1DPUA

Solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
publication title Structural basis for the recognition of DNA repair proteins UNG2, XPA, and RAD52 by replication factor RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dpuA00
1FYMA 3GFIA 1FT9A 5F1RA 2MC3A 2CWEA 4UUVA 4NB5A 5LHIA 1ZH5A 3ABUA 1TLHB 3MZHA 3J80Z 4EGYA 1UCRA 4OINF 3GZ6A 2YX4A 5A2QZ 1H9TA 4Q47A 3RIRA 3TOBA 4AVPA 2EFQA 3KP5A 4HLXA 4OIOF 1FC3A 3RJPA 4A12A 2FEZA 5AONA 5FLXZ 4QLCU 1EH6A 1QPMA 3KZZA 4HX7A 1U5TB 1XSDA 4CO8A 5EEGA 2L3DA 2LF7A 4AD9A 1G3YA 4P55A 2ZBKA 2VXZA 2PQ8A 2XUBA 2PMUA 1J7KA 2Q0OA 2YU3A 3V7RA 2HQRA 1BC7C 1S7AA 2VBWA 2FMLA 5BPDA 2HWVA 4WWCA 3L7WA 3F72A 1RI7A 2QYOA 3R6SA 1MKMA 4ZYHA 1SFXA 1YG2A 4RAYA 5HLIA 1J9IA 4YIFA 4Y15A 1G4DA 3DPLC 4M71A 3ML6A 3I71A 2P6TA 1EH7A 3IKVA 3KZYA 2F5CA 3ROUA 4EJTA 2A07F 1F9NA 4A5MA 2V79A 1W7PB 4GO1A 3EETA 3C1DA 1O7LA 4M9XA 1T2KA 1R23A 1T39A 1KU7A 5L3FA 1W5TA 5HLGA 4Q5SF 2HDCA 4I0AA 2HKOA 3B73A 4HX8A 2IPQX 4LG0A 2G9WA 2XRNA 5D5WB 5LGUA 2QVOA 3H92A 1ZRDA 5FB2A 3HYIA 3ZPLA 1EV7A 2A69F 2ZNYA 1OYYA 2ACJA 2KRFA 4RGXA 2FBIA 3JSOA 4FHTA 3RI4A 1IN6A 4MHGA 2L4AA 3FM3A 2D2WA 1Z6RA 1H0MA 1STZA 2NRAC 3TKYA 1R1TA 3I4PA 5E1XA 3LA2A 3WGHA 2VODA 2W84A 2QQAA 3F8BA 1RUOA 1KQ0A 4ESJA 3VOEA 1IUYA 3S2WA 2M1BA 1G6NA 1IXCA 3ZMSA 1DPRA 3WU0A 2NAZA 4HW0A 4O6JA 2O6GE 3REOA 2QQ9A 1DUXC 1XMAA 4PCQA 2XKPA 2BYVE 1UHWA 4Z2YA 4G7OF 4U0WA 4DNCA 3OV8A 5CVIA 5L3DA 3CO7C 2J5PA 1RIOH 3BJOA 4S05A 1SMTA 3FMQA 3GFLA 3G3ZA 5DCMA 4Q4ZF 3QOPA 1Z7UA 2F5EA 4IRHA 3TQNA 3IWZA 4BYYA 3KP7A 4HQMA 5KK1A 2GZWA 1CF7B 4M9ZA 3DQVC 1HKTA 3ZN0A 2DU9A 2MLKA 5CLSA 1P4WA 3KP6A 3K1MA 1XGSA 4ENJA 4HOBA 4IJAA 2ZMEB 3HHHA 5DD8A 5JVTA 2FE3A 2F5DA 4GCVA 4MNUA 1FOKA 2VOPA 4CDGA 2DPUA 4M9SA 4KIFA 1ZGJA 2M87A 1ZGAA 2H6BA 4I0BA 2NYXA 1FBUA 3L00A 1U2WA 3F6OA 2FMYA 3I58A 2CSOA 4HAMA 4GGGA 3W6JB 1Z1DA 3MCZA 2F2EA 3R0JA 1ZREA 1K78B 1D8JA 4ENMA 1U8RA 2Z33A 4EJUA 1WQ2A 1YIOA 4CGZA 2DQLA 1NHAA 1WSUA 1R00A 2WTEA 4O3MA 3LAJA 4A0XA 1TBXA 4IXAA 5K1YA 1SD6A 2MLGA 1GXPA 1OYWA 4KNYA 3EYYA 4OIQF 3SFZA 1D8KA 1IRGA 2KIUA 2GXBA 3GEZA 4A6EA 2O0YA 3GFMA 1FP1D 3GZ5A 3DP7A 2A61A 1TTYA 4GYIA 1FLIA 1SFUA 3E6DA 1PDNC 4LLGF 1ZRCA 2DFIA 2HOEA 4UVCA 2IA1A 5LGNA 3IRQA 2XKOA 5ERIA 2GAUA 1FYKA 3HRMA 1R1VA 1UFMA 4LD5A 4LFUA 3KLNA 1XD7A 5AIQA 2VOOA 2L02A 2QBYA 2VE9A 4N0BA 5CYVA 2UZKA 3RKYA 3ZQ7A 4LB5A 5JFRA 4KIGA 2EA4A 3MWMA 4M72A 3V7CA 4RGUA 4G9YA 2RQPA 2HFHA 2R7FA 2H09A 3FMSA 3J81Z 1B9NA 3TO6A 4ZZDA 3BJ6A 2M30A 2YPRA 1MJBA 2W57A 2W85A 4BNCA 1J5YA 2WC2A 1I1GA 2K27A 1F5TA 3F23A 3I64A 5JR3A 2OZUA 4YIIA 2JPBA 5IT9Z 2PBIA 1YQAA 3E6BA 4WK8F 4LK0F 5TJJA 1HSJA 3TDUC 2HYFA 1RNLA 1LB2A 3KFWX 2FXAA 4A5NA 1F1ZA 3CTAA 2XHKA 3ZP5A 1J59A 3CLOA 1I5ZA 4OMYA 4KN7X 2BEOA 4N9HA 3KP4A 3ULQB 2DW4A 4XLNF 1R58A 5H6QA 1KU9A 1HSTA 4JBAA 4HF1A 4WF2A 3CUQB 3GW2A 2XASA 5BPIA 3JW4A 4U7DA 1YS7A 4IHSA 4L9VA 2LKPA 2LSOA 5E1ZB 2EK5A 3V8LA 3TO9A 2A6HF 2HTSA 2XV4S 1YW8A 2OU2A 1A04A 5D8KB 3ZMUA 1ODDA 1MGTA 3M8EA 2XAGA 4MEYF 2G7UA 5HOOA 2LF8A 5LEKA 1FBQA 3LA7A 2QENA 2ZNZA 2Y48A 3KEQA 1P6RA 2KIFA 1YW9A 5FFXA 4D0PA 1S6LA 4ON0A 2TDXA 1ON1A 3RTRA 3HRUA 1TW3A 3HTSB 3K69A 1U5TA 3V4GA 1KQ9A 3L09A 4NQWA 3VFZA 2MH2A 1XDUA 1KQ8A 1JGSA 2EB7A 5D5XB 4GYGA 1O3RA 1GHCA 4YFXF 2COMA 5LHHA 2HS5A 3KETA 2OAZA 4LK1F 2BBYA 3WTYC 4NHJA 2HTJA 3LWFA 5D5UB 3JTGA 1WWXA 1BM9A 4BXUA 1KU3A 1HW1A 3N4MA 4I09A 2BE5F 2ZXJA 2X4HA 3RDIA 3FM5A 2EA2A 1OMIA 2ESNA 1YYVA 4HA8A 1BBYA 2Z3YA 2IA2A 4XRFA 2HKXA 3JAMZ 3T8RA 1W7PA 2K4JA 3QU3A 3D5LA 1XDSA 3HRSA 3VEPA 3E5UA 1JHFA 3NEUA 4KFCA 4L5JA 3DV8A 2JZYA 3V7SA 2RVCA 4AIHA 1FP2A 3HSRA 4EMSA 5BMZA 3JTHA 1D3YA 1S3JA 1MD0A 2H94A 1ONVA 1U5TC 3K9TA 5K5QA 4EQQA 4G7ZF 2WV0A 2KJCA 2RGVA 4RB3C 3EQLF 2A5YB 5ICFA 3WODF 2H27A 1R1UA 4OMZA 3O2PE 4ETSA 2HR3A 3P9KA 1B9MA 3Q9SA 2OBPA 4M73A 3QP5A 4UNOA 3E6CC 5LEJA 2XAHA 5HS9A 4A0ZA 1P92A 1YLFA 2Z5UA 1JXSA 1FPQA 3R0AA 3R4KA 4P9FA 1J2XA 3VB2A 3T8TA 3M9AA 3ZN1A 2P7VB 5L3CA 4EJOA 1P2FA 4XSZF 1X3UA 3TGNA 5LGTA 2ISZA 3QAHA 2IRFG 1LQ1A 3DKWA 4O5VA 2EFOA 2O61A 1LEBA 4YFNF 3MQ0A 5D4RA 4UVAA 3RYRA 1BIAA 3W6KB 4LLNA 4KICA 2P8TA 3K0LA 2RKHA 4BHBA 2UWMA 1PP7U 5CJ9A 3WTTC 2RNJA 4XSXF 3FXUA 2CGPA 4LB6B 2RDPA 1IRFA 5FGMA 4G7HF 1IAWA 2XAJA 1EH8A 4UXNA 1ZG1A 4ZH4F 1U3EM 1C0WA 3KE2A 2DPDA 4CYDA 1LEAA 4KIBA 3Q5FA 2Y0MA 1QZZA 5L3BA 1U78A 3WTXC 2GQQA 1CF7A 1SD4A 1TNSA 1KYZA 3BJAA 1RUNA 3G73A 2ZFWA 2IW5A 5E20A 2KIMA 4FX4A 2FQ3A 4WCGA 1IXSB 1XGNA 2DLLA 2NS0A 5L3GA 6PAXA 1K79A 1BJAA 4ESBA 1HBXG 2M45A 1QZYA 2WWYA 4P5OA 2XAFA 1V4RA 2QLZA 1J75A 5HLHA 3GWZA 2VONA 2K7LA 2VBXA 3F3XA 4P96A 2ETHA 2XGXA 3DPTA 1MDMB 3ZMTA 1FSHA 4ENNA 3T1BA 3CO6C 1O3TA 1TQMA 3U9GA 2W25A 1K78A 3SHFA 5E18F 4AWXB 5D5VB 2FA5A 4KDPA 1XSXA 4RGRA 3HOSA 3GYHX 2IT0A 1IN8A 3SQNA 1MZBA 5FD6A 4HLYA 4L18B 1FSEA 2K4BA 3R60A 4IVNA 3FWEA 2FBHA 2BGCA 4EV0A 1W5SA 3Q9VA 5ILSA 3T0YA 1ZN2A 5CVJA 2DBBA 3IWFA 1HKQA 1J0RA 4H0EA 5HS7A 2ZO4A 1TQIA 2GA1A 2JT1A 3ZMZA 2PLYA 3QRFF 4RGSA 4HV5A 1LVAA 1XN7A 2FBKA 3AAFA 5E8IA 3WTWC 2Q2EA 2FRHA 3ZMDA 2IP2A 3FXRA 1IF1A 2P5LC 3EUHA 1UHMA 3E5XA 2Z9OA 3F6VA 4CZZA 5CVUA 3R61A 3LFKA 2GXGA 5DEQA 4P9UA 1LDDA 3P7NA 2HEOA 1I27A 2L01A 3C3WA 1QQIA 2CYYA 2VT3A 5ILVA 3PFIA 1Y0UA 3I59B 2AXLA 2P5VA 3OOPA 1O7FA 2QZ8A 3K1PA 2A3SA 2D45A 1G3TA 2XIGA 1FZPB 2MA3A 2VBYA 5F6FA 4G6QA 3DFGA 4ESFA 3HHGA 1BI0A 2ADUA 2L54A 2ISYA 2CW0F 5LBQA 3J80K 4I02A 1MJ9A 1R22A 1B4AA 1Z05A 3WTSC 4LLLA 1WKMA 1OR7A 5A2QK 5EEHA 4R8HA 3BWGA 3PQKA 2D1HA 2E1NA 2UXXA 3M8FA 2PN6A 3WG9A 2VT2A 1USTA 5ICEA 5FLXK 4HYEA 4HBLA 1YW7A 4MEXF 2ZKZA 1AWCA 4HDVA 2OA4A 2P4WA 1YTYA 5D6FA 4L5IA 5DUIA 2E7WA 1ZAOA 1JE8A 4IPAA 3SZTA 1LDJA 3F8FA 4ZZLA 4AIKA 1VTNC 2DQRA 3HOTA 1S8NA 1T6SA 3CUQA 3MAJA 2Y75A 5LRSA 1KU2A 2EV0A 1B1BA 4PZJA 5K5RA 4KUMA 5BQTA 4I7HA 4BHCA 1I1SA 1IW7F 2XVCA 3QU6A 1DP7P 5DUKA 4WXHA 4PGHA 2AS5F 1JHHA 4MQVA 2EWNA 3P9CA 2D1VA 1BN5A 1FX7A 2M5WA 3HTUA 3COAC 2L4MA 2DO7A 4RS8A 3K2ZA 5F64A 3IHUA 2ZJ2A 1HXDA 2HGCA 4TV7A 3KP3A 1YO5C 5LHGA 3LA3A 4S04A 2F5FA 1OKRA 5HDGA 2XAQA 1O57A 4EGZA 3ECHA 4I98B 4HQEA 2RV8A 1QGPA 4XLPF 1SFEA 1IN5A 3H3UA 2P6SA 4HF2A 3TDZC 4G94A 2YR2A 3IKTA 4HV6A 4E70A 4HX4A 1TQPA 3BROA 1K7AA 3BPVA 3GO5A 4HZFA 2CG4A 2PI0A 2NNNA 2JPCA 4RB2C 3HSFA 4F7ZA 2KJBA 1HW5A 5FD5A 3F22A 2EFNA 3RKWA 5LLQA 1O3SA 3I0TA 1SAXA 3RPUA 1BIBA 1W7PD 3HRTA 1LDKB 2JSCA 1ZHFA 2PMHA 3QP6A 4JQFA 1SD7A 4Q48A 1T98A 3PQJA 2IA0A 2X0LA 5H6RA 1G3SA 1XCBA 3GX4X 3HUGA 1FBSA 1USSA 1Z9CA 5HDNA 1ZRFA 3LQRA 5J6XA 2RC4A 4RB0A 4OIRF 5J8FA 2V1DA 2DI3A 1I6XA 4YFKF 1E17A 1U6GA 1FY7A 5L3EA 3F8MA 2YSRA 3H3ZA 2VBZA 2ELHA 5ED4A 1DDNA 3WE2A 3LAPA 3DF8A 2OQGA 3BP8A 4FX0A 4UVBA 2OD5A 3RPQA 3WTZA 3L9FA 2HYGD 2QUFA 2VN2A 1SMYF 2PJPA 2PEXA 4U7BA 1WI9A 3RKXA 5HDKA 4M6XA 2EV5A 2V1UA 4RAZA 2H6CA 3E3VA 1Z91A 3KLOA 4KA4A 5HS8A 3ECOA 1IN4A 2HZTA 1S29A 2CO5A 2LDUA 2M8EA 1XB4A 5LRRA 4ZYGA 1OYIA 4CICA 5D6EA 1W4MA 3FHZA 5ICCA 2VC0A 1HQCA 1TW2A 4G8XA 4KMUX 5DV5A 3CDHA 3V8KA 2K86A 2YX7A 3V8JA 2PG4A 4RB1A 3E97A 3MFKA 1IN7A 3BZ6A 4WXCA 3KCCA 3KEOA 5HVQC 5BOXA 3CUOA 1R36A 3GFJA 4EVIA 3WE3A 4LG0B 2KKOA 4UV9A 1ZARA 3N97A 2EJRA 3M1EA 3FXQA 4A2UA 3BDDA 3QPHA 2CFXA 2FNPA 4HDUA 4U0VA 5AIPA 2NNYA 2CQKA 1GVJA 3BOQA 1QO0D 2P7CB 4MTEA 3GUDA 5K5OA 4EM1A 3CJNA 1GXQA 2W24A 3U2RA 2V9VA 1QBJA 3K1NA 1CGPA 3O3KA 2K02A 1MDMA 4L0ZB 1QNTA 2ZMEA 5KVRA 1B59A 1P4XA 4ZYDA 1HKSA 3MZYA 2BV6A 3KP2A 3M7GA 1BI3A 5DDGA 3FMRA 2O8XA 2JTVA 3ABTA 4A0YA 4G6DA 5H20A 5E1WA 1SD5A 1T0FA 4KMFA 1XSVA 5JHUA 4YG2F 4IRIA 2DT5A 3B02A 2VC1A 3U1DA 3ISPA 4BQAA 5DCFA 1AOYA 1IZ1A 2IJLA 2QWWA 1BI2A 4PDKA 4DQ2A 2ESHA 2FNAA 3IL2A 1BC8C 4UHTA 2A68F 5D4SA 4QWQA 1S7OA 3J81K 3LQQA 5DCMB 3I5UA 5DD4A 4EM2A 3ERED 2HQNA 4A6DA 1PP8F 4OIPF 2FSWA 1R7JA 2STWA 2R3SA 4KN4X 2QQBA 4BHPA 2DK5A 3WTUC 5IT9K 4CHUA 4EM0B 1MJAA 4M6YA 1ZLKA 3WU1B 1E2XA 4IRGA 2JRTA 5ILUA 1K6OA 2GIVA 3FZVA 2DAOA 2V1XA 2E1CA 4WX9A 4HF0A 4L0YB 2FU4A 3O6BB 4LJZF 1R5HA 2Q8KA 3I59A 1D5VA 1RZ4A 4BH9A 1FWZA 2LNBA 2C6YA 1F4KA 1KYWA 4OU0A 4ASNA 4Y13A 2J5OA 2GWRA 3BY6A 1WRJA 5CVVA 3EYIA 4FT8A 4I2OA 1Z6TA 3GXOA 3LSTA 2V6CA 2RN7A 3SZPA 3TO7A 4JK1X 2VE8A 3C18A 2P5KA 3DXJF 4R1HA 4L9NA 2O3FA 4N9IA 3J7AO 4MGRA 1YFHA 4B09A 4MQ9F 4ZYEA 1IXRC 2R7DA 2QM3A 4AIJA 1PUEE 5CVRA 2UXNA 1G3WA 3HIFA 4BAYA 3L2CA 1FYLA 1LJ9A 4MTDA 4CXFA 4IHTA 1O3QA 3FF5A 3F21A 3D0SA 2OZ6A 3I54A 1L3LA 4UV8A 2OQRA 3IC7A 1UB9A 5J8CA 1ZLJA 2XROA 5DYMA 3GF2A 1XGMA 4PGGA 4LGWA 1R5GA 4Y17A 3WGGA 3GVAA 1H9GA 4LMYA 1Q1HA 3JSPA 1P4AA 1ZG3A 5E17F 2G7HA 3MEXA 1ZG5A 5BS6A 3JAMK 1DPUA 1V3FA 3FX3A 3SXYA 5FO5A 5D8LB 1ON2A 1XCVA 1REPC 3RYPA 3TOAA 2E7XA 1KA8A 2O03A 3BPXA 3E6MA 3F8NA 1XGOA 4U88A 2GA2A 3P9IA 2DK8A 2Z99A 4L9JA 5FFZA 3EDPA 2QBYB 5ICGA 1YS6A 2ZCWA 2MD5A 1XMKA 4KYWA 3VODA 2A6EF 3WTVC 1B6AA 3F8CA 4IF4A 3ELKA 5TRDA 2FF4A 2EFPA 5JI6A 4XBFA 5IT3A 2MH9A 1OPCA 3NQOA 3E5QA 3DEUA 5E8GA 4OOIA 3T5XA 3IRRA 3I53A 4I01A 2EFWA 4EJWA 3HSEA 2FOKA 4M74A 1T38A 3C7JA 4L9TA 4KT5C 4EJVA 4GXOA 4WXDA 2MBFA 3QPTA 3CUQC 1LNWA 3NRVA 4R79A 4U0YA 2EV6A 1KGSA 1ULYA 1ZYRF 2PFBA 3GLXA 1HW2A 1L0OC 2IVMA 4K2EA 1TNTA 3WGIA 1FNNA 2B0LA 2DTRA 3ZMVA 2STTA 1BI1A 1BOAA 4B8XA 4ENKA
chains in the Genus database with same CATH superfamily
3J7YJ 5EYRA 1FYMA 3GFIA 1FT9A 5F1RA 2MC3A 1ZTRA 4I6ZA 2CWEA 1PVEA 1T95A 3C2HA 3CDIA 4NB5A 5LHIA 5J1YA 3SJMA 2D5VA 4UUVA 1FOXA 3GTLJ 1FTTA 1ZH5A 3ABUA 4HRIA 1TLHB 1AKHB 1MBEA 3MZHA 2BW3B 2M0CA 3J80Z 4EGYA 1UCRA 4HG2A 4OINF 2X6YA 3GZ6A 2E1MB 2YX4A 5A2QZ 1H9TA 4Q47A 2CS3A 2JRMA 3RIRA 3TOBA 3JRFA 1MIJA 3OYIA 4AVPA 2EFQA 3KP5A 4HNTA 1GDTA 4FQGA 3ONQA 4HLXA 2R7WA 4OIOF 3HKZN 1OLTA 1FC3A 3RJPA 1JT6A 4A12A 4XOPA 3M4OJ 3CCVI 2FEZA 2DFHA 4Y4RA 5AONA 2WBMA 1SC7A 5FLXZ 2K40A 5EJCA 4QLCU 4IHXA 1EH6A 4NC7A 1QPMA 3KZZA 1TL8A 2Q1ZB 4HX7A 1U5TB 2R5YA 1XSDA 1X58A 5EF6A 1P7JA 5EEGA 4CO8A 2L3DA 2LF7A 4AD9A 1Y8RB 4XLEA 1G3YA 4P55A 2ZBKA 2VXZA 2PQ8A 2XUBA 2O9LA 2PMUA 1DU6A 1J7KA 5M5WJ 2Q0OA 3FXOA 5EGOB 2YU3A 5FROA 3V7RA 2HQRA 1BC7C 1LE8B 3HZJA 3FK7A 1S7AA 3A02A 2R0QC 3AG3H 2PMZA 3EPZA 2VBWA 4AUXA 3OSGA 2FMLA 4C30A 5BPDA 2HWVA 2VL8A 3HJEA 3JRCA 4M3DA 1EA3A 4WWCA 2DMUA 2M8GX 5K7FA 3DU5A 3L7WA 3F72A 3H1CA 1U0JA 2KFDA 1RI7A 2QYOA 2VJJA 3CF2A 3R6SA 2NVYJ 2QQ8A 2JQ7A 1MKMA 3OYNA 4ZYHA 1SFXA 1YG2A 4RAYA 5HLIA 1J9IA 4YIFA 1ETVA 1EF4A 4Y15A 1G4DA 3DPLC 4M71A 3ML6A 5E79C 3I71A 3S3MA 1LFPA 1SVMA 2P6TA 1EH7A 3IKVA 3KZYA 2F5CA 3ROUA 4EJTA 1CQTA 4BJ5C 2A07F 1F9NA 4A5MA 2V79A 2EPFA 5J40A 2XB0X 1W7PB 1BR4A 4GO1A 4H4KC 4A3KJ 3G1MA 2BOLA 3EETA 1K4SA 3C1DA 3TP3A 3FXMA 3GLLA 1EJ9A 1O7LA 2AXTC 3QWLA 4M9XA 3I3LA 1Z21A 1K61A 1R4MB 1R23A 1T2KA 3TMOA 3GTGJ 1T39A 3VYSB 1KU7A 2HVSA 5L3FA 1W5TA 1SFKA 5HLGA 3FIWA 9ANTA 4Q5SF 1A6IA 2RNGA 4I0AA 2HDCA 2HKOA 3B73A 4HX8A 2IGOA 3CP2A 2IPQX 2Y69H 3F0CA 4LG0A 4GRIA 1W36C 2G9WA 2XRNA 5IYDJ 5D5WB 1NG6A 5LGUA 2QVOA 3H92A 1D0XA 2R93J 2KPMA 1JGGA 5GTIC 1ZRDA 4OWRB 5FB2A 3A0BC 2H8WA 3HYIA 3HL2A 1PYVA 1WGXA 1GV2A 3ZPLA 1EV7A 2A69F 2ZNYA 5EZHA 5FKOA 1OYYA 2ACJA 4BXXJ 3IH4A 5CQEA 4A3MJ 3G71I 2LY9A 2KRFA 3LSJA 1TC3C 4RGXA 2KRCA 3BC8A 1VNDA 2FBIA 2LD5A 3JSOA 4FHTA 3RI4A 1IN6A 4MHGA 2L4AA 3FM3A 2D2WA 2VQLA 1Z6RA 3LSKA 1H0MA 1STZA 3J7AY 2NRAC 3I55I 3TKYA 2LK2A 1NG7A 1R1TA 3I4PA 5E1XA 3E0JB 3LA2A 2ME6A 2KMUA 4PSWA 1TWCJ 3ZR8X 3WGHA 2XSJC 1FTZA 2V1NA 2VJ4A 4Y7NJ 2VODA 1QRYA 2W84A 2QQAA 3F8BA 1RUOA 3E7LA 1KQ0A 4ESJA 3VOEA 2XF6A 1IUYA 3S2WA 2M1BA 3K4BA 1G6NA 5EEAA 1IXCA 3ZMSA 5KHDA 3A03A 1IV6A 1DPRA 1VQMI 3WU0A 1POGA 2NAZA 4HW0A 2LC2A 4O6JA 5M5XJ 2O6GE 3REOA 2VPRA 1LFUP 4CUGA 2QQ9A 1G8XA 4X0GA 1WCMJ 3Q0WA 1DUXC 2M4GA 1XMAA 4PCQA 2XKPA 2BYVE 1UHWA 2L7KA 3ASNH 4Z2YA 4G7OF 4U0WA 4DNCA 3OV8A 1OCPA 5CVIA 5L3DA 3CO7C 2IGNA 2J5PA 1RIOH 3I4NJ 5GTHC 3BJOA 4F93B 4W1UA 4S05A 1SMTA 5FRMA 1HOMA 2V26A 3L2RA 3SEQA 4D7NA 2QGUA 3FMQA 1NK2P 2HXOA 4LIUA 3L2UA 3ZXSA 3HOZJ 1MNMC 3GFLA 1IRZA 3G3ZA 5DCMA 3UKGA 3DBLB 4Q4ZF 1UZCA 3KYDB 2GBYA 4UY8I 3QOPA 1Z7UA 3BTCA 2X9DA 2F5EA 4IRHA 4ITVA 3CCSI 2HQ5A 2ECCA 3TQNA 2L9RA 3IWZA 4BYYA 3Q0UA 3KP7A 4HQMA 5KK1A 2GZWA 1CF7B 1Y8QB 4M9ZA 3DQVC 1N78A 2HI3A 3K4NA 1HKTA 3ZN0A 1MBKA 4NNJA 2ZC2A 2EZLA 3CLQA 2DU9A 2BVLA 2MLKA 2Y31A 5CLSA 4C2MJ 1P4WA 1D1BA 3KP6A 4KT6A 3K1MA 4NDLA 4DW6A 1XGSA 4ENJA 4HOBA 2L9VA 1BW6A 5FKMA 5B1AH 4IJAA 2ZMEB 3HHHA 2XPVA 5DD8A 1A6QA 5JVTA 2FE3A 2F5DA 3S1NJ 4GCVA 3CC4I 4MNUA 1FOKA 2VOPA 3MKWB 2X6WA 3SDGA 4CDGA 2DPUA 3HGGA 2DMNA 4M9SA 4BDZA 4KIFA 2XF7A 3DU6A 1ZGJA 2M87A 1ZGAA 2H6BA 4I0BA 2NYXA 4PJMA 4M3GA 3BT9A 5LD2C 1FBUA 3L00A 1U2WA 2E71A 3F6OA 2FMYA 4GFBA 4UUSA 3C2GA 3I58A 1MBGA 2VUMJ 1B72B 2CSOA 4E7ZA 4HAMA 4GGGA 3W6JB 2KISA 2LR8A 3K2AA 5BNGA 3CDLA 1Z1DA 3MCZA 1VFCA 2F2EA 5KNLA 3R0JA 3W6VA 1WHUA 2LOOA 1ZREA 1K78B 1VF9A 1D8JA 4ENMA 2XPUA 1U8RA 4RM3A 2Z33A 4CZCA 2V4JC 3OYGA 4UB8C 3PSFA 1B8IA 3QODA 4EJUA 1I6HJ 1WQ2A 1RETA 1YIOA 4CGZA 1W1WE 2DQLA 3HOYJ 2MYSA 3VYTB 1NHAA 3BCBA 3DCFA 2LBFB 1WSUA 2CQQA 1R00A 1YX5A 2WTEA 3ZQIA 4O3MA 3LAJA 4A0XA 3HOXJ 4BUPA 1TBXA 2YUSA 4IXAA 4Y33A 5K1YA 4NC6A 4IO9F 1SD6A 1MH4A 2MLGA 1GXPA 4CH7A 2IS4A 2EIKH 1OYWA 5J3LA 5TGTA 1ETQA 5IY5H 4KNYA 2W48A 3EYYA 3UR3C 1X19A 1HDPA 1VQKI 3SFZA 4OIQF 2HU9A 2MGQA 2VXDA 4JX5A 2KL4A 2DOAA 3S3NA 1D8KA 3H9QA 2K5CA 2OC6A 1IRGA 1BR1A 2CUZA 2MC4A 2Y0SN 3WG7H 2KIUA 3KEYA 2QSHX 2GXBA 3GEZA 4BQNA 1YE9A 4A6EA 3QOEA 2XSDC 1UG0A 2O0YA 3GFMA 2VKEA 1FP1D 2UUZA 3L2VA 3GZ5A 2Q2EB 1Y1WJ 3DP7A 2HZDA 2BY2A 2R7XA 3BTIA 4E7HA 2A61A 4V2GA 2JMWA 2WV1A 1TTYA 4GYIA 1FLIA 1XX5A 5J47A 4ZC3A 1SFUA 3E6DA 1PDNC 4LLGF 4LITA 1ZRCA 1VZ0A 2DFIA 2HOEA 4UVCA 2LKSA 2IA1A 5LGNA 2X1CA 4V19K 3BR3A 3IRQA 2XKOA 2X51A 5ERIA 4RMNA 2GAUA 2CQNA 1FYKA 1NH3A 3HRMA 1DQUA 1R1VA 4PSXA 2LMDA 3NARA 2WY7Q 1UFMA 3TEDA 4LD5A 1PUFB 4LFUA 3KLNA 4RAGA 1XD7A 1GUUA 3OYAA 5AIQA 2VOOA 2X6OA 2L02A 2QBYA 4BL0B 2VE9A 1LPQA 1YITI 4N0BA 3J7ZI 3QYFA 5CYVA 5M3FJ 2UZKA 2QF7A 1WH7A 3RKYA 5FKLA 3CJRB 3ZQ7A 3ABKH 4LB5A 5JFRA 2HXIA 2GOXB 4KIGA 2EA4A 3MWMA 4M72A 3V7CA 4RGUA 4G9YA 5E3LA 2RQPA 2HFHA 2HDWA 2OF7A 3Q3SA 4C3JJ 1ZQ3P 2R7FA 2H09A 2DTZA 3PUBA 2I5UA 3CCYA 1YI2I 3FMSA 3J81Z 1B9NA 3TO6A 3VSLA 4DGWB 4ZZDA 2E1OA 3BJ6A 3VPRA 2M30A 2YPRA 3O8HA 3RQ4A 2LY1A 2MW8A 4BQOA 1MJBA 2W57A 2BHYA 2W85A 3W2WA 1J5YA 4BNCA 2WC2A 1I1GA 2K27A 4BE0A 1F5TA 1QA6A 3VDXA 3F23A 3I64A 3C2BA 5JR3A 2OZUA 4YIIA 2JPBA 5IT9Z 2PBIA 1YQAA 3E6BA 4WK8F 4LK0F 5TJJA 2VQGA 1YJWI 1HSJA 4JP0A 3AL0C 3TDUC 2EZHA 2HYFA 1RNLA 1WFXA 1LB2A 2PMZN 3KFWX 2FXAA 3ZQHA 1VQNI 4A5NA 1F1ZA 1GV5A 3BR6A 3CTAA 5KCMA 2XHKA 4IHYA 1P9QC 3ZP5A 2MFZA 3HB9A 1J59A 2PJRA 3CLOA 1IUFA 4A93J 1I5ZA 5GADJ 3K4LA 3L2QA 4OMYA 4KN7X 3JRHA 2B7EA 2BEOA 4N9HA 3KP4A 3ULQB 3IH2A 4C3HJ 2DW4A 4XLNF 4CYCA 3S15J 5GP9A 2IS2A 1R58A 2W00A 2V9PA 5H6QA 2IGKA 1KU9A 2ELKA 1HSTA 1Q1VA 2FQ4A 4JBAA 4HF1A 4WF2A 3U21A 3BG6A 3CUQB 3GW2A 2W82A 2XASA 5BPIA 2OUMA 1GLNA 3JW4A 4U7DA 1YS7A 4IHSA 2HPIA 1W5CC 4L9VA 2LKPA 3VYUB 1X2MA 2LSOA 2M2EA 1KONA 1U8BA 3KX2A 5E1ZB 2EK5A 3V8LA 3TO9A 3BQYA 2A6HF 2HTSA 2FJ1A 3K4CA 1MNDA 3OY9A 2XV4S 1YW8A 3K10A 4BBSJ 3F9KA 2OU2A 5C4JJ 2VB6A 1A04A 5D8KB 1FIPA 1ODDA 4XKBA 1MGTA 3ZMUA 1AKHA 3M8EA 3LSRA 2XAGA 2BW3A 4D1QA 4MEYF 2G7UA 3MVPA 2ZSIB 5HOOA 2LF8A 3OSFA 1WJ5A 2AHQA 4BBRJ 5LEKA 1IRXA 1FBQA 4DZPA 3LA7A 4CA0A 2QENA 4XONA 2OTLI 2ZNZA 5CPRB 2CUFA 2Y48A 3KEQA 4KITB 3H35A 1ZR2A 1P6RA 2KIFA 4XKVA 3ZQGA 2E36A 3FKJA 2LRDA 3BTJA 3WU2C 1WZ2A 1X1PA 3H9JA 1YW9A 5FFXA 4D0PA 2JA8J 1YJNI 1S6LA 3P5JA 4KJZA 4ON0A 2KRHA 1ON1A 2L2OA 2TDXA 5F08A 5FKNA 3RTRA 3S16J 3HRUA 1TW3A 3HTSB 2DJNA 3K69A 1U5TA 3V4GA 1KQ9A 3K7AJ 3L09A 3DEWA 4NQWA 5M3MJ 3VFZA 2LREA 2MH2A 4IHVA 1YRNB 2XB5A 1I3QJ 1XDUA 1S72I 1HA8A 1KQ8A 4E7JA 2DCEA 1JGSA 2EB7A 5M5YJ 5D5XB 4GYGA 3HOVJ 1O3RA 5EGOA 1GHCA 2VJ5A 1MSFC 2OCCH 4YFXF 1LE8A 2HOTA 1DU0A 2COMA 2IXSA 1W36D 5EZGA 5LHHA 2HS5A 3KETA 2OAZA 3OYMA 4LK1F 3S1MJ 1X4OA 2BBYA 3WTYC 4NHJA 5HNHA 2HTJA 3LWFA 5GAHJ 1XMXA 4M3EA 1FOWA 5D5UB 2DA5A 1DGWY 3JTGA 2HNHA 5CQGA 4FTHA 1WWXA 2DA7A 1W0TA 1BM9A 2WB1N 4BXUA 1TZLA 5C3EJ 4LOCA 2YU9J 2BZTA 1MBJA 3PL8A 1KU3A 4IQJA 1HW1A 3N4MA 1ETOA 1X2NA 4I09A 2BE5F 2ZXJA 2X4HA 4PK4A 4HSRA 2KQRA 3RDIA 3FM5A 2EA2A 1OMIA 2NOGA 4AU7A 2ESNA 1YYVA 4HA8A 1BBYA 3BLYA 2DMPA 2Z3YA 2IA2A 1OJLA 4XRSA 4XRFA 2E1MC 1S5LC 2HKXA 3JAMZ 3FKIJ 3T8RA 1W7PA 2K4JA 3LSGA 3QU3A 4XN0A 3D5LA 1XDSA 4IOAF 3HRSA 1R4NB 3VEPA 3E5UA 1JHFA 2BY0A 3NEUA 4OAZA 4KFCA 4L5JA 3DV8A 4EATA 2JZYA 3V7SA 2RVCA 3IP4B 4AIHA 2XAUA 3A4CA 1FP2A 3HSRA 4EMSA 5BMZA 1V5GA 4M6VA 1QPIA 1MSEC 3JTHA 3KIOA 1ZELA 3ABMH 1D3YA 5JLWA 3GTPJ 3G2BA 1S3JA 1V5EA 1MD0A 2H94A 1ONVA 1U5TC 1WJFA 3K9TA 1RESA 3AG4H 5K5QA 4EQQA 4G7ZF 2WV0A 1DP3A 3H5RA 3DBRB 3QPLA 2KJCA 2MSYA 4XLCA 3GTQJ 2RGVA 4AC0A 4A3CJ 4RB3C 1E3OC 3MKZA 3CMYA 1WJCA 1TT0A 3QYBA 3JRGA 3EQLF 2A5YB 5ICFA 3HUGB 2V9KA 3DLAA 2L7ZA 3ZQFA 4E7LA 2CJJA 3WODF 2G0EA 2JVGA 3S32A 5JVGF 2H27A 4QSHA 1R1UA 3DKXA 4OMZA 3O2PE 2JUGA 3CESA 2V7FA 3ASOH 3ERMA 2MG4A 1I39A 4LG3A 2KZVA 4ETSA 2GIZA 2HR3A 3AG2H 3P9KA 1ETWA 2NVTJ 1B9MA 4D5CA 3Q9SA 1H89C 3CMMA 1IDZA 2OBPA 2I8DA 3AG1H 4M73A 4IHWA 4Y52J 2NOJB 3ZQQA 2LH9A 3QP5A 3E6CC 5LEJA 4UNOA 2XAHA 5HS9A 4A0ZA 1P92A 1YLFA 2Z5UA 3PIOF 1JXSA 1AA7A 4XK4A 4E7SA 1FPQA 1OCOH 2K85A 5GPAA 3R0AA 3R4KA 1T33A 4P9FA 1J2XA 3VB2A 4Z6YA 3T8TA 3MZ8A 3M9AA 3ZN1A 3A01B 2P7VB 5L3CA 4EJOA 1MW7A 2CV1A 1P2FA 3I56I 1D5YA 4XSZF 1X3UA 3M8JA 1OFCX 1UJ8A 3TGNA 3LSHA 4BY7J 5LGTA 2ISZA 3QAHA 2IRFG 4YRVA 3S1RJ 1VQOI 1ITYA 1LQ1A 3HG9A 3DKWA 2JN6A 4O5VA 2EFOA 4FETA 2O61A 1LEBA 1ZR4A 4YFNF 2A6TA 3MQ0A 5D4RA 4E6KG 3CP8A 4UVAA 3RYRA 1BIAA 5FJ8J 3W6KB 5IOYA 4LLNA 3EUKL 4KICA 2DOEA 2P8TA 3K0LA 5B3SH 2RKHA 5C44J 2EIJH 3A0HC 2CUEA 4BHBA 2UWMA 1PP7U 5CJ9A 3WTTC 2RNJA 3OR1C 3QYEA 2QKLB 2WB1A 1UMQA 3L1PA 4XSXF 3LOCA 3DPUA 3FXUA 1JUSA 1LKXA 2CGPA 3S2HJ 4LB6B 2RDPA 2R7QA 3TBIA 1IRFA 3G4SI 3CF5F 5FGMA 4G7HF 1U9OA 1IAWA 2XAJA 2Y9YA 5B66C 1EH8A 2O7OA 4UXNA 1VQPI 1ZG1A 4ZH4F 4IOCF 2W1OA 1XTAA 3BR1A 3HM5A 1U3EM 4CCJA 2M3AA 1C0WA 3HPHA 3DBHB 3KE2A 2DPDA 2R92J 4CYDA 1F36A 1LEAA 4KIBA 4J19A 3Q5FA 2Y0MA 1QZZA 4C9YA 5L3BA 1U78A 3WTXC 3FXLA 3CMEI 4BQQA 2ICWG 2GQQA 1Y39A 2F48A 1CF7A 1SD4A 2QKMB 1R71A 4A3EJ 1TNSA 1IG7A 1KYZA 2K9QA 1RR7A 3CCJI 1IJWC 3O8GA 1JTYA 3BJAA 3FXKA 3PNVA 1WJEA 3CJQB 3G73A 2ZFWA 1RUNA 2IW5A 2R7ZJ 1QZEA 1V54H 4BY1J 5E20A 1X3ZB 2KIMA 4JYKA 4FX4A 1S7EA 1AU7A 2FQ3A 3MD2A 4RLQA 1X1AA 4FISA 4WCGA 1IXSB 1XGNA 2E35A 3H36A 2DLLA 2NS0A 2JJ7A 5L3GA 1JJ6C 2OJED 4L5EA 4XM3A 1BJAA 2QCOA 5J4VA 1K79A 6PAXA 4ESBA 3IAS2 1HBXG 2M45A 1QZYA 2F6CA 2WWYA 4P5OA 2XAFA 4FE7A 2CMPA 1FIAA 2KHMA 2LFBA 3AKZA 1V4RA 4XMYA 3K6GA 4BEHB 2F4IA 2QLZA 4I99C 1UG2A 2LTPA 1J75A 2L7FP 3FK6A 5HLHA 3GWZA 3KYCB 3OIPA 2VONA 2VJIA 5JLXA 4II2A 1VQ6I 2K7LA 2M9HA 2XGEA 3OR2C 3ZRGA 2VBXA 1Y6IA 3F3XA 3CZ6A 1RC9A 3VWBA 4P96A 2ETHA 3SEZA 1B72A 1HDDC 1JUPA 2JVHA 2XGXA 3DPTA 1SANA 3OL4A 1MDMB 3ZMTA 1FSHA 4ENNA 3T1BA 3CO6C 1O3TA 2JUCA 1TQMA 3U9GA 2W25A 2I10A 1K78A 3SHFA 3MMYB 5E18F 4AWXB 5D5VB 2FA5A 4KDPA 1XSXA 4RGRA 1FMWA 3OIOA 2E5ZA 3HOSA 1VQ7I 4CCOA 5IP9J 1WI3A 3GYHX 1D1CA 2IT0A 1IN8A 1E3HA 3SQNA 2H8RA 1MZBA 4NC8A 4A69C 5FD6A 4HLYA 4L18B 2LBFA 2CV2A 1ORKA 3JR9A 1JKOC 1FSEA 2K4BA 3R60A 2Y30A 4IVNA 2DT7B 1RRJA 3FWEA 2FBHA 2BGCA 2CV0A 4EV0A 3LL7A 4BE2A 1ACIA 2DODA 3CCUI 4YEJA 1W5SA 1Y56A 3Q9VA 1X1BA 5ILSA 3T0YA 1ZN2A 5CVJA 2DBBA 4J00A 3IWFA 1HKQA 2OV7A 3HBLA 5FRNA 3OMYA 1J0RA 2IGMA 3JRIA 3PJRA 4H0EA 5HS7A 5EDNA 4DZJA 3DKYA 1M1EB 2ZO4A 2QSGX 1Z3YA 3CMAI 2E2IJ 1TQIA 2GA1A 2JT1A 3ZMZA 2PLYA 4IKFA 3X2QH 3QRFF 4RGSA 4HV5A 2NVXJ 4DYQA 1LVAA 1XN7A 3GCMA 2FBKA 4HNVA 5K7ZA 2OCEA 2Z1DA 4F55A 3KPHA 1F43A 3AAFA 5E8IA 4DJAA 3WTWC 2E60A 1HLVA 2Q2EA 2FRHA 3ZMDA 3PIPF 2IP2A 1YOVB 3IAM2 2L9SA 3FXRA 1IF1A 2L9NA 1YHQI 1OCZH 2EILH 2P5LC 2WA0A 2CU7A 1MH3A 3EUHA 2ZJPF 4HNUA 1UHMA 3E5XA 3IH3A 2Z9OA 3F6VA 1NTCA 3LMMA 2WAQA 5IP7J 4CZZA 5CVUA 4XIDA 2ID3A 4ZYAA 4X6AJ 2DA3A 3R61A 1IGNA 2NXNB 3LFKA 1VQ4I 2GXGA 5DEQA 3RZOJ 4A3FJ 3RQIA 4P9UA 4BKXA 1LDDA 1OCRH 4QTRA 3P7NA 1PUFA 2HEOA 4NUBA 4YIRX 3S3OA 1I27A 2L01A 3C3WA 1QQIA 2CYYA 3H5NA 3PNYA 4XOTA 2VT3A 5ILVA 3PFIA 1Y0UA 4DYRA 3I59B 2AXLA 4IL6C 2FOWA 4NBQA 2BHZA 2P5VA 3OOPA 2UV1A 1O7FA 2QZ8A 3DWLE 3K1PA 3FISA 2A3SA 2D45A 1G3TA 2X1EA 2XIGA 5F04A 1FZPB 2MA3A 2VBYA 3QPSA 5F6FA 4G6QA 1DGRM 3DFGA 4ESFA 3HHGA 1BI0A 2OPTA 2ADUA 2L54A 2ISYA 4G6TB 2CW0F 4XICA 4ABZA 5LBQA 3J80K 4I02A 1MJ9A 3LNQA 1R22A 2AQEA 1B4AA 4F52A 3BR5A 1Z05A 3GBGA 3WTSC 4LLLA 1WKMA 1OR7A 5A2QK 3OYJA 5EEHA 3DTEA 4R8HA 3BWGA 2WAFA 2D1HA 3PQKA 2E1NA 2HQAA 2UXXA 3GTJJ 2AO9A 3M07A 1LVKA 3M8FA 5E3OA 2EH3A 1TWHJ 2B63J 1JJ8C 4MFEA 1G59A 2PN6A 2X1DA 4HEA2 3WG9A 2VT2A 1USTA 5FLVA 5ICEA 5FLXK 4HYEA 4HBLA 2R7UA 5J4YA 1YW7A 4MEXF 2ZKZA 4XKCA 1AWCA 4HDVA 4XNFA 3RKQA 2OA4A 2L5QA 2P4WA 2M4KA 2VASA 2R7OA 5D6FA 1YTYA 4L5IA 1VQ8I 3AL0B 1XC5A 5DUIA 2HOSA 2E7WA 1ZAOA 2BY1A 1JE8A 1RR8C 3GMEA 4IPAA 3S93A 3SZTA 1LDJA 3F8FA 3S8PA 4ZZLA 4AIKA 1VTNC 4IQ4A 4XORA 4A3BJ 2DN0A 3H5AA 2DQRA 3HOTA 4BXFA 1S8NA 2O8KA 1T6SA 3CUQA 3MAJA 2Y75A 2XPWA 2P81A 5LRSA 2ZJQF 1GT0C 1KU2A 4UB6C 3BZCA 2EV0A 1B1BA 4PZJA 2GLOA 1Z7LA 3BG7A 2DOFA 4CSWA 2P0WA 5IOZA 2CFOA 1JI8A 5K5RA 4KUMA 5BQTA 3K70C 2X48A 4I7HA 4CCKA 4BHCA 3GZNB 1I1SA 1IW7F 1SAUA 2XVCA 4RLFA 4II3A 2YS9A 2RREA 1H88C 3QU6A 1DP7P 5DUKA 4WXHA 2L7MP 1YX3A 4PGHA 2AS5F 2F4MB 3AFHA 1HCRA 3I4MJ 1JHHA 3CC2I 1SVOA 4MQVA 4BS9A 2EWNA 2LG4A 2TCTA 2D1VA 3P9CA 1OR7C 4MO7A 2VIXA 2ZXIA 4BE1A 1BN5A 1FX7A 2M5WA 3HTUA 3COAC 2L4MA 2DO7A 2VLAA 5FKKA 2ELJA 4RS8A 3K2ZA 5F64A 3PM1A 3CCLI 4E7KA 3IHUA 2ZJ2A 4OAYA 1HXDA 4IZZA 3ZGKA 3V42A 4XRSG 3RCOA 2HGCA 4TV7A 3JCUC 3KP3A 1YO5C 4BGDA 2BXYA 5DTDA 5LHGA 3LA3A 4S04A 2F5FA 1R6RA 2XGDA 3BG3A 1OKRA 5HDGA 2XAQA 1I3AA 1O57A 1QU3A 4EGZA 3ECHA 2CQXA 1YRNA 2HVRA 3GTOJ 4I98B 4AYBA 3S14J 4HQEA 2RV8A 1QGPA 5HODA 4XLPF 3RSNA 2HOAA 4D9JA 4J01A 2M7BA 1TWFJ 5EG0B 3OYKA 1IV8A 1SFEA 1SVLA 1Z67A 1IN5A 3BG5A 3H3UA 1PJRA 2P6SA 5LFAA 3MKYB 4HF2A 3TDZC 1ZKGA 2E19A 4G94A 1UHSA 2YR2A 3IKTA 4HV6A 4E70A 4HX4A 1TQPA 3BROA 1VI0A 4ZTFA 3PO2J 1K7AA 3BPVA 3OIQA 2KDZA 3JRDA 3GO5A 4HZFA 3L2WA 1X1CA 2CG4A 2PI0A 2NVUB 1BL0A 1MBHA 4RA2A 2NNNA 2JPCA 3MN2A 4A3GJ 1H8AC 2K9SA 4RB2C 1A31A 3HSFA 4F7ZA 1YIJI 2LP0A 2JA2A 4DYCA 2KJBA 1HW5A 5FD5A 3F22A 2EFNA 3RKWA 5LLQA 2O5RA 1O3SA 2JK3A 1A5JA 2F5VA 3I0TA 1SAXA 2DA2A 1BIBA 3RPUA 1W7PD 2CW8A 3HRTA 5JHFA 3WHCA 3GTKJ 1LDKB 2JSCA 1ZHFA 1A35A 2M7AA 4FASD 1BW5A 2DYRH 3H3VK 2IS1A 2CW7A 2PMHA 2HYJA 3QP6A 4JQFA 1R9TJ 1SD7A 3SZGA 4Q48A 1T98A 2R5ZB 4B43A 3CCQI 3PNTA 3PQJA 2IA0A 2X0LA 5H6RA 3D5RC 1K6YA 1G3SA 1XCBA 3GX4X 1APLC 3HC7A 4BDYA 3HUGA 1FBSA 1USSA 1Z9CA 1X3WB 5HDNA 1ZRFA 4CCNA 3LQRA 5J6XA 1KZHA 2RC4A 2IAIA 3LSPA 1JT0A 2NS8A 2VKHA 4NQWB 4YELA 2KP6A 4RB0A 4OIRF 2GM4A 5J8FA 2V1DA 3W2AA 1WH5A 2DI3A 1I6XA 5GAEJ 2ZFUA 4YFKF 4ANJA 1D1AA 1E17A 1U6GA 1FY7A 5L3EA 3F8MA 3PUFA 2L0KA 1OCCH 1MMSA 2YSRA 4PJ0C 3H3ZA 2VBZA 3ZQLA 1FEXA 2WADA 1SFOJ 1QVTA 2ELHA 5ED4A 1BR2A 2WAEA 1DDNA 3WE2A 3LAPA 2Y9ZA 3DF8A 2AQFA 2OQGA 3HOUJ 1OQYA 3BP8A 2JA5J 4FX0A 4UVBA 3A01A 2OD5A 2R5YB 3RPQA 2BVMA 2K9MA 3WTZA 3L9FA 2HYGD 2QUFA 2VN2A 1SMYF 2PJPA 1Z0XA 2PEXA 4U7BA 1WI9A 3RKXA 5HDKA 4M6XA 4XLHA 2COBA 4XLAA 1WJDA 2CQ7A 2EV5A 4DBQA 1R5ID 3W2VA 5HLTA 2V1UA 4RAZA 1ZGWA 2WY8Q 2H6CA 3OYFA 3ABLH 2ZJRF 3E3VA 1LFBA 4B47A 1YJ9I 1Z91A 3IV5A 3OYHA 4I76A 3KLOA 4KA4A 2RQQA 5B5EC 5HS8A 3ECOA 1IN4A 2HZTA 1S29A 2CO5A 2LDUA 2M8EA 1XB4A 4C2UA 5LRRA 4ZYGA 1OYIA 4CICA 1XPXA 2R4GA 5D6EA 1S9HA 3IUOA 3TP0A 1W4MA 3FHZA 5F0CA 2DJIA 5ICCA 5E3MA 2VC0A 2CH0A 1TWAJ 1HQCA 2DMQA 4XN3A 1P7IA 1TW2A 4G8XA 4KMUX 5DV5A 1WPKA 3CDHA 4GDFA 4PFPA 2ZXHA 3JRBA 3V8KA 2K86A 4A3IJ 2R7VA 4PFOA 2DA4A 2YX7A 3V8JA 2PG4A 3OYDA 3TL4X 4RB1A 2JA7J 1U9NA 1G2HA 2E5NA 3OS1A 3E97A 3MFKA 1IN7A 3BZ6A 4WXCA 3G1OA 5B1BH 3KCCA 2KDOA 1MMAA 3OOUA 3KEOA 2HDDA 5HVQC 4JOMA 5BOXA 3CUOA 3BCAA 2VPLA 1R36A 3GFJA 5H2FC 2HPMA 4EVIA 4DOZA 3WE3A 3OWTA 4LG0B 2KKOA 4UV9A 3SFIA 4PJLA 1ZARA 3N97A 1T56A 2EJRA 3E1SA 4XRMA 3M1EA 3FXQA 3H0GJ 4A2UA 3HKZA 1MMNA 3BDDA 3QPHA 4CCLA 2CFXA 2FNPA 4E4HA 4HDUA 4U0VA 2XC7A 5AIPA 4PUSA 2NNYA 2CQKA 1GVJA 3BOQA 4F3QA 1JUMA 2ZSHB 4MLOA 4ZJZA 1T8IA 4D5FA 4BACA 1QO0D 2P7CB 4N4NB 4MTEA 3CC7I 4BEHA 3GUDA 5K5OA 4EM1A 3CJNA 1Y0NA 2XGCA 1GXQA 2W24A 4QIWN 3U2RA 2V9VA 3HGYA 5CKTA 1BA5A 1Z77A 2ZXWH 3NWTA 1QBJA 1OCTC 4ZDPA 1ETKA 2WAQN 3BR0A 3K1NA 1CGPA 3O3KA 3CCEI 2DYSH 3BQZA 4XKWA 4B3AA 2K02A 2KIQA 3PFYA 1MDMA 1ETYA 1D0YA 1QNTA 2LLKA 4G12A 4DBRA 4L0ZB 3G6EI 3SYTA 2MABA 3DEEA 2NVQJ 4XL9A 2ZMEA 3PO3J 4Y3OA 1W0UA 5KVRA 2DFEA 1B59A 1P4XA 4ZYDA 1HKSA 3M1CA 3MZYA 5IYCJ 2DMTA 2XDVA 4A3LJ 2BV6A 1TP4A 3KP2A 3M7GA 4B48A 1BI3A 4P1WA 4V2FA 5DDGA 3FMRA 2O8XA 2JTVA 5HNFA 3ABTA 2EINH 4A0YA 2X6XA 4G6DA 5H20A 5E1WA 1SD5A 1T0FA 4KMFA 2F4OB 1XSVA 1E3PA 5JHUA 4YG2F 2R7RA 3BTLA 3H9GA 4IRIA 2DT5A 3B02A 2VC1A 3U1DA 3ISPA 4BQAA 5DCFA 1AOYA 1IZ1A 2IJLA 2QWWA 1BI2A 4PDKA 2DA6A 3FHNA 4JX6A 4RAFA 4DQ2A 2ESHA 3NAUA 2FNAA 3IL2A 2VI6A 3ZCOA 1IO2A 1BC8C 4UHTA 1LUJB 2A68F 2K9NA 5D4SA 4QWQA 4RDUA 2H1LA 1S7OA 4XQFA 3CCRI 2M34A 2K3PA 4X1EA 3J81K 3LQQA 4QPOA 2M0MA 5F27A 1JTXA 2ECBA 5DCMB 3I5UA 5DD4A 4EM2A 3OS0A 3ERED 4AIDA 2HQNA 4A6DA 1PP8F 2DFFA 4OIPF 3ZOBA 2FSWA 1R7JA 5J1UA 3H0DA 2STWA 2R3SA 4KN4X 2QQBA 3DLLF 4BHPA 2DK5A 3WTUC 5IT9K 4CHUA 4N4OB 1JKQC 4EM0B 1MJAA 2ZMEC 4M6YA 1ZLKA 3WU1B 1E2XA 2CRGA 3W3CA 1A36A 4IRGA 2JRTA 5ILUA 4M3BA 1QVUA 4MFDA 5FLMJ 3CQZJ 1K6OA 3CJTB 1EKEA 3M3YJ 5IYBJ 4XLFA 2GIVA 2W7NA 3FZVA 2DAOA 1V5FA 1QHHD 2V1XA 2E1CA 4C2TA 4WX9A 3KZIC 4HF0A 4L0YB 4A3DJ 2FU4A 1BOBA 3QQAA 2OTJI 5F0HA 2KZGA 1X4PA 1T0FC 5IPAA 3O6BB 2GOMA 3GTMJ 3TW7A 2PX9A 1R5HA 4LJZF 4QPQA 5GPCA 3BZKA 3LSIA 1FJLA 2H1KA 4UUTA 3U1KA 2Q8KA 4DIQA 5J1RA 3I59A 1D5VA 1RZ4A 4EEFG 4BH9A 1FWZA 2A5WA 4ZTJA 1MBFA 4PJNA 2LNBA 4B3XA 2BXZA 3PSIA 2C6YA 2VQHA 1KYWA 1F4KA 4OU0A 5F0FA 4ASNA 5C4XJ 4E7IA 4Y13A 2J5OA 2IS6A 4UUSB 1E0EA 2GWRA 2QEXI 1GVDA 5F1JA 3BY6A 3RZDJ 4XR6A 1WRJA 5CVVA 3VYRB 4BU2A 3EYIA 4W97A 3TW6A 3MKLA 2N8GA 1ETXA 4FT8A 4I2OA 1Z6TA 4RM2A 3GXOA 3LSTA 1FMVA 2V6CA 3HXLA 4CCMA 1NK3P 2RN7A 3SZPA 3TO7A 4LIVA 3K70D 4JK1X 2VE8A 3C18A 3SDBA 1MMGA 1VQLI 2JA6J 5IP6A 1B8IB 2P5KA 2MD0A 3DXJF 4R1HA 3NWSA 1K83J 4L9NA 3CCMI 1UELB 1V55H 4JX4A 2O3FA 4N9IA 3J7AO 2NS7A 4AYBN 4BJ6C 1BJZA 4FCYA 2B9SA 4MGRA 1YFHA 4RBOA 3I9V2 2K9LA 3HEFA 4B09A 4MQ9F 4ZYEA 5GAGJ 1IXRC 2E2JJ 2R7DA 2QM3A 1IC8A 1AHDP 4AIJA 1PUEE 5CVRA 1N77A 2UXNA 1G3WA 4IEJA 3D5SC 3LFUA 3FBIB 4U87A 3HIFA 4BAYA 3L2CA 2DXIA 4B4CA 2KLOA 3VSKA 1FYLA 1LJ9A 2R7TA 4MTDA 4CXFA 3OS2A 4IHTA 1O3QA 1MNEA 4F92B 3FF5A 3F21A 3D0SA 1HF0A 2LVSA 2OZ6A 3I54A 3EUAA 3FBNB 1L3LA 3OYBA 4UV8A 4KISA 2OQRA 3IC7A 4S0HB 1UB9A 5J8CA 2Z16A 2CUJA 1WJAA 4AVZA 1ZLJA 4D7MA 1WVRA 2VKVA 3A1YA 2XROA 4F91B 1XG1A 5DYMA 3JRAA 3GF2A 1XGMA 2ZB9A 5E3NA 4PJJA 4PGGA 3EUHC 4LGWA 1R5GA 1WJBA 1OISA 4Y17A 1TT5B 3BG9A 3WGGA 4HSTA 3OYEA 1MMDA 1Z3XA 1ENHA 2LKXA 3GVAA 1H9GA 4LMYA 2BY3A 3K4MA 1Q1HA 5DM7F 3JSPA 1I50J 2Z2SB 3FXJA 1P4AA 2VQCA 4HPQA 1T08B 3CD6I 1ZG3A 1ERDA 2E34A 1X1DA 5E17F 2G7HA 1D0ZA 3MEXA 1ZG5A 5BS6A 3OYLA 1JKPC 2R7SA 3DTKA 3JAMK 3S2DJ 2HVQA 1DPUA 5DM6F 3S17J 1V3FA 3FX3A 1VQ9I 3SXYA 5FO5A 5D8LB 2K3FA 1ON2A 1RKWA 2GXAA 2E2HJ 1XCVA 1REPC 3UNGC 3WHBA 3RYPA 3TOAA 2E7XA 1KA8A 2O03A 3BPXA 3E6MA 4MIMA 2W4SA 1XGOA 2FD5A 3F8NA 2GA2A 2EZIA 3P9IA 4U88A 5KAFC 2V6EA 1TWGJ 2DK8A 2QSFX 2Z99A 3LSMA 4L9JA 3HDDA 5FFZA 2FX0A 3K4KA 3EDPA 2QBYB 5ICGA 2DDBA 1YS6A 1HC8A 2EZKA 2ZCWA 2MD5A 1XMKA 2Y2ZA 5EG0A 4KYWA 2VKDA 3DTIA 3VODA 2A6EF 3B6AA 2XRLA 3WTVC 1B6AA 2EIMH 3F8CA 1JKRC 1K4TA 4IF4A 3ELKA 5TRDA 2FF4A 1FOYA 3OL3A 1O4XA 1XS9A 2EFPA 5JI6A 3ESWB 4XBFA 2LYCA 1N25A 1N75A 2IEKA 3OYCA 5IT3A 3JREA 4A3JJ 3KYLA 3A2KA 4ZDLA 1RPWA 3HPGA 1QHGA 2MH9A 4IX7A 1OPCA 3NQOA 3S1QJ 4BJTA 2EQRA 3E5QA 3DEUA 4FE4A 1IDYA 3Q0VA 4C3IJ 5E8GA 2TRTA 4OOIA 3T5XA 3BR2A 2RAEA 5TISC 3B6CA 1Y1VJ 5DS9A 3IRRA 2ME0A 1ZK8A 3K4JA 3I53A 4I01A 2EFWA 4EJWA 1UAAA 3HSEA 1R49A 1J09A 1VQ5I 5KAIC 2FOKA 4M74A 1T38A 3C7JA 4L9TA 2Y0SA 1SEUA 4KT5C 4EJVA 4GXOA 4WXDA 2MBFA 3QPTA 3CUQC 1RKTA 2PJRB 4M3FA 2EBIA 5K7HA 2X85A 3D1NI 1LNWA 4B1RA 2XF5A 3NRVA 4R79A 3G1LA 3N05A 4U0YA 2DDAA 1KGSA 2EV6A 1ULYA 1ZYRF 2KT0A 2PFBA 4B44A 4CYCB 3GLXA 1HW2A 1L0OC 2JSPA 2IVMA 3ZQCA 4K2EA 1TNTA 2DT6A 4ZDOA 3WGIA 2FUG2 1FNNA 2A05A 2B0LA 2ID6A 3HOWJ 3RPUD 2DA1A 2DTRA 2R5ZA 2IBDA 3FDYA 1BI1A 1BOAA 2JWTA 3ZMVA 4B8XA 2QA4I 2STTA 4AM3A 4ENKA 2LY2A
chains in the Genus database with same CATH topology
1FYMA 3GFIA 1FT9A 5F1RA 2MC3A 2CWEA 4UUVA 4NB5A 5LHIA 1ZH5A 3ABUA 1TLHB 3MZHA 3J80Z 4EGYA 1UCRA 4OINF 3GZ6A 2YX4A 5A2QZ 1H9TA 4Q47A 3RIRA 3TOBA 4AVPA 2EFQA 3KP5A 4HLXA 4OIOF 1FC3A 3RJPA 4A12A 2FEZA 5AONA 5FLXZ 4QLCU 1EH6A 1QPMA 3KZZA 4HX7A 1U5TB 1XSDA 4CO8A 5EEGA 2L3DA 2LF7A 4AD9A 1G3YA 4P55A 2ZBKA 2VXZA 2PQ8A 2XUBA 2PMUA 1J7KA 2Q0OA 2YU3A 3V7RA 2HQRA 1BC7C 1S7AA 2VBWA 2FMLA 5BPDA 2HWVA 4WWCA 3L7WA 3F72A 1RI7A 2QYOA 3R6SA 1MKMA 4ZYHA 1SFXA 1YG2A 4RAYA 5HLIA 1J9IA 4YIFA 4Y15A 1G4DA 3DPLC 4M71A 3ML6A 3I71A 2P6TA 1EH7A 3IKVA 3KZYA 2F5CA 3ROUA 4EJTA 2A07F 1F9NA 4A5MA 2V79A 1W7PB 4GO1A 3EETA 3C1DA 1O7LA 4M9XA 1T2KA 1R23A 1T39A 1KU7A 5L3FA 1W5TA 5HLGA 4Q5SF 2HDCA 4I0AA 2HKOA 3B73A 4HX8A 2IPQX 4LG0A 2G9WA 2XRNA 5D5WB 5LGUA 2QVOA 3H92A 1ZRDA 5FB2A 3HYIA 3ZPLA 1EV7A 2A69F 2ZNYA 1OYYA 2ACJA 2KRFA 4RGXA 2FBIA 3JSOA 4FHTA 3RI4A 1IN6A 4MHGA 2L4AA 3FM3A 2D2WA 1Z6RA 1H0MA 1STZA 2NRAC 3TKYA 1R1TA 3I4PA 5E1XA 3LA2A 3WGHA 2VODA 2W84A 2QQAA 3F8BA 1RUOA 1KQ0A 4ESJA 3VOEA 1IUYA 3S2WA 2M1BA 1G6NA 1IXCA 3ZMSA 1DPRA 3WU0A 2NAZA 4HW0A 4O6JA 2O6GE 3REOA 2QQ9A 1DUXC 1XMAA 4PCQA 2XKPA 2BYVE 1UHWA 4Z2YA 4G7OF 4U0WA 4DNCA 3OV8A 5CVIA 5L3DA 3CO7C 2J5PA 1RIOH 3BJOA 4S05A 1SMTA 3FMQA 3GFLA 3G3ZA 5DCMA 4Q4ZF 3QOPA 1Z7UA 2F5EA 4IRHA 3TQNA 3IWZA 4BYYA 3KP7A 4HQMA 5KK1A 2GZWA 1CF7B 4M9ZA 3DQVC 1HKTA 3ZN0A 2DU9A 2MLKA 5CLSA 1P4WA 3KP6A 3K1MA 1XGSA 4ENJA 4HOBA 4IJAA 2ZMEB 3HHHA 5DD8A 5JVTA 2FE3A 2F5DA 4GCVA 4MNUA 1FOKA 2VOPA 4CDGA 2DPUA 4M9SA 4KIFA 1ZGJA 2M87A 1ZGAA 2H6BA 4I0BA 2NYXA 1FBUA 3L00A 1U2WA 3F6OA 2FMYA 3I58A 2CSOA 4HAMA 4GGGA 3W6JB 1Z1DA 3MCZA 2F2EA 3R0JA 1ZREA 1K78B 1D8JA 4ENMA 1U8RA 2Z33A 4EJUA 1WQ2A 1YIOA 4CGZA 2DQLA 1NHAA 1WSUA 1R00A 2WTEA 4O3MA 3LAJA 4A0XA 1TBXA 4IXAA 5K1YA 1SD6A 2MLGA 1GXPA 1OYWA 4KNYA 3EYYA 4OIQF 3SFZA 1D8KA 1IRGA 2KIUA 2GXBA 3GEZA 4A6EA 2O0YA 3GFMA 1FP1D 3GZ5A 3DP7A 2A61A 1TTYA 4GYIA 1FLIA 1SFUA 3E6DA 1PDNC 4LLGF 1ZRCA 2DFIA 2HOEA 4UVCA 2IA1A 5LGNA 3IRQA 2XKOA 5ERIA 2GAUA 1FYKA 3HRMA 1R1VA 1UFMA 4LD5A 4LFUA 3KLNA 1XD7A 5AIQA 2VOOA 2L02A 2QBYA 2VE9A 4N0BA 5CYVA 2UZKA 3RKYA 3ZQ7A 4LB5A 5JFRA 4KIGA 2EA4A 3MWMA 4M72A 3V7CA 4RGUA 4G9YA 2RQPA 2HFHA 2R7FA 2H09A 3FMSA 3J81Z 1B9NA 3TO6A 4ZZDA 3BJ6A 2M30A 2YPRA 1MJBA 2W57A 2W85A 4BNCA 1J5YA 2WC2A 1I1GA 2K27A 1F5TA 3F23A 3I64A 5JR3A 2OZUA 4YIIA 2JPBA 5IT9Z 2PBIA 1YQAA 3E6BA 4WK8F 4LK0F 5TJJA 1HSJA 3TDUC 2HYFA 1RNLA 1LB2A 3KFWX 2FXAA 4A5NA 1F1ZA 3CTAA 2XHKA 3ZP5A 1J59A 3CLOA 1I5ZA 4OMYA 4KN7X 2BEOA 4N9HA 3KP4A 3ULQB 2DW4A 4XLNF 1R58A 5H6QA 1KU9A 1HSTA 4JBAA 4HF1A 4WF2A 3CUQB 3GW2A 2XASA 5BPIA 3JW4A 4U7DA 1YS7A 4IHSA 4L9VA 2LKPA 2LSOA 5E1ZB 2EK5A 3V8LA 3TO9A 2A6HF 2HTSA 2XV4S 1YW8A 2OU2A 1A04A 5D8KB 3ZMUA 1ODDA 1MGTA 3M8EA 2XAGA 4MEYF 2G7UA 5HOOA 2LF8A 5LEKA 1FBQA 3LA7A 2QENA 2ZNZA 2Y48A 3KEQA 1P6RA 2KIFA 1YW9A 5FFXA 4D0PA 1S6LA 4ON0A 2TDXA 1ON1A 3RTRA 3HRUA 1TW3A 3HTSB 3K69A 1U5TA 3V4GA 1KQ9A 3L09A 4NQWA 3VFZA 2MH2A 1XDUA 1KQ8A 1JGSA 2EB7A 5D5XB 4GYGA 1O3RA 1GHCA 4YFXF 2COMA 5LHHA 2HS5A 3KETA 2OAZA 4LK1F 2BBYA 3WTYC 4NHJA 2HTJA 3LWFA 5D5UB 3JTGA 1WWXA 1BM9A 4BXUA 1KU3A 1HW1A 3N4MA 4I09A 2BE5F 2ZXJA 2X4HA 3RDIA 3FM5A 2EA2A 1OMIA 2ESNA 1YYVA 4HA8A 1BBYA 2Z3YA 2IA2A 4XRFA 2HKXA 3JAMZ 3T8RA 1W7PA 2K4JA 3QU3A 3D5LA 1XDSA 3HRSA 3VEPA 3E5UA 1JHFA 3NEUA 4KFCA 4L5JA 3DV8A 2JZYA 3V7SA 2RVCA 4AIHA 1FP2A 3HSRA 4EMSA 5BMZA 3JTHA 1D3YA 1S3JA 1MD0A 2H94A 1ONVA 1U5TC 3K9TA 5K5QA 4EQQA 4G7ZF 2WV0A 2KJCA 2RGVA 4RB3C 3EQLF 2A5YB 5ICFA 3WODF 2H27A 1R1UA 4OMZA 3O2PE 4ETSA 2HR3A 3P9KA 1B9MA 3Q9SA 2OBPA 4M73A 3QP5A 4UNOA 3E6CC 5LEJA 2XAHA 5HS9A 4A0ZA 1P92A 1YLFA 2Z5UA 1JXSA 1FPQA 3R0AA 3R4KA 4P9FA 1J2XA 3VB2A 3T8TA 3M9AA 3ZN1A 2P7VB 5L3CA 4EJOA 1P2FA 4XSZF 1X3UA 3TGNA 5LGTA 2ISZA 3QAHA 2IRFG 1LQ1A 3DKWA 4O5VA 2EFOA 2O61A 1LEBA 4YFNF 3MQ0A 5D4RA 4UVAA 3RYRA 1BIAA 3W6KB 4LLNA 4KICA 2P8TA 3K0LA 2RKHA 4BHBA 2UWMA 1PP7U 5CJ9A 3WTTC 2RNJA 4XSXF 3FXUA 2CGPA 4LB6B 2RDPA 1IRFA 5FGMA 4G7HF 1IAWA 2XAJA 1EH8A 4UXNA 1ZG1A 4ZH4F 1U3EM 1C0WA 3KE2A 2DPDA 4CYDA 1LEAA 4KIBA 3Q5FA 2Y0MA 1QZZA 5L3BA 1U78A 3WTXC 2GQQA 1CF7A 1SD4A 1TNSA 1KYZA 3BJAA 1RUNA 3G73A 2ZFWA 2IW5A 5E20A 2KIMA 4FX4A 2FQ3A 4WCGA 1IXSB 1XGNA 2DLLA 2NS0A 5L3GA 6PAXA 1K79A 1BJAA 4ESBA 1HBXG 2M45A 1QZYA 2WWYA 4P5OA 2XAFA 1V4RA 2QLZA 1J75A 5HLHA 3GWZA 2VONA 2K7LA 2VBXA 3F3XA 4P96A 2ETHA 2XGXA 3DPTA 1MDMB 3ZMTA 1FSHA 4ENNA 3T1BA 3CO6C 1O3TA 1TQMA 3U9GA 2W25A 1K78A 3SHFA 5E18F 4AWXB 5D5VB 2FA5A 4KDPA 1XSXA 4RGRA 3HOSA 3GYHX 2IT0A 1IN8A 3SQNA 1MZBA 5FD6A 4HLYA 4L18B 1FSEA 2K4BA 3R60A 4IVNA 3FWEA 2FBHA 2BGCA 4EV0A 1W5SA 3Q9VA 5ILSA 3T0YA 1ZN2A 5CVJA 2DBBA 3IWFA 1HKQA 1J0RA 4H0EA 5HS7A 2ZO4A 1TQIA 2GA1A 2JT1A 3ZMZA 2PLYA 3QRFF 4RGSA 4HV5A 1LVAA 1XN7A 2FBKA 3AAFA 5E8IA 3WTWC 2Q2EA 2FRHA 3ZMDA 2IP2A 3FXRA 1IF1A 2P5LC 3EUHA 1UHMA 3E5XA 2Z9OA 3F6VA 4CZZA 5CVUA 3R61A 3LFKA 2GXGA 5DEQA 4P9UA 1LDDA 3P7NA 2HEOA 1I27A 2L01A 3C3WA 1QQIA 2CYYA 2VT3A 5ILVA 3PFIA 1Y0UA 3I59B 2AXLA 2P5VA 3OOPA 1O7FA 2QZ8A 3K1PA 2A3SA 2D45A 1G3TA 2XIGA 1FZPB 2MA3A 2VBYA 5F6FA 4G6QA 3DFGA 4ESFA 3HHGA 1BI0A 2ADUA 2L54A 2ISYA 2CW0F 5LBQA 3J80K 4I02A 1MJ9A 1R22A 1B4AA 1Z05A 3WTSC 4LLLA 1WKMA 1OR7A 5A2QK 5EEHA 4R8HA 3BWGA 3PQKA 2D1HA 2E1NA 2UXXA 3M8FA 2PN6A 3WG9A 2VT2A 1USTA 5ICEA 5FLXK 4HYEA 4HBLA 1YW7A 4MEXF 2ZKZA 1AWCA 4HDVA 2OA4A 2P4WA 1YTYA 5D6FA 4L5IA 5DUIA 2E7WA 1ZAOA 1JE8A 4IPAA 3SZTA 1LDJA 3F8FA 4ZZLA 4AIKA 1VTNC 2DQRA 3HOTA 1S8NA 1T6SA 3CUQA 3MAJA 2Y75A 5LRSA 1KU2A 2EV0A 1B1BA 4PZJA 5K5RA 4KUMA 5BQTA 4I7HA 4BHCA 1I1SA 1IW7F 2XVCA 3QU6A 1DP7P 5DUKA 4WXHA 4PGHA 2AS5F 1JHHA 4MQVA 2EWNA 3P9CA 2D1VA 1BN5A 1FX7A 2M5WA 3HTUA 3COAC 2L4MA 2DO7A 4RS8A 3K2ZA 5F64A 3IHUA 2ZJ2A 1HXDA 2HGCA 4TV7A 3KP3A 1YO5C 5LHGA 3LA3A 4S04A 2F5FA 1OKRA 5HDGA 2XAQA 1O57A 4EGZA 3ECHA 4I98B 4HQEA 2RV8A 1QGPA 4XLPF 1SFEA 1IN5A 3H3UA 2P6SA 4HF2A 3TDZC 4G94A 2YR2A 3IKTA 4HV6A 4E70A 4HX4A 1TQPA 3BROA 1K7AA 3BPVA 3GO5A 4HZFA 2CG4A 2PI0A 2NNNA 2JPCA 4RB2C 3HSFA 4F7ZA 2KJBA 1HW5A 5FD5A 3F22A 2EFNA 3RKWA 5LLQA 1O3SA 3I0TA 1SAXA 3RPUA 1BIBA 1W7PD 3HRTA 1LDKB 2JSCA 1ZHFA 2PMHA 3QP6A 4JQFA 1SD7A 4Q48A 1T98A 3PQJA 2IA0A 2X0LA 5H6RA 1G3SA 1XCBA 3GX4X 3HUGA 1FBSA 1USSA 1Z9CA 5HDNA 1ZRFA 3LQRA 5J6XA 2RC4A 4RB0A 4OIRF 5J8FA 2V1DA 2DI3A 1I6XA 4YFKF 1E17A 1U6GA 1FY7A 5L3EA 3F8MA 2YSRA 3H3ZA 2VBZA 2ELHA 5ED4A 1DDNA 3WE2A 3LAPA 3DF8A 2OQGA 3BP8A 4FX0A 4UVBA 2OD5A 3RPQA 3WTZA 3L9FA 2HYGD 2QUFA 2VN2A 1SMYF 2PJPA 2PEXA 4U7BA 1WI9A 3RKXA 5HDKA 4M6XA 2EV5A 2V1UA 4RAZA 2H6CA 3E3VA 1Z91A 3KLOA 4KA4A 5HS8A 3ECOA 1IN4A 2HZTA 1S29A 2CO5A 2LDUA 2M8EA 1XB4A 5LRRA 4ZYGA 1OYIA 4CICA 5D6EA 1W4MA 3FHZA 5ICCA 2VC0A 1HQCA 1TW2A 4G8XA 4KMUX 5DV5A 3CDHA 3V8KA 2K86A 2YX7A 3V8JA 2PG4A 4RB1A 3E97A 3MFKA 1IN7A 3BZ6A 4WXCA 3KCCA 3KEOA 5HVQC 5BOXA 3CUOA 1R36A 3GFJA 4EVIA 3WE3A 4LG0B 2KKOA 4UV9A 1ZARA 3N97A 2EJRA 3M1EA 3FXQA 4A2UA 3BDDA 3QPHA 2CFXA 2FNPA 4HDUA 4U0VA 5AIPA 2NNYA 2CQKA 1GVJA 3BOQA 1QO0D 2P7CB 4MTEA 3GUDA 5K5OA 4EM1A 3CJNA 1GXQA 2W24A 3U2RA 2V9VA 1QBJA 3K1NA 1CGPA 3O3KA 2K02A 1MDMA 4L0ZB 1QNTA 2ZMEA 5KVRA 1B59A 1P4XA 4ZYDA 1HKSA 3MZYA 2BV6A 3KP2A 3M7GA 1BI3A 5DDGA 3FMRA 2O8XA 2JTVA 3ABTA 4A0YA 4G6DA 5H20A 5E1WA 1SD5A 1T0FA 4KMFA 1XSVA 5JHUA 4YG2F 4IRIA 2DT5A 3B02A 2VC1A 3U1DA 3ISPA 4BQAA 5DCFA 1AOYA 1IZ1A 2IJLA 2QWWA 1BI2A 4PDKA 4DQ2A 2ESHA 2FNAA 3IL2A 1BC8C 4UHTA 2A68F 5D4SA 4QWQA 1S7OA 3J81K 3LQQA 5DCMB 3I5UA 5DD4A 4EM2A 3ERED 2HQNA 4A6DA 1PP8F 4OIPF 2FSWA 1R7JA 2STWA 2R3SA 4KN4X 2QQBA 4BHPA 2DK5A 3WTUC 5IT9K 4CHUA 4EM0B 1MJAA 4M6YA 1ZLKA 3WU1B 1E2XA 4IRGA 2JRTA 5ILUA 1K6OA 2GIVA 3FZVA 2DAOA 2V1XA 2E1CA 4WX9A 4HF0A 4L0YB 2FU4A 3O6BB 4LJZF 1R5HA 2Q8KA 3I59A 1D5VA 1RZ4A 4BH9A 1FWZA 2LNBA 2C6YA 1F4KA 1KYWA 4OU0A 4ASNA 4Y13A 2J5OA 2GWRA 3BY6A 1WRJA 5CVVA 3EYIA 4FT8A 4I2OA 1Z6TA 3GXOA 3LSTA 2V6CA 2RN7A 3SZPA 3TO7A 4JK1X 2VE8A 3C18A 2P5KA 3DXJF 4R1HA 4L9NA 2O3FA 4N9IA 3J7AO 4MGRA 1YFHA 4B09A 4MQ9F 4ZYEA 1IXRC 2R7DA 2QM3A 4AIJA 1PUEE 5CVRA 2UXNA 1G3WA 3HIFA 4BAYA 3L2CA 1FYLA 1LJ9A 4MTDA 4CXFA 4IHTA 1O3QA 3FF5A 3F21A 3D0SA 2OZ6A 3I54A 1L3LA 4UV8A 2OQRA 3IC7A 1UB9A 5J8CA 1ZLJA 2XROA 5DYMA 3GF2A 1XGMA 4PGGA 4LGWA 1R5GA 4Y17A 3WGGA 3GVAA 1H9GA 4LMYA 1Q1HA 3JSPA 1P4AA 1ZG3A 5E17F 2G7HA 3MEXA 1ZG5A 5BS6A 3JAMK 1DPUA 1V3FA 3FX3A 3SXYA 5FO5A 5D8LB 1ON2A 1XCVA 1REPC 3RYPA 3TOAA 2E7XA 1KA8A 2O03A 3BPXA 3E6MA 3F8NA 1XGOA 4U88A 2GA2A 3P9IA 2DK8A 2Z99A 4L9JA 5FFZA 3EDPA 2QBYB 5ICGA 1YS6A 2ZCWA 2MD5A 1XMKA 4KYWA 3VODA 2A6EF 3WTVC 1B6AA 3F8CA 4IF4A 3ELKA 5TRDA 2FF4A 2EFPA 5JI6A 4XBFA 5IT3A 2MH9A 1OPCA 3NQOA 3E5QA 3DEUA 5E8GA 4OOIA 3T5XA 3IRRA 3I53A 4I01A 2EFWA 4EJWA 3HSEA 2FOKA 4M74A 1T38A 3C7JA 4L9TA 4KT5C 4EJVA 4GXOA 4WXDA 2MBFA 3QPTA 3CUQC 1LNWA 3NRVA 4R79A 4U0YA 2EV6A 1KGSA 1ULYA 1ZYRF 2PFBA 3GLXA 1HW2A 1L0OC 2IVMA 4K2EA 1TNTA 3WGIA 1FNNA 2B0LA 2DTRA 3ZMVA 2STTA 1BI1A 1BOAA 4B8XA 4ENKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYM A;  3GFI A;  1FT9 A;  5F1R A;  2MC3 A;  2CWE A;  4UUV A;  4NB5 A;  5LHI A;  1ZH5 A;  3ABU A;  1TLH B;  3MZH A;  3J80 Z;  4EGY A;  1UCR A;  4OIN F;  3GZ6 A;  2YX4 A;  5A2Q Z;  1H9T A;  4Q47 A;  3RIR A;  3TOB A;  4AVP A;  2EFQ A;  3KP5 A;  4HLX A;  4OIO F;  1FC3 A;  3RJP A;  4A12 A;  2FEZ A;  5AON A;  5FLX Z;  4QLC U;  1EH6 A;  1QPM A;  3KZZ A;  4HX7 A;  1U5T B;  1XSD A;  4CO8 A;  5EEG A;  2L3D A;  2LF7 A;  4AD9 A;  1G3Y A;  4P55 A;  2ZBK A;  2VXZ A;  2PQ8 A;  2XUB A;  2PMU A;  1J7K A;  2Q0O A;  2YU3 A;  3V7R A;  2HQR A;  1BC7 C;  1S7A A;  2VBW A;  2FML A;  5BPD A;  2HWV A;  4WWC A;  3L7W A;  3F72 A;  1RI7 A;  2QYO A;  3R6S A;  1MKM A;  4ZYH A;  1SFX A;  1YG2 A;  4RAY A;  5HLI A;  1J9I A;  4YIF A;  4Y15 A;  1G4D A;  3DPL C;  4M71 A;  3ML6 A;  3I71 A;  2P6T A;  1EH7 A;  3IKV A;  3KZY A;  2F5C A;  3ROU A;  4EJT A;  2A07 F;  1F9N A;  4A5M A;  2V79 A;  1W7P B;  4GO1 A;  3EET A;  3C1D A;  1O7L A;  4M9X A;  1T2K A;  1R23 A;  1T39 A;  1KU7 A;  5L3F A;  1W5T A;  5HLG A;  4Q5S F;  2HDC A;  4I0A A;  2HKO A;  3B73 A;  4HX8 A;  2IPQ X;  4LG0 A;  2G9W A;  2XRN A;  5D5W B;  5LGU A;  2QVO A;  3H92 A;  1ZRD A;  5FB2 A;  3HYI A;  3ZPL A;  1EV7 A;  2A69 F;  2ZNY A;  1OYY A;  2ACJ A;  2KRF A;  4RGX A;  2FBI A;  3JSO A;  4FHT A;  3RI4 A;  1IN6 A;  4MHG A;  2L4A A;  3FM3 A;  2D2W A;  1Z6R A;  1H0M A;  1STZ A;  2NRA C;  3TKY A;  1R1T A;  3I4P A;  5E1X A;  3LA2 A;  3WGH A;  2VOD A;  2W84 A;  2QQA A;  3F8B A;  1RUO A;  1KQ0 A;  4ESJ A;  3VOE A;  1IUY A;  3S2W A;  2M1B A;  1G6N A;  1IXC A;  3ZMS A;  1DPR A;  3WU0 A;  2NAZ A;  4HW0 A;  4O6J A;  2O6G E;  3REO A;  2QQ9 A;  1DUX C;  1XMA A;  4PCQ A;  2XKP A;  2BYV E;  1UHW A;  4Z2Y A;  4G7O F;  4U0W A;  4DNC A;  3OV8 A;  5CVI A;  5L3D A;  3CO7 C;  2J5P A;  1RIO H;  3BJO A;  4S05 A;  1SMT A;  3FMQ A;  3GFL A;  3G3Z A;  5DCM A;  4Q4Z F;  3QOP A;  1Z7U A;  2F5E A;  4IRH A;  3TQN A;  3IWZ A;  4BYY A;  3KP7 A;  4HQM A;  5KK1 A;  2GZW A;  1CF7 B;  4M9Z A;  3DQV C;  1HKT A;  3ZN0 A;  2DU9 A;  2MLK A;  5CLS A;  1P4W A;  3KP6 A;  3K1M A;  1XGS A;  4ENJ A;  4HOB A;  4IJA A;  2ZME B;  3HHH A;  5DD8 A;  5JVT A;  2FE3 A;  2F5D A;  4GCV A;  4MNU A;  1FOK A;  2VOP A;  4CDG A;  2DPU A;  4M9S A;  4KIF A;  1ZGJ A;  2M87 A;  1ZGA A;  2H6B A;  4I0B A;  2NYX A;  1FBU A;  3L00 A;  1U2W A;  3F6O A;  2FMY A;  3I58 A;  2CSO A;  4HAM A;  4GGG A;  3W6J B;  1Z1D A;  3MCZ A;  2F2E A;  3R0J A;  1ZRE A;  1K78 B;  1D8J A;  4ENM A;  1U8R A;  2Z33 A;  4EJU A;  1WQ2 A;  1YIO A;  4CGZ A;  2DQL A;  1NHA A;  1WSU A;  1R00 A;  2WTE A;  4O3M A;  3LAJ A;  4A0X A;  1TBX A;  4IXA A;  5K1Y A;  1SD6 A;  2MLG A;  1GXP A;  1OYW A;  4KNY A;  3EYY A;  4OIQ F;  3SFZ A;  1D8K A;  1IRG A;  2KIU A;  2GXB A;  3GEZ A;  4A6E A;  2O0Y A;  3GFM A;  1FP1 D;  3GZ5 A;  3DP7 A;  2A61 A;  1TTY A;  4GYI A;  1FLI A;  1SFU A;  3E6D A;  1PDN C;  4LLG F;  1ZRC A;  2DFI A;  2HOE A;  4UVC A;  2IA1 A;  5LGN A;  3IRQ A;  2XKO A;  5ERI A;  2GAU A;  1FYK A;  3HRM A;  1R1V A;  1UFM A;  4LD5 A;  4LFU A;  3KLN A;  1XD7 A;  5AIQ A;  2VOO A;  2L02 A;  2QBY A;  2VE9 A;  4N0B A;  5CYV A;  2UZK A;  3RKY A;  3ZQ7 A;  4LB5 A;  5JFR A;  4KIG A;  2EA4 A;  3MWM A;  4M72 A;  3V7C A;  4RGU A;  4G9Y A;  2RQP A;  2HFH A;  2R7F A;  2H09 A;  3FMS A;  3J81 Z;  1B9N A;  3TO6 A;  4ZZD A;  3BJ6 A;  2M30 A;  2YPR A;  1MJB A;  2W57 A;  2W85 A;  4BNC A;  1J5Y A;  2WC2 A;  1I1G A;  2K27 A;  1F5T A;  3F23 A;  3I64 A;  5JR3 A;  2OZU A;  4YII A;  2JPB A;  5IT9 Z;  2PBI A;  1YQA A;  3E6B A;  4WK8 F;  4LK0 F;  5TJJ A;  1HSJ A;  3TDU C;  2HYF A;  1RNL A;  1LB2 A;  3KFW X;  2FXA A;  4A5N A;  1F1Z A;  3CTA A;  2XHK A;  3ZP5 A;  1J59 A;  3CLO A;  1I5Z A;  4OMY A;  4KN7 X;  2BEO A;  4N9H A;  3KP4 A;  3ULQ B;  2DW4 A;  4XLN F;  1R58 A;  5H6Q A;  1KU9 A;  1HST A;  4JBA A;  4HF1 A;  4WF2 A;  3CUQ B;  3GW2 A;  2XAS A;  5BPI A;  3JW4 A;  4U7D A;  1YS7 A;  4IHS A;  4L9V A;  2LKP A;  2LSO A;  5E1Z B;  2EK5 A;  3V8L A;  3TO9 A;  2A6H F;  2HTS A;  2XV4 S;  1YW8 A;  2OU2 A;  1A04 A;  5D8K B;  3ZMU A;  1ODD A;  1MGT A;  3M8E A;  2XAG A;  4MEY F;  2G7U A;  5HOO A;  2LF8 A;  5LEK A;  1FBQ A;  3LA7 A;  2QEN A;  2ZNZ A;  2Y48 A;  3KEQ A;  1P6R A;  2KIF A;  1YW9 A;  5FFX A;  4D0P A;  1S6L A;  4ON0 A;  2TDX A;  1ON1 A;  3RTR A;  3HRU A;  1TW3 A;  3HTS B;  3K69 A;  1U5T A;  3V4G A;  1KQ9 A;  3L09 A;  4NQW A;  3VFZ A;  2MH2 A;  1XDU A;  1KQ8 A;  1JGS A;  2EB7 A;  5D5X B;  4GYG A;  1O3R A;  1GHC A;  4YFX F;  2COM A;  5LHH A;  2HS5 A;  3KET A;  2OAZ A;  4LK1 F;  2BBY A;  3WTY C;  4NHJ A;  2HTJ A;  3LWF A;  5D5U B;  3JTG A;  1WWX A;  1BM9 A;  4BXU A;  1KU3 A;  1HW1 A;  3N4M A;  4I09 A;  2BE5 F;  2ZXJ A;  2X4H A;  3RDI A;  3FM5 A;  2EA2 A;  1OMI A;  2ESN A;  1YYV A;  4HA8 A;  1BBY A;  2Z3Y A;  2IA2 A;  4XRF A;  2HKX A;  3JAM Z;  3T8R A;  1W7P A;  2K4J A;  3QU3 A;  3D5L A;  1XDS A;  3HRS A;  3VEP A;  3E5U A;  1JHF A;  3NEU A;  4KFC A;  4L5J A;  3DV8 A;  2JZY A;  3V7S A;  2RVC A;  4AIH A;  1FP2 A;  3HSR A;  4EMS A;  5BMZ A;  3JTH A;  1D3Y A;  1S3J A;  1MD0 A;  2H94 A;  1ONV A;  1U5T C;  3K9T A;  5K5Q A;  4EQQ A;  4G7Z F;  2WV0 A;  2KJC A;  2RGV A;  4RB3 C;  3EQL F;  2A5Y B;  5ICF A;  3WOD F;  2H27 A;  1R1U A;  4OMZ A;  3O2P E;  4ETS A;  2HR3 A;  3P9K A;  1B9M A;  3Q9S A;  2OBP A;  4M73 A;  3QP5 A;  4UNO A;  3E6C C;  5LEJ A;  2XAH A;  5HS9 A;  4A0Z A;  1P92 A;  1YLF A;  2Z5U A;  1JXS A;  1FPQ A;  3R0A A;  3R4K A;  4P9F A;  1J2X A;  3VB2 A;  3T8T A;  3M9A A;  3ZN1 A;  2P7V B;  5L3C A;  4EJO A;  1P2F A;  4XSZ F;  1X3U A;  3TGN A;  5LGT A;  2ISZ A;  3QAH A;  2IRF G;  1LQ1 A;  3DKW A;  4O5V A;  2EFO A;  2O61 A;  1LEB A;  4YFN F;  3MQ0 A;  5D4R A;  4UVA A;  3RYR A;  1BIA A;  3W6K B;  4LLN A;  4KIC A;  2P8T A;  3K0L A;  2RKH A;  4BHB A;  2UWM A;  1PP7 U;  5CJ9 A;  3WTT C;  2RNJ A;  4XSX F;  3FXU A;  2CGP A;  4LB6 B;  2RDP A;  1IRF A;  5FGM A;  4G7H F;  1IAW A;  2XAJ A;  1EH8 A;  4UXN A;  1ZG1 A;  4ZH4 F;  1U3E M;  1C0W A;  3KE2 A;  2DPD A;  4CYD A;  1LEA A;  4KIB A;  3Q5F A;  2Y0M A;  1QZZ A;  5L3B A;  1U78 A;  3WTX C;  2GQQ A;  1CF7 A;  1SD4 A;  1TNS A;  1KYZ A;  3BJA A;  1RUN A;  3G73 A;  2ZFW A;  2IW5 A;  5E20 A;  2KIM A;  4FX4 A;  2FQ3 A;  4WCG A;  1IXS B;  1XGN A;  2DLL A;  2NS0 A;  5L3G A;  6PAX A;  1K79 A;  1BJA A;  4ESB A;  1HBX G;  2M45 A;  1QZY A;  2WWY A;  4P5O A;  2XAF A;  1V4R A;  2QLZ A;  1J75 A;  5HLH A;  3GWZ A;  2VON A;  2K7L A;  2VBX A;  3F3X A;  4P96 A;  2ETH A;  2XGX A;  3DPT A;  1MDM B;  3ZMT A;  1FSH A;  4ENN A;  3T1B A;  3CO6 C;  1O3T A;  1TQM A;  3U9G A;  2W25 A;  1K78 A;  3SHF A;  5E18 F;  4AWX B;  5D5V B;  2FA5 A;  4KDP A;  1XSX A;  4RGR A;  3HOS A;  3GYH X;  2IT0 A;  1IN8 A;  3SQN A;  1MZB A;  5FD6 A;  4HLY A;  4L18 B;  1FSE A;  2K4B A;  3R60 A;  4IVN A;  3FWE A;  2FBH A;  2BGC A;  4EV0 A;  1W5S A;  3Q9V A;  5ILS A;  3T0Y A;  1ZN2 A;  5CVJ A;  2DBB A;  3IWF A;  1HKQ A;  1J0R A;  4H0E A;  5HS7 A;  2ZO4 A;  1TQI A;  2GA1 A;  2JT1 A;  3ZMZ A;  2PLY A;  3QRF F;  4RGS A;  4HV5 A;  1LVA A;  1XN7 A;  2FBK A;  3AAF A;  5E8I A;  3WTW C;  2Q2E A;  2FRH A;  3ZMD A;  2IP2 A;  3FXR A;  1IF1 A;  2P5L C;  3EUH A;  1UHM A;  3E5X A;  2Z9O A;  3F6V A;  4CZZ A;  5CVU A;  3R61 A;  3LFK A;  2GXG A;  5DEQ A;  4P9U A;  1LDD A;  3P7N A;  2HEO A;  1I27 A;  2L01 A;  3C3W A;  1QQI A;  2CYY A;  2VT3 A;  5ILV A;  3PFI A;  1Y0U A;  3I59 B;  2AXL A;  2P5V A;  3OOP A;  1O7F A;  2QZ8 A;  3K1P A;  2A3S A;  2D45 A;  1G3T A;  2XIG A;  1FZP B;  2MA3 A;  2VBY A;  5F6F A;  4G6Q A;  3DFG A;  4ESF A;  3HHG A;  1BI0 A;  2ADU A;  2L54 A;  2ISY A;  2CW0 F;  5LBQ A;  3J80 K;  4I02 A;  1MJ9 A;  1R22 A;  1B4A A;  1Z05 A;  3WTS C;  4LLL A;  1WKM A;  1OR7 A;  5A2Q K;  5EEH A;  4R8H A;  3BWG A;  3PQK A;  2D1H A;  2E1N A;  2UXX A;  3M8F A;  2PN6 A;  3WG9 A;  2VT2 A;  1UST A;  5ICE A;  5FLX K;  4HYE A;  4HBL A;  1YW7 A;  4MEX F;  2ZKZ A;  1AWC A;  4HDV A;  2OA4 A;  2P4W A;  1YTY A;  5D6F A;  4L5I A;  5DUI A;  2E7W A;  1ZAO A;  1JE8 A;  4IPA A;  3SZT A;  1LDJ A;  3F8F A;  4ZZL A;  4AIK A;  1VTN C;  2DQR A;  3HOT A;  1S8N A;  1T6S A;  3CUQ A;  3MAJ A;  2Y75 A;  5LRS A;  1KU2 A;  2EV0 A;  1B1B A;  4PZJ A;  5K5R A;  4KUM A;  5BQT A;  4I7H A;  4BHC A;  1I1S A;  1IW7 F;  2XVC A;  3QU6 A;  1DP7 P;  5DUK A;  4WXH A;  4PGH A;  2AS5 F;  1JHH A;  4MQV A;  2EWN A;  3P9C A;  2D1V A;  1BN5 A;  1FX7 A;  2M5W A;  3HTU A;  3COA C;  2L4M A;  2DO7 A;  4RS8 A;  3K2Z A;  5F64 A;  3IHU A;  2ZJ2 A;  1HXD A;  2HGC A;  4TV7 A;  3KP3 A;  1YO5 C;  5LHG A;  3LA3 A;  4S04 A;  2F5F A;  1OKR A;  5HDG A;  2XAQ A;  1O57 A;  4EGZ A;  3ECH A;  4I98 B;  4HQE A;  2RV8 A;  1QGP A;  4XLP F;  1SFE A;  1IN5 A;  3H3U A;  2P6S A;  4HF2 A;  3TDZ C;  4G94 A;  2YR2 A;  3IKT A;  4HV6 A;  4E70 A;  4HX4 A;  1TQP A;  3BRO A;  1K7A A;  3BPV A;  3GO5 A;  4HZF A;  2CG4 A;  2PI0 A;  2NNN A;  2JPC A;  4RB2 C;  3HSF A;  4F7Z A;  2KJB A;  1HW5 A;  5FD5 A;  3F22 A;  2EFN A;  3RKW A;  5LLQ A;  1O3S A;  3I0T A;  1SAX A;  3RPU A;  1BIB A;  1W7P D;  3HRT A;  1LDK B;  2JSC A;  1ZHF A;  2PMH A;  3QP6 A;  4JQF A;  1SD7 A;  4Q48 A;  1T98 A;  3PQJ A;  2IA0 A;  2X0L A;  5H6R A;  1G3S A;  1XCB A;  3GX4 X;  3HUG A;  1FBS A;  1USS A;  1Z9C A;  5HDN A;  1ZRF A;  3LQR A;  5J6X A;  2RC4 A;  4RB0 A;  4OIR F;  5J8F A;  2V1D A;  2DI3 A;  1I6X A;  4YFK F;  1E17 A;  1U6G A;  1FY7 A;  5L3E A;  3F8M A;  2YSR A;  3H3Z A;  2VBZ A;  2ELH A;  5ED4 A;  1DDN A;  3WE2 A;  3LAP A;  3DF8 A;  2OQG A;  3BP8 A;  4FX0 A;  4UVB A;  2OD5 A;  3RPQ A;  3WTZ A;  3L9F A;  2HYG D;  2QUF A;  2VN2 A;  1SMY F;  2PJP A;  2PEX A;  4U7B A;  1WI9 A;  3RKX A;  5HDK A;  4M6X A;  2EV5 A;  2V1U A;  4RAZ A;  2H6C A;  3E3V A;  1Z91 A;  3KLO A;  4KA4 A;  5HS8 A;  3ECO A;  1IN4 A;  2HZT A;  1S29 A;  2CO5 A;  2LDU A;  2M8E A;  1XB4 A;  5LRR A;  4ZYG A;  1OYI A;  4CIC A;  5D6E A;  1W4M A;  3FHZ A;  5ICC A;  2VC0 A;  1HQC A;  1TW2 A;  4G8X A;  4KMU X;  5DV5 A;  3CDH A;  3V8K A;  2K86 A;  2YX7 A;  3V8J A;  2PG4 A;  4RB1 A;  3E97 A;  3MFK A;  1IN7 A;  3BZ6 A;  4WXC A;  3KCC A;  3KEO A;  5HVQ C;  5BOX A;  3CUO A;  1R36 A;  3GFJ A;  4EVI A;  3WE3 A;  4LG0 B;  2KKO A;  4UV9 A;  1ZAR A;  3N97 A;  2EJR A;  3M1E A;  3FXQ A;  4A2U A;  3BDD A;  3QPH A;  2CFX A;  2FNP A;  4HDU A;  4U0V A;  5AIP A;  2NNY A;  2CQK A;  1GVJ A;  3BOQ A;  1QO0 D;  2P7C B;  4MTE A;  3GUD A;  5K5O A;  4EM1 A;  3CJN A;  1GXQ A;  2W24 A;  3U2R A;  2V9V A;  1QBJ A;  3K1N A;  1CGP A;  3O3K A;  2K02 A;  1MDM A;  4L0Z B;  1QNT A;  2ZME A;  5KVR A;  1B59 A;  1P4X A;  4ZYD A;  1HKS A;  3MZY A;  2BV6 A;  3KP2 A;  3M7G A;  1BI3 A;  5DDG A;  3FMR A;  2O8X A;  2JTV A;  3ABT A;  4A0Y A;  4G6D A;  5H20 A;  5E1W A;  1SD5 A;  1T0F A;  4KMF A;  1XSV A;  5JHU A;  4YG2 F;  4IRI A;  2DT5 A;  3B02 A;  2VC1 A;  3U1D A;  3ISP A;  4BQA A;  5DCF A;  1AOY A;  1IZ1 A;  2IJL A;  2QWW A;  1BI2 A;  4PDK A;  4DQ2 A;  2ESH A;  2FNA A;  3IL2 A;  1BC8 C;  4UHT A;  2A68 F;  5D4S A;  4QWQ A;  1S7O A;  3J81 K;  3LQQ A;  5DCM B;  3I5U A;  5DD4 A;  4EM2 A;  3ERE D;  2HQN A;  4A6D A;  1PP8 F;  4OIP F;  2FSW A;  1R7J A;  2STW A;  2R3S A;  4KN4 X;  2QQB A;  4BHP A;  2DK5 A;  3WTU C;  5IT9 K;  4CHU A;  4EM0 B;  1MJA A;  4M6Y A;  1ZLK A;  3WU1 B;  1E2X A;  4IRG A;  2JRT A;  5ILU A;  1K6O A;  2GIV A;  3FZV A;  2DAO A;  2V1X A;  2E1C A;  4WX9 A;  4HF0 A;  4L0Y B;  2FU4 A;  3O6B B;  4LJZ F;  1R5H A;  2Q8K A;  3I59 A;  1D5V A;  1RZ4 A;  4BH9 A;  1FWZ A;  2LNB A;  2C6Y A;  1F4K A;  1KYW A;  4OU0 A;  4ASN A;  4Y13 A;  2J5O A;  2GWR A;  3BY6 A;  1WRJ A;  5CVV A;  3EYI A;  4FT8 A;  4I2O A;  1Z6T A;  3GXO A;  3LST A;  2V6C A;  2RN7 A;  3SZP A;  3TO7 A;  4JK1 X;  2VE8 A;  3C18 A;  2P5K A;  3DXJ F;  4R1H A;  4L9N A;  2O3F A;  4N9I A;  3J7A O;  4MGR A;  1YFH A;  4B09 A;  4MQ9 F;  4ZYE A;  1IXR C;  2R7D A;  2QM3 A;  4AIJ A;  1PUE E;  5CVR A;  2UXN A;  1G3W A;  3HIF A;  4BAY A;  3L2C A;  1FYL A;  1LJ9 A;  4MTD A;  4CXF A;  4IHT A;  1O3Q A;  3FF5 A;  3F21 A;  3D0S A;  2OZ6 A;  3I54 A;  1L3L A;  4UV8 A;  2OQR A;  3IC7 A;  1UB9 A;  5J8C A;  1ZLJ A;  2XRO A;  5DYM A;  3GF2 A;  1XGM A;  4PGG A;  4LGW A;  1R5G A;  4Y17 A;  3WGG A;  3GVA A;  1H9G A;  4LMY A;  1Q1H A;  3JSP A;  1P4A A;  1ZG3 A;  5E17 F;  2G7H A;  3MEX A;  1ZG5 A;  5BS6 A;  3JAM K;  1DPU A;  1V3F A;  3FX3 A;  3SXY A;  5FO5 A;  5D8L B;  1ON2 A;  1XCV A;  1REP C;  3RYP A;  3TOA A;  2E7X A;  1KA8 A;  2O03 A;  3BPX A;  3E6M A;  3F8N A;  1XGO A;  4U88 A;  2GA2 A;  3P9I A;  2DK8 A;  2Z99 A;  4L9J A;  5FFZ A;  3EDP A;  2QBY B;  5ICG A;  1YS6 A;  2ZCW A;  2MD5 A;  1XMK A;  4KYW A;  3VOD A;  2A6E F;  3WTV C;  1B6A A;  3F8C A;  4IF4 A;  3ELK A;  5TRD A;  2FF4 A;  2EFP A;  5JI6 A;  4XBF A;  5IT3 A;  2MH9 A;  1OPC A;  3NQO A;  3E5Q A;  3DEU A;  5E8G A;  4OOI A;  3T5X A;  3IRR A;  3I53 A;  4I01 A;  2EFW A;  4EJW A;  3HSE A;  2FOK A;  4M74 A;  1T38 A;  3C7J A;  4L9T A;  4KT5 C;  4EJV A;  4GXO A;  4WXD A;  2MBF A;  3QPT A;  3CUQ C;  1LNW A;  3NRV A;  4R79 A;  4U0Y A;  2EV6 A;  1KGS A;  1ULY A;  1ZYR F;  2PFB A;  3GLX A;  1HW2 A;  1L0O C;  2IVM A;  4K2E A;  1TNT A;  3WGI A;  1FNN A;  2B0L A;  2DTR A;  3ZMV A;  2STT A;  1BI1 A;  1BOA A;  4B8X A;  4ENK A; 
#chains in the Genus database with same CATH topology
 3J7Y J;  5EYR A;  1FYM A;  3GFI A;  1FT9 A;  5F1R A;  2MC3 A;  1ZTR A;  4I6Z A;  2CWE A;  1PVE A;  1T95 A;  3C2H A;  3CDI A;  4NB5 A;  5LHI A;  5J1Y A;  3SJM A;  2D5V A;  4UUV A;  1FOX A;  3GTL J;  1FTT A;  1ZH5 A;  3ABU A;  4HRI A;  1TLH B;  1AKH B;  1MBE A;  3MZH A;  2BW3 B;  2M0C A;  3J80 Z;  4EGY A;  1UCR A;  4HG2 A;  4OIN F;  2X6Y A;  3GZ6 A;  2E1M B;  2YX4 A;  5A2Q Z;  1H9T A;  4Q47 A;  2CS3 A;  2JRM A;  3RIR A;  3TOB A;  3JRF A;  1MIJ A;  3OYI A;  4AVP A;  2EFQ A;  3KP5 A;  4HNT A;  1GDT A;  4FQG A;  3ONQ A;  4HLX A;  2R7W A;  4OIO F;  3HKZ N;  1OLT A;  1FC3 A;  3RJP A;  1JT6 A;  4A12 A;  4XOP A;  3M4O J;  3CCV I;  2FEZ A;  2DFH A;  4Y4R A;  5AON A;  2WBM A;  1SC7 A;  5FLX Z;  2K40 A;  5EJC A;  4QLC U;  4IHX A;  1EH6 A;  4NC7 A;  1QPM A;  3KZZ A;  1TL8 A;  2Q1Z B;  4HX7 A;  1U5T B;  2R5Y A;  1XSD A;  1X58 A;  5EF6 A;  1P7J A;  5EEG A;  4CO8 A;  2L3D A;  2LF7 A;  4AD9 A;  1Y8R B;  4XLE A;  1G3Y A;  4P55 A;  2ZBK A;  2VXZ A;  2PQ8 A;  2XUB A;  2O9L A;  2PMU A;  1DU6 A;  1J7K A;  5M5W J;  2Q0O A;  3FXO A;  5EGO B;  2YU3 A;  5FRO A;  3V7R A;  2HQR A;  1BC7 C;  1LE8 B;  3HZJ A;  3FK7 A;  1S7A A;  3A02 A;  2R0Q C;  3AG3 H;  2PMZ A;  3EPZ A;  2VBW A;  4AUX A;  3OSG A;  2FML A;  4C30 A;  5BPD A;  2HWV A;  2VL8 A;  3HJE A;  3JRC A;  4M3D A;  1EA3 A;  4WWC A;  2DMU A;  2M8G X;  5K7F A;  3DU5 A;  3L7W A;  3F72 A;  3H1C A;  1U0J A;  2KFD A;  1RI7 A;  2QYO A;  2VJJ A;  3CF2 A;  3R6S A;  2NVY J;  2QQ8 A;  2JQ7 A;  1MKM A;  3OYN A;  4ZYH A;  1SFX A;  1YG2 A;  4RAY A;  5HLI A;  1J9I A;  4YIF A;  1ETV A;  1EF4 A;  4Y15 A;  1G4D A;  3DPL C;  4M71 A;  3ML6 A;  5E79 C;  3I71 A;  3S3M A;  1LFP A;  1SVM A;  2P6T A;  1EH7 A;  3IKV A;  3KZY A;  2F5C A;  3ROU A;  4EJT A;  1CQT A;  4BJ5 C;  2A07 F;  1F9N A;  4A5M A;  2V79 A;  2EPF A;  5J40 A;  2XB0 X;  1W7P B;  1BR4 A;  4GO1 A;  4H4K C;  4A3K J;  3G1M A;  2BOL A;  3EET A;  1K4S A;  3C1D A;  3TP3 A;  3FXM A;  3GLL A;  1EJ9 A;  1O7L A;  2AXT C;  3QWL A;  4M9X A;  3I3L A;  1Z21 A;  1K61 A;  1R4M B;  1R23 A;  1T2K A;  3TMO A;  3GTG J;  1T39 A;  3VYS B;  1KU7 A;  2HVS A;  5L3F A;  1W5T A;  1SFK A;  5HLG A;  3FIW A;  9ANT A;  4Q5S F;  1A6I A;  2RNG A;  4I0A A;  2HDC A;  2HKO A;  3B73 A;  4HX8 A;  2IGO A;  3CP2 A;  2IPQ X;  2Y69 H;  3F0C A;  4LG0 A;  4GRI A;  1W36 C;  2G9W A;  2XRN A;  5IYD J;  5D5W B;  1NG6 A;  5LGU A;  2QVO A;  3H92 A;  1D0X A;  2R93 J;  2KPM A;  1JGG A;  5GTI C;  1ZRD A;  4OWR B;  5FB2 A;  3A0B C;  2H8W A;  3HYI A;  3HL2 A;  1PYV A;  1WGX A;  1GV2 A;  3ZPL A;  1EV7 A;  2A69 F;  2ZNY A;  5EZH A;  5FKO A;  1OYY A;  2ACJ A;  4BXX J;  3IH4 A;  5CQE A;  4A3M J;  3G71 I;  2LY9 A;  2KRF A;  3LSJ A;  1TC3 C;  4RGX A;  2KRC A;  3BC8 A;  1VND A;  2FBI A;  2LD5 A;  3JSO A;  4FHT A;  3RI4 A;  1IN6 A;  4MHG A;  2L4A A;  3FM3 A;  2D2W A;  2VQL A;  1Z6R A;  3LSK A;  1H0M A;  1STZ A;  3J7A Y;  2NRA C;  3I55 I;  3TKY A;  2LK2 A;  1NG7 A;  1R1T A;  3I4P A;  5E1X A;  3E0J B;  3LA2 A;  2ME6 A;  2KMU A;  4PSW A;  1TWC J;  3ZR8 X;  3WGH A;  2XSJ C;  1FTZ A;  2V1N A;  2VJ4 A;  4Y7N J;  2VOD A;  1QRY A;  2W84 A;  2QQA A;  3F8B A;  1RUO A;  3E7L A;  1KQ0 A;  4ESJ A;  3VOE A;  2XF6 A;  1IUY A;  3S2W A;  2M1B A;  3K4B A;  1G6N A;  5EEA A;  1IXC A;  3ZMS A;  5KHD A;  3A03 A;  1IV6 A;  1DPR A;  1VQM I;  3WU0 A;  1POG A;  2NAZ A;  4HW0 A;  2LC2 A;  4O6J A;  5M5X J;  2O6G E;  3REO A;  2VPR A;  1LFU P;  4CUG A;  2QQ9 A;  1G8X A;  4X0G A;  1WCM J;  3Q0W A;  1DUX C;  2M4G A;  1XMA A;  4PCQ A;  2XKP A;  2BYV E;  1UHW A;  2L7K A;  3ASN H;  4Z2Y A;  4G7O F;  4U0W A;  4DNC A;  3OV8 A;  1OCP A;  5CVI A;  5L3D A;  3CO7 C;  2IGN A;  2J5P A;  1RIO H;  3I4N J;  5GTH C;  3BJO A;  4F93 B;  4W1U A;  4S05 A;  1SMT A;  5FRM A;  1HOM A;  2V26 A;  3L2R A;  3SEQ A;  4D7N A;  2QGU A;  3FMQ A;  1NK2 P;  2HXO A;  4LIU A;  3L2U A;  3ZXS A;  3HOZ J;  1MNM C;  3GFL A;  1IRZ A;  3G3Z A;  5DCM A;  3UKG A;  3DBL B;  4Q4Z F;  1UZC A;  3KYD B;  2GBY A;  4UY8 I;  3QOP A;  1Z7U A;  3BTC A;  2X9D A;  2F5E A;  4IRH A;  4ITV A;  3CCS I;  2HQ5 A;  2ECC A;  3TQN A;  2L9R A;  3IWZ A;  4BYY A;  3Q0U A;  3KP7 A;  4HQM A;  5KK1 A;  2GZW A;  1CF7 B;  1Y8Q B;  4M9Z A;  3DQV C;  1N78 A;  2HI3 A;  3K4N A;  1HKT A;  3ZN0 A;  1MBK A;  4NNJ A;  2ZC2 A;  2EZL A;  3CLQ A;  2DU9 A;  2BVL A;  2MLK A;  2Y31 A;  5CLS A;  4C2M J;  1P4W A;  1D1B A;  3KP6 A;  4KT6 A;  3K1M A;  4NDL A;  4DW6 A;  1XGS A;  4ENJ A;  4HOB A;  2L9V A;  1BW6 A;  5FKM A;  5B1A H;  4IJA A;  2ZME B;  3HHH A;  2XPV A;  5DD8 A;  1A6Q A;  5JVT A;  2FE3 A;  2F5D A;  3S1N J;  4GCV A;  3CC4 I;  4MNU A;  1FOK A;  2VOP A;  3MKW B;  2X6W A;  3SDG A;  4CDG A;  2DPU A;  3HGG A;  2DMN A;  4M9S A;  4BDZ A;  4KIF A;  2XF7 A;  3DU6 A;  1ZGJ A;  2M87 A;  1ZGA A;  2H6B A;  4I0B A;  2NYX A;  4PJM A;  4M3G A;  3BT9 A;  5LD2 C;  1FBU A;  3L00 A;  1U2W A;  2E71 A;  3F6O A;  2FMY A;  4GFB A;  4UUS A;  3C2G A;  3I58 A;  1MBG A;  2VUM J;  1B72 B;  2CSO A;  4E7Z A;  4HAM A;  4GGG A;  3W6J B;  2KIS A;  2LR8 A;  3K2A A;  5BNG A;  3CDL A;  1Z1D A;  3MCZ A;  1VFC A;  2F2E A;  5KNL A;  3R0J A;  3W6V A;  1WHU A;  2LOO A;  1ZRE A;  1K78 B;  1VF9 A;  1D8J A;  4ENM A;  2XPU A;  1U8R A;  4RM3 A;  2Z33 A;  4CZC A;  2V4J C;  3OYG A;  4UB8 C;  3PSF A;  1B8I A;  3QOD A;  4EJU A;  1I6H J;  1WQ2 A;  1RET A;  1YIO A;  4CGZ A;  1W1W E;  2DQL A;  3HOY J;  2MYS A;  3VYT B;  1NHA A;  3BCB A;  3DCF A;  2LBF B;  1WSU A;  2CQQ A;  1R00 A;  1YX5 A;  2WTE A;  3ZQI A;  4O3M A;  3LAJ A;  4A0X A;  3HOX J;  4BUP A;  1TBX A;  2YUS A;  4IXA A;  4Y33 A;  5K1Y A;  4NC6 A;  4IO9 F;  1SD6 A;  1MH4 A;  2MLG A;  1GXP A;  4CH7 A;  2IS4 A;  2EIK H;  1OYW A;  5J3L A;  5TGT A;  1ETQ A;  5IY5 H;  4KNY A;  2W48 A;  3EYY A;  3UR3 C;  1X19 A;  1HDP A;  1VQK I;  3SFZ A;  4OIQ F;  2HU9 A;  2MGQ A;  2VXD A;  4JX5 A;  2KL4 A;  2DOA A;  3S3N A;  1D8K A;  3H9Q A;  2K5C A;  2OC6 A;  1IRG A;  1BR1 A;  2CUZ A;  2MC4 A;  2Y0S N;  3WG7 H;  2KIU A;  3KEY A;  2QSH X;  2GXB A;  3GEZ A;  4BQN A;  1YE9 A;  4A6E A;  3QOE A;  2XSD C;  1UG0 A;  2O0Y A;  3GFM A;  2VKE A;  1FP1 D;  2UUZ A;  3L2V A;  3GZ5 A;  2Q2E B;  1Y1W J;  3DP7 A;  2HZD A;  2BY2 A;  2R7X A;  3BTI A;  4E7H A;  2A61 A;  4V2G A;  2JMW A;  2WV1 A;  1TTY A;  4GYI A;  1FLI A;  1XX5 A;  5J47 A;  4ZC3 A;  1SFU A;  3E6D A;  1PDN C;  4LLG F;  4LIT A;  1ZRC A;  1VZ0 A;  2DFI A;  2HOE A;  4UVC A;  2LKS A;  2IA1 A;  5LGN A;  2X1C A;  4V19 K;  3BR3 A;  3IRQ A;  2XKO A;  2X51 A;  5ERI A;  4RMN A;  2GAU A;  2CQN A;  1FYK A;  1NH3 A;  3HRM A;  1DQU A;  1R1V A;  4PSX A;  2LMD A;  3NAR A;  2WY7 Q;  1UFM A;  3TED A;  4LD5 A;  1PUF B;  4LFU A;  3KLN A;  4RAG A;  1XD7 A;  1GUU A;  3OYA A;  5AIQ A;  2VOO A;  2X6O A;  2L02 A;  2QBY A;  4BL0 B;  2VE9 A;  1LPQ A;  1YIT I;  4N0B A;  3J7Z I;  3QYF A;  5CYV A;  5M3F J;  2UZK A;  2QF7 A;  1WH7 A;  3RKY A;  5FKL A;  3CJR B;  3ZQ7 A;  3ABK H;  4LB5 A;  5JFR A;  2HXI A;  2GOX B;  4KIG A;  2EA4 A;  3MWM A;  4M72 A;  3V7C A;  4RGU A;  4G9Y A;  5E3L A;  2RQP A;  2HFH A;  2HDW A;  2OF7 A;  3Q3S A;  4C3J J;  1ZQ3 P;  2R7F A;  2H09 A;  2DTZ A;  3PUB A;  2I5U A;  3CCY A;  1YI2 I;  3FMS A;  3J81 Z;  1B9N A;  3TO6 A;  3VSL A;  4DGW B;  4ZZD A;  2E1O A;  3BJ6 A;  3VPR A;  2M30 A;  2YPR A;  3O8H A;  3RQ4 A;  2LY1 A;  2MW8 A;  4BQO A;  1MJB A;  2W57 A;  2BHY A;  2W85 A;  3W2W A;  1J5Y A;  4BNC A;  2WC2 A;  1I1G A;  2K27 A;  4BE0 A;  1F5T A;  1QA6 A;  3VDX A;  3F23 A;  3I64 A;  3C2B A;  5JR3 A;  2OZU A;  4YII A;  2JPB A;  5IT9 Z;  2PBI A;  1YQA A;  3E6B A;  4WK8 F;  4LK0 F;  5TJJ A;  2VQG A;  1YJW I;  1HSJ A;  4JP0 A;  3AL0 C;  3TDU C;  2EZH A;  2HYF A;  1RNL A;  1WFX A;  1LB2 A;  2PMZ N;  3KFW X;  2FXA A;  3ZQH A;  1VQN I;  4A5N A;  1F1Z A;  1GV5 A;  3BR6 A;  3CTA A;  5KCM A;  2XHK A;  4IHY A;  1P9Q C;  3ZP5 A;  2MFZ A;  3HB9 A;  1J59 A;  2PJR A;  3CLO A;  1IUF A;  4A93 J;  1I5Z A;  5GAD J;  3K4L A;  3L2Q A;  4OMY A;  4KN7 X;  3JRH A;  2B7E A;  2BEO A;  4N9H A;  3KP4 A;  3ULQ B;  3IH2 A;  4C3H J;  2DW4 A;  4XLN F;  4CYC A;  3S15 J;  5GP9 A;  2IS2 A;  1R58 A;  2W00 A;  2V9P A;  5H6Q A;  2IGK A;  1KU9 A;  2ELK A;  1HST A;  1Q1V A;  2FQ4 A;  4JBA A;  4HF1 A;  4WF2 A;  3U21 A;  3BG6 A;  3CUQ B;  3GW2 A;  2W82 A;  2XAS A;  5BPI A;  2OUM A;  1GLN A;  3JW4 A;  4U7D A;  1YS7 A;  4IHS A;  2HPI A;  1W5C C;  4L9V A;  2LKP A;  3VYU B;  1X2M A;  2LSO A;  2M2E A;  1KON A;  1U8B A;  3KX2 A;  5E1Z B;  2EK5 A;  3V8L A;  3TO9 A;  3BQY A;  2A6H F;  2HTS A;  2FJ1 A;  3K4C A;  1MND A;  3OY9 A;  2XV4 S;  1YW8 A;  3K10 A;  4BBS J;  3F9K A;  2OU2 A;  5C4J J;  2VB6 A;  1A04 A;  5D8K B;  1FIP A;  1ODD A;  4XKB A;  1MGT A;  3ZMU A;  1AKH A;  3M8E A;  3LSR A;  2XAG A;  2BW3 A;  4D1Q A;  4MEY F;  2G7U A;  3MVP A;  2ZSI B;  5HOO A;  2LF8 A;  3OSF A;  1WJ5 A;  2AHQ A;  4BBR J;  5LEK A;  1IRX A;  1FBQ A;  4DZP A;  3LA7 A;  4CA0 A;  2QEN A;  4XON A;  2OTL I;  2ZNZ A;  5CPR B;  2CUF A;  2Y48 A;  3KEQ A;  4KIT B;  3H35 A;  1ZR2 A;  1P6R A;  2KIF A;  4XKV A;  3ZQG A;  2E36 A;  3FKJ A;  2LRD A;  3BTJ A;  3WU2 C;  1WZ2 A;  1X1P A;  3H9J A;  1YW9 A;  5FFX A;  4D0P A;  2JA8 J;  1YJN I;  1S6L A;  3P5J A;  4KJZ A;  4ON0 A;  2KRH A;  1ON1 A;  2L2O A;  2TDX A;  5F08 A;  5FKN A;  3RTR A;  3S16 J;  3HRU A;  1TW3 A;  3HTS B;  2DJN A;  3K69 A;  1U5T A;  3V4G A;  1KQ9 A;  3K7A J;  3L09 A;  3DEW A;  4NQW A;  5M3M J;  3VFZ A;  2LRE A;  2MH2 A;  4IHV A;  1YRN B;  2XB5 A;  1I3Q J;  1XDU A;  1S72 I;  1HA8 A;  1KQ8 A;  4E7J A;  2DCE A;  1JGS A;  2EB7 A;  5M5Y J;  5D5X B;  4GYG A;  3HOV J;  1O3R A;  5EGO A;  1GHC A;  2VJ5 A;  1MSF C;  2OCC H;  4YFX F;  1LE8 A;  2HOT A;  1DU0 A;  2COM A;  2IXS A;  1W36 D;  5EZG A;  5LHH A;  2HS5 A;  3KET A;  2OAZ A;  3OYM A;  4LK1 F;  3S1M J;  1X4O A;  2BBY A;  3WTY C;  4NHJ A;  5HNH A;  2HTJ A;  3LWF A;  5GAH J;  1XMX A;  4M3E A;  1FOW A;  5D5U B;  2DA5 A;  1DGW Y;  3JTG A;  2HNH A;  5CQG A;  4FTH A;  1WWX A;  2DA7 A;  1W0T A;  1BM9 A;  2WB1 N;  4BXU A;  1TZL A;  5C3E J;  4LOC A;  2YU9 J;  2BZT A;  1MBJ A;  3PL8 A;  1KU3 A;  4IQJ A;  1HW1 A;  3N4M A;  1ETO A;  1X2N A;  4I09 A;  2BE5 F;  2ZXJ A;  2X4H A;  4PK4 A;  4HSR A;  2KQR A;  3RDI A;  3FM5 A;  2EA2 A;  1OMI A;  2NOG A;  4AU7 A;  2ESN A;  1YYV A;  4HA8 A;  1BBY A;  3BLY A;  2DMP A;  2Z3Y A;  2IA2 A;  1OJL A;  4XRS A;  4XRF A;  2E1M C;  1S5L C;  2HKX A;  3JAM Z;  3FKI J;  3T8R A;  1W7P A;  2K4J A;  3LSG A;  3QU3 A;  4XN0 A;  3D5L A;  1XDS A;  4IOA F;  3HRS A;  1R4N B;  3VEP A;  3E5U A;  1JHF A;  2BY0 A;  3NEU A;  4OAZ A;  4KFC A;  4L5J A;  3DV8 A;  4EAT A;  2JZY A;  3V7S A;  2RVC A;  3IP4 B;  4AIH A;  2XAU A;  3A4C A;  1FP2 A;  3HSR A;  4EMS A;  5BMZ A;  1V5G A;  4M6V A;  1QPI A;  1MSE C;  3JTH A;  3KIO A;  1ZEL A;  3ABM H;  1D3Y A;  5JLW A;  3GTP J;  3G2B A;  1S3J A;  1V5E A;  1MD0 A;  2H94 A;  1ONV A;  1U5T C;  1WJF A;  3K9T A;  1RES A;  3AG4 H;  5K5Q A;  4EQQ A;  4G7Z F;  2WV0 A;  1DP3 A;  3H5R A;  3DBR B;  3QPL A;  2KJC A;  2MSY A;  4XLC A;  3GTQ J;  2RGV A;  4AC0 A;  4A3C J;  4RB3 C;  1E3O C;  3MKZ A;  3CMY A;  1WJC A;  1TT0 A;  3QYB A;  3JRG A;  3EQL F;  2A5Y B;  5ICF A;  3HUG B;  2V9K A;  3DLA A;  2L7Z A;  3ZQF A;  4E7L A;  2CJJ A;  3WOD F;  2G0E A;  2JVG A;  3S32 A;  5JVG F;  2H27 A;  4QSH A;  1R1U A;  3DKX A;  4OMZ A;  3O2P E;  2JUG A;  3CES A;  2V7F A;  3ASO H;  3ERM A;  2MG4 A;  1I39 A;  4LG3 A;  2KZV A;  4ETS A;  2GIZ A;  2HR3 A;  3AG2 H;  3P9K A;  1ETW A;  2NVT J;  1B9M A;  4D5C A;  3Q9S A;  1H89 C;  3CMM A;  1IDZ A;  2OBP A;  2I8D A;  3AG1 H;  4M73 A;  4IHW A;  4Y52 J;  2NOJ B;  3ZQQ A;  2LH9 A;  3QP5 A;  3E6C C;  5LEJ A;  4UNO A;  2XAH A;  5HS9 A;  4A0Z A;  1P92 A;  1YLF A;  2Z5U A;  3PIO F;  1JXS A;  1AA7 A;  4XK4 A;  4E7S A;  1FPQ A;  1OCO H;  2K85 A;  5GPA A;  3R0A A;  3R4K A;  1T33 A;  4P9F A;  1J2X A;  3VB2 A;  4Z6Y A;  3T8T A;  3MZ8 A;  3M9A A;  3ZN1 A;  3A01 B;  2P7V B;  5L3C A;  4EJO A;  1MW7 A;  2CV1 A;  1P2F A;  3I56 I;  1D5Y A;  4XSZ F;  1X3U A;  3M8J A;  1OFC X;  1UJ8 A;  3TGN A;  3LSH A;  4BY7 J;  5LGT A;  2ISZ A;  3QAH A;  2IRF G;  4YRV A;  3S1R J;  1VQO I;  1ITY A;  1LQ1 A;  3HG9 A;  3DKW A;  2JN6 A;  4O5V A;  2EFO A;  4FET A;  2O61 A;  1LEB A;  1ZR4 A;  4YFN F;  2A6T A;  3MQ0 A;  5D4R A;  4E6K G;  3CP8 A;  4UVA A;  3RYR A;  1BIA A;  5FJ8 J;  3W6K B;  5IOY A;  4LLN A;  3EUK L;  4KIC A;  2DOE A;  2P8T A;  3K0L A;  5B3S H;  2RKH A;  5C44 J;  2EIJ H;  3A0H C;  2CUE A;  4BHB A;  2UWM A;  1PP7 U;  5CJ9 A;  3WTT C;  2RNJ A;  3OR1 C;  3QYE A;  2QKL B;  2WB1 A;  1UMQ A;  3L1P A;  4XSX F;  3LOC A;  3DPU A;  3FXU A;  1JUS A;  1LKX A;  2CGP A;  3S2H J;  4LB6 B;  2RDP A;  2R7Q A;  3TBI A;  1IRF A;  3G4S I;  3CF5 F;  5FGM A;  4G7H F;  1U9O A;  1IAW A;  2XAJ A;  2Y9Y A;  5B66 C;  1EH8 A;  2O7O A;  4UXN A;  1VQP I;  1ZG1 A;  4ZH4 F;  4IOC F;  2W1O A;  1XTA A;  3BR1 A;  3HM5 A;  1U3E M;  4CCJ A;  2M3A A;  1C0W A;  3HPH A;  3DBH B;  3KE2 A;  2DPD A;  2R92 J;  4CYD A;  1F36 A;  1LEA A;  4KIB A;  4J19 A;  3Q5F A;  2Y0M A;  1QZZ A;  4C9Y A;  5L3B A;  1U78 A;  3WTX C;  3FXL A;  3CME I;  4BQQ A;  2ICW G;  2GQQ A;  1Y39 A;  2F48 A;  1CF7 A;  1SD4 A;  2QKM B;  1R71 A;  4A3E J;  1TNS A;  1IG7 A;  1KYZ A;  2K9Q A;  1RR7 A;  3CCJ I;  1IJW C;  3O8G A;  1JTY A;  3BJA A;  3FXK A;  3PNV A;  1WJE A;  3CJQ B;  3G73 A;  2ZFW A;  1RUN A;  2IW5 A;  2R7Z J;  1QZE A;  1V54 H;  4BY1 J;  5E20 A;  1X3Z B;  2KIM A;  4JYK A;  4FX4 A;  1S7E A;  1AU7 A;  2FQ3 A;  3MD2 A;  4RLQ A;  1X1A A;  4FIS A;  4WCG A;  1IXS B;  1XGN A;  2E35 A;  3H36 A;  2DLL A;  2NS0 A;  2JJ7 A;  5L3G A;  1JJ6 C;  2OJE D;  4L5E A;  4XM3 A;  1BJA A;  2QCO A;  5J4V A;  1K79 A;  6PAX A;  4ESB A;  3IAS 2;  1HBX G;  2M45 A;  1QZY A;  2F6C A;  2WWY A;  4P5O A;  2XAF A;  4FE7 A;  2CMP A;  1FIA A;  2KHM A;  2LFB A;  3AKZ A;  1V4R A;  4XMY A;  3K6G A;  4BEH B;  2F4I A;  2QLZ A;  4I99 C;  1UG2 A;  2LTP A;  1J75 A;  2L7F P;  3FK6 A;  5HLH A;  3GWZ A;  3KYC B;  3OIP A;  2VON A;  2VJI A;  5JLX A;  4II2 A;  1VQ6 I;  2K7L A;  2M9H A;  2XGE A;  3OR2 C;  3ZRG A;  2VBX A;  1Y6I A;  3F3X A;  3CZ6 A;  1RC9 A;  3VWB A;  4P96 A;  2ETH A;  3SEZ A;  1B72 A;  1HDD C;  1JUP A;  2JVH A;  2XGX A;  3DPT A;  1SAN A;  3OL4 A;  1MDM B;  3ZMT A;  1FSH A;  4ENN A;  3T1B A;  3CO6 C;  1O3T A;  2JUC A;  1TQM A;  3U9G A;  2W25 A;  2I10 A;  1K78 A;  3SHF A;  3MMY B;  5E18 F;  4AWX B;  5D5V B;  2FA5 A;  4KDP A;  1XSX A;  4RGR A;  1FMW A;  3OIO A;  2E5Z A;  3HOS A;  1VQ7 I;  4CCO A;  5IP9 J;  1WI3 A;  3GYH X;  1D1C A;  2IT0 A;  1IN8 A;  1E3H A;  3SQN A;  2H8R A;  1MZB A;  4NC8 A;  4A69 C;  5FD6 A;  4HLY A;  4L18 B;  2LBF A;  2CV2 A;  1ORK A;  3JR9 A;  1JKO C;  1FSE A;  2K4B A;  3R60 A;  2Y30 A;  4IVN A;  2DT7 B;  1RRJ A;  3FWE A;  2FBH A;  2BGC A;  2CV0 A;  4EV0 A;  3LL7 A;  4BE2 A;  1ACI A;  2DOD A;  3CCU I;  4YEJ A;  1W5S A;  1Y56 A;  3Q9V A;  1X1B A;  5ILS A;  3T0Y A;  1ZN2 A;  5CVJ A;  2DBB A;  4J00 A;  3IWF A;  1HKQ A;  2OV7 A;  3HBL A;  5FRN A;  3OMY A;  1J0R A;  2IGM A;  3JRI A;  3PJR A;  4H0E A;  5HS7 A;  5EDN A;  4DZJ A;  3DKY A;  1M1E B;  2ZO4 A;  2QSG X;  1Z3Y A;  3CMA I;  2E2I J;  1TQI A;  2GA1 A;  2JT1 A;  3ZMZ A;  2PLY A;  4IKF A;  3X2Q H;  3QRF F;  4RGS A;  4HV5 A;  2NVX J;  4DYQ A;  1LVA A;  1XN7 A;  3GCM A;  2FBK A;  4HNV A;  5K7Z A;  2OCE A;  2Z1D A;  4F55 A;  3KPH A;  1F43 A;  3AAF A;  5E8I A;  4DJA A;  3WTW C;  2E60 A;  1HLV A;  2Q2E A;  2FRH A;  3ZMD A;  3PIP F;  2IP2 A;  1YOV B;  3IAM 2;  2L9S A;  3FXR A;  1IF1 A;  2L9N A;  1YHQ I;  1OCZ H;  2EIL H;  2P5L C;  2WA0 A;  2CU7 A;  1MH3 A;  3EUH A;  2ZJP F;  4HNU A;  1UHM A;  3E5X A;  3IH3 A;  2Z9O A;  3F6V A;  1NTC A;  3LMM A;  2WAQ A;  5IP7 J;  4CZZ A;  5CVU A;  4XID A;  2ID3 A;  4ZYA A;  4X6A J;  2DA3 A;  3R61 A;  1IGN A;  2NXN B;  3LFK A;  1VQ4 I;  2GXG A;  5DEQ A;  3RZO J;  4A3F J;  3RQI A;  4P9U A;  4BKX A;  1LDD A;  1OCR H;  4QTR A;  3P7N A;  1PUF A;  2HEO A;  4NUB A;  4YIR X;  3S3O A;  1I27 A;  2L01 A;  3C3W A;  1QQI A;  2CYY A;  3H5N A;  3PNY A;  4XOT A;  2VT3 A;  5ILV A;  3PFI A;  1Y0U A;  4DYR A;  3I59 B;  2AXL A;  4IL6 C;  2FOW A;  4NBQ A;  2BHZ A;  2P5V A;  3OOP A;  2UV1 A;  1O7F A;  2QZ8 A;  3DWL E;  3K1P A;  3FIS A;  2A3S A;  2D45 A;  1G3T A;  2X1E A;  2XIG A;  5F04 A;  1FZP B;  2MA3 A;  2VBY A;  3QPS A;  5F6F A;  4G6Q A;  1DGR M;  3DFG A;  4ESF A;  3HHG A;  1BI0 A;  2OPT A;  2ADU A;  2L54 A;  2ISY A;  4G6T B;  2CW0 F;  4XIC A;  4ABZ A;  5LBQ A;  3J80 K;  4I02 A;  1MJ9 A;  3LNQ A;  1R22 A;  2AQE A;  1B4A A;  4F52 A;  3BR5 A;  1Z05 A;  3GBG A;  3WTS C;  4LLL A;  1WKM A;  1OR7 A;  5A2Q K;  3OYJ A;  5EEH A;  3DTE A;  4R8H A;  3BWG A;  2WAF A;  2D1H A;  3PQK A;  2E1N A;  2HQA A;  2UXX A;  3GTJ J;  2AO9 A;  3M07 A;  1LVK A;  3M8F A;  5E3O A;  2EH3 A;  1TWH J;  2B63 J;  1JJ8 C;  4MFE A;  1G59 A;  2PN6 A;  2X1D A;  4HEA 2;  3WG9 A;  2VT2 A;  1UST A;  5FLV A;  5ICE A;  5FLX K;  4HYE A;  4HBL A;  2R7U A;  5J4Y A;  1YW7 A;  4MEX F;  2ZKZ A;  4XKC A;  1AWC A;  4HDV A;  4XNF A;  3RKQ A;  2OA4 A;  2L5Q A;  2P4W A;  2M4K A;  2VAS A;  2R7O A;  5D6F A;  1YTY A;  4L5I A;  1VQ8 I;  3AL0 B;  1XC5 A;  5DUI A;  2HOS A;  2E7W A;  1ZAO A;  2BY1 A;  1JE8 A;  1RR8 C;  3GME A;  4IPA A;  3S93 A;  3SZT A;  1LDJ A;  3F8F A;  3S8P A;  4ZZL A;  4AIK A;  1VTN C;  4IQ4 A;  4XOR A;  4A3B J;  2DN0 A;  3H5A A;  2DQR A;  3HOT A;  4BXF A;  1S8N A;  2O8K A;  1T6S A;  3CUQ A;  3MAJ A;  2Y75 A;  2XPW A;  2P81 A;  5LRS A;  2ZJQ F;  1GT0 C;  1KU2 A;  4UB6 C;  3BZC A;  2EV0 A;  1B1B A;  4PZJ A;  2GLO A;  1Z7L A;  3BG7 A;  2DOF A;  4CSW A;  2P0W A;  5IOZ A;  2CFO A;  1JI8 A;  5K5R A;  4KUM A;  5BQT A;  3K70 C;  2X48 A;  4I7H A;  4CCK A;  4BHC A;  3GZN B;  1I1S A;  1IW7 F;  1SAU A;  2XVC A;  4RLF A;  4II3 A;  2YS9 A;  2RRE A;  1H88 C;  3QU6 A;  1DP7 P;  5DUK A;  4WXH A;  2L7M P;  1YX3 A;  4PGH A;  2AS5 F;  2F4M B;  3AFH A;  1HCR A;  3I4M J;  1JHH A;  3CC2 I;  1SVO A;  4MQV A;  4BS9 A;  2EWN A;  2LG4 A;  2TCT A;  2D1V A;  3P9C A;  1OR7 C;  4MO7 A;  2VIX A;  2ZXI A;  4BE1 A;  1BN5 A;  1FX7 A;  2M5W A;  3HTU A;  3COA C;  2L4M A;  2DO7 A;  2VLA A;  5FKK A;  2ELJ A;  4RS8 A;  3K2Z A;  5F64 A;  3PM1 A;  3CCL I;  4E7K A;  3IHU A;  2ZJ2 A;  4OAY A;  1HXD A;  4IZZ A;  3ZGK A;  3V42 A;  4XRS G;  3RCO A;  2HGC A;  4TV7 A;  3JCU C;  3KP3 A;  1YO5 C;  4BGD A;  2BXY A;  5DTD A;  5LHG A;  3LA3 A;  4S04 A;  2F5F A;  1R6R A;  2XGD A;  3BG3 A;  1OKR A;  5HDG A;  2XAQ A;  1I3A A;  1O57 A;  1QU3 A;  4EGZ A;  3ECH A;  2CQX A;  1YRN A;  2HVR A;  3GTO J;  4I98 B;  4AYB A;  3S14 J;  4HQE A;  2RV8 A;  1QGP A;  5HOD A;  4XLP F;  3RSN A;  2HOA A;  4D9J A;  4J01 A;  2M7B A;  1TWF J;  5EG0 B;  3OYK A;  1IV8 A;  1SFE A;  1SVL A;  1Z67 A;  1IN5 A;  3BG5 A;  3H3U A;  1PJR A;  2P6S A;  5LFA A;  3MKY B;  4HF2 A;  3TDZ C;  1ZKG A;  2E19 A;  4G94 A;  1UHS A;  2YR2 A;  3IKT A;  4HV6 A;  4E70 A;  4HX4 A;  1TQP A;  3BRO A;  1VI0 A;  4ZTF A;  3PO2 J;  1K7A A;  3BPV A;  3OIQ A;  2KDZ A;  3JRD A;  3GO5 A;  4HZF A;  3L2W A;  1X1C A;  2CG4 A;  2PI0 A;  2NVU B;  1BL0 A;  1MBH A;  4RA2 A;  2NNN A;  2JPC A;  3MN2 A;  4A3G J;  1H8A C;  2K9S A;  4RB2 C;  1A31 A;  3HSF A;  4F7Z A;  1YIJ I;  2LP0 A;  2JA2 A;  4DYC A;  2KJB A;  1HW5 A;  5FD5 A;  3F22 A;  2EFN A;  3RKW A;  5LLQ A;  2O5R A;  1O3S A;  2JK3 A;  1A5J A;  2F5V A;  3I0T A;  1SAX A;  2DA2 A;  1BIB A;  3RPU A;  1W7P D;  2CW8 A;  3HRT A;  5JHF A;  3WHC A;  3GTK J;  1LDK B;  2JSC A;  1ZHF A;  1A35 A;  2M7A A;  4FAS D;  1BW5 A;  2DYR H;  3H3V K;  2IS1 A;  2CW7 A;  2PMH A;  2HYJ A;  3QP6 A;  4JQF A;  1R9T J;  1SD7 A;  3SZG A;  4Q48 A;  1T98 A;  2R5Z B;  4B43 A;  3CCQ I;  3PNT A;  3PQJ A;  2IA0 A;  2X0L A;  5H6R A;  3D5R C;  1K6Y A;  1G3S A;  1XCB A;  3GX4 X;  1APL C;  3HC7 A;  4BDY A;  3HUG A;  1FBS A;  1USS A;  1Z9C A;  1X3W B;  5HDN A;  1ZRF A;  4CCN A;  3LQR A;  5J6X A;  1KZH A;  2RC4 A;  2IAI A;  3LSP A;  1JT0 A;  2NS8 A;  2VKH A;  4NQW B;  4YEL A;  2KP6 A;  4RB0 A;  4OIR F;  2GM4 A;  5J8F A;  2V1D A;  3W2A A;  1WH5 A;  2DI3 A;  1I6X A;  5GAE J;  2ZFU A;  4YFK F;  4ANJ A;  1D1A A;  1E17 A;  1U6G A;  1FY7 A;  5L3E A;  3F8M A;  3PUF A;  2L0K A;  1OCC H;  1MMS A;  2YSR A;  4PJ0 C;  3H3Z A;  2VBZ A;  3ZQL A;  1FEX A;  2WAD A;  1SFO J;  1QVT A;  2ELH A;  5ED4 A;  1BR2 A;  2WAE A;  1DDN A;  3WE2 A;  3LAP A;  2Y9Z A;  3DF8 A;  2AQF A;  2OQG A;  3HOU J;  1OQY A;  3BP8 A;  2JA5 J;  4FX0 A;  4UVB A;  3A01 A;  2OD5 A;  2R5Y B;  3RPQ A;  2BVM A;  2K9M A;  3WTZ A;  3L9F A;  2HYG D;  2QUF A;  2VN2 A;  1SMY F;  2PJP A;  1Z0X A;  2PEX A;  4U7B A;  1WI9 A;  3RKX A;  5HDK A;  4M6X A;  4XLH A;  2COB A;  4XLA A;  1WJD A;  2CQ7 A;  2EV5 A;  4DBQ A;  1R5I D;  3W2V A;  5HLT A;  2V1U A;  4RAZ A;  1ZGW A;  2WY8 Q;  2H6C A;  3OYF A;  3ABL H;  2ZJR F;  3E3V A;  1LFB A;  4B47 A;  1YJ9 I;  1Z91 A;  3IV5 A;  3OYH A;  4I76 A;  3KLO A;  4KA4 A;  2RQQ A;  5B5E C;  5HS8 A;  3ECO A;  1IN4 A;  2HZT A;  1S29 A;  2CO5 A;  2LDU A;  2M8E A;  1XB4 A;  4C2U A;  5LRR A;  4ZYG A;  1OYI A;  4CIC A;  1XPX A;  2R4G A;  5D6E A;  1S9H A;  3IUO A;  3TP0 A;  1W4M A;  3FHZ A;  5F0C A;  2DJI A;  5ICC A;  5E3M A;  2VC0 A;  2CH0 A;  1TWA J;  1HQC A;  2DMQ A;  4XN3 A;  1P7I A;  1TW2 A;  4G8X A;  4KMU X;  5DV5 A;  1WPK A;  3CDH A;  4GDF A;  4PFP A;  2ZXH A;  3JRB A;  3V8K A;  2K86 A;  4A3I J;  2R7V A;  4PFO A;  2DA4 A;  2YX7 A;  3V8J A;  2PG4 A;  3OYD A;  3TL4 X;  4RB1 A;  2JA7 J;  1U9N A;  1G2H A;  2E5N A;  3OS1 A;  3E97 A;  3MFK A;  1IN7 A;  3BZ6 A;  4WXC A;  3G1O A;  5B1B H;  3KCC A;  2KDO A;  1MMA A;  3OOU A;  3KEO A;  2HDD A;  5HVQ C;  4JOM A;  5BOX A;  3CUO A;  3BCA A;  2VPL A;  1R36 A;  3GFJ A;  5H2F C;  2HPM A;  4EVI A;  4DOZ A;  3WE3 A;  3OWT A;  4LG0 B;  2KKO A;  4UV9 A;  3SFI A;  4PJL A;  1ZAR A;  3N97 A;  1T56 A;  2EJR A;  3E1S A;  4XRM A;  3M1E A;  3FXQ A;  3H0G J;  4A2U A;  3HKZ A;  1MMN A;  3BDD A;  3QPH A;  4CCL A;  2CFX A;  2FNP A;  4E4H A;  4HDU A;  4U0V A;  2XC7 A;  5AIP A;  4PUS A;  2NNY A;  2CQK A;  1GVJ A;  3BOQ A;  4F3Q A;  1JUM A;  2ZSH B;  4MLO A;  4ZJZ A;  1T8I A;  4D5F A;  4BAC A;  1QO0 D;  2P7C B;  4N4N B;  4MTE A;  3CC7 I;  4BEH A;  3GUD A;  5K5O A;  4EM1 A;  3CJN A;  1Y0N A;  2XGC A;  1GXQ A;  2W24 A;  4QIW N;  3U2R A;  2V9V A;  3HGY A;  5CKT A;  1BA5 A;  1Z77 A;  2ZXW H;  3NWT A;  1QBJ A;  1OCT C;  4ZDP A;  1ETK A;  2WAQ N;  3BR0 A;  3K1N A;  1CGP A;  3O3K A;  3CCE I;  2DYS H;  3BQZ A;  4XKW A;  4B3A A;  2K02 A;  2KIQ A;  3PFY A;  1MDM A;  1ETY A;  1D0Y A;  1QNT A;  2LLK A;  4G12 A;  4DBR A;  4L0Z B;  3G6E I;  3SYT A;  2MAB A;  3DEE A;  2NVQ J;  4XL9 A;  2ZME A;  3PO3 J;  4Y3O A;  1W0U A;  5KVR A;  2DFE A;  1B59 A;  1P4X A;  4ZYD A;  1HKS A;  3M1C A;  3MZY A;  5IYC J;  2DMT A;  2XDV A;  4A3L J;  2BV6 A;  1TP4 A;  3KP2 A;  3M7G A;  4B48 A;  1BI3 A;  4P1W A;  4V2F A;  5DDG A;  3FMR A;  2O8X A;  2JTV A;  5HNF A;  3ABT A;  2EIN H;  4A0Y A;  2X6X A;  4G6D A;  5H20 A;  5E1W A;  1SD5 A;  1T0F A;  4KMF A;  2F4O B;  1XSV A;  1E3P A;  5JHU A;  4YG2 F;  2R7R A;  3BTL A;  3H9G A;  4IRI A;  2DT5 A;  3B02 A;  2VC1 A;  3U1D A;  3ISP A;  4BQA A;  5DCF A;  1AOY A;  1IZ1 A;  2IJL A;  2QWW A;  1BI2 A;  4PDK A;  2DA6 A;  3FHN A;  4JX6 A;  4RAF A;  4DQ2 A;  2ESH A;  3NAU A;  2FNA A;  3IL2 A;  2VI6 A;  3ZCO A;  1IO2 A;  1BC8 C;  4UHT A;  1LUJ B;  2A68 F;  2K9N A;  5D4S A;  4QWQ A;  4RDU A;  2H1L A;  1S7O A;  4XQF A;  3CCR I;  2M34 A;  2K3P A;  4X1E A;  3J81 K;  3LQQ A;  4QPO A;  2M0M A;  5F27 A;  1JTX A;  2ECB A;  5DCM B;  3I5U A;  5DD4 A;  4EM2 A;  3OS0 A;  3ERE D;  4AID A;  2HQN A;  4A6D A;  1PP8 F;  2DFF A;  4OIP F;  3ZOB A;  2FSW A;  1R7J A;  5J1U A;  3H0D A;  2STW A;  2R3S A;  4KN4 X;  2QQB A;  3DLL F;  4BHP A;  2DK5 A;  3WTU C;  5IT9 K;  4CHU A;  4N4O B;  1JKQ C;  4EM0 B;  1MJA A;  2ZME C;  4M6Y A;  1ZLK A;  3WU1 B;  1E2X A;  2CRG A;  3W3C A;  1A36 A;  4IRG A;  2JRT A;  5ILU A;  4M3B A;  1QVU A;  4MFD A;  5FLM J;  3CQZ J;  1K6O A;  3CJT B;  1EKE A;  3M3Y J;  5IYB J;  4XLF A;  2GIV A;  2W7N A;  3FZV A;  2DAO A;  1V5F A;  1QHH D;  2V1X A;  2E1C A;  4C2T A;  4WX9 A;  3KZI C;  4HF0 A;  4L0Y B;  4A3D J;  2FU4 A;  1BOB A;  3QQA A;  2OTJ I;  5F0H A;  2KZG A;  1X4P A;  1T0F C;  5IPA A;  3O6B B;  2GOM A;  3GTM J;  3TW7 A;  2PX9 A;  1R5H A;  4LJZ F;  4QPQ A;  5GPC A;  3BZK A;  3LSI A;  1FJL A;  2H1K A;  4UUT A;  3U1K A;  2Q8K A;  4DIQ A;  5J1R A;  3I59 A;  1D5V A;  1RZ4 A;  4EEF G;  4BH9 A;  1FWZ A;  2A5W A;  4ZTJ A;  1MBF A;  4PJN A;  2LNB A;  4B3X A;  2BXZ A;  3PSI A;  2C6Y A;  2VQH A;  1KYW A;  1F4K A;  4OU0 A;  5F0F A;  4ASN A;  5C4X J;  4E7I A;  4Y13 A;  2J5O A;  2IS6 A;  4UUS B;  1E0E A;  2GWR A;  2QEX I;  1GVD A;  5F1J A;  3BY6 A;  3RZD J;  4XR6 A;  1WRJ A;  5CVV A;  3VYR B;  4BU2 A;  3EYI A;  4W97 A;  3TW6 A;  3MKL A;  2N8G A;  1ETX A;  4FT8 A;  4I2O A;  1Z6T A;  4RM2 A;  3GXO A;  3LST A;  1FMV A;  2V6C A;  3HXL A;  4CCM A;  1NK3 P;  2RN7 A;  3SZP A;  3TO7 A;  4LIV A;  3K70 D;  4JK1 X;  2VE8 A;  3C18 A;  3SDB A;  1MMG A;  1VQL I;  2JA6 J;  5IP6 A;  1B8I B;  2P5K A;  2MD0 A;  3DXJ F;  4R1H A;  3NWS A;  1K83 J;  4L9N A;  3CCM I;  1UEL B;  1V55 H;  4JX4 A;  2O3F A;  4N9I A;  3J7A O;  2NS7 A;  4AYB N;  4BJ6 C;  1BJZ A;  4FCY A;  2B9S A;  4MGR A;  1YFH A;  4RBO A;  3I9V 2;  2K9L A;  3HEF A;  4B09 A;  4MQ9 F;  4ZYE A;  5GAG J;  1IXR C;  2E2J J;  2R7D A;  2QM3 A;  1IC8 A;  1AHD P;  4AIJ A;  1PUE E;  5CVR A;  1N77 A;  2UXN A;  1G3W A;  4IEJ A;  3D5S C;  3LFU A;  3FBI B;  4U87 A;  3HIF A;  4BAY A;  3L2C A;  2DXI A;  4B4C A;  2KLO A;  3VSK A;  1FYL A;  1LJ9 A;  2R7T A;  4MTD A;  4CXF A;  3OS2 A;  4IHT A;  1O3Q A;  1MNE A;  4F92 B;  3FF5 A;  3F21 A;  3D0S A;  1HF0 A;  2LVS A;  2OZ6 A;  3I54 A;  3EUA A;  3FBN B;  1L3L A;  3OYB A;  4UV8 A;  4KIS A;  2OQR A;  3IC7 A;  4S0H B;  1UB9 A;  5J8C A;  2Z16 A;  2CUJ A;  1WJA A;  4AVZ A;  1ZLJ A;  4D7M A;  1WVR A;  2VKV A;  3A1Y A;  2XRO A;  4F91 B;  1XG1 A;  5DYM A;  3JRA A;  3GF2 A;  1XGM A;  2ZB9 A;  5E3N A;  4PJJ A;  4PGG A;  3EUH C;  4LGW A;  1R5G A;  1WJB A;  1OIS A;  4Y17 A;  1TT5 B;  3BG9 A;  3WGG A;  4HST A;  3OYE A;  1MMD A;  1Z3X A;  1ENH A;  2LKX A;  3GVA A;  1H9G A;  4LMY A;  2BY3 A;  3K4M A;  1Q1H A;  5DM7 F;  3JSP A;  1I50 J;  2Z2S B;  3FXJ A;  1P4A A;  2VQC A;  4HPQ A;  1T08 B;  3CD6 I;  1ZG3 A;  1ERD A;  2E34 A;  1X1D A;  5E17 F;  2G7H A;  1D0Z A;  3MEX A;  1ZG5 A;  5BS6 A;  3OYL A;  1JKP C;  2R7S A;  3DTK A;  3JAM K;  3S2D J;  2HVQ A;  1DPU A;  5DM6 F;  3S17 J;  1V3F A;  3FX3 A;  1VQ9 I;  3SXY A;  5FO5 A;  5D8L B;  2K3F A;  1ON2 A;  1RKW A;  2GXA A;  2E2H J;  1XCV A;  1REP C;  3UNG C;  3WHB A;  3RYP A;  3TOA A;  2E7X A;  1KA8 A;  2O03 A;  3BPX A;  3E6M A;  4MIM A;  2W4S A;  1XGO A;  2FD5 A;  3F8N A;  2GA2 A;  2EZI A;  3P9I A;  4U88 A;  5KAF C;  2V6E A;  1TWG J;  2DK8 A;  2QSF X;  2Z99 A;  3LSM A;  4L9J A;  3HDD A;  5FFZ A;  2FX0 A;  3K4K A;  3EDP A;  2QBY B;  5ICG A;  2DDB A;  1YS6 A;  1HC8 A;  2EZK A;  2ZCW A;  2MD5 A;  1XMK A;  2Y2Z A;  5EG0 A;  4KYW A;  2VKD A;  3DTI A;  3VOD A;  2A6E F;  3B6A A;  2XRL A;  3WTV C;  1B6A A;  2EIM H;  3F8C A;  1JKR C;  1K4T A;  4IF4 A;  3ELK A;  5TRD A;  2FF4 A;  1FOY A;  3OL3 A;  1O4X A;  1XS9 A;  2EFP A;  5JI6 A;  3ESW B;  4XBF A;  2LYC A;  1N25 A;  1N75 A;  2IEK A;  3OYC A;  5IT3 A;  3JRE A;  4A3J J;  3KYL A;  3A2K A;  4ZDL A;  1RPW A;  3HPG A;  1QHG A;  2MH9 A;  4IX7 A;  1OPC A;  3NQO A;  3S1Q J;  4BJT A;  2EQR A;  3E5Q A;  3DEU A;  4FE4 A;  1IDY A;  3Q0V A;  4C3I J;  5E8G A;  2TRT A;  4OOI A;  3T5X A;  3BR2 A;  2RAE A;  5TIS C;  3B6C A;  1Y1V J;  5DS9 A;  3IRR A;  2ME0 A;  1ZK8 A;  3K4J A;  3I53 A;  4I01 A;  2EFW A;  4EJW A;  1UAA A;  3HSE A;  1R49 A;  1J09 A;  1VQ5 I;  5KAI C;  2FOK A;  4M74 A;  1T38 A;  3C7J A;  4L9T A;  2Y0S A;  1SEU A;  4KT5 C;  4EJV A;  4GXO A;  4WXD A;  2MBF A;  3QPT A;  3CUQ C;  1RKT A;  2PJR B;  4M3F A;  2EBI A;  5K7H A;  2X85 A;  3D1N I;  1LNW A;  4B1R A;  2XF5 A;  3NRV A;  4R79 A;  3G1L A;  3N05 A;  4U0Y A;  2DDA A;  1KGS A;  2EV6 A;  1ULY A;  1ZYR F;  2KT0 A;  2PFB A;  4B44 A;  4CYC B;  3GLX A;  1HW2 A;  1L0O C;  2JSP A;  2IVM A;  3ZQC A;  4K2E A;  1TNT A;  2DT6 A;  4ZDO A;  3WGI A;  2FUG 2;  1FNN A;  2A05 A;  2B0L A;  2ID6 A;  3HOW J;  3RPU D;  2DA1 A;  2DTR A;  2R5Z A;  2IBD A;  3FDY A;  1BI1 A;  1BOA A;  2JWT A;  3ZMV A;  4B8X A;  2QA4 I;  2STT A;  4AM3 A;  4ENK A;  2LY2 A; 
#chains in the Genus database with same CATH homology
 1FYM A;  3GFI A;  1FT9 A;  5F1R A;  2MC3 A;  2CWE A;  4UUV A;  4NB5 A;  5LHI A;  1ZH5 A;  3ABU A;  1TLH B;  3MZH A;  3J80 Z;  4EGY A;  1UCR A;  4OIN F;  3GZ6 A;  2YX4 A;  5A2Q Z;  1H9T A;  4Q47 A;  3RIR A;  3TOB A;  4AVP A;  2EFQ A;  3KP5 A;  4HLX A;  4OIO F;  1FC3 A;  3RJP A;  4A12 A;  2FEZ A;  5AON A;  5FLX Z;  4QLC U;  1EH6 A;  1QPM A;  3KZZ A;  4HX7 A;  1U5T B;  1XSD A;  4CO8 A;  5EEG A;  2L3D A;  2LF7 A;  4AD9 A;  1G3Y A;  4P55 A;  2ZBK A;  2VXZ A;  2PQ8 A;  2XUB A;  2PMU A;  1J7K A;  2Q0O A;  2YU3 A;  3V7R A;  2HQR A;  1BC7 C;  1S7A A;  2VBW A;  2FML A;  5BPD A;  2HWV A;  4WWC A;  3L7W A;  3F72 A;  1RI7 A;  2QYO A;  3R6S A;  1MKM A;  4ZYH A;  1SFX A;  1YG2 A;  4RAY A;  5HLI A;  1J9I A;  4YIF A;  4Y15 A;  1G4D A;  3DPL C;  4M71 A;  3ML6 A;  3I71 A;  2P6T A;  1EH7 A;  3IKV A;  3KZY A;  2F5C A;  3ROU A;  4EJT A;  2A07 F;  1F9N A;  4A5M A;  2V79 A;  1W7P B;  4GO1 A;  3EET A;  3C1D A;  1O7L A;  4M9X A;  1T2K A;  1R23 A;  1T39 A;  1KU7 A;  5L3F A;  1W5T A;  5HLG A;  4Q5S F;  2HDC A;  4I0A A;  2HKO A;  3B73 A;  4HX8 A;  2IPQ X;  4LG0 A;  2G9W A;  2XRN A;  5D5W B;  5LGU A;  2QVO A;  3H92 A;  1ZRD A;  5FB2 A;  3HYI A;  3ZPL A;  1EV7 A;  2A69 F;  2ZNY A;  1OYY A;  2ACJ A;  2KRF A;  4RGX A;  2FBI A;  3JSO A;  4FHT A;  3RI4 A;  1IN6 A;  4MHG A;  2L4A A;  3FM3 A;  2D2W A;  1Z6R A;  1H0M A;  1STZ A;  2NRA C;  3TKY A;  1R1T A;  3I4P A;  5E1X A;  3LA2 A;  3WGH A;  2VOD A;  2W84 A;  2QQA A;  3F8B A;  1RUO A;  1KQ0 A;  4ESJ A;  3VOE A;  1IUY A;  3S2W A;  2M1B A;  1G6N A;  1IXC A;  3ZMS A;  1DPR A;  3WU0 A;  2NAZ A;  4HW0 A;  4O6J A;  2O6G E;  3REO A;  2QQ9 A;  1DUX C;  1XMA A;  4PCQ A;  2XKP A;  2BYV E;  1UHW A;  4Z2Y A;  4G7O F;  4U0W A;  4DNC A;  3OV8 A;  5CVI A;  5L3D A;  3CO7 C;  2J5P A;  1RIO H;  3BJO A;  4S05 A;  1SMT A;  3FMQ A;  3GFL A;  3G3Z A;  5DCM A;  4Q4Z F;  3QOP A;  1Z7U A;  2F5E A;  4IRH A;  3TQN A;  3IWZ A;  4BYY A;  3KP7 A;  4HQM A;  5KK1 A;  2GZW A;  1CF7 B;  4M9Z A;  3DQV C;  1HKT A;  3ZN0 A;  2DU9 A;  2MLK A;  5CLS A;  1P4W A;  3KP6 A;  3K1M A;  1XGS A;  4ENJ A;  4HOB A;  4IJA A;  2ZME B;  3HHH A;  5DD8 A;  5JVT A;  2FE3 A;  2F5D A;  4GCV A;  4MNU A;  1FOK A;  2VOP A;  4CDG A;  2DPU A;  4M9S A;  4KIF A;  1ZGJ A;  2M87 A;  1ZGA A;  2H6B A;  4I0B A;  2NYX A;  1FBU A;  3L00 A;  1U2W A;  3F6O A;  2FMY A;  3I58 A;  2CSO A;  4HAM A;  4GGG A;  3W6J B;  1Z1D A;  3MCZ A;  2F2E A;  3R0J A;  1ZRE A;  1K78 B;  1D8J A;  4ENM A;  1U8R A;  2Z33 A;  4EJU A;  1WQ2 A;  1YIO A;  4CGZ A;  2DQL A;  1NHA A;  1WSU A;  1R00 A;  2WTE A;  4O3M A;  3LAJ A;  4A0X A;  1TBX A;  4IXA A;  5K1Y A;  1SD6 A;  2MLG A;  1GXP A;  1OYW A;  4KNY A;  3EYY A;  4OIQ F;  3SFZ A;  1D8K A;  1IRG A;  2KIU A;  2GXB A;  3GEZ A;  4A6E A;  2O0Y A;  3GFM A;  1FP1 D;  3GZ5 A;  3DP7 A;  2A61 A;  1TTY A;  4GYI A;  1FLI A;  1SFU A;  3E6D A;  1PDN C;  4LLG F;  1ZRC A;  2DFI A;  2HOE A;  4UVC A;  2IA1 A;  5LGN A;  3IRQ A;  2XKO A;  5ERI A;  2GAU A;  1FYK A;  3HRM A;  1R1V A;  1UFM A;  4LD5 A;  4LFU A;  3KLN A;  1XD7 A;  5AIQ A;  2VOO A;  2L02 A;  2QBY A;  2VE9 A;  4N0B A;  5CYV A;  2UZK A;  3RKY A;  3ZQ7 A;  4LB5 A;  5JFR A;  4KIG A;  2EA4 A;  3MWM A;  4M72 A;  3V7C A;  4RGU A;  4G9Y A;  2RQP A;  2HFH A;  2R7F A;  2H09 A;  3FMS A;  3J81 Z;  1B9N A;  3TO6 A;  4ZZD A;  3BJ6 A;  2M30 A;  2YPR A;  1MJB A;  2W57 A;  2W85 A;  4BNC A;  1J5Y A;  2WC2 A;  1I1G A;  2K27 A;  1F5T A;  3F23 A;  3I64 A;  5JR3 A;  2OZU A;  4YII A;  2JPB A;  5IT9 Z;  2PBI A;  1YQA A;  3E6B A;  4WK8 F;  4LK0 F;  5TJJ A;  1HSJ A;  3TDU C;  2HYF A;  1RNL A;  1LB2 A;  3KFW X;  2FXA A;  4A5N A;  1F1Z A;  3CTA A;  2XHK A;  3ZP5 A;  1J59 A;  3CLO A;  1I5Z A;  4OMY A;  4KN7 X;  2BEO A;  4N9H A;  3KP4 A;  3ULQ B;  2DW4 A;  4XLN F;  1R58 A;  5H6Q A;  1KU9 A;  1HST A;  4JBA A;  4HF1 A;  4WF2 A;  3CUQ B;  3GW2 A;  2XAS A;  5BPI A;  3JW4 A;  4U7D A;  1YS7 A;  4IHS A;  4L9V A;  2LKP A;  2LSO A;  5E1Z B;  2EK5 A;  3V8L A;  3TO9 A;  2A6H F;  2HTS A;  2XV4 S;  1YW8 A;  2OU2 A;  1A04 A;  5D8K B;  3ZMU A;  1ODD A;  1MGT A;  3M8E A;  2XAG A;  4MEY F;  2G7U A;  5HOO A;  2LF8 A;  5LEK A;  1FBQ A;  3LA7 A;  2QEN A;  2ZNZ A;  2Y48 A;  3KEQ A;  1P6R A;  2KIF A;  1YW9 A;  5FFX A;  4D0P A;  1S6L A;  4ON0 A;  2TDX A;  1ON1 A;  3RTR A;  3HRU A;  1TW3 A;  3HTS B;  3K69 A;  1U5T A;  3V4G A;  1KQ9 A;  3L09 A;  4NQW A;  3VFZ A;  2MH2 A;  1XDU A;  1KQ8 A;  1JGS A;  2EB7 A;  5D5X B;  4GYG A;  1O3R A;  1GHC A;  4YFX F;  2COM A;  5LHH A;  2HS5 A;  3KET A;  2OAZ A;  4LK1 F;  2BBY A;  3WTY C;  4NHJ A;  2HTJ A;  3LWF A;  5D5U B;  3JTG A;  1WWX A;  1BM9 A;  4BXU A;  1KU3 A;  1HW1 A;  3N4M A;  4I09 A;  2BE5 F;  2ZXJ A;  2X4H A;  3RDI A;  3FM5 A;  2EA2 A;  1OMI A;  2ESN A;  1YYV A;  4HA8 A;  1BBY A;  2Z3Y A;  2IA2 A;  4XRF A;  2HKX A;  3JAM Z;  3T8R A;  1W7P A;  2K4J A;  3QU3 A;  3D5L A;  1XDS A;  3HRS A;  3VEP A;  3E5U A;  1JHF A;  3NEU A;  4KFC A;  4L5J A;  3DV8 A;  2JZY A;  3V7S A;  2RVC A;  4AIH A;  1FP2 A;  3HSR A;  4EMS A;  5BMZ A;  3JTH A;  1D3Y A;  1S3J A;  1MD0 A;  2H94 A;  1ONV A;  1U5T C;  3K9T A;  5K5Q A;  4EQQ A;  4G7Z F;  2WV0 A;  2KJC A;  2RGV A;  4RB3 C;  3EQL F;  2A5Y B;  5ICF A;  3WOD F;  2H27 A;  1R1U A;  4OMZ A;  3O2P E;  4ETS A;  2HR3 A;  3P9K A;  1B9M A;  3Q9S A;  2OBP A;  4M73 A;  3QP5 A;  4UNO A;  3E6C C;  5LEJ A;  2XAH A;  5HS9 A;  4A0Z A;  1P92 A;  1YLF A;  2Z5U A;  1JXS A;  1FPQ A;  3R0A A;  3R4K A;  4P9F A;  1J2X A;  3VB2 A;  3T8T A;  3M9A A;  3ZN1 A;  2P7V B;  5L3C A;  4EJO A;  1P2F A;  4XSZ F;  1X3U A;  3TGN A;  5LGT A;  2ISZ A;  3QAH A;  2IRF G;  1LQ1 A;  3DKW A;  4O5V A;  2EFO A;  2O61 A;  1LEB A;  4YFN F;  3MQ0 A;  5D4R A;  4UVA A;  3RYR A;  1BIA A;  3W6K B;  4LLN A;  4KIC A;  2P8T A;  3K0L A;  2RKH A;  4BHB A;  2UWM A;  1PP7 U;  5CJ9 A;  3WTT C;  2RNJ A;  4XSX F;  3FXU A;  2CGP A;  4LB6 B;  2RDP A;  1IRF A;  5FGM A;  4G7H F;  1IAW A;  2XAJ A;  1EH8 A;  4UXN A;  1ZG1 A;  4ZH4 F;  1U3E M;  1C0W A;  3KE2 A;  2DPD A;  4CYD A;  1LEA A;  4KIB A;  3Q5F A;  2Y0M A;  1QZZ A;  5L3B A;  1U78 A;  3WTX C;  2GQQ A;  1CF7 A;  1SD4 A;  1TNS A;  1KYZ A;  3BJA A;  1RUN A;  3G73 A;  2ZFW A;  2IW5 A;  5E20 A;  2KIM A;  4FX4 A;  2FQ3 A;  4WCG A;  1IXS B;  1XGN A;  2DLL A;  2NS0 A;  5L3G A;  6PAX A;  1K79 A;  1BJA A;  4ESB A;  1HBX G;  2M45 A;  1QZY A;  2WWY A;  4P5O A;  2XAF A;  1V4R A;  2QLZ A;  1J75 A;  5HLH A;  3GWZ A;  2VON A;  2K7L A;  2VBX A;  3F3X A;  4P96 A;  2ETH A;  2XGX A;  3DPT A;  1MDM B;  3ZMT A;  1FSH A;  4ENN A;  3T1B A;  3CO6 C;  1O3T A;  1TQM A;  3U9G A;  2W25 A;  1K78 A;  3SHF A;  5E18 F;  4AWX B;  5D5V B;  2FA5 A;  4KDP A;  1XSX A;  4RGR A;  3HOS A;  3GYH X;  2IT0 A;  1IN8 A;  3SQN A;  1MZB A;  5FD6 A;  4HLY A;  4L18 B;  1FSE A;  2K4B A;  3R60 A;  4IVN A;  3FWE A;  2FBH A;  2BGC A;  4EV0 A;  1W5S A;  3Q9V A;  5ILS A;  3T0Y A;  1ZN2 A;  5CVJ A;  2DBB A;  3IWF A;  1HKQ A;  1J0R A;  4H0E A;  5HS7 A;  2ZO4 A;  1TQI A;  2GA1 A;  2JT1 A;  3ZMZ A;  2PLY A;  3QRF F;  4RGS A;  4HV5 A;  1LVA A;  1XN7 A;  2FBK A;  3AAF A;  5E8I A;  3WTW C;  2Q2E A;  2FRH A;  3ZMD A;  2IP2 A;  3FXR A;  1IF1 A;  2P5L C;  3EUH A;  1UHM A;  3E5X A;  2Z9O A;  3F6V A;  4CZZ A;  5CVU A;  3R61 A;  3LFK A;  2GXG A;  5DEQ A;  4P9U A;  1LDD A;  3P7N A;  2HEO A;  1I27 A;  2L01 A;  3C3W A;  1QQI A;  2CYY A;  2VT3 A;  5ILV A;  3PFI A;  1Y0U A;  3I59 B;  2AXL A;  2P5V A;  3OOP A;  1O7F A;  2QZ8 A;  3K1P A;  2A3S A;  2D45 A;  1G3T A;  2XIG A;  1FZP B;  2MA3 A;  2VBY A;  5F6F A;  4G6Q A;  3DFG A;  4ESF A;  3HHG A;  1BI0 A;  2ADU A;  2L54 A;  2ISY A;  2CW0 F;  5LBQ A;  3J80 K;  4I02 A;  1MJ9 A;  1R22 A;  1B4A A;  1Z05 A;  3WTS C;  4LLL A;  1WKM A;  1OR7 A;  5A2Q K;  5EEH A;  4R8H A;  3BWG A;  3PQK A;  2D1H A;  2E1N A;  2UXX A;  3M8F A;  2PN6 A;  3WG9 A;  2VT2 A;  1UST A;  5ICE A;  5FLX K;  4HYE A;  4HBL A;  1YW7 A;  4MEX F;  2ZKZ A;  1AWC A;  4HDV A;  2OA4 A;  2P4W A;  1YTY A;  5D6F A;  4L5I A;  5DUI A;  2E7W A;  1ZAO A;  1JE8 A;  4IPA A;  3SZT A;  1LDJ A;  3F8F A;  4ZZL A;  4AIK A;  1VTN C;  2DQR A;  3HOT A;  1S8N A;  1T6S A;  3CUQ A;  3MAJ A;  2Y75 A;  5LRS A;  1KU2 A;  2EV0 A;  1B1B A;  4PZJ A;  5K5R A;  4KUM A;  5BQT A;  4I7H A;  4BHC A;  1I1S A;  1IW7 F;  2XVC A;  3QU6 A;  1DP7 P;  5DUK A;  4WXH A;  4PGH A;  2AS5 F;  1JHH A;  4MQV A;  2EWN A;  3P9C A;  2D1V A;  1BN5 A;  1FX7 A;  2M5W A;  3HTU A;  3COA C;  2L4M A;  2DO7 A;  4RS8 A;  3K2Z A;  5F64 A;  3IHU A;  2ZJ2 A;  1HXD A;  2HGC A;  4TV7 A;  3KP3 A;  1YO5 C;  5LHG A;  3LA3 A;  4S04 A;  2F5F A;  1OKR A;  5HDG A;  2XAQ A;  1O57 A;  4EGZ A;  3ECH A;  4I98 B;  4HQE A;  2RV8 A;  1QGP A;  4XLP F;  1SFE A;  1IN5 A;  3H3U A;  2P6S A;  4HF2 A;  3TDZ C;  4G94 A;  2YR2 A;  3IKT A;  4HV6 A;  4E70 A;  4HX4 A;  1TQP A;  3BRO A;  1K7A A;  3BPV A;  3GO5 A;  4HZF A;  2CG4 A;  2PI0 A;  2NNN A;  2JPC A;  4RB2 C;  3HSF A;  4F7Z A;  2KJB A;  1HW5 A;  5FD5 A;  3F22 A;  2EFN A;  3RKW A;  5LLQ A;  1O3S A;  3I0T A;  1SAX A;  3RPU A;  1BIB A;  1W7P D;  3HRT A;  1LDK B;  2JSC A;  1ZHF A;  2PMH A;  3QP6 A;  4JQF A;  1SD7 A;  4Q48 A;  1T98 A;  3PQJ A;  2IA0 A;  2X0L A;  5H6R A;  1G3S A;  1XCB A;  3GX4 X;  3HUG A;  1FBS A;  1USS A;  1Z9C A;  5HDN A;  1ZRF A;  3LQR A;  5J6X A;  2RC4 A;  4RB0 A;  4OIR F;  5J8F A;  2V1D A;  2DI3 A;  1I6X A;  4YFK F;  1E17 A;  1U6G A;  1FY7 A;  5L3E A;  3F8M A;  2YSR A;  3H3Z A;  2VBZ A;  2ELH A;  5ED4 A;  1DDN A;  3WE2 A;  3LAP A;  3DF8 A;  2OQG A;  3BP8 A;  4FX0 A;  4UVB A;  2OD5 A;  3RPQ A;  3WTZ A;  3L9F A;  2HYG D;  2QUF A;  2VN2 A;  1SMY F;  2PJP A;  2PEX A;  4U7B A;  1WI9 A;  3RKX A;  5HDK A;  4M6X A;  2EV5 A;  2V1U A;  4RAZ A;  2H6C A;  3E3V A;  1Z91 A;  3KLO A;  4KA4 A;  5HS8 A;  3ECO A;  1IN4 A;  2HZT A;  1S29 A;  2CO5 A;  2LDU A;  2M8E A;  1XB4 A;  5LRR A;  4ZYG A;  1OYI A;  4CIC A;  5D6E A;  1W4M A;  3FHZ A;  5ICC A;  2VC0 A;  1HQC A;  1TW2 A;  4G8X A;  4KMU X;  5DV5 A;  3CDH A;  3V8K A;  2K86 A;  2YX7 A;  3V8J A;  2PG4 A;  4RB1 A;  3E97 A;  3MFK A;  1IN7 A;  3BZ6 A;  4WXC A;  3KCC A;  3KEO A;  5HVQ C;  5BOX A;  3CUO A;  1R36 A;  3GFJ A;  4EVI A;  3WE3 A;  4LG0 B;  2KKO A;  4UV9 A;  1ZAR A;  3N97 A;  2EJR A;  3M1E A;  3FXQ A;  4A2U A;  3BDD A;  3QPH A;  2CFX A;  2FNP A;  4HDU A;  4U0V A;  5AIP A;  2NNY A;  2CQK A;  1GVJ A;  3BOQ A;  1QO0 D;  2P7C B;  4MTE A;  3GUD A;  5K5O A;  4EM1 A;  3CJN A;  1GXQ A;  2W24 A;  3U2R A;  2V9V A;  1QBJ A;  3K1N A;  1CGP A;  3O3K A;  2K02 A;  1MDM A;  4L0Z B;  1QNT A;  2ZME A;  5KVR A;  1B59 A;  1P4X A;  4ZYD A;  1HKS A;  3MZY A;  2BV6 A;  3KP2 A;  3M7G A;  1BI3 A;  5DDG A;  3FMR A;  2O8X A;  2JTV A;  3ABT A;  4A0Y A;  4G6D A;  5H20 A;  5E1W A;  1SD5 A;  1T0F A;  4KMF A;  1XSV A;  5JHU A;  4YG2 F;  4IRI A;  2DT5 A;  3B02 A;  2VC1 A;  3U1D A;  3ISP A;  4BQA A;  5DCF A;  1AOY A;  1IZ1 A;  2IJL A;  2QWW A;  1BI2 A;  4PDK A;  4DQ2 A;  2ESH A;  2FNA A;  3IL2 A;  1BC8 C;  4UHT A;  2A68 F;  5D4S A;  4QWQ A;  1S7O A;  3J81 K;  3LQQ A;  5DCM B;  3I5U A;  5DD4 A;  4EM2 A;  3ERE D;  2HQN A;  4A6D A;  1PP8 F;  4OIP F;  2FSW A;  1R7J A;  2STW A;  2R3S A;  4KN4 X;  2QQB A;  4BHP A;  2DK5 A;  3WTU C;  5IT9 K;  4CHU A;  4EM0 B;  1MJA A;  4M6Y A;  1ZLK A;  3WU1 B;  1E2X A;  4IRG A;  2JRT A;  5ILU A;  1K6O A;  2GIV A;  3FZV A;  2DAO A;  2V1X A;  2E1C A;  4WX9 A;  4HF0 A;  4L0Y B;  2FU4 A;  3O6B B;  4LJZ F;  1R5H A;  2Q8K A;  3I59 A;  1D5V A;  1RZ4 A;  4BH9 A;  1FWZ A;  2LNB A;  2C6Y A;  1F4K A;  1KYW A;  4OU0 A;  4ASN A;  4Y13 A;  2J5O A;  2GWR A;  3BY6 A;  1WRJ A;  5CVV A;  3EYI A;  4FT8 A;  4I2O A;  1Z6T A;  3GXO A;  3LST A;  2V6C A;  2RN7 A;  3SZP A;  3TO7 A;  4JK1 X;  2VE8 A;  3C18 A;  2P5K A;  3DXJ F;  4R1H A;  4L9N A;  2O3F A;  4N9I A;  3J7A O;  4MGR A;  1YFH A;  4B09 A;  4MQ9 F;  4ZYE A;  1IXR C;  2R7D A;  2QM3 A;  4AIJ A;  1PUE E;  5CVR A;  2UXN A;  1G3W A;  3HIF A;  4BAY A;  3L2C A;  1FYL A;  1LJ9 A;  4MTD A;  4CXF A;  4IHT A;  1O3Q A;  3FF5 A;  3F21 A;  3D0S A;  2OZ6 A;  3I54 A;  1L3L A;  4UV8 A;  2OQR A;  3IC7 A;  1UB9 A;  5J8C A;  1ZLJ A;  2XRO A;  5DYM A;  3GF2 A;  1XGM A;  4PGG A;  4LGW A;  1R5G A;  4Y17 A;  3WGG A;  3GVA A;  1H9G A;  4LMY A;  1Q1H A;  3JSP A;  1P4A A;  1ZG3 A;  5E17 F;  2G7H A;  3MEX A;  1ZG5 A;  5BS6 A;  3JAM K;  1DPU A;  1V3F A;  3FX3 A;  3SXY A;  5FO5 A;  5D8L B;  1ON2 A;  1XCV A;  1REP C;  3RYP A;  3TOA A;  2E7X A;  1KA8 A;  2O03 A;  3BPX A;  3E6M A;  3F8N A;  1XGO A;  4U88 A;  2GA2 A;  3P9I A;  2DK8 A;  2Z99 A;  4L9J A;  5FFZ A;  3EDP A;  2QBY B;  5ICG A;  1YS6 A;  2ZCW A;  2MD5 A;  1XMK A;  4KYW A;  3VOD A;  2A6E F;  3WTV C;  1B6A A;  3F8C A;  4IF4 A;  3ELK A;  5TRD A;  2FF4 A;  2EFP A;  5JI6 A;  4XBF A;  5IT3 A;  2MH9 A;  1OPC A;  3NQO A;  3E5Q A;  3DEU A;  5E8G A;  4OOI A;  3T5X A;  3IRR A;  3I53 A;  4I01 A;  2EFW A;  4EJW A;  3HSE A;  2FOK A;  4M74 A;  1T38 A;  3C7J A;  4L9T A;  4KT5 C;  4EJV A;  4GXO A;  4WXD A;  2MBF A;  3QPT A;  3CUQ C;  1LNW A;  3NRV A;  4R79 A;  4U0Y A;  2EV6 A;  1KGS A;  1ULY A;  1ZYR F;  2PFB A;  3GLX A;  1HW2 A;  1L0O C;  2IVM A;  4K2E A;  1TNT A;  3WGI A;  1FNN A;  2B0L A;  2DTR A;  3ZMV A;  2STT A;  1BI1 A;  1BOA A;  4B8X A;  4ENK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...