1S4S A;  2KOI A;  3LIB A;  4JGP A;  1LL8 A;  4MN6 A;  4DN0 A;  2OAP 1;  2HGV A;  4JGR A;  2L4R A;  5G4Z A;  4CLC B;  5FL3 A;  2H28 A;  3E0Y A;  3TE8 A;  3PHY A;  4DMZ A;  2ZMF A;  3A0V A;  4EER A;  1T1B A;  1Y28 A;  4GHI A;  4BWI A;  1TS7 A;  5DKK A;  3ZYT A;  4BJP A;  3U2A A;  5HWV A;  1LSV A;  2HJE A;  1UWN X;  2JKT M;  5TBM B;  4H6J A;  3BQA A;  4YWZ A;  4XT2 B;  2W3D A;  4MDZ A;  3LYX A;  1MZU A;  3O5Y A;  4BBT A;  4GCZ A;  3PBN A;  1DRM A;  2B02 A;  2J80 A;  4IUK A;  2QYB A;  2XA7 M;  4ARZ A;  3LIA A;  2KLI A;  3LR4 A;  3IS2 B;  2L0W A;  1KOU A;  3UE3 A;  4IJG A;  4ETX A;  4WEK A;  3OLO A;  5DF9 A;  3FG8 A;  4CLC D;  4IUH A;  4Y3I A;  3PBR A;  2DMW A;  1EW0 A;  3D72 A;  3CAX A;  2OWH A;  3OCL A;  3KSI A;  2JKR I;  4I39 A;  3UB7 A;  2IA2 A;  3BY8 A;  3EOI A;  3PR6 A;  3JVV A;  3EEA A;  1X0O A;  3JVU A;  2MJ6 A;  5HPF A;  4WLA A;  4NEE D;  5L8M A;  4HOI A;  1TD5 A;  3BW6 A;  3LUQ A;  4HI4 A;  5HDD A;  3VE4 A;  1S1Y A;  4BMW A;  4NXF A;  4R38 A;  2P7J A;  3B33 A;  1NLZ A;  1XFQ A;  2W3E A;  3OBF A;  3KYQ A;  3IBR A;  2A24 B;  3TJZ C;  1OTA A;  3T4L A;  3H7W B;  4FSF A;  4EUV A;  2KX6 A;  4LPZ A;  1D06 A;  2EA9 A;  4R6L A;  2EWW A;  3TW8 A;  3S7Q A;  3LIE A;  4EQ1 A;  4EW7 A;  1LT0 A;  3A0S A;  5HDS A;  3PXP A;  5HD3 A;  3OCN A;  2VV8 A;  3CIT A;  2V1A A;  4L9G A;  3NHQ A;  2O9A A;  4Y5F A;  2GNX A;  4WN5 A;  2QJ7 A;  4NXE A;  1TS8 A;  3W2Z A;  2M7V A;  3R7W A;  4EES A;  1W63 M;  3IBJ A;  2L1M A;  3PBT A;  4HH2 A;  2M1C A;  3KYZ A;  3MMH A;  1N9O A;  4IHQ A;  4OOM A;  4HY8 A;  3ICY A;  4P6Z M;  2VLG A;  4GJ4 A;  4ME4 A;  1T19 A;  3T4T A;  2XRO A;  3HCY A;  2J3W A;  4XT2 A;  2K31 A;  3KSF A;  2A2L A;  4HQA A;  2PR5 A;  1TF1 A;  2JKR M;  3BQ8 A;  2LB9 A;  4MCW A;  1ZTU A;  3EGX C;  3F1P B;  4I38 A;  4EET B;  2PD8 A;  4R70 A;  3H9W A;  3IS2 A;  1OTE A;  1OT9 A;  1GSW A;  1NLY A;  4KQD A;  1YKD A;  2YKH A;  2INW A;  4HJ6 A;  1GSV A;  4HHD A;  3V67 A;  3TRC A;  1S67 L;  2P08 A;  4YOF A;  4II7 A;  5A8B A;  2BAS A;  3F1N B;  3T50 A;  4F3L A;  1LSX A;  2OAQ 1;  3UB6 A;  2V0W A;  1OTD A;  4UQI S;  2HF6 A;  3E98 A;  2FH5 A;  2Y8H A;  4I3I A;  1F9I A;  1MC0 A;  3E4Q A;  3MQQ A;  1G6O A;  4L0L A;  2PYP A;  4PHT A;  4LRZ E;  3HJK A;  5DFX A;  2W3G A;  4NKP A;  1S66 L;  3CWF A;  3RH8 B;  1P9R A;  2ZMV A;  4AFI A;  3UB9 A;  4QPR A;  2WKP A;  4K08 A;  3B47 A;  5KIZ A;  2GJ3 A;  2XRN A;  4ZRR A;  1JNU A;  2CMN A;  2O9B A;  4I3J A;  5HD5 A;  3F1O B;  2QKP A;  3H82 B;  4HIA A;  1H8M A;  4M4X A;  4PKY A;  4MN7 A;  4UQI M;  2PYR A;  5J7E A;  1UWP X;  5DJT A;  2D01 A;  3NOT C;  3T4S A;  3CI6 A;  1OJG A;  5I5L A;  1F98 A;  1V9Z A;  1GSX A;  2OWJ A;  2QWS A;  4JGO A;  3VE3 A;  3MFX A;  2D02 A;  4G3V A;  4YNR A;  4NXB A;  5C5K A;  2LB5 A;  5F6A A;  3MQ0 A;  1DP8 A;  4HJ4 A;  1P9W A;  2J3T C;  3PBS A;  3BJN A;  3GDI A;  5CX7 A;  5DJU A;  3F1P A;  2W0N A;  3LFV A;  3E4O A;  1P0Z A;  1WA9 A;  2QJ5 A;  1D7E A;  5KSH A;  4EEP A;  3K3D A;  3UMD A;  1S4R A;  1OJ5 A;  2PR6 A;  4Q0H A;  2VKS A;  4UEY A;  5HWW A;  2XSS A;  4B93 A;  2VGL S;  4G3K A;  4WL9 A;  5AVF A;  5K5B A;  4GS9 A;  3F1N A;  4GHI B;  1NWZ A;  4GW9 A;  3S7P A;  4H6J B;  1DP9 A;  1YAX A;  3EWK A;  4CLC A;  2KDK A;  4G3W A;  3T4K A;  1XJ4 A;  3LR3 A;  4Z1W A;  5IT5 A;  3EEH A;  4HJ3 A;  4JGQ A;  3C30 A;  4ARZ B;  4L9E A;  3FPV A;  4O0P A;  4Q0J A;  5TBM A;  2Z6D A;  1W63 Q;  1VHM A;  1IOU A;  2OOL A;  1N9N A;  4KUK A;  5F68 A;  3GEC A;  4LRX C;  1T1A A;  2O9C A;  2B18 A;  5HZH A;  3PBO A;  1UGU A;  2VX8 A;  3LID A;  3VOL A;  3LIF A;  2PT7 A;  3MQO A;  3DBA A;  1LSW A;  1NRJ A;  4BBV A;  2O99 A;  2ZBB A;  2YKF A;  3NOP C;  3RTY A;  4GLQ A;  3G6O A;  4I3A A;  2J3T D;  3HJI A;  3KO6 A;  2QHK A;  2FZ0 A;  2W1R A;  5DKL A;  1S1Z A;  5AVE A;  2W1T B;  2M7U A;  2XA7 S;  1OT6 A;  1H3Q A;  1XJ6 A;  4E04 A;  4Y2F A;  2GZA A;  2K2N A;  2V0U A;  2G7U A;  2A24 A;  1G28 A;  2VEA A;  3H7W A;  2I9V A;  3CUE C;  2Z6C A;  3SW1 A;  3T4Q A;  3LIC A;  3C8C A;  2V9A A;  3R7W B;  4KQO A;  1TS6 A;  1V9Y A;  5HDC A;  4ETZ A;  3CLO A;  4R3A A;  2NUP C;  4DJ2 A;  3LI8 A;  1OTI A;  3T4J A;  4WF0 A;  5IU1 A;  5HPI A;  3R4K A;  4BBU A;  4NXG A;  5MC7 A;  3KSH A;  3MXQ A;  3C2W A;  3KX0 X;  3EGD C;  4HP4 A;  2VA0 A;  3LR5 A;  3LR0 A;  4O8G A;  3FC7 A;  5TJJ A;  4OOL A;  5G4Y A;  4O01 A;  3VV4 A;  3S7O A;  3C38 A;  3NJA A;  2EWV A;  4B9O A;  4EEU A;  1XJ2 A;  2Y79 A;  3B42 A;  3BY9 A;  5J3W A;  5F5Y A;  3EQU A;  2HV1 A;  1XFN A;  3BWL A;  1YSQ A;  3S7N A;  3LI9 A;  2JN7 A;  4DJ3 A;  4F3L B;  2K7S A;  4WEL A;  2ZOH A;  5IS1 A;  3MJQ A;  4WUJ A;  1OTB A;  1OPX A;  4EU0 A;  4LLO B;  2P04 A;  3RFB A;  1MKM A;  3ZQ5 A;  4CQH A;  4L9F A;  4MN5 A;  4P6Z S;  3P7N A;  2VV7 A;  2WKQ A;  4PAU A;  3ULF A;  5HSQ A;  3D3O A;  4HH3 A;  2PHY A;  5J4E A;  3OC2 A;  4FOF A;  4CLC E;  1TS0 A;  2O0Y A;  4MMN A;  5HWT A;  3PYP A;  4I5S A;  2HJ9 C;  3UME A;  3MF0 A;  3OOV A;  3PBQ A;  2W1T A;  3K3C A;  4PKY G;  1STZ A;  3KSG A;  4WEJ A;  4EXO A;  2VZW A;  1ZHH B;  3MR0 A;  3E4P A;  2PD7 A;  4RQ9 A;  2VV6 A;  5HL6 A;  2JKT I;  1XJ3 A;  4HNB A;  1N9L A;  2V1B A;  3FPW A;  5LBR A;  2WKR A;  2VJW A;  1DP6 A;  2VGL M;  3F1O A;  3H82 A;  1T1C A;  4CLC C;  2ZOI A;  2JHE A;  2R78 A;  1P97 A;  5EFW A;  1T18 A;  3UE6 A;  3P01 A;  2W3H A;  5F69 A;  1BYW A;  3A0R A;  2W27 A;  4Q0I A;  5AJG A;  1YSP A;  3EQV A;  4HP9 A;  2W3F A;  3T4O A;  1VB6 A;  1ODV A;  3NOU C;  2GX5 A;  1F5M A;  4KUO A;  4LRY C;  2NUT C;  5DFY A;  3CUE A;  3UB8 A;  2PDR A;  3K2N A;  4GS9 B;  1IFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...