1DQDH

Crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
221
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRLSITRDTSRNQYYLQLKSVTPEDTATYYCASPPGYYGSGPYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKISPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HGR-2 F6
publication title Structure of Fab hGR-2 F6, a competitive antagonist of the glucagon receptor.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2000-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdH02
3U9PH 1ERNA 4RFNB 2YUVA 5CBAA 3ARQA 4OF7A 1K6QL 5DLMH 2VDQH 1JV5B 5KSAC 4OZHF 1FBIL 5FKAB 2I60H 2NTSP 3U7YH 1C12B 4HX1A 2E9BA 2E3VA 3O2DA 3SKNB 5C6WH 3NMEA 25C8L 4MNGA 2ICEB 3S6CA 4F7CB 5CGMA 3O6LH 1KF9B 4G5ZH 4MJIE 3QG7L 4HXBL 4LLYA 3BN3B 1CL7L 5JUEH 1KIPB 4K3EH 2RR3A 4JGJA 4XX1E 4ZO8A 1A1NB 1C1EL 5E94B 1KNOB 3FT4B 4HUKB 3OJDB 4Y2OA 3T65B 2VLJE 4ELMB 3SE8H 2H26A 4WWKD 3TO2A 4PS4L 1I8MA 1CG9A 1NAMB 3DXAB 3BE1H 1QQDB 3LKPB 3QT2A 2R4SL 5D2LF 3FJTA 1MRCL 3KYKH 3QFJB 5D70L 1TLKA 3MBEB 3V7AG 3HMXH 4JZJC 3IB4A 3MODH 5FF6B 4M3KB 2CH8A 3SJVD 4DAGL 4WNQA 1FNGA 2BNRD 3GJEB 2JK5B 2BSED 3MJ9H 4M8QB 1KB5B 3OAYH 1IGTB 3L95A 2ESVA 3BWUC 5KVFH 4YXHH 1Q0YH 2ZG1A 3P0VL 4U2YA 5HPMB 1A3RH 2B39A 3WFCH 1E4KC 4JG0L 3QNXA 4WGVB 3TFKD 2P45B 2WINB 1I8LC 1NCCL 2R2EA 1UACH 3KPOB 4UUJA 2RAMA 5JW5A 4J23A 4TVPE 1WT5C 4M6OH 4P46A 4FQ1L 2YK1H 4P2OB 4RRPG 3SKOA 4JM4H 1UC6A 2EYRB 3U0PA 4R8WL 2W60B 1QRND 3MRGB 4DN3L 1R24B 4Z7UB 2F53D 5EOCH 1II4E 5CZKA 2IBZY 1NL0H 4RGOH 3WUWB 3UPCA 1BBDL 1S8DA 2D0GA 4KI1A 5T1DH 4DTGH 4XWGH 4QOKD 1E27B 3OX8B 4U3HA 2DLEA 5HHVL 2MQCA 4N0UB 2UWEF 3BD5A 3C08H 4Y5YA 1IZKA 4OSUH 1T66C 5CEYB 2NY6B 2HT4C 4MAYA 3GSUA 2PO6D 3L1OH 1FN4A 3V0WH 3DSFL 4CGTA 5FUZL 3V6BR 3CFBB 3B9EA 2R56L 4M9OA 1OY3B 4L4TE 2XY1A 4NO2B 3CX5K 2VDLL 2YD7A 1IAOA 2DQJH 3NFPA 2V6HA 4OJFL 3BPLB 4M1CC 3MYZA 4Y4HA 3O3DA 2YKLL 4IIQC 2HG5B 3FQWB 1YQ2A 1TZGH 1OGAE 3Q2CA 5JQ6L 2XTJC 5FUOH 1BQHG 4CVWA 4Z0XB 4NFDA 3GSXB 1XIWC 4KJQC 3REWA 1SEQL 2XWTA 4XC1L 4PB9H 4R97B 3WS3B 2FLRT 4RGNB 4S1SH 2VDPL 3ZTJG 4GG6E 3MV9E 4XC3L 5F3BA 1O5DT 3X3GL 4KTEL 1WF5A 4XHJC 1CLYH 5HD8D 2UVEA 4FFWD 5FYLE 2IPTH 3CH8A 1TZIB 1N64L 4OGXH 5MI0B 4IRSC 4CDHA 3U6RB 2OTWA 5DHVH 1TIUA 2EE2A 1D9KB 1WFTA 1MCKA 5GJSH 4RDQG 3QG6B 1KLUA 4IS6B 3WYRA 4MQ7B 3B5GA 5ICZA 3SEPA 5JPNB 3SDAA 2DD8L 3MRJA 3WHE1 4JRYB 4G6MH 5F9WC 3UC0H 3DX7B 3L3KA 3GRWL 5DR5L 2NY2B 3ZDZF 1AO7B 3PQYD 4H88H 1RVFH 4N9GB 3S35H 3C2SA 2AGJH 2CDEB 1AH1A 2ZG2A 1HSAB 4XPAH 2ORBH 3HNVH 4OT1H 2BVTA 2Y07L 1YEFH 2J7LA 1TMCB 1QHPA 2YMXL 3BI9X 3V4UL 1FIGL 4UIMA 1BEYL 1AHWC 3QULA 1H5BC 4EVNB 5ITFB 2OL3L 3OWEA 3PL6D 5DUBA 5H37G 4BFIB 3HMWL 2WBJD 4XCYB 5IMKA 1VGKA 3BRDA 1EXUB 1Y6MR 4KK6C 3WKMH 3KLHC 1UXWB 1HK6A 1I7TA 4HFUL 4M7KH 1DBMH 2W1NA 4BK4A 5E00A 1CR9H 3BKYH 2CUMA 3FQRA 4I18B 2GT9A 4D8PB 4G6KH 3RX7A 3L5WB 5B38G 4F2MB 3GBNH 1MQ8A 1Q8MA 1H8OA 4LKXB 2QR0A 4QHLA 1PY4A 5C09B 3O6FA 1RZ8A 5HGBA 3H9SD 3ZHKA 3U9PL 4JKWA 2X7LA 4M4RA 1A6ZB 4U0RB 5F6HI 4FXKB 4HEME 1NC4B 2O93L 5CSZA 3N1FC 5DLML 4RFEB 3UO1H 2VDQL 3ZT5A 4JKMA 2I60L 3U7YL 4R7DA 4DZ8B 4XH2A 4NO5B 1DVFA 3RAJH 4YZFF 3TNNB 3ARBA 1T2QH 1DEEB 3O6LL 1MI5B 4G5ZL 3MO1B 2GEEA 5JUEL 4PV8B 4K3EL 5BS0E 3HB3C 2VDRH 3BAEL 3TBVA 1WFOA 3V52L 2UWEE 4JM2F 2FX9H 4PJBB 3SE8L 3HLAA 4ZUTA 3DRTB 1PYWA 2D7TH 4JQXC 5GGUA 1P6FA 3BE1L 4JFZH 32C2A 3RWCB 2G9HB 2DAVA 1WICA 2ZUQB 4ZNCD 2NXYC 1KCSL 3KYKL 3MRQA 3D85B 3HMXL 4PREB 3MODL 2NY5H 3WO4C 1FP5A 3SQOH 3VFWB 2Q7NA 3MJ9L 4HZLB 4H1LH 1RD6A 5CINL 5KVFL 4YXHL 3HCVA 4QRRE 3MROA 5C0ND 5F7LB 1A3RL 1G7IB 3HPJB 4Z77B 1BQLH 1Y0LB 3BKML 5BRZD 3VFGH 1UACL 5I15H 4WCYH 4BSVB 3T1FA 2H32H 4O02H 3U36A 1RAMA 3RVVC 4ONHB 1AKJA 2FWOA 4M6OL 3PWLB 2YK1L 5FO9B 2DL2A 2PYEE 4PRPD 2HVJB 4JM4L 3IXTA 1I9EA 3K8KA 1M1SA 2VAAA 3BGFC 1AGFB 3BGAA 5B4MC 4U05A 4OAWB 4JQVC 5EOCL 3MUGB 3WJJA 1JZ4A 1EO8H 3HZYB 1S7WB 1KPUB 1NL0L 1HHKB 1TFHA 5F1NA 3JTSA 4JRWA 4RGOL 2W9DH 2DQTH 2A6JB 4OFPA 2CXGA 1ORSA 2EIBA 4AJ0A 4BFBD 3F7YA 1BIIA 5GRWA 5FO7B 2QADD 5T1DL 4DTGL 4XWGL 3IGAA 1DQDH 2B7DT 2MQ0A 3F7RA 5I0DA 1JNJA 2IPUK 4R9HA 3C08L 3F12A 5C0JA 5ISZA 4OSUL 1DQJB 4GG8A 5FO8B 5K9QG 3L1OL 3BZ4A 4DK6A 4XPTH 1S7XB 3V0WL 3OB0K 4G8EA 4PGCA 1B4RA 2AJYH 4NC1E 1HKLH 2NY4C 3QIBB 3PNWB 4DW2H 5HVHB 4QRQB 2AV1A 5HHNB 3B9KA 5B3NA 1NJ9A 3SBWA 4PJAB 1ZTXH 4D9QE 1AGBA 5CKAA 5LGJA 4PD4J 2DQJL 1ZLWK 3TT1H 2FDBP 3H3BC 5BZWB 5D93B 1S7VB 4LKCA 1F2QA 5B22A 1Z9MA 5CWSA 3UBXB 2N1KA 3ECBA 2IAMB 2J8UB 3PWPD 1CD8A 5M95B 1TZGL 4YO0B 3TJHC 3GJFK 4YNYA 1ZGLB 4MJIA 5FUOL 3BRFA 2BRRH 2VN7A 1K5NB 4U1MA 4QTHB 5HYJD 5J12B 1A21A 2AJ3A 4P57A 1QYGH 2HFEA 4PB9L 1CDYA 4KRPC 3FB8B 5FDWA 2VLJA 3OBAA 1J05A 4AQOA 3V5HB 3N0PB 1LE5B 2ARJB 1MJ7H 1CLYL 2IPTL 4CADB 2IMNA 3UTTA 3WXVH 3LN4A 4GRMA 4OGXL 3ROLA 5AZ2H 5IT2H 2V17H 1HIML 1HI6B 2VXQH 2DYPA 1M05B 1M7DA 1LEKA 3T08A 3VE0A 3SCMD 2CGRH 4TTGA 1CS6A 1RIHH 3WCYA 5GJSL 2VR5A 2AXHA 4XNZC 5D96C 5I19H 5HGAA 2DQGH 4G6ML 4JDVB 3GSNB 3P4MB 3UC0L 3E3QC 3QPXH 2AV7B 4OLWL 3AM8A 3VWKB 4H88L 1EHNA 1RVFL 4UT6H 3S35L 2AGJL 1IM9D 3GZKA 3WN5C 2WW8A 4XPAL 4QHNB 2ORBL 2CKBB 3HNVL 4OT1L 4F7EA 1HE7A 5INDB 2DMKA 1YEFL 4G42B 4LQFH 4KJPD 1O7VA 4Y2DB 4LAQH 4X9BA 3G6AB 1PBYA 3D9AH 4JY4A 3U1SL 2GSGB 3MMEA 4CRPA 5CS7A 2YA0A 4JHBA 3WKML 1Q9KB 2HYMA 4A2MA 4CN1A 2QJDA 3QUYA 3EDFA 1BFOA 4JZNB 1YN6A 1SY6H 4M7KL 3QDME 3X14A 3X11A 4LRIC 5DMKA 2HN7B 1CR9L 3PV6B 2GJ6E 3BKYL 2N7BA 3AUVA 4G6KL 1A6PA 3BH8A 1FPTH 2J8OA 3DWTA 4FQQA 3GBNL 1WISA 4OD3H 3TLRA 4G3YH 3ARTA 2EEDA 1GGYA 1LO3H 2OTPA 3IJYA 1KLGA 1T0PB 4L4TA 4Y8AA 3SPVA 3IJSB 3GB7A 3WNOA 1GYAA 1CFSA 3UO1L 3VXME 1ACZA 5F44A 3BIBX 2HTKC 5A3IC 4QT5B 3LRGA 4TOYH 1W0YT 4WFFD 2DTSA 3WMSA 2FD6H 3RAJL 4HUWB 3MZGB 2DJ4A 3RBGA 4DOHE 4IMLB 1MCIA 1OGAA 1T2QL 4O2FA 3V9FA 3U7WL 1OT1A 3E6FA 4ZUSA 4WO4C 4GW4B 3EFDH 1N4XH 5MP6H 2AK4D 4TNVK 2VDRL 4BELD 2P5EB 4O2EB 4NRXA 4Y88A 2NTFA 2Y6SD 3IDNA 3QCUL 4HEPG 3TESA 3MNVB 4YJZL 5CBAB 5EZIH 2C1PB 3QUMH 4GG6A 3MV9A 2D7TL 3TBYA 5SV4A 3SGKA 3RVXD 4JFZL 1S7QA 4GMSL 4ZS7H 5DA0B 4OZGF 5H2BB 5GGSA 3PABB 3ZDYE 5C9JB 3MPCA 4HWNA 3REVB 3VFOA 1YN7A 2KDGA 4MNGB 1A22B 5TE4L 1DBJH 1GGTA 2NY5L 1RZIB 5EU6D 3SQOL 1BPVA 4LLYB 1H8NA 4Y4FB 4Y5VC 4HWZB 4ZS6C 1EERB 1N0XH 1FH5H 4PB0H 3MV01 4X8XA 1IGJA 1BQLL 2H26B 4PD4K 5HHXH 3VFGL 3ROOB 4YK4C 4YPGA 5I15L 4WCYL 1CG9B 3X3FH 4O02L 4ZFGL 4I5BA 4LVHB 3B5HA 5JXAH 4N1HB 4K8RD 3MRLA 2D0FA 1QFOA 4JANB 1W0WA 3VWJA 1FNGB 5IEHA 1KGCE 2J2ZA 4F15C 1CD9B 4R6UA 1XF4B 3L95B 5I2IA 4NM4L 4P2QD 3MCKA 2W9DL 4OZIE 2DQTL 1RU9H 2IWGA 3CFKA 1I3RB 1LK2A 3PHOB 4GLRH 3PJSB 3C5JB 1DQDL 4LSQH 1QFWH 4PTUA 4YQXH 2A6KB 4FABH 2A38A 2R1WB 2ZOLA 2FJFA 4Z7VF 2MKLC 4NNXA 3H2WA 1A7PH 4OV5A 3TYFA 3U0PB 3PXJA 1GOFA 1YC8A 5C0FA 4MA3B 4YFLF 3C8KA 1P4IH 4XPTL 1WBXA 4JLRB 2CLZA 2Q1EA 5DMGC 2AJYL 1HKLL 1TZHA 4EI5B 4DW2L 1ONQB 1MREL 1C5BH 3BP4A 3DUSB 4ZAKD 4OGZA 3G5XB 4XNQA 3BZEA 2NZIA 4L9LA 1ZTXL 1G6VK 2P49B 3VFMA 3VGGA 3T04D 3D18A 3WDIA 3TT1L 2C3XA 1XGUB 4JFOB 3CXHK 2Y9RT 5IK3A 1BZ9A 4Y5YB 4LLVA 4NQED 2ZUUA 1ED3A 3C09C 1HN1A 5HJ3B 1IQDB 2BRRL 2NCMA 3HC0A 1FN4B 4PR5B 3TN0A 5BS0A 3ARPA 4Q9BA 4U6VH 5EU7C 1QYGL 2UWEA 3SDCD 1NCDH 4HUXA 2CK2A 4NC0B 1N3NA 1MJ7L 4NRZB 4PJEF 4W6YB 3VD5A 3PWUA 3UX9B 3MRMB 5C71A 4PTTB 4PJ9B 1YNKL 1FL5A 1BVKA 4Y4HB 2A9NH 4K7FA 1N2RA 1NSNH 5AZ2L 1FJ1B 5IT2L 2DIBA 2DWDB 3E6HB 5EUOE 1NBZA 1XCQA 4QXWA 2Z31D 1RUMH 2EDDA 1MVUA 3MJ8B 4HH8A 1A1OA 2CGRL 4MXVE 1RIHL 5E1AA 3HRZA 2DN7A 3QI9C 2MNUA 4XZUA 4QRRA 1QSFB 1MCLA 1WWWX 1H15A 5I19L 1K2DB 2DQGL 5BV7B 5CUSH 4IRZH 3QPXL 3QEGH 3UAJD 4K8RH 5IM7B 5E9DD 5C3TA 2BHYA 5E6ID 2GTWA 4UT6L 4EXPX 4PGEB 4LPVA 1PKQB 2PYEA 1SM3H 4LCYA 4UQ3B 3X13A 1R3JA 1BVLA 4RSVA 1G84A 1EH9A 1MCFA 4LQFL 3IFLH 2EIZB 4LAQL 4J4PC 1WFUA 5I1JH 2BRQA 1HHJA 5F9DC 3D9AL 5MENE 5ICZB 3I6LD 3V2AR 2VQ1B 4F7MB 5F9AC 1XCTB 4XCEA 4ODWA 1DBAH 3MJ7B 3QEHA 3WSQH 1JGUH 1KB9K 3C9NA 5K33A 1TVDA 1XF1A 43C9B 3GNMH 4WY7L 4BH8A 4OD3L 2KKQA 2XKNB 1WEJL 4G3YL 3J8F7 3FFDB 4N8VG 5HYIA 3D2UA 1LO3L 3RNQA 5EUKA 3JWOH 5L88H 4O51A 4MS8D 1CD0A 5IMKB 2DDQH 5EBLA 5T1MA 4XP9H 3ILQC 5HHPB 2VE6A 1AXTH 4ONFH 4TOYL 3VU2A 1VFUA 5ALCH 3GBMH 1WVZA 4FMFA 2FD6L 1J8HB 4I9WD 5D1XA 3FQRB 1P69B 3HE6C 2JCCF 1NEUA 3EFDL 1N4XL 5MP6L 3SJVE 4O2CB 2YR3A 1A14H 2BNRE 2EIEA 4Z7VE 5HGBB 3ARGB 3T4YB 1YY9C 3QIWA 5GISL 2W9EH 3L5HA 5EZIL 1F8TH 2VUOA 4Z76A 4Y5XA 3RWFA 5DSCB 1W8OA 2P8MB 1F4WH 4ZS7L 3B3IB 4LPTA 4YHYC 4R7DB 1FCCA 4L3EB 1X5LA 4XH2B 1DVFB 5DRWB 4PRIB 1P2CA 1DBJL 1F11A 2D31A 4FQCH 4ETQB 1K8DA 1QRNE 2DLGA 4EXKA 4FQHA 5SWZD 4NO0A 2F53E 1KJVA 1FH5L 2UUDK 5CP3A 3TBVB 4LK4A 4LLMB 5ID0A 2RBLA 2IEPA 3HLAB 3STZA 1KSRA 1UADC 4R90H 5HHXL 1U8JB 4MQXD 5EO9B 1PYWB 1SHMA 5GGUB 5SWSB 4RQQA 1AR2A 1P7KB 3X3FL 32C2B 5JOPD 4QOKE 4R4BA 5JXAL 2EC9T 5FOJA 5DMYA 3QEQD 4HIEA 5IIEA 4ODBD 3MRQB 5KJRH 4HUMB 2XA8H 3HHRB 5I73B 2HP4A 5CSGA 1X44A 4QF1A 4N8VB 4NP4H 3UTQB 4MHHG 4KKLD 2P43B 4IEFB 3HCVB 5E99H 1RU9L 5GRXG 3S7GA 1IJ9A 3SE3C 2HJFA 1QVOB 4DZBB 3OB0H 4KJWD 4LSQL 1QFWL 4YQXL 2QHRH 3A6BH 5I1LA 2JB5H 1Z6JT 4X8JB 4FABL 3QDMA 3WIIH 3SDYH 3S3JA 4F7PA 2GJ6A 3IXTB 1A7PL 5TF1H 1SBBA 4L3AA 4H26A 1A6WH 1BMGA 1P4IL 5I6XC 1IEHA 1U91A 1ZLWH 3FHQA 4ODUB 5FA4A 1NC2D 4KGJA 2QL1A 2MCPH 3JTSB 3LH2H 2V9TA 4LBEA 1I1AB 2DKSA 4RAHA 1C5BL 2VDOH 1KFAH 3QWOA 5GZNC 5SWQB 3GJFH 1ORSB 3EYVA 2FYYA 2CXKA 3GMLA 3VXMA 5FXCH 4APQB 3RZCC 1T5WB 1RMFH 3BYTA 3F12B 2OSLA 2HT3D 2YZ8A 3N1GC 2OI9B 4P23B 4JFDD 1AY1H 4GG8B 1CVSC 5KG9A 2G5BB 4QXGH 4G8EB 4PGCB 4U6VL 5IW1A 2LU7A 3TBSA 1NCDL 5KVGH 4PJ8A 1NJ9B 4X7SH 4YE4L 3TA3B 1ACYH 1I7RA 2MPAH 5DXWA 3ILPB 3JUZA 5CD5C 3PQYE 2A9NL 5CWSB 2VLRB 3MLZH 1NSNL 5A2LH 3SDDD 1G9MC 1Q72L 3GRWA 4G9DA 3EJYC 5FYKD 4B7LA 3ARSA 4MAUH 5F7DB 1RUML 4YNYB 4HJGA 3VXRD 5DRXA 2AJ3B 3UTSB 1XGQA 3E8UH 3ZE1E 4MB3A 4EIGB 2JIXA 4FFVC 1JP5A 2CIIB 5JW4M 3PGCA 4J3VA 3WHXB 1KG0A 1B0RB 2JCCE 4MJ4A 1I8KA 5CUSL 2DQUH 4IRZL 5C0CD 3QEGL 3RBSA 4S10A 4K8RL 2OL3A 2X6MA 4RGMC 1TTFA 2GAZA 2N56A 2PXYA 3FQTB 5BW7C 2BSSA 1KPRA 3FT3A 4OUUA 3LN4B 1SM3L 1FORH 3HC3H 2DICA 3EJZC 3STLA 3MV7D 4ODTH 1NBVH 3B9DA 1LEKB 3SE4C 3SO3B 5AWNH 1BP3B 4LOUD 5IHUH 1CICD 3IFLL 1XGPB 3QZWA 1FLTX 2FHCA 5I1JL 1TCRA 1T2JA 4E0RB 4OZIA 3H9SE 1IC7H 5I1IH 1E4WH 1JYWA 5F89A 5DGQA 4XBPB 1J0HA 3KPPB 3WSQL 4LARH 3HNSH 3MA7A 1NFKA 5KZCD 4M43H 3GNML 5IR1B 2NY1D 5E8DH 1BZ7B 4LRNH 1U8QB 1AE6H 1FFOA 2FECI 2I24N 1XF5A 2MMXA 3W11C 2DM7A 5DD6A 2YXMA 4FS0A 3CFJA 4Y2DC 3JWOL 5L88L 3CSGA 3LRSA 3Q0HA 3MMEB 4Y4KD 3GSRA 4X5LA 3K7UA 5IOPB 3GGWB 4XP9L 4QXTA 5J13C 1AXTL 4ONFL 3MGTB 4R2GD 5ALCL 3GBML 1CT8A 3X11B 1UWXH 4K3GA 4FQXA 3RL1B 3OXSA 3BH8B 5DTFB 5CLTA 2NY7H 4PBVC 4FQQB 4ZUUA 4RIRA 3IDMA 3L3GB 1F97A 5BOPA 1VB9A 1A14L 4ODXB 3AXLA 5E95B 3HMXA 3BMVA 2VLKB 5JHDB 1OTTC 5JNYA 2W9EL 2FGWH 3MJ9A 1F8TL 3S96B 3GB7B 4LEXH 4QY8A 1PG7H 2DTMH 5BRZE 5L2JB 4NC2B 4LCIH 1F4WL 3MUZ1 1P9MC 1YC7A 3IVKA 3VXQA 2YUXA 2J12B 1ZHLA 1Q9WB 1GOGA 4X7EC 5C0GA 4PRPE 1TQCB 4FQCL 5EUOA 2UZXB 4ISVA 3PHQA 5KANI 4B53A 5BXFA 1KBGH 4NKOA 4WW2B 5BO1L 3WNMA 4P0DA 4NRXB 2NTFB 5CGYD 5TQ0L 3GBLA 2OMBA 3LQMA 2EEAA 2BVYA 5T1LD 4U49A 4R90L 1DQLH 2PW1A 3GSQA 2Z35B 2IH3A 3WUZA 3F7VB 2OP4H 5GGSB 4KKAC 1D5XA 1K3ZA 3FO1A 5KJRL 1YN7B 2XA8L 4J3UA 5I17A 2W0KA 5IF0A 1DLHA 4YC2C 1AXIB 2WUBH 4OZHB 4NP4L 2OK0H 5I1DB 2ERJC 1DTUA 4NQXA 5E99L 3VFUA 5DURD 3FT2A 4PJCF 4YHNB 4QHKJ 5DUMH 5MENA 2L7JA 4GKSB 2EE6A 4YPGB 3MTRA 3JZ7A 3DTXB 4JN2A 4MA1B 2QHRL 3A6BL 4AEHH 3MUHL 2JB5L 4LVHC 1G7LA 1JYNA 2VIRB 3MBED 3RNKA 3SDYL 3WIIL 3MRLB 5HGHA 3DGCR 5TF1L 1I1RA 3PWPE 3DGGB 3UZVB 1A6WL 2I27N 1MNUH 2K7QA 2X70B 3VFRA 2WK2A 1S5HB 4JRXD 3C6LB 1MLCA 3WIFA 2HKFH 3PP4H 2MCPL 4B41A 5HYJE 3LH2L 1N59A 4R7NA 5D2LB 1KFAL 2VWEC 3O3UN 1L6ZA 4H20H 5T5NF 5D7IF 5DJCA 4P5TB 3CMGA 4WWKA 5EBMA 5FEBA 2PTVA 4ZXBD 3W9EB 1NLBH 1IAIH 5IFAH 3BH9A 1RMFL 3ULVC 2FJFB 4P46C 4K9EH 4OV5B 1HQ4A 4HIHB 1I9IH 2FSEB 2BVPA 1YNLH 1Q9LA 1CFQA 1WBXB 4QXGL 3SJVA 1UGNA 4HIJA 4LFHG 2BNRA 4GH7B 4MXQC 3UTZA 1JWSB 4Z7VA 5DHVA 1NGXB 3RTQB 4KVCH 4XNQB 4X7SL 1G6RB 3DUUA 4XPBH 1ACYL 3VFMB 5IVXE 2MPAL 1CGWA 1QFHA 1W2KT 2LVCA 3QWQB 3MLZL 1IGYA 3U0WL 3P73B 5FM5O 3C60D 4MAUL 4NKMB 3LKQA 1QRNA 4Q97A 4MAYC 1M71A 2WQ8A 2B4CH 2F53A 3E8UL 5MERA 5F7YC 1I9RH 2Y72A 2UWEB 1NMBH 1YQVH 3U30C 4GKZB 5E4IA 2AJZB 3QQNA 2C4FT 1X5HA 8CGTA 2DQUL 1N3NB 5EIQA 1T22A 1KPVA 4RBPK 5KVMC 2W91A 4UBDD 4QOKA 1FL5B 1BVKB 4K7FB 1N2RB 1FORL 3HC3L 4F3FB 1P53A 4ODTL 1XCQB 4HUUB 1NBVL 3K80A 4RNRB 4XGZB 2VDNH 2PO6A 5AWNL 5IHUL 1LVEA 1A1OB 3BFOA 2BVEA 4RGND 3HRZB 4K7PH 1NAMH 5DRNA 4HLJA 4QRRB 4HWUA 1IC7L 4IOIA 1H15B 1KXTB 5I1IL 1E4WL 3I3EA 1X5ZA 3NCYS 1OAQH 4KUCD 4U1KB 3BPCA 4WFHD 2NW3A 4NDMB 1EJ6A 1H0DB 1K8IA 4WFFE 1KB5H 1JPGB 4LCYB 1UA6H 4M43L 4WI9A 3EBAA 4HHAB 3X13B 5E5MB 1D9KD 4YFLI 5E8DL 4LRNL 3BO8A 1AE6L 5ICXA 1H8SA 2QSQA 2E7CA 2XN9B 3JVGA 1U95B 2AK4E 2PF6A 1P6AB 5K9KA 1L0YA 4Q2ZA 2EICA 4D9RD 4DN4H 3GSOA 4JRYD 4RCAA 4LGRB 3QNYB 2ICWJ 3SDAC 2NY2D 2X4NA 3MOQA 1AO7D 3QJHB 5JIHA 1Y18B 4XCEB 2ZUTA 4ZFOA 1U8OA 1S7TA 2XG5A 4I48A 3UJTH 3VG9B 4M6MH 3N9GL 4WUUD 2NY7L 5EU6E 1KJMA 1SEBA 5DS8A 1RQ5A 1MPAH 4JE4B 3UYRH 2EDRA 4S1QH 3D0VA 5EUKB 1U8MB 2FGWL 4H1LA 4LGSB 5E6YA 3QYCA 1PG7L 2DTML 2LAAA 5EBLB 1D7FA 4LCIL 4UILH 1S9WB 5GGRY 5LGKA 2C3VA 2UUDH 3FN9A 5C08B 5LGHH 2XZAH 3OKKA 5C92A 5D7LA 5KTEL 3PQYA 1FL6A 2H32A 5D7IE 3EYQD 4EN3D 5C09D 4H8WL 1OTSD 4JO4H 1ZOXA 4LHUB 3O6FC 2XNAA 2BCKB 4P2QE 2W0LA 1NC4D 3QIWB 4H0IA 5I75C 5CZXD 4G8FA 1DQLL 3QQ4B 1N5AA 3PL6A 2CKNA 4FMKA 1OAZH 3T0EC 4PYHA 1U8KA 3HA0A 5E7BA 2OP4L 1AR1C 5D7JD 4F37F 1CLOL 1FVDA 1DVFC 1P2CB 1F11B 4WV1A 1DUZB 1K8DB 3ARBC 3WLWD 2WUBL 2LVEA 3TT3H 4B50A 1MCWW 2OK0L 3MLXH 4M6NH 1UENA 5ID0B 5HDOA 1S7RB 3CPLA 4NPYA 5DUML 4FA8A 1LO0H 3H9SA 4OTXH 1ZAGA 1P7QD 5J0BA 4HQQH 1ZSDB 2HWZH 4AT6A 5DJ6B 4R4BB 1XF3A 3D85D 2MSPA 3NFNA 4LPYA 3WFEH 4JM2B 3PUCA 1CXKA 3R4DA 5IKCA 2XG4A 5IVZA 1MNUL 3VGAC 5L9DH 4NQEE 3LVEA 4RMWA 3QRFM 3MRBA 1UCTA 4KI5C 4IRJD 1AGCA 4LMQE 2HKFL 1A9EA 3IU4H 1IKFH 1T20B 1YPZF 1FAIH 3MOBH 3D69A 4H20L 2Q3ZA 2AXGB 1DR9A 4OGAC 4R4FH 5JOFA 2Z8VC 1QFPA 5AD0A 1NLBL 3QXUA 4WJ5B 5H94A 2BJML 1IAIL 4AG4H 1QLFA 3V4VH 4ZYKA 4K9EL 2GJ6B 1I9IL 2B8OT 4HLZH 1YNLL 5ID1A 1CFVH 3WJJC 2W9LA 2NY3B 5EBWA 3OR7B 5DMIH 3F7PC 3H8NA 2OM5A 4QRSA 1A2YB 3R8QA 1F6AA 4KVCL 3EYVB 3QNZA 2ED7A 4O5LH 3I85A 5DUPH 5L2KD 4XPBL 3ULUC 5HHQA 1ZVSA 5BRZA 2EKSA 1X7QB 2GITB 1N8ZA 1EHLH 5E9DE 3OV6A 1MJ8H 2XZCH 2VISB 1RV6X 3DARA 3IDYC 4KDWA 5J89A 4JZOB 4PRPA 3UXFA 5C0IA 3CVIH 1G9NH 1HQRA 4AYFA 1W72B 3Q5OA 5D1QB 4NZUL 3QIBD 2B4CL 1E28A 5JW3L 3VXSB 1MCWM 3TBSB 1I9RL 1EJOH 4CUCA 1NMBL 2L7UA 1FNHA 4PP2A 1CDCA 1F3JA 1CTNA 1WCQA 3FO2A 4M61B 3B9KC 3I6LE 3SBWC 3TH2T 1T4KA 4AK1A 4YXKH 4Z95H 3FO9B 2IAMD 4W6WB 3MCG1 4XP5H 4WEUD 3V6OC 5IEKB 3PWJA 3EGSA 2J3SA 5KOVC 2DL9A 4ZNEE 4N5UA 4HUNB 4NQUA 1NGPH 4XVUC 4X6BA 5I16A 1R3IH 4RX4D 3UJIH 2VDNL 1NEZG 4CU6A 4OM1L 3CUPA 4AIZA 4K7PL 1JRHH 1YMMD 1F3RB 1KG0B 2XQBH 2APFA 4UNTA 1OAQL 2ZCHL 3HS0A 1ZT1B 3RVTD 2BSTA 4BQCA 2PXYB 4U1SA 4NQVA 2R69H 1KPRB 2Q76B 1MAKA 1KB5L 4I9WE 3RDTB 3UCRA 5L0QC 2VKWA 3DX9A 3PWPA 2WLYA 5DEZA 3CDYA 1RJZA 4G43B 1TJIH 4WVRA 1NAKH 4I0KA 1MJJB 5D5MF 1ROWA 4LCCA 5CCKH 5HYJA 4LNRB 3QXAB 5JDJA 3MV8D 4MLSA 1FE8H 4Z5RB 3IS1X 3VWKD 5F89B 3O4OB 4W4NA 4DJMA 4MGXA 3QFDB 3AM8C 5DJXB 3CVHB 3OKNB 3EAKA 1N5YH 3MA7B 4FQLH 1HYSC 3G9AB 4M6ML 2AKRA 1EAJA 4ZFZB 3VD3A 4WIQA 4ZUVB 1LGVA 4P5MA 4JKPH 1HILA 1MPAL 4K3DH 5SWZE 3UYRL 4S1QL 5IJKA 2C1OB 1IGFH 4LLUB 3SCMA 3LRSB 1G7QA 1UB6A 2AXFA 3E2HB 3Q48A 5LBSH 3QDJB 1GRWA 3BXNA 5EOTB 4X9GA 4UILL 5IVXA 1G7MB 4JDTH 3DIFB 5DI8A 5JOPE 2CDFA 5LGHL 4D0DA 2XZAL 1NGYA 3MRDA 1JF1B 3GMNA 3QUYC 5DHYA 1WBZA 3B8SA 3QEQE 4ESKA 2E7LA 2HH0L 2X5PA 4OBRA 3VH8A 3OXSB 1IM9A 2CSPA 1UH3A 5ESQA 3TBTA 3IDMB 3RRQA 4HJ0C 2D3VA 5C0BD 3G6DH 3RP1A 3QDGD 2A0LD 4JO4L 1FZMB 2QBWA 3LMJL 2PETA 3ZE0E 1WWBX 3HZVB 4P4RA 3CH1A 1HCVA 2DF3A 2DJSA 1XR9B 1FZOA 2X4UA 3ARED 4JPVL 1OAZL 1DJSA 4CMHC 1Z0MA 4JFYB 5KSUA 4NZTH 3VXQB 1ZHLB 1IL1B 5C0GB 4IDJH 4OF6A 4E5XB 3E1F1 3PHQB 1FZKA 2P5ED 4J1UB 3TT3L 1M6OA 3D0LB 1HXMA 3QO1A 2P8PB 3MLXL 3P11H 4JDZA 4M6NL 1XZ0A 3TCXA 5BVJA 3RUGF 3H42L 4ZFFB 1LO0L 3V5KB 4AEIL 3LSOA 3NA9L 4OTXL 2PW1B 4KV5E 1H3GA 4UV4L 2ZUVA 4HQQL 2XV6B 1VEMA 2HWZL 3EO1A 4YX2L 5HYSB 5MEQA 1NDMB 2COQA 3EFFA 3WFEL 5C9KA 1D5XB 1JZ3A 1P7HL 4CU8A 3P9MB 5TQ2H 2EH7H 1R5IB 2IAND 2APXA 4Y4FD 1MAJA 5L9DL 5IF0B 4FQ2H 1KOAA 4JFDE 5DK0A 4YEFA 5F71A 4ZOEA 3O6KH 5FDYA 4OZGB 1IAKB 2AK4A 5I8EB 3OG4B 5A16B 3HFMH 5DHXB 1IKFL 1RZGA 3VFUB 4L4VD 5DJDA 3MOBL 3NPZB 4ZOAA 4CVXA 4R4FL 2YEZA 2VDML 3MFFA 1A5FH 4YHPA 1A8JH 3O9WA 5GQBA 2CKBH 4AG4L 1T80A 5C07B 3M1BA 3V4VL 1JWUB 3OGCA 4HK0B 4PRHD 4OKDA 5FYKE 5ENWA 3VFRB 4NUJB 1G0XA 1CFVL 5EU6A 3KPQB 3VWJC 3VXRE 5DMIL 3DBXB 1N59B 3EO0A 3KPSB 4Z7QF 3SGEI 5GIRA 2HMIC 3DLQR 4Z0BH 4BJLA 5DUPL 4O5LL 3D25B 4ZPVB 1D6EA 1C5CH 2P24B 5KSVB 5C0CE 5DQ9A 2XQYK 1MJ8L 2V5MA 2XZCL 3TC9A 4NYLA 2BVOA 3O3AA 4HK3N 4M6AA 3PDDA 4ZTOH 4K3JH 5D7IA 4PRBA 1G9NL 1GGIH 3MV7E 3VXUB 3EIFA 2I07A 1DFBL 3NPSC 3QCVH 4L1DA 4RBPH 4EI5D 3D6GA 1Q9LB 2WP3T 2YOCA 4HIJB 1FRGH 2BNRB 3QUZD 2VZ3A 3O4LB 1EJOL 4HDIB 4PGZA 2M1KA 4Z7VB 4JFXA 4LIQH 4P2QA 4MQTB 5FCUH 3QAZC 4J3WA 2RFXB 4JPKH 3TPKA 1T66D 4L9LC 2AEQH 5DVOA 5ACZA 2EC8A 2A1WL 5ETUB 4YXKL 3I2CH 4KKBD 3VRIB 2BXYA 3MACH 5CLWA 4KRLB 4M48L 1J0IA 4C4KO 4RMQA 4TSBH 1P1ZB 4I4WA 2EDFA 1FDLH 1NGPL 2BY1A 1BJ1J 3QQ9D 1R3IL 1I3UA 3UJIL 3RL2B 4PGDA 2GHWB 3TN0C 4WTWA 2CRIA 4L8CB 4PJGF 1R5WB 5MERB 1JRHL 2YRLA 5I1GH 3OL2A 2BHZA 5CJ8A 4V1DD 5EFIA 1H3TA 2XQBL 3ALXA 3ZDXF 3FONA 1YJDL 3RWIA 4JFQB 4F58H 1JL8A 4JFPA 1T22B 1HHIB 5HPOA 3TH4T 2FEEL 4X4YB 2FATH 4FN0A 4MSWB 1OQOA 4QOKB 1HHGA 1XMWA 2R69L 3CZFB 5GS1A 4KJQD 4G9FB 1LWRA 5A40E 4LLWB 4ZTPH 4NQEA 1TJIL 4PJEB 1BREA 4PJ7F 1KEGH 2PO6B 5CCKL 4FP8H 1C16B 5L8LB 4Z7WF 3QXDA 3VI3E 4LF3A 1ZHNB 3ES6A 3SDCA 1FE8L 3OR6A 1X5FA 4IRSD 3W39A 5C8JA 5HI5C 1EHAA 1RZKC 1K8IB 1WC7B 5EU5B 1ZS8A 1UH4A 1N5YL 4FQLL 4NN6B 1BGXH 4J7RA 1DLFH 3FMGH 1NMCC 6CGTA 4OZ4B 4W4OA 4X5WA 5HI3D 3S4SG 5B21A 2Z31A 5IBLD 4PJ5B 4KUCF 1T6VN 4JKPL 5DC9B 5AG9A 4ZODA 4K3DL 2EKJA 1BLNA 2R8SH 4Q2ZB 3JWDH 3CSYA 2F19H 5DVLA 1IGFL 4K71B 3GSOB 2I9TB 1U93B 4CN4A 3LD8C 4MB4A 4NT6B 5LBSL 3NTCH 3ZYOA 1QFWM 4PGBA 5BJTA 2JB6A 4JDTL 3PXHA 4ZFOB 2HA1A 3VD4A 5E9DA 4LLQA 3PHSA 5E6IA 3NFSL 3O3BA 3IKKA 5I76B 3CSPA 3KLSA 4U2ZA 2E9IA 3WDHA 1T04B 3DPBA 1KJMB 4XP1H 2XOTA 3G6DL 4O4YH 2ADGA 2YRPA 2Y5TA 3BJLA 2ZSVA 3EOYG 4KK6D 5JZ7D 3KLHD 5JIIA 3G08A 4NC1C 1T1ZA 3O11A 2MQ3A 3ARWA 3T3MF 1HDMA 4LASH 4HG4K 1J8HD 3DVNA 2JJUA 4YHLL 4HGMA 5J6HA 2V5SA 1FL6B 5K9OB 5GGVY 3FTGA 5D1XC 4KXZI 4ZNEA 5B39G 1T6WA 4XT1C 3P77A 4X7TA 4JRXE 2FEDC 1GGBH 3ARGD 2WIMA 3V95A 5E5RB 1CDIA 1FVCA 4POYA 4P2YA 3QDAA 3UTPD 3DI2B 5D6CB 2X4RA 3G5ZB 3PF2A 4EIZC 4PJHE 2JCCB 1YYMH 2Z92A 2WBJB 4Y5XC 5E0QA 4S11A 4WW1A 2DRUA 4L3ED 4M93B 4M00A 2GK0A 3GJFA 2AJXH 3DRQB 2GY5A 4ZUWA 2EYTA 3TIEB 4PRID 1FVDB 3BIKA 2F54D 4MVBC 5TQ2L 2ZKHH 2EH7L 1JPFA 1KTDB 4TTDC 4FQ2L 5DQDH 1FSKB 2DJUA 3LV3A 3O6KL 3NGBC 4J3XA 5GS3A 5BV7H 3GSNL 4TNWF 3S37L 3V6FB 3HFML 5HHMD 4LCUB 1WITA 3GFUA 3OKMA 3EYFB 4OQ1A 1T21B 1TTGA 4MD0B 1RURL 5SWSD 1B0WA 4KUZL 5JPMA 2NXYD 4JREC 5TJWK 4Q6IC 1U8HA 3IDJB 1A5FL 3BKJH 4AT6B 4RDQF 2CKBL 5ADOL 4N0UE 3NFNB 2Q8AL 1OD9A 3BUYA 4CW1A 2GCYA 3CFIC 4ELKA 5IKCB 1EGJA 2V7NA 4MD5B 3M45A 2VLMD 6FABH 1EEUA 4TUOB 4XX1G 2RQ8A 2DM4A 2X1WL 1UZ6E 5SWZA 1U0QA 1OF2A 4WTZG 4YUEH 1ES0A 5E7FA 4DWHA 4F33B 2FLBT 1C5CL 1UB5A 5AD0B 4KK9D 5B4MD 3T0WA 1CI5A 3QPQC 1IEAA 5JXEC 4PLJC 4Z7WE 3V7AE 3TO4B 4ZTOL 3QEQA 2NZ9C 4K3JL 3TVMB 3VMPA 1GGIL 1FYTB 3QCVL 2DI7A 4U7KA 3P40A 3NIGF 5HVGB 5IMMB 1A4KA 1FC1A 2QKIA 4HIIB 5A1AA 4RGNE 5MEOA 1F6AB 1T5XA 5FCUL 4JO1H 2OMNA 3BQUA 4JPKL 4RMVA 1JGVH 1B4JH 4JPIB 4APQD 2AEQL 3G5VB 1OSPH 3I2CL 5BRZB 1QPXA 2EKSB 3L3OA 3HZKA 1CLCA 4WFHE 5INCB 1QO3B 3QWRD 1HH6A 1W8NA 4P23D 4TSBL 2PTTA 4HCRH 2EDOA 3KXFD 1FDLL 1S9YA 4M1DH 4OQTH 3DV4B 4NJAH 4BM7A 3RHWF 5GS0H 2DMBA 1N26A 1E28B 1SVZA 3WEXB 4NZJA 3RX8A 1NC2A 5I1GL 4PP2B 2BY2A 4D9RE 4L8SA 3TA3D 5ICYB 2V5YA 4JRYE 3FO2B 5CILH 2IJ0C 4PJ8C 2EDJA 4F58L 4OFDA 3V8OA 1MFDH 1AO7E 2O5YL 2VLRD 4GQPH 4Y19B 2FATL 2V7HA 4Q58C 1B0GA 2F74B 2C7UB 3PWJB 1JN6A 3K4ZA 1JYVA 4UT7H 3DX8A 1ZE3C 4ZTPL 3LOWA 4P2RB 4KRPD 4WUUE 4X6BB 4M5ZH 3UTSD 4JFDA 1A6VH 1KEGL 4AENB 2NX5B 4U6XA 1AGEA 2V2XB 3VXTA 5HVFB 4FP8L 5JW4N 4XAKD 3UTOA 4MD4B 5F8RC 3Q3GA 1YMHA 2P4AB 1LO4H 3HE7C 2IALA 3L3HA 5CP7A 4O9HH 1ZT7B 3P9LB 3FL7A 2BSTB 4PRAB 4D94A 5BOZG 5AAWA 1DLFL 3FMGL 3HI1A 1JTOA 4Z78A 4M4PA 2YD1A 5MEPB 3SDDA 2YHGA 1JNHA 3LRHA 1CDGA 1F3DH 4BH7A 5C09E 3VXRA 4CAGA 1EFQA 2R8SL 1UZ8A 3JWDL 2F19L 4LCCB 5HYJB 5DJAB 1LE9A 4BZYA 3NTCL 2EDLA 3BEVB 1QSVA 3ZLQC 3OG6B 4Z9KB 5C0CA 1EEQA 3PGFH 1QR1A 5C0EB 1U3HD 3P0GB 4I1NB 1J18A 4YLQT 4X7CC 4NHCH 3RQ3A 1B90A 4LSTH 1IGCH 3MV7A 4XXCA 4XP1L 4O4YL 4X6FA 1U41A 4P5MB 3HUJF 4PY7B 3AS2A 4OLZH 1CICA 5L8JB 5ERWA 1UB6B 4QHUA 1IMHC 2MJWA 1QR4A 3B2UC 2ZUXA 1SMOA 4UTBH 3WNKA 1UM5H 1WBZB 1P84K 1KJ2B 3MNWB 4FZEH 1DN2A 1U2CA 1U8LB 4FQXC 1UQSA 3OQ3B 3VFSB 1QBMH 4R96B 4NSKB 1GGBL 2VLKD 5JHDD 2A77H 4LU5L 4UIKH 1CD1B 4YIQA 5A3ID 3CNKA 4XP4H 5FOBB 4OZFB 5J3HC 2R0LH 2X4SB 3CH1B 3CLEH 4Y4KA 3F8UB 1YYML 4HWBL 5D9SA 2P7TA 1CDBA 2JTDA 1NCWH 5L8KB 2AJXL 3OAZK 1MFNA 2NXZB 3C87A 1NBYA 2OTUB 3UEZA 4WI4A 2ZKHL 1E4XI 5EIVA 1M6OB 7CGTA 5DK3A 5F97E 5BV7L 2ZG3A 1XAUA 4JDZB 3KYMB 1I7UB 4EUPB 3LSOB 2UYLB 2YPVH 2ZJSH 5L2KE 2LTQB 2ATKA 4XNYH 3BKJL 4YDJA 1UJ3B 5D1ZB 3EFFB 2DLFH 4HBQA 5DQJA 5D2NB 5KN5A 1T1XA 2DQDL 4B7IA 4ZS6D 3GSVA 5I71B 3DMMB 6FABL 3MRKB 1P4BH 3QISA 5DK0B 2AJVH 2LABA 3GHBH 1RZGB 5FGRA 5K9JH 3V0VA 3IETB 4YUEL 4QHMA 4CVXB 4YAQB 5T1LA 1RJYA 5CEXB 4WI5A 4YHPB 5DJ0A 5FKAA 4IBLT 3OJVC 1C12A 3M1BB 3OGCB 2A73B 3ARFB 3SKNA 1S78D 4PJCB 2ICEA 3C6LD 3HAEB 5ENWB 3DETC 1D3CA 1L7TH 1KIPA 5EU6B 3ZZ1A 1T0MB 1RK0B 1MHPH 2OR7A 1D6VL 2GTZB 1KNOA 3FT4A 3K8MA 4ORGB 5E94A 3OJDA 3T65A 1YMME 4JO1L 1TQBB 1B4JL 1D6EB 1OSPL 4WWKC 2A9MH 3LKPA 5DQ9B 3DO7A 3LIZH 3DV6A 4NYLB 2BVOB 3MBEA 4HCRL 5D7IB 2D4FA 5FF6A 4M1DL 2OYPA 4OQTL 4P2CG 4NJAL 1NCAH 3GJEA 2JK5A 4M8QA 5GS0L 4CVUA 1KB5A 1JFQH 1IGTA 4JRXA 3QO0B 1K4DB 3RTQD 3OMZA 1EAPB 5HPMA 4P3WA 4OCSH 5HHOD 2GY7B 2XY2A 4Y16B 4M62H 5IB4B 2WINA 1GH7A 5CILL 1PDKA 3AU1B 3MV8E 4PJHA 3KPOA 3EOAB 1MFDL 3WFBH 5JR1H 5LWYH 4ZXBA 2VZOA 2ADIB 2J5LC 1KLFA 4UT7L 4XCCH 3MRGA 2NYYD 1R24A 2R2BB 4M5ZL 4AL8L 1A6VL 1V05A 1G7PA 3QUXC 4PGDB 4O00A 1ZXQA 2D9CA 2R1XB 4QWWC 1IARB 4NGHH 3WUWA 3S97C 4TYUA 5FYLH 1LO4L 5IB1B 4ZAKB 1B2WH 3RWIB 4JFPB 4WDIB 5F9OH 2EXWC 2FJHB 2XKSA 1E27A 1QPPA 3OX8A 1A47A 3BHBB 1T83A 5F6IC 5F96H 4N0UA 5HYFA 4A6YB 5CEYA 5GS1B 3WE6B 5I18H 1RUKL 5LJYH 2XZZA 1AXSA 3C60A 3LZFH 1J86A 5C0BE 5TGBB 4M3JA 3OSKA 3CFBA 3QDGE 2HKHH 1J7VR 1RUAH 3EYOB 3OGOE 4KDTC 5F7NC 4NHUA 3OR6B 1LP9F 5L7XH 3DECA 1B6DA 5ILTH 2LE9A 3PGFL 3NZ8B 2Z9TA 1ZS8B 2EEBA 4NOBA 3VGBA 2HG5A 4Z7WA 3FQWA 1TPXB 1A7BA 2APTA 2DIAA 4NHCL 2XN9D 3ZHLA 1IGCL 3WLBB 3FN3A 4Z0XA 2P5EE 3BESR 3GSXA 1BLNB 1FV1A 4CMMB 3DI3B 1FIEA 5JA8B 3WS3A 4WHYG 5HBBA 1MEXH 1JPTH 2BVQA 5BJTB 3KLDA 1IAIM 3DHJA 4UTBL 1TZIA 1UM5L 3I75A 5DFVC 3IJHB 4OI7A 1MF2L 1S5IH 2AJSL 1WJ3A 3RFZC 3ARDB 3INUH 2IANE 1D9KA 1DL7L 1QBML 4JR9H 2ADGB 3IDGA 1C5DA 4GXUM 3LDBC 1G6RH 2Y5TB 4UIKL 2ZSVB 3GMMB 3QG6A 3ILQD 4MQ7A 2NY5C 4XP4L 2GUOA 4L4VE 5JPNA 1MHHA 2R0LL 3O11B 4JRYA 4XPHH 3CLEL 2QSCL 3KYAA 3K0WA 5C08D 3VGEA 5I9QB 1NCWL 1AO7A 4I13B 2A6DA 4UTAH 1KYOJ 4N9GA 1LK3L 4NQTA 5J6HB 2CDEA 3N50A 4HMDA 1HSAA 3FTGB 5EZLA 5I0ZA 4PRHE 1NCBH 3ARXA 1ZLSH 3UZEA 4X7TB 1NUGA 4LHUD 3AB0C 2LQRA 1FVCB 1MJUH 5FM5M 3BMWA 1AD0B 4EVNA 4BFIA 4UI2A 2HRPH 5ITFA 5E56A 4URTB 4XCYA 2ZJSL 3PL6C 4XNYL 4WW1B 1UXWA 3FRPG 3MREB 4I0CC 2GK0B 4PIRF 4OIBA 3I6GA 4QGYA 2EYTB 2DLFL 4HKJA 3S36L 4DQOH 2X1XR 3BIKB 4I18A 4LHQB 4XMKH 4WUKH 1S7SB 1BHGA 4F2MA 1P4BL 4WV1C 4QRUA 4LKXA 3RGHA 5C09A 3GHBL 1AI1H 5K9JL 1RZKH 5IB5B 2XTLA 1O0VA 3FQUB 4GRLB 1NC4A 2WLZA 4OKVB 4MCYB 3V6ZA 5KVDH 3OF6D 4JM2D 4NBXB 5I74B 2DLHA 4E42B 2CIKB 1CE6A 1XGRB 2Z93B 2AERT 4DZ8A 4X6DF 1CFBA 3OXRB 5D7JA 4L8BA 3WJLA 4KGLA 2V7NB 3Q6FA 3MO1A 1L7TL 4OCLC 3VG0H 2R23A 1EEYB 4OIAA 1MHPL 2HT2D 1R3HB 8FABA 5FYJD 4FRWA 3JWNC 5D71H 4M5YH 4V1DE 3DRTA 3ZKMC 1WIPA 2I9LB 1PQZA 3K2UH 2G9HA 3QQ3B 4E41D 2A9ML 1P7QA 3PE9A 3LIZL 1YPZB 1SYVB 3D85A 4J6RL 4WWID 3ZHDA 1A02N 3VFWA 2FRGP 2NY3D 5GGRA 3CK0L 1NCAL 5IMOA 1KTKE 2AK1H 3B2VH 3QZWG 4HZLA 1VKXB 1JFQL 1A4KB 1RIUH 1D5IH 1QUNA 4IRJA 2KH2B 3CFDB 5FYKU 1CGUA 5MEOB 2SEBB 4G8GD 3HPJA 3MOAH 1NGZA 1QP1A 2OZ4H 4M62L 3EDDA 2XI9A 1Y0LA 1VEOA 5C0NC 4EKXA 3WFBL 5JR1L 5LWYL 5DO2D 4ONHA 2W59A 3PWLA 4KMLB 1PKQE 4BA8A 5FO9A 2HVJA 2VTFA 5D70H 4NNPH 4DGIH 2PTTB 4DEPB 3BX7C 3LS5L 4XCCL 5D1QD 1AGFA 5IUSA 4U1GB 2VABA 5SV3A 3MUGA 3VXSD 4NOFA 4BQBA 1M7IB 1KPUA 3M8OH 1CQKA 4PJIF 1KXQE 3OHXB 2A6JA 2OQJB 4OF0A 1JE6A 5FO7A 1B2WL 3EJYD 2XRAH 3U4EB 5JLZB 3VI4E 5L2KA 1OARH 1Z0NA 5DD5H 2QADC 5F96L 2V7HB 2CR3A 2YD8A 4OFVA 3VDCA 5DJ8B 1MHCB 1JN6B 5I18L 2FBOJ 2YPKA 4FFVD 1DQJA 4YHMH 3QHTC 5FO8A 3AVEA 3ZSSA 1I85A 1S7XA 2C3HA 4B5EA 4M9PA 2VXVH 3AS1A 3KPMA 2OJEB 3QIBA 2HKHL 3VXOA 1ADQH 4QRQA 4EEEA 4HF5H 1RUAL 5HHNA 3WS6C 3Q3GB 3QBTB 3L3HB 4PJAA 4PY8I 2V9RA 1KYOK 1JVKA 3CC5A 5L7XL 5BZWA 1S7VA 5ILTL 2XACC 1J8HE 3RDTD 4HKXA 3UBXA 2IAMA 4LNVA 3IF1B 2BP3A 4JEGB 4YO0A 3QP3A 1X5AA 3RGVC 3SDDB 2QLVB 1ZGLA 4WEMB 1K5NA 3QIUB 1EV2E 4BH7B 4QTHA 5DYOB 4RX4A 5EIIB 1V3KA 5EC1B 1KCLA 1MELA 4Z7NF 3MC0A 3FB8A 3UTPE 1LE9B 1YMMA 1MEXL 1JPTL 4BZ2H 1LE5A 4OLXH 4K94H 5IHZA 2BMKB 3TPUB 5C0CB 3FQNB 5D5MB 4L3EE 3LQZA 1XT5A 2YKLH 1MCJA 4PRIE 1JPSH 3L7EB 2F54E 1V3MA 1S5IL 2WUCH 1HI6A 3INUL 3G6JF 4DFIA 3QEUB 4KRMB 4QRTA 4R26H 1G6RL 2W0PA 3OAZH 4UOW0 1SEQH 5IJKC 5HHME 1I8IB 3QDJD 2Z8WC 5ERWB 3SCMC 3V8CA 4QHUB 1X5GA 4LCWB 4C83A 4JDVA 5SWSE 3GSNA 3P4MA 4X7FC 1JCKA 3MV8A 2AV7A 4P59H 4YHZH 3VWKA 4LSPH 4UTAL 3FOMB 1YEGH 1W72H 5K93A 5IBTH 4XBGA 2E7LC 2CRMA 2CKBA 1UQSB 3ARYA 1NCBL 1ZLSL 5INDA 1PGRB 2VLME 4G42A 4ZOBA 3GSWB 1MJUL 3F6IA 3QR2A 4YIQB 2HRPL 3NABL 2GSGA 4KJPC 2DD8H 4NKDA 4Y4KB 4U6HB 5K59E 3VGFA 4RA0C 1Q9KA 2JJSA 1NKRA 4LVEA 3MLYH 3D1MC 4N0CD 4DQOL 2EDYA 4WUKL 4XMKL 2VR9A 4MNHB 2HTLC 4XVJH 2YMXH 2EDEA 5C0BA 1YEHL 1AI1L 2C5DC 1FLRH 1J10A 1BEYH 3QDGA 5IQ9B 3WFZA 4UAOB 2Y36L 4KKAD 4YBLC 4YR6B 3IJSA 3D3VB 2DBLH 5KVDL 4ODHH 2FJGA 3AREA 4QT5A 5FGCE 4YDJB 2DOCA 4JKLA 5KS9F 5KN5B 3GDBA 4KVNH 4IMLA 1EO7A 1ZA3B 1IM3B 4GW4A 3KXFE 3VG0L 5FKPB 3FOLB 1LEGB 2NY0C 4LVOC 2P5EA 4O2EA 5J56B 1OP3H 4NN7C 3MNVA 4LVNB 2PW2A 5D71L 4QHMB 1LNUB 4M5YL 1BECA 2C1PA 2Y6SC 5K9QI 3CVHH 2QQLL 5T1LB 1RJYB 1HKFA 3K2UL 5C07D 2ID5A 5DJ0B 3K8LA 5H2BA 4I0PB 3PABA 2VLRE 3O9WC 5C9JA 2HFFA 3REVA 2NW2B 5EU3B 2X4TB 2ESVD 1FG2B 1RZIA 1QFUH 2IANA 4Y4FA 2AK1L 3B2VL 4HWZA 1UG9A 1MIMH 3UTSE 1RIUL 1D5IL 4GLRI 3KJ4B 3AY4C 3BAEH 3KPSD 3U48A 3V52H 3KYOA 4L29B 4X5XA 4XAKE 3MOAL 2OZ4L 4GKNA 4L4VA 3MX0A 4Y89A 5DURB 4RMUA 3ROOA 3W81A 2CD0A 4GS7C 4BUGA 5TDNA 4Q9RH 3T0VA 5IGXH 3OTTA 4JZJA 4DVBA 4L4JA 4NCDA 1S7UB 4KAQH 3DO7B 1KCSH 3DV6B 4NNPL 4DGIL 4JANA 3VXUD 4G80B 3T3PF 3ZL4H 4LLAA 4K8RC 3F6LA 4PRHA 3D39D 4X4ME 4U1JA 5F88B 4A2LA 1PFCA 1WAAF 1DZBA 1XF4A 3O4LD 1YEEH 5CINH 4JRXB 2HFGH 3M8OL 3ME0A 1I8LA 3VRLE 3C5SA 4NQCD 2H1PH 4Z7UF 1I3RA 4AM0B 3PHOA 2XA3A 3BKMH 4PJHB 2XRAL 2XKUA 3PJSA 3C5JA 4L3CB 1ZGLM 2A6KA 3S5LG 1OARL 5DD5L 2VQTA 4ZXBB 2R1WA 1E0OB 1RULH 3BT2H 3FQXA 3KS0J 5E2VH 4MA3A 3W5MA 4YHML 4JLRA 1G7PB 2VXVL 4MZ2A 3RY6A 4EI5A 4MJ6B 1ADQL 4ZD3H 2JJWA 2YD3A 1ONQA 4H1LG 4HF5L 3B9AA 4FZ8H 3DUSA 1J0JA 3QUZA 3G5XA 4EOWH 4HPYH 4F80A 1B3JA 2DLIA 4R0LB 3DVGA 1CDUA 1XGUA 4JFOA 3C5ZB 3JWOC 5FAAA 4G9FD 4PJGB 4EDWH 3BKCH 5D7KD 1QZ1A 3O8XB 4DUXA 5HJ3A 5ESVB 1AXSB 3C60B 4OM0H 1IQDA 5DDHB 4PR5A 5HVWA 4GSDH 5CBEA 4XTRD 2VLKE 1OCWH 5JHDE 2UVFA 4KK5C 2AABH 2H9GB 1AD9B 2UZYB 4BQ6A 4BZ2L 4RZCB 1QSZA 2GKIA 4QHKI 4NHUB 4V1DA 3SDCC 3T09A 4NRZA 4OLXL 4K94L 1J1XH 3MRMA 3L7FA 4PTTA 4PJ9A 2LU4A 4RMRA 5E4EC 2VO5A 4PUBH 1FJ1A 4HWBA 4Z7WB 1JPSL 2DWDA 3E6HA 5DZLA 1TXKA 2WUCL 3PV7A 4PJ5D 3B5TA 3MJ8A 3TJEH 3MLUH 4R26L 2Z31C 3OAUH 1FV1B 1XEDA 2WBWB 1QSFA 3AGVA 1FNSH 1K2DA 2BVQB 2BSRA 4P59L 3BEWB 4YHZL 2W07A 5IM7A 1G0DA 4IRSA 4LSPL 4L8DB 1YEGL 2X89D 1W72L 4S2SB 4PGEA 1PKQA 3UAJC 3I75B 5EOQH 5IBTL 4UQ3A 5E6IC 1HIMH 4P49A 1QBLH 3J7HA 1EX0A 2IH1B 4OF5A 4OZHE 2H2SD 5FUCE 3IDGB 1C5DB 2EIZA 3A6CH 4P4KC 3QB7C 2VL5B 5IB2A 1G7HA 2DB8A 2FECL 2GUOB 1MHHB 2VQ1A 1UVQB 4XI5D 4F7MA 1XCTA 2UY6A 1MFBH 5EPMB 4OLWH 3ZE2F 2A6DB 2IF7A 3MLYL 4NIKB 4OV6F 3MJ7A 3JV4B 43C9A 5C0RH 1DQQB 5EZLB 1JZ6A 2EYSB 1UWGH 3IDIB 2XKNA 2ICWA 4WUUB 1AHWA 4GAFB 4XVJL 3FFDA 4BSWB 5J11C 3O41B 5D2LE 5DZNA 3T0ED 1FLRL 5GJTH 3U1SH 4PJXF 2VH5L 2DBLL 2X4QB 2IADB 3PDOB 3RWJA 3LKRB 4ODHL 2FH6A 3LB6D 5HHPA 4FQIH 2WAHA 2RB8A 1HWHB 3I6GB 3KDMA 4UQ2A 4WI2A 4HKJB 1J8HA 1ZLVK 2V2WB 4KVNL 5CJ5A 5F1OB 3NIDF 5FHAH 4D9LH 1BQHB 2ED8A 2MFNA 4O2CA 1ZLUK 4QRUB 4EN3B 1KTRL 3JV5A 4HCRA 3ARGA 4OQTA 3T4YA 2VXUH 5A2IH 2EE9A 5HHOE 3V5DA 4KHTH 3RKDC 1X4XA 1NFDF 3CVHL 1EHXA 5DSCA 1AP2B 2P8MA 3V6ZB 1VACB 1KN2H 3B3IA 4NJ9H 4PJBF 1CE6B 2V2TB 4KI5D 4L3EA 1M4KA 5FM8A 1LHZA 5D7JB 5DRWA 4L8BB 4PRIA 5TDPB 2F54A 4ETQA 3Q6FB 1TCMA 4GRWF 3U7WH 1QFUL 2R23B 5B8CC 1MIML 3S9DB 4H25B 4OGAD 4CVZA 1W0VA 1MCOH 8FABB 4LLMA 3ZTNL 1ZA6B 3QCUH 5BZDB 4JQXA 3MZTA 1FNLA 4GBXB 1EZVX 1U8JA 5EO9A 2YSSB 5SWSA 1PQZB 1P7KA 2ICWI 2E6QA 4Q9RL 4GMSH 4N1CA 1P7QB 3TO4D 4MQXC 5EO0A 5IGXL 3L3DB 1HHHA 4KAQL 1OT2A 3TVMD 1FYTD 1WZ1H 1Z3GH 2G60H 5TE4H 3ZL4L 3D87B 5GGRB 2GSIB 3T2NH 3V0AC 5IMOB 4N8VA 1JYXA 1A6UH 3R0NA 1YEEL 1Z5LB 4OD2B 3UTQA 2HFGL 1HZHL 3BPOB 5DVKA 4IRJB 2H1PL 3ET9F 1NGZB 4KKLC 4XMLH 3JBG7 3NA4A 1QVOA 3BQUC 2DMCA 4DZBA 4MJ5A 1M7XA 1MFAH 5E6ZA 4ZFGH 4X8JA 1RULL 4KJWC 4XCNB 3BT2L 4JQVA 5DJZB 3UDWC 5E2VL 5B38B 1KTLB 4X6CF 1X9QA 2VABB 2XN9E 4KROB 4ODUA 4Y1AB 2APWA 5FIEA 1L9MA 4YHOH 1N6UA 4NM4H 2BFVL 4ZD3L 1I1AA 4FZ8L 1J0YA 2EDHA 4EOWL 5SWQA 4HPYL 4PJFF 1JJUA 4L8SC 1TNNA 1QEWB 3SGJC 4Y19D 3ZSTA 5L2KB 2JJTC 3BRGC 4NKIH 4APQA 3BPNC 4XVUD 5GHWH 1T5WA 1FYHB 4EDWL 1OPGL 3BKCL 3QWRA 3VH8G 4P2RD 1UKTA 5B3JF 1F58H 2YPKB 4P23A 2NX5D 2FBJH 2EO1A 1CZ8H 4OM0L 2M8XA 2CR6A 3TH3T 2HT3C 4NN5C 3KXFA 4LDOB 3IKCB 3ZDZE 2G5BA 1E6OH 2YPLB 4UINH 4GSDL 2J8UF 3KPMB 1OCWL 3VXOB 1GXEA 2AABL 1NPUA 4XXDB 1MREH 1RZ7H 3EOBB 2XWBB 3UTTD 3L5XH 3TA3A 3CC5B 1J1XL 1XH3A 3ILPA 5C08E 3LQAL 3I50H 1T89A 4HKXB 2VLRA 3CMOL 4PUBL 1R0AH 4YDKH 1Q94B 4PJXE 3BWAA 5F7DA 2ZZUT 3N85H 4J3SA 3TJEL 5IFJA 1CGTA 3MLUL 3N1PC 2LU3A 4N9OB 3OAUL 3UTSA 5HYQA 3MJGX 2CIIA 1VERA 5C7XL 5F7EH 5AZEH 3WHXA 1XGTB 1FNSL 3BW9B 1B0RA 1YMMB 4HMCA 4F37K 4H8WC 5HDBF 1RI8A 5IHZB 4ENED 4X7DC 1YNKH 2W65B 3FQTA 1OW0C 3LQZB 5EOQL 1QBLL 4MJ2A 5TE7H 1WZKA 5CIPB 4X4MA 5CKGA 4QRTB 1E4JA 1INQB 4XXCC 1XGPA 2XIDA 3A6CL 3B9VA 2Y7QB 1FNEA 4M02A 4YZFE 4E0RA 2FR4B 4LOUC 1CICC 2H2PD 3WDJA 1EEZB 3U0TB 4GRWE 2MWCA 4C83B 1UKQA 3CFEB 1NFIA 1MFBL 3MV8B 4XBPA 3L3JB 1OTUD 3HUJB 2B5IB 2R29H 3KPPA 3SDXF 3FB6B 1CIUA 1LD9A 1UFUA 2H6PB 5DGRA 2BC4B 4XBGB 3KPRB 5C0RL 1U3HA 5IR1A 1UWGL 5F3HB 1RY7B 5DFWH 1BZ7A 5T33L 1U8QA 2V5RA 4WU7A 3ESUF 1KXVC 4XVSH 2NY1C 3DJ9A 1BWWA 4CNIB 3GI9H 4PV9B 2ZWLT 5FYJE 5GJTL 4Q6YA 4O58L 4X6EA 4LDEB 1F4XL 2RCSH 4NKDB 5IOPA 3GGWA 5HXMA 4LRIA 4DKFH 5EOCJ 4MHHI 4FQIL 4YDVA 3TZVD 1UEYA 3MGTA 4XPFH 2NXZD 4E41E 3M17A 5FB8A 1GZPB 2VKXA 5IG7A 4R2GC 4MMXC 3RL1A 5FHAL 3ZKXB 4D9LL 2EXYD 1R3LB 5DTFA 4WY7H 3L3GA 3EZ8A 3U46B 1WEJH 4ODXA 4ODVL 1AIFB 3DO3A 4K9EC 1Q1JH 5C0BB 5JTWA 2G75B 2VLKA 4I3RH 3HC4H 1A6TB 3QDGB 5JHDA 5IVNA 2VXUL 2K1MA 4WI8A 2OR9H 4G8GE 1NCNA 4KHTL 2XICA 3S96A 1CIDA 2AI0H 1KCUL 5L2JA 5D1ZD 1KN2L 2FJGB 2QQKH 2E8YA 3AREB 4NJ9L 3MUJA 1MH5B 3GI8H 4PLKD 4W81A 5T5FH 1Q9WA 1MHEB 1U8NB 1SJXA 3DMMD 1BM3H 1Y6NR 4TRPH 4S1RL 3RWHA 1MIEH 2E27H 5GSRA 3RKPA 1OAKH 3IAQA 4NQSA 3VXSE 4WW2A 1MCOL 1FFPB 2XWJA 3S8WA 2PW2B 4ZFOL 5GISH 5KSAB 4RFNC 5CGYC 2CPCA 2B4CC 2Z35A 2I26N 3F7VA 1K4CA 2ICES 4YXLH 4F7TB 3ARFD 3M07A 5ANMB 4OFYD 3MRHB 4Z8FH 4NQDB 2HFFB 1WZ1L 1Z3GL 2G60L 4AIXA 4LL9A 1RHHB 3T2NL 4HGKC 2IANB 1A6UL 4OZHA 3EDEA 5I1DA 3K1KC 2DWEA 3KYOB 4X5XB 4M7JH 3H9HA 4YHNA 4GKNB 4L4VB 1JMXA 4XMLL 4GKSA 4RAVB 1KJ2H 4ZG1A 3AS3A 3KPLA 5I1CL 3DTXA 1MFAL 5TDNB 5IHLB 4JZJB 2VIRA 4DVBB 2PCPB 3DGGA 3HPLB 3MBEC 2X70A 1NH6A 1S5HA 4PRHB 3C6LA 4U1JB 5IMLB 3ULVF 4OZFH 4HS6A 4YHOL 4KH2A 4Y16D 3IS0X 5D2LA 3C5SB 2FHBA 3QH3B 4P5TA 1LEIB 3SGEH 2P1YA 4NKIL 3W9EA 5GHWL 2MOVA 1DE4A 2A83A 1UM4H 2ZCLH 4P2OC 2RIKA 3FQXB 1YECH 1F58L 1VHPA 4HIHA 3ZYJA 2FBJL 2FSEA 1CZ8L 2XPGB 4EUPH 1E6OL 1FFNB 4KMQA 4UINL 5MHSD 1REIA 4LSSH 3ARRA 4MNQB 4G7VH 1JWSA 1NGXA 1RZ7L 4UU9A 3RTQA 5I66B 3QUZB 2IPUG 4UOJA 3QDJE 5C0DB 5HHOA 4WRLA 1EFXB 1G6RA 3L5XL 1VDGA 4UDUB 3KGRA 3DVGB 4EQ3A 3MRCA 3NN8B 3QA3A 3I50L 1F00I 1T83C 2G2RA 1JZ7A 1R0AL 3P73A 3MUY1 4YDKL 1PEWA 2R2HB 2NY6C 4NKMA 3N85L 1J1PH 5I1EH 1GZQB 1IC1A 1JI1A 2F8XC 3S35X 3F65A 5CBEB 4C56B 4OCMC 5F7EL 3NH7H 5AZEL 1CBVH 1KACB 4GKZA 4GAYB 2AJZA 2HVKB 5ACMA 2F5AH 4YE4H 4V1DB 4HGWB 3UYOD 4IJ3B 4IIQB 3HAEH 3L7FB 5J1AB 2ATPB 2XTJB 3BPLC 5IROA 3QHZH 3IU3B 2E9JA 3CD4A 3K2MC 4JB9L 3KWWB 4F3FA 1Q72H 4FTVB 4UBDC 3S98A 3BZFB 1JIBA 3MYJB 4HUUA 4Q0XH 1XIWB 3AAZB 5TE7L 4RNRA 1TITA 4XGZA 5BCAA 3FB7A 1LP9B 2BNUB 2VB5A 4LAJH 5C0AD 4WGWB 2B2XH 3VXPA 2A74B 4RFOH 2EDQA 4X4ZA 4R97C 4KHXH 4RGNC 1SJVA 4U1KA 1IE5A 5LCVH 3KHOA 2BSRB 4S0TD 1EBPA 3ALWA 4UDTB 4NDMA 4BUHA 4IRSB 1H0DA 1U8IA 2R29L 2YWYA 1EZVY 4GT7A 1JPGA 3ARDD 4HHAA 5MI0C 5E5MA 5JMRA 3EOTH 5C1MB 1MQKH 3F5WA 2XN9A 4GXUN 4OZGE 1U95A 4XVSL 1D9KC 1IAMA 4KJYA 4YGAB 1ZLVH 3S3SA 3GI9L 3SE9H 4F9PC 5F9WB 1AJ7H 1G7HB 5IB2B 5IBUG 2RCSL 4ZQKB 5E8OB 3QNYA 4R4ND 1ZLUH 3QJHA 4DKFL 4EDXB 1Y18A 1TVBA 4XPFL 1A7QH 1QD0A 5C07E 2NY2C 2HJLB 4KU1A 4W68A 4W70A 3DYMA 2VLLA 4Y8DC 1UXSB 2ESVE 3OKOA 5IESH 1I9JH 2ICWB 2VWEE 1AHWB 3T2OA 3CIQA 1H5BB 3HR5B 1FQ9C 2DQFB 1Q1JL 3UZQA 3KPSE 4WTXA 4I3RL 3TF7C 3HC4L 1MFEH 1Q38A 1S9VA 1U8MA 2OR9L 2Z4QB 2AI0L 3T77B 4A6YH 5C3LD 3RWJB 1S9WA 2QQKL 3TM6A 2OZ4A 5C08A 3GI8L 5T5FL 4UQ2B 3KDMB 3GMQA 3KLAB 1WLHA 2B0SL 1Q9OB 1BM3L 4TRPL 3PP3K 4I18C 4PJXA 3VXUE 1MIEL 1DANT 1U92B 1YDPA 2DBJA 2E27L 1OAKL 3D39E 4KXZH 3O4LE 4M8VA 4LHUA 2BCKA 4GRLD 1G9NC 3EJJX 3NAAH 1OTSC 4NQCE 3V5DB 3QQ4A 4U0RC 1FAKT 1LDSA 5CZXC 3MQIA 4YXLL 3RWEB 4Z8FL 3GMOA 3LS4H 4X99B 5D7JC 2Z91B 2F54B 1DUZA 3KYNB 1K9TA 5CHNB 3WJLC 3Q5TA 4G7YH 4N0FB 4OIIH 5GSVB 1JZ2A 1J87A 1CGYA 4CVZB 1W0VB 5BO1H 4JVWA 4QO1A 3LKSA 5TQ0H 1S7RA 4X6DB 1F45A 4M7JL 4KI5F 5HHMB 2LFGA 1T3FB 3WNPA 3QPQD 4PY8J 5JXED 4PLJD 1G9EA 4M1GL 1KJ2L 1YEDA 1ADQA 3RJQB 15C8H 2NXYB 1ZSDA 3DX6B 3RY5A 3F58H 5DJ6A 5EO0B 2E7HA 5HDQH 3OF6A 3WO4B 4JM2A 5CJBA 3TWCH 1HHHB 2JELL 2WWMD 2ZUQC 4G9FE 1G7JB 2EC9U 1YJDC 1Z9SA 1A6AB 2IFGA 3L3IB 4MX7A 3FFCB 2GJJA 5D7KE 4Z7OF 3AFLA 4OCWH 4PJEE 2ITDA 2ADJB 2ARJQ 3CDGB 5E2WH 4DCQB 5GGTH 2EE3A 1GC1H 3U2SB 1T20A 4IRJC 4YWGH 2AXGA 3MXVH 2H45A 4QNPF 1L9NA 2FB4H 4MJ5B 5F8QC 4TSAH 5LQBH 4WJ5A 4P48A 5E2JA 4QKXB 3BGFB 1R5VA 1UM4L 3ULUF 1EK3A 2ZCLL 4MDIB 4AEEA 1P5UA 2E9WA 1YECL 4LPWA 2KZ1B 2FCBA 3LPGA 4PJ5E 4WU5B 4PRNB 4LSSL 1BF8A 3U79A 4QRPB 3OR7A 3MLWH 4G7VL 2XXCB 2XFXB 1MVFA 1A2YA 1CK0H 1A4JB 1IC4H 2YUZA 4HIXH 2R9HD 4G8GA 4HT1L 5IB3A 5AYQA 1X7QA 5E5UB 1T7XA 2GITA 5FGCB 3VRJB 2VISA 1QTYT 4LSVH 4PJIB 2FX7H 4D0BA 1C7TA 4JZOA 4IOFD 4WFED 1JRHI 1D5MA 2VC2H 4KK8C 2NY4B 1EUTA 1J1PL 1WV7T 5CMAA 1W72A 3CSBA 5D1QA 5I1EL 3HE7D 3KXFB 1JWMB 1I85C 1HXYB 2N7AA 2CMRH 5D7SH 3VXSA 2NMSA 3Q6GH 3QIBC 2BXZA 4GAGH 3SOBL 3NH7L 5HVHC 1CBVL 4M61A 2F5AL 2WNGA 2IFFH 1XH3B 3FO9A 1EGJH 2HLAB 5E70A 2Y25A 3ZKND 5D93C 3QHZL 1J1OL 5IEKA 1UEMA 2AXJA 5DJYB 3U0WH 2IAMC 5I8KH 3BWAB 4KQ4H 4Q0XL 3QIUD 2D7NA 2J1KA 1U2HA 3NCJH 5IFJB 4X4XB 5T3ZD 5D4QA 4KRPB 4JFEB 3U82B 3WO3B 4FNLH 5J12C 1AQDB 4YHIB 5HYQB 2B2XL 3T0EE 1J11A 1CYGA 4RFOL 4M7LT 4KHXL 2DQEH 5LCVL 3NBNA 5BW7A 5FECA 4DK3A 2EZ0C 1U3ZA 5FV1L 1ZT1A 2YUWA 3BVNB 5CD3A 2Q76A 2YD5A 3RVTC 5FA3B 3RDTA 4NBZB 3EOTL 4TNWK 5DEFB 2P47B 4G43A 2Q87A 1MQKL 3VCLB 1T1YB 5E8NA 4KTDH 2VQUA 1MJJA 4XNZB 3B2UD 3QUKB 3EO9H 5D96B 1FNEB 3SE9L 1ZWIA 4LNRA 1AJ7L 5EN2B 4LCWD 4N8CH 3O2WL 1LDPH 3QXAA 1T2XA 1XR8B 1NQBA 4Z5RA 1NFIB 5TH2B 3G6JB 4KC3B 3SN6N 3ULSA 1BD2B 4FQXD 3QFDA 3VA6A 1A7QL 5SX4H 5DJXA 3EKCA 4YFDB 4ZOCA 3VWKC 1LD9B 3CVHA 2B5IC 3OKNA 2R4RH 2IPKB 2JF1A 1U3HB 4ZFZA 4WU7B 5IESL 1I9JL 3P4OB 3TP4A 4ZUVA 2VDKH 3MGAA 4G6AD 2C1OA 4LLUA 1MFEL 3OKDB 3L9RB 1YEKL 4X6EB 3QDJA 3CX5J 2QSVA 3ZO0A 5EOTA 2B1HH 2C3GA 2O5XH 4A6YL 1G7MA 2R39A 5F21B 3DIFA 1QBAA 4YDVB 2JJSC 5FB8B 1JF1A 3M17B 5EDXA 5IG7B 1FYTE 3N9GH 4QNPE 3MBXL 3K74B 5KAQF 1HEZB 5D6DA 3S34H 2CO6B 1ZHBB 1FZMA 3DURA 4F9LC 3D3VD 5BVPH 3K46A 3NAAL 3HZVA 3ESVF 4ZO7A 1XR9A 4IOSD 4LPXA 5DEGB 1VFMA 3IFOB 4JFYA 5FYKH 1CXHA 5KTEH 5TDOA 3LS4L 3NZHH 1IL1A 2F15A 4GG6F 3RHWK 4OI8A 4TPRH 4ZPTA 1CXLA 3RWHB 5T3ZH 4E5XA 4G7YL 5GSRB 4OIIL 1BBJB 4J1UA 4NQSB 3D0LA 1MUJA 2P8PA 4H8WH 5TPWH 3WUWG 3FZUD 5KS9B 1C7SA 5D8JH 2GQHA 1E4XH 1J9CT 2XWJB 4ZFFA 3V5KA 2XZQH 4U6YB 2W0FA 1NGWB 2E8ZA 3V6OE 2VZSA 4I0PD 15C8L 4Y19E 1K4CB 5HYSA 3DETD 3F58L 4Y7MA 1NDMA 5HDQL 2C26A 3TWCL 4U1LB 1CLOH 3P9MA 4Y5VB 5I1AB 1R5IA 2IQAB 4P2RE 4AH2B 5DD1H 4OCWL 5ADPH 3W0WD 3IAPA 1J5OH 4NCC1 1MFCH 5E2WL 2NX5E 4Y4FC 5GGTL 4OZGA 1IAKA 5I8EA 1JK8B 2DWEB 5A16A 1YY8B 4C54A 1GC1L 4YK4B 3H9HB 2GW5A 4YWGL 2R0ZH 4HKBA 1MWAA 3MXVL 3W2DL 3UTTE 3KPLB 1KIRA 2FB4L 4TSAL 5LQBL 2F58H 4ZSOB 2ED9A 5I8OL 5C07A 1JWUA 3BYYA 4HK0A 5KW9H 4F15B 1NUNB 3EZJB 5KSBF 2PYFB 4NUJA 1A1MB 3NCMA 1U9KA 3KPQA 4HS6B 4JVUA 2WWKT 1FO0B 3MLWL 3DBXA 2GFBA 1CK0L 3SY0B 2WIIA 1HNFA 3CU1A 3JV0A 3KPSA 2IGFH 1IC4L 4HIXL 3D25A 1N7MH 4ZPVA 1Z9OA 2P24A 5KSVA 3JWDC 5EZOH 12E8H 1CGSH 2HJKB 2B20A 1QSED 2BJMH 1RUPL 4LSVL 2FX7L 1DE4B 3RI5F 2A83B 3QUXD 2WM0A 2BZDA 4QWWD 1JBJA 2VC2L 3VXUA 5GRJH 2UZIH 4U0QB 1ULVA 3ZYIA 1D5ZA 3D39A 1D5BB 1DDHB 1FG9C 2CMRL 5D7SL 3RWDA 5AAMA 3RY6C 2EXWD 3O4LA 3Q6GL 4HDIA 4EI5C 4GAGL 3CFCH 1T0NA 4UU9B 1A0QH 3GKZA 3QUZC 5HHOB 2RFXA 4NQCA 3WL9B 1FL3B 3C5ZD 2IFFL 5ETUA 3MRCB 3VRIA 1EGJL 2CK0H 4X80H 3HR6A 3QA3B 3C09B 2G2RB 3O8XD 4KKBC 4Y5YC 4YGVB 5I8KL 1P1ZA 3W9DB 4KQ4L 3MFGB 3BN9D 3NCJL 1WSST 1QG3A 3RL2A 1RZJH 4NZUH 5JW3H 4FNLL 4HLZG 4L8CA 3QQ9C 1R5WA 4FFZH 1X4YA 1NUFA 2DQEL 1IBGH 4JFQA 4X83A 3KJ6H 3CJJA 4IJ3C 1HHIA 2C4FU 1JF5A 4X4YA 1VCAA 4MSWA 3QXTA 1GGCH 4PJ9C 4ZDHB 4Y4HC 3CZFA 4G9FA 4LPCA 4LLWA 2FH8A 3QI9B 4PJEA 4HH9A 4KTDL 3FB7B 5TFSL 3EO9L 4OM1H 3T0XA 1C16A 4N8CL 1LDPL 3VXPB 1ZHNA 3B6SB 2ZCHH 5DFVD 2YN5A 2H3NA 5BV7C 2IQ9H 1U8IB 3I3BA 1WC7A 2F8OA 3VFPB 5D2NE 5EU5A 3GUTB 1BF2A 3VGHA 3MCLH 2R4RL 3G04B 3WFHB 2Q86A 1KCRH 4ONOA 4NRYB 4OZ4A 3SKMA 1HOCB 2IMMA 4KTYA 4PJ5A 1PSKH 2Q3AA 3F5WB 1U3YA 2VDKL 5EU4B 5HI3C 2CJUH 3MRNB 4KJYB 3GM8A 5IBLC 5JHLL 3R06B 2I9TA 4LP5A 3HNTH 5EORH 1U93A 3LCYA 3PP3H 4PFEA 4NT6A 3P4NA 4P9HH 1NMAH 4ODSH 2B1HL 5D7LD 2NR6D 2O5XL 4XAWH 1TVBB 4I3SH 2X4OA 4OLEA 3O45B 3MJ6A 3IYLW 2D7QA 4PJCE 2X89A 3MRRB 4GUPB 5I76A 2VLLB 3LHPH 1T04A 3OKOB 1U8PB 5M94B 4FXGB 1X5YA 3FAXA 3S34L 1F5WA 1J88A 4OCYH 2F5BL 4JFFD 4P5KB 1IT9H 1V8HA 3MNZB 1S9VB 2CRZA 2KL6A 5BVPL 5KSBE 5JZ7C 2E7BA 4KKCD 2YD4A 4JJ5B 4NFBA 5FYJU 1HWGB 3HE6B 2VZ1A 5A2JH 5FYKL 1OAUH 3GMQB 3NZHL 1ZGLP 1INDH 1F4YH 1VADB 2EDTA 2FX8H 3PWNB 4TPRL 5K9OA 2HH0H 4PJXB 5T3ZL 1YDPB 2EO9A 3THMH 5AUMB 3HG1D 3D5OF 2AEWA 5TPWL 4JQIH 1EPFA 5D8JL 1E4XL 3CDCA 4XPGH 5D6CA 3LMJH 3K81A 3T0EA 2YS4A 3ARGC 3G5ZA 2XZQL 3KHQA 3QCTH 4HUVB 3SO5A 2YXFA 5GS0C 2NNAB 2JCCA 4YHYB 4JPVH 2WBJA 2X4PA 4MWFB 4J8RA 1RZFH 3DRQA 3BIAX 3AMKA 3TIEA 2QQNH 3BGMB 3QJFB 3GMOB 5J6GB 2XYCA 3S4SA 5C6TH 1KTDA 1NFDB 5DD1L 5ADPL 1J5OL 1MFCL 3AC0A 5E8EB 3ZKMD 1YZZA 5MHSE 3V6FA 5EA0H 4GBXD 4LCUA 3LKSB 3EYFA 1T21A 3H42H 3RIFF 4GW5B 4MD0A 2R0ZL 4AEIH 3NA9H 4GRWB 1YEDB 1NLDH 4UV4H 3IDJA 1OGTB 2F58L 3UBXG 4YX2H 3VXNB 4I8DA 5ACLA 4NBYB 5KW9L 5DK2A 4MX7B 4MD5A 2ZUSA 4TUOA 2ITDB 5I73C 1PX3A 3GMRA 2H41A 1EMTH 1Q0YL 5EC2B 3T2PA 4CJ0A 1ND0B 1SYSB 3WFCL 2DKUA 1OQXA 3T8XB 4LDLB 2IGFL 4PRDA 1ZT4B 4UZGA 1CFTA 4AQ1B 4F33A 5ESAB 1N7ML 3C6SA 2VDMH 2HLFD 5EZOL 12E8L 1CGSL 3JTTB 1KJ3H 3MGOB 4E41B 1R5VB 2C4XA 3TO4A 5I6XB 2A2QT 4KK9C 3TVMA 5B39A 4KROD 5T1KD 4Y1AD 1FYTA 2EIDA 5GRJL 2UZIL 3I84A 4UV7H 5IMMA 3HI6H 4GO6B 4IHOA 3BP7B 4HIIA 5JIKA 1PAMA 5C0AE 1KC5H 3CFCL 1I1AC 1A0QL 4HXAH 2AS5M 3RZCB 4G8GB 4UOW1 4X6CB 5IB3B 3K4DA 4JPIA 5ALBH 4E9LA 3G5VA 4WI7A 4JGUA 2CK0L 4TUJB 4X80L 2A6IB 5INCA 1QO3A 1ZK9A 4APQC 2Y1VA 4D0BB 3GO1H 4PJFB 1WBYB 1D5MB 2YPLD 3DV4A 2OI9C 4P23C 2YD9A 1DFBH 1TENA 1MSPA 4MMZC 5CMAB 3ZTJH 1RZJL 3ZDYF 3WEXA 1FZJB 1LQSR 4FFZL 3ARVA 3TNMB 3U9UB 5ICYA 1AGDB 1IVLA 1IBGL 1JZ8A 2FIKB 3TA3C 3KJ6L 3V6OA 2A1WH 3RGVD 4D0CA 4Y19A 5IV2B 4C59B 1GGCL 2JLLA 3HTLX 4M48H 2F74A 4AZ8A 1LO2H 1T89C 2C7UA 3RVWD 3OKEA 2CLRB 4P2RA 4WHTB 1OVZA 4XMPH