1DQDH

Crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
221
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRLSITRDTSRNQYYLQLKSVTPEDTATYYCASPPGYYGSGPYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKISPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Fab hGR-2 F6, a competitive antagonist of the glucagon receptor.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB HGR-2 F6
total genus 41
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2000-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdH02
5I19H 3HAEA 1J8HA 3TZVB 1KXVC 2VL5A 4PJDE 3AS2A 3MRDB 1RUPH 4GLRH 3VH8A 4LP4A 3I6GA 5IFHH 2EO1A 3L3OB 4NC0B 3BP6B 3VD3A 3VXUE 4YBQC 4PJGB 2XQYG 4PLKC 5GS1B 2EH8L 3D1MC 2EEAA 1NEUA 3JWNC 4PRIB 4YFDB 5KSBE 5GRZA 3L95B 5BV7L 3L7FA 4S1QH 5TH2B 3JWDL 3HFML 3CVHH 4NRYA 1PG7L 1FH5L 2HT4C 3BPLC 4LKCA 4NO2B 5FIEA 4P4KB 5EZLA 5AZEL 5E08H 1YEFH 1W0VA 2BVUA 2FJHA 1QRNA 3K8KA 2WLYA 3S4SG 2AV7B 3PIQB 1Z9LA 2C26A 5DMGC 2HKHL 2BHYA 4TPRL 1KTLB 3WJLC 1A7PH 3CX5K 4P4KD 2DLIA 2CRMA 1YNLH 4WI6A 1HHIB 3ME0A 1ZT1A 4POZC 5I8OH 1P4LA 3MNZB 4WGVB 1V7ML 2I25N 4AT6B 1CDHA 4ZXBA 1G84A 2P42B 1S9YA 3HNSL 1XF2B 2RB8A 3SKNB 4PJCA 3HC4H 4DTGH 4HF5H 4GG8B 4U05A 4V1DB 4OIIL 4DK3A 3QNXB 1OARL 1W72L 4XZUA 1OM3L 2X05A 5J9PA 4TSBH 4HV8B 3C8HA 4KQ4L 1JI2A 4N0FA 5ILTL 2HMIC 1NL0L 4F7TA 1HDMA 2EIBA 1UWXH 4HAFA 5A16A 5EBMA 3VE0A 3FB7A 2NY3D 5EPMB 4MNGB 1FNFA 1AGBA 3RQ3A 1RZJH 3VFSB 2A1WL 4RMTA 3VGEA 5FDYA 1NUFA 4O00A 4DUVA 2OI9C 4X6EA 4PP1D 3QH3A 2FECL 3FB5B 5ADPH 3LH2H 3T3ME 3RWFA 1GGBL 1ACYH 4LVOB 3BDBA 1A6WL 5D1ZC 1VGKA 4B0MM 4QF1B 5GGTL 1J8KA 2XN9D 3GMLA 3EFFA 4Y2DC 3ROOB 3IJYB 4KKCC 1LP9A 4HS6A 2WW8A 1EFXD 2EE6A 4LNRB 4YC2B 1SJEA 3GSNA 1Y6KR 6FABL 4IMLB 1RV6X 5SWZA 4EN3A 1VFBA 4PV9B 3QHZL 3MA9H 2HN7B 1AQKH 3S96B 3WN5C 3UP1A 3QHFH 1U6AH 4YDJA 5E2TH 3QUYC 2GTZB 1WCBB 4M8QB 1UH2A 2ERJC 4PJCE 2DLGA 3L3JA 3ULUC 5CZXC 1CD9B 4KAQL 3G6JF 5HHOB 3OX8A 1CFBA 3NGBB 5F71A 3EUUA 5MEPA 3UTSA 4G8EA 5E56A 3O3BA 4NQDD 1A6UH 4G6KL 3FFDB 3MRGB 3ELAT 3UPRA 4OGYH 3SKOB 1L7TL 1CFNA 1VACA 4YBQD 4KV5F 4TRPH 3VFPB 2R56H 1JHTB 1HSBB 5E7FA 4CMHC 4P5TD 2ZCHH 3K8MA 5BS0B 2XY2A 3RUGA 2QTEA 1ZHBA 5EZOH 4X5LA 4JO2H 5FHBH 4Z8FL 1KBGH 4EQ2A 3DX8A 2KKQA 4HDIA 1EEZA 3IXTB 5J12B 4F8TA 1IGJB 5IBTH 3E0GA 4PD4K 2APVA 2X4TB 1LMKA 3R06A 3QA3A 1T4KB 3NOIA 5DRWB 4TNWF 3DARA 4S11A 1BHGA 3ZE0E 5KZCD 1TQBC 3KYOB 2EYSB 3QXDA 3U46B 4Z7UE 5H8DA 4FQ2L 2O93L 1MCEA 5EOQL 4R4FL 3O2WL 2XQBL 5JZ7C 1PKOA 4YHOH 4HWBL 4NO2A 4I48A 4GW4A 1DN2A 4H5SB 1DQDL 1YY8B 5EUOF 4K9EC 2EC9T 1T1YB 4ZPVB 3IRZA 1DUYA 1F90L 2UY7A 4YHLL 1GHFH 4YBLC 4P5TC 4XB7A 2R2BA 3QEHA 1AKJB 1EGJL 2ADJA 3A0OA 2OK0H 2HMID 1PSKH 4L4JA 4XI5C 4M48H 2ZUVA 1KT2B 4IRJB 4OFPA 3IS0X 3O41A 3MNWA 2JELL 5IQ7L 3VMOA 2BSTB 5ELIA 4Q0XH 1NDMB 2E3VA 4ONFL 4S0TD 4P59L 2IFGA 3BZFB 4HS6B 3H9HA 2PUQT 1N59B 2NXZB 3THMH 3QEGH 4PYHA 4D0BB 1NAMB 5MENE 4K94C 2VUOA 2WP3O 1UFUA 5MHSD 5F44A 4WFHD 3OJDB 2VAAB 1H3WM 4L8SC 4QT5A 5DD1H 3V5DB 4KQ3L 4M4PA 3TCXA 3A6CL 5DEGB 1FZOB 5TQ0L 4Z7UA 1OAUH 3PQYE 2H45A 1T66C 4Y4KD 2ESVE 3X11A 4M6MH 3SDXB 3MRFB 3PDGA 4ZFZB 3IXAA 1PDKA 1C1EH 2EKSB 2QQNL 4KKLD 2QADD 1KIPA 3IB4A 1QFWL 1UXSA 2AJSL 2NPLX 3RNQB 4LLDB 4AEEA 4NUGH 3I9GL 2Z92A 1BQHG 1TXKA 1CXIA 1NAML 5EBLB 3NZHL 1UVQB 3ARRA 4Y2DD 5IMOA 4JDVB 1S9WA 4ZOEA 3G6AA 3OKDA 3EO0A 2QHRL 4NO3B 1FL5B 5IB1B 1KJ2A 2HKFH 5IT2H 4P5KA 1FE8L 1UH4A 4JFYB 4J3UA 1BFVL 4NQSB 5EU5A 4M1GL 2JCCA 4JANB 1GGBH 1P4IH 3IF1B 2Y07L 4HT1H 3NABL 2GSGB 3O6FD 2VDRH 3E6HB 4MDJB 2VOTA 1RAMA 2KDGA 4OZHA 3FN9A 1KJ2B 4HWUA 3QRFM 3GGWA 3SKMA 3BEVA 5IW6B 1KCUL 1JYVA 4K2UH 3MR9B 4GH7B 2XN9A 1EO8H 1QZ1A 5ABDE 2WBJD 3K3QA 4ZYKA 5IMLB 1Q9KB 5DMYA 3C6LA 1NFDF 1D5XB 4IRZL 1MWAB 4JAMB 4U1NB 5C0DA 3ZE1E 3UJIH 3PV6B 4LCWD 2CUHA 1O7VA 1R3KA 4OF7A 5D5MF 4XBPB 5C09D 3KAAA 2BSRB 4OFIA 5E6IA 5IJKC 4Y5XA 4RISH 3BP5A 1H0DA 2VZSA 5C6TH 4OLVH 1K8DB 2EDTA 3HA0A 3ZKND 3FQWB 1J88A 4QXTA 4L5FH 4YHYC 1BJMA 3U4EA 3B9AA 1L7IL 3VG0L 3QJHA 2FSEB 3LIZH 4DZBB 1I8MA 3OKMA 4ZUSA 1JZ6A 1DBMH 3HPLB 3ZE0F 2AJ3A 2LTQC 4PG9A 4UIMB 4LCCA 2OL3A 1JCKA 1IT9L 4ELME 2OSLA 1PY4A 1DBBL 2APTA 4Y7MA 3LEXA 5LGHL 3VRLE 3HB3D 1B3JA 2AS5M 4L4VE 2Y36H 1HH9B 2X4QA 3OGOE 2QSCL 5BS0E 3EDKA 3PXJA 2ENYA 4WV1B 5DD3L 3VXSE 1CTNA 4J4PA 2NX5A 3WIIH 2WZPD 1H3VA 4OZHE 2A74A 1AGDA 4R3SB 3VGAB 4U3HA 3WUWB 1YMMB 3MODH 3C08H 2JJWA 4GXVH 4KUCD 3LZFH 1SY6L 4Y1AE 1IAOB 3TIDA 3MZGB 3REVA 2VDOL 1A2YA 2RGSA 5DJ2A 3QO0A 1N5AB 2RJMA 3DNKA 3HMWL 3RDTC 1CFSA 7CGTA 1U3ZA 4MAYB 2X4NB 35C8L 5J3HC 3QWOB 1F90H 3DTXB 2CDFB 3O6LH 3P4MB 1KSRA 2F53D 3NPZB 5LXGH 4NM8H 3O3EB 2XT1B 4PPTA 4NN7B 2IGFL 5DI8B 5I15H 1X5GA 3VXSD 4IRSA 1GOGA 4ZAKC 3S5LA 1NMAH 4KXZI 5JQ6L 5CCKH 3HI6H 4IOSD 4JQIH 3KHOA 3KJ4C 3GMRA 1A5FH 4CVUA 3D39E 2CUMA 1JNNH 1L7TH 3C9NB 1CGSL 2F19H 3M8OH 3RDTA 3I75A 2GK2A 5D1XB 3O4LA 2AKRB 3D6GA 4NHUA 2J6EL 4PBXA 3EFDH 1CICB 4P48A 4MNQD 1IGMH 1TQCB 1R3KB 4HMCA 5IP4A 4MNGE 1QSVA 5JIPA 1UYWH 4ZYKB 4U1JB 5IEHA 4PLOB 4F9LA 1EXUA 2VC2H 3LDBC 4G5ZL 4L3EE 4LCUB 3DETC 3I85A 5TJWK 1U93A 5FYJL 4Z6AT 4RIRB 5KVEL 1RHHB 2VSCA 3KLAB 5E2UH 4LLYA 3OKEA 3DVNA 2GSGA 5DLMH 3C8KA 4N0UE 1DTUA 1R3LA 5C0CA 5D1XD 2XNAA 3MJ7A 3HZVA 2PO6D 3UAJD 4G3YH 2NW2A 3MRJA 1Z5LA 4X4XB 4NYLB 4K3DL 5J6GB 3TBVB 3LV3B 4MCYA 2X5PA 4FABH 3ARGC 1NCNA 1J5OL 2OK0L 3F8UB 4ZFFA 2Q20A 2BRRL 4L3ED 4OZIA 3FT2B 3I2CH 2H6PB 3EDFA 2P43B 5T1MB 5I74B 1F00I 2RCSL 1X3DA 3WNLA 5J57B 1NANI 5FDWB 3CXHK 3S3SA 3THML 4LK4A 1DVFD 1TZGL 3C8DA 2FBJH 3T8XB 3VXMB 3VXUB 5AAWA 1VCAA 3MX0A 4UINL 5JIIA 1WAAF 3UC0H 1U41A 5GGVY 4ZQKB 4LBEA 4U6VL 3UZEA 3DVFA 4NQDE 2OP4L 4P2YA 2X42A 4KY1H 4TNWK 2X4QB 1MFCH 2F74B 3OTTA 4H8WH 4KZDH 1MRFH 4LU5H 2O5XL 1CIDA 4RGMB 4JE4B 5C6TL 2EDYA 3UJTL 3H7BA 3OV6A 3TYGL 1KTDB 2AEQH 4NJAH 1A7OH 4G8IA 3DI2B 4WO4A 4UDTB 4D94A 4IRJC 1JHKH 2CKNA 5C3LD 5D96C 1CD8A 2DTSA 2FGWH 2GFBB 3FMGH 3IU3A 4LSRH 3X12A 4YBHA 4LHUG 1AKJA 1E6OH 1JGLH 3TN0A 4NZUL 1PZUB 3HCVA 2ARJA 4FXGB 3P0GB 5LCVL 4OCSH 4NO0B 5DEFB 3K80A 1T6VN 1VEOA 2EECA 1L0QA 2GYSA 3CMOH 4MD0B 4NCDA 3SDDD 4IM8A 4N1CA 3MRHA 4OFYA 5IMKA 2XTJE 3HI5L 4OUUB 3VXPA 3PP4L 3QG7L 1JGEB 1F4XH 4WO4C 3W11C 3WHE0 1RJCA 5EIVA 1ZT7A 5DJYA 3GNML 4WDIB 1P2CB 4P46B 1AXTH 1XR8B 3BO8B 5BOZG 2JJTA 1Z5LB 1A1OB 2ERJB 5C7XH 5ALBH 5L2KE 4HEPG 5JDJA 4QHKI 4QWWC 3QCTH 2WV3A 4LSSL 3PL6B 4O2FA 4G9FD 3UJJH 4FZ8L 2RR3A 5B8CB 2ZSWA 3IJSA 1RUMH 1H9VA 4NUGL 2J88H 5I1DB 3LPWA 5DJAB 1BOGA 5CBEB 5E00A 1T80A 2PO6A 4ODVH 4Y4HA 3VFRA 3T08A 5JW4M 3AS1A 4DCQB 1QKZL 2UY6A 3BRDA 1S9VA 2N7BA 1JGDB 1OTUC 1DCLA 2VLJB 3FO2B 4KRPC 2BMKA 3IU4L 2GCYB 2FEEL 1E27B 4PJBB 5EUOA 3RPIB 3IYLW 3K2UH 5BW7C 2NY4B 2WQRA 2BXZA 4JJHA 2J6EH 4A2MA 2GQHA 3U9UB 1TFHA 2GK0A 4LASH 4KC3B 1F2QA 3ARED 4LLVB 3D0LA 1GH7A 2CIKB 3C6SA 3ZYJA 2J8UE 2OMNA 3WFHA 4IDLA 3FQTB 3CC5B 4JRWA 2VAJA 1BBDL 5DMJB 2AERT 2NY1B 4M8VA 1YUHA 4R6UA 4JLRA 4Z7UF 3QQ3B 4XGZA 1OP3H 5FM5O 5ISZA 1KXTB 4JO3H 3MBEA 4OM1L 2VDOH 2AXGA 5C0IB 4UTAH 3CDGA 3NVQA 4DJMA 3TVMA 1KT2A 3W0WE 2QJDA 4XNUH 2LU4A 2R9HC 4ODSH 5TPWH 3BP6A 1A14H 1INDL 2G2RA 4KTDH 3X12B 5HY9B 1FZJB 5IFHL 4J7RA 1K2DB 1MFDH 2NY4D 5GSRA 3WO4B 1G7JA 3VH8G 4DW2H 2PYED 4LPUA 1NMAL 4O2CB 5F7KC 4ZXBB 5EB9A 3NCJH 1OGAD 3QUZC 1MUJB 2EH7H 2JCCF 1CGYA 4TVPE 5DVNA 4KPHL 3ZKMC 1I9IL 5F6IB 4JRYA 1AC0A 2OZ4H 4JKMA 5ALCL 4WEMB 4OI8A 4G9FB 3BXNA 3T2NL 3FFCB 2VR4A 3T2PA 5FYLL 2ZUXA 1NCWH 4R90L 4KI5E 2A9MH 5F7WC 1YMHA 2YUXA 1CL7L 1XGYH 1PJ9A 4GXVL 2F5BH 4ZNEE 3DSNA 1HXYA 2I26N 2G5BB 2VLRA 4LNVA 1T5WB 5F9OH 3BZ4B 1CU4L 1UXWB 3FB5A 1KJ2H 1MH5B 4XXCC 3H42H 5JHDB 4Y19A 2VJXA 3TF7C 4P9HC 1MFBL 4TUJA 4DN3H 3KPNA 1BFOB 3ULVH 3FFDA 5BS0D 3LHPL 4JB9L 2GFBA 5ANME 3G9AB 5L8JB 1FYTB 3G5ZB 1D9KB 2XRAL 5EBMB 2VH5L 4N90D 5JHLL 4NBZB 2BNRE 1I85C 3WE6B 5JPNB 2Y4SA 3T04D 3AS0A 4WTZG 3MRQB 3PHOA 4Y4FB 4GKSB 2K1MA 4KK9D 4TULH 3WO3B 4TSCL 4YR6B 1G7MB 5I1EH 4GG8A 3WSQH 2A1WH 3BYYA 3IDJA 3PP3K 4X6FB 3Q1SL 2VABA 3BPCB 3ZDXF 2QEJA 1NEZB 2I9TB 4D0DB 2Q7YA 1FNHA 1MF2H 1OSPL 3OXRB 3KYMA 3BN9D 1CFQB 1N5YL 2GUOB 5ADPL 1MQKL 5GRWA 4JO1H 3FTGB 3N85H 3V8OA 5KS9F 2AXFA 3LQZB 5AZ2L 3OX8B 2UZXB 4OZ4A 3OKDB 4MNHB 1NUDA 4Y4KA 1RUKL 3JWDH 5HYFA 1RK1B 1REIA 1WJ3A 1IC1A 4NQSA 4OBSA 3JV4B 2FDBP 4P2CG 1YEFL 3QR2A 1D6EA 2CIIA 4ZO9A 4HUVB 3HNVH 5DYOA 4HIEB 4LKCB 3MLWH 4KKBD 3GHEH 5ANMB 3V6ZB 1FLTX 3H9SE 4UQ2B 2FJFB 2BY0A 1RZ7L 4KZDL 1K4CB 5JIKA 1WBYA 4HPYH 4JVPA 4MQSB 1UB5A 4MLSA 1T3FB 4BQBA 4M3KB 1RZKC 4XVJL 5ANMA 5CJOH 2XY1A 2CKBL 2DYPA 1A7OL 3MRDA 4GKZA 5DZOA 1RUPL 4RAVA 5F1IA 1QRND 4WI5A 4XNZB 4RGOL 4YAQB 3FFCE 3SKNA 1T83A 2FEDD 3RWIA 2X4RB 3PABA 3VGAC 5C09E 3CFBA 3RA7L 3RAJH 4E41A 2RCSH 5DK3A 4C83B 5JW5B 3VI3F 1T22B 5HHOA 5C2BL 1QYGH 1QBLL 1I7UB 4DZ8A 1U8HB 3BFOA 3DGCR 5JOEA 3AREA 4IBLT 3V0VB 3OR6B 3ZTJH 1XFPA 1A6WH 5ETUA 4RWYH 2WNGA 1N7MH 5ADOH 3BDYH 1W8NA 5D1QB 2I5YH 3S36X 1XIWC 1T04A 4D9RD 2EDFA 2AQ1A 3HPJA 1T1YA 2VQUA 1A6TB 3SBWC 1U8KA 4Z77A 1DQDH 4YHYB 5EN2B 4KK6C 2R2BB 3QEHB 3ZTNL 5IB3A 4G8EB 4YO0B 2IFFL 4HF5L 1CD1B 3IVKA 2ZUUA 4NQEE 3U46A 2O5YH 1T7YA 2FB4L 3KLSA 3T2QA 3GMRB 3CVHB 2F54E 4MNQB 4I77H 2P5WE 4LKXB 5CWSA 4AEHH 2ICEB 4FZEL 4R7NA 4YK4B 5BMFH 1NJ9B 3FZUC 4F7CB 2MKLC 3U0TB 4ISVB 4MJIA 3WDJA 1MCFA 1ADQH 1IZJA 1KIPB 5L2JA 4U1JA 4X9IA 1GGIL 4XPTL 3C5JB 3VFTB 1IGFL 3VG9B 3UTZA 4GSDH 1M7DA 4JJ5A 3GJFK 1XGQA 2V2WB 3WKMH 3I75B 1AXTL 4WI4A 4RZCB 3SDDC 3KPOB 3OZ9H 5H37G 1S7VB 3BUTA 4WWID 4HIIB 4LRNL 2P5EA 2JB6A 1NSNH 3MRCA 2DJ4A 4FQ2H 3MUHL 2CRIA 1KTRL 2OX5A 5ITFA 4J3WA 5DSCB 4CVWA 2HTKD 3P9MA 3X3GL 4BUGA 3TT1L 5DJ8B 3MACL 2VITB 4PJAE 4R26H 4AZ8A 2F54A 5GS1A 3P3YA 2J2ZA 4WFFD 5D5MB 3GM0A 2J1KA 3KLDA 5E6IB 3WXVL 1UT9A 2UZIH 5D7JA 4Z5RA 3UX9B 1QA9B 3U30B 1OAXL 3QUKA 1UJ3B 3UXFA 3KNBB 4GRLC 3JBG7 1ES0A 7FABH 3VMNA 1I1RA 3S35X 2AV7A 5J13C 4G9FE 1RZJC 2OLDA 5LBSL 3VD7A 4X4YA 5D4QA 5ALCH 1XF5B 1MAKA 4Z78A 1VHPA 1D5XA 4U1NA 5C0DB 4N8CL 3KR3H 4G42A 4GT7A 4LVEA 4H25A 1HOCA 3QXVA 32C2A 1LO3H 4GAGL 5TH2A 3VFVB 4HHAB 4IRZH 1TETH 4KMTL 2WWKO 4JFQB 2XTLA 3NAAH 5EOQH 5D7JC 2YMXL 5CP7A 3NCMA 2IPKA 1T21A 4OT1H 5DS8B 2Z4QB 3DXAB 3QNZA 1YNTB 1IARB 3OKMB 1MFBH 4RCAA 4KDVA 3EO1A 3GSNH 1P1ZB 1WIPA 4KK6D 3SGDI 1VEPA 2H32A 2JB5L 2V17L 4Y16C 5B4MD 2VB5A 5C08A 1MWAH 4HIHB 3KPRA 3PWPD 3GJFA 3VWJA 5JR1H 1G7HA 4JVUA 4N0CD 5DQJA 2E7BA 1A4JA 4F15B 5C0RL 2JJVA 4JHAL 3IJHA 1A1NB 1IGCH 4A6YB 1D9KC 3SE9L 3ZKXB 1AGFB 3QNYB 4RAUA 3ZKXC 1U8JB 4X0KA 1X6LA 2EH7L 1A6ZB 3RJQB 1MCNA 3LQAL 3T4AA 1LEIB 1Y6NR 4JFXA 2Q86A 3JV6A 3DUSB 5ICXA 3OWEA 1BBJB 1E28A 3ECBA 3J7HA 3Q6FB 5HGHB 1OTTC 5CEYB 1OVZA 4D9LH 3SEPA 1BP3B 2GTWB 2YD8A 5C07A 3QUZA 4U1LB 3VW3H 3KPPA 1LEIA 2AAVA 1JF1A 3EIFA 4M5ZH 4R96A 2BNUB 1OPGL 1CDJA 2X10A 4YXHL 4YPGB 3HNVL 1KC5H 2VLJE 1OGAE 5FXCH 5J6GA 3SE3C 1Q9OA 1CIUA 4DN3L 3LEYH 1VFMA 4KVNL 5ACZB 2AJUL 1NKOA 1BLNB 1A9EA 5F9WC 1S9VB 1FYTD 3G6JA 2BOBB 3RZCA 4ODWA 1EA9C 4BK5A 1NC2D 2IQAB 3RPIA 5DRZA 5ID1B 4PJHA 4IJ3B 3JUYA 1U8NA 1JWUB 4B41A 1U8MB 3CSYA 4JQIL 2P7TB 1NGXA 1KENL 1KELL 1R3LB 4FQXC 5C0CB 1WCBA 2R1XA 2A77H 2D7MA 1QLFA 4C54A 1BOGB 1SMAA 4GBXC 4FFVD 1N26A 2QADC 4LVOC 1GC1L 2DQGH 1LILA 3G6DH 2V5YA 3MFGB 5GGSB 3LAFA 4BZ2L 2FL5B 1F3JA 2QSCH 1RUKH 4NO5B 1PEWA 3QQ3A 4XGZB 5E1AB 4D0CA 2QQLH 4X9FA 3O3DB 2PTVA 3QXDB 2YSSB 2HYMA 4PJ9B 1IE5A 1CDCA 5B38B 1AHWA 3QI9B 3GUTB 3JTSA 2Z0BA 2DM7A 2MOVA 4H20L 3DXAD 5HI4C 1INEL 4M43L 4L9LC 5BZWB 1YEKH 4CJ0A 3HUJA 3D3VA 3MODL 5I1KH 4LCCC 4P3DA 1AGEA 2OJZH 3O3DA 5BXFA 1P69B 1IKFL 4IIQA 4O51A 4KKLC 4LQ1A 1D5BA 4XWGL 4UU9B 2C3WA 3CGTA 4KDWA 5EZJA 1I9RH 4LP5A 4PB9H 1TMCB 3VFWA 2KH2B 1S7TA 5I76B 3KLAA 5DUBB 2VO5A 4K3DH 5KN5A 3AU1A 3WXWL 4WO4B 2IGFH 3MOAL 1S7SA 4WHTB 2R1YA 4YFEA 3B3IB 5CZVH 1DQQA 4OB5H 5D1ZB 4FS0A 4GW1B 1FGVL 2Y36L 4LMQE 1QYGL 5H94A 1A5FL 2YZ8A 5JA9A 5ESQA 1HZHL 2HVJB 3ILQC 3VXME 2H2SD 1TLKA 3RVVC 5I17A 1XGUB 2QQKL 3JVGA 4LAQH 1U8HA 3FO1B 1QLRA 5EOCH 4NP4L 5C0JA 4L4TD 1BQHB 4OGXH 2CUIA 4OAWB 5LQBH 4OKVA 2A83A 4GAYB 3S6CA 4G5ZH 3UEZA 4Q9QH 4XPBL 4HQQL 4N9GA 4H8WL 4TUKH 1MEXL 1CDBA 3BSZL 5LKNA 2V2XA 3QWOA 3VRIB 1IEBA 2H2PC 5IM7B 4KXZH 5D5ME 3MRNA 1IAKB 1EHLH 3MROA 3MXVL 4U6HA 2D0GA 4PYGA 4QWWD 3OR7A 4PP2A 5I1CL 2QR0A 3MUGA 3RWJB 5F9AC 4MZ3A 5D71H 1UH3A 4KHXL 3AY4C 4LCYB 3V6FA 4X9HA 3TM6A 3WJJC 5JPMA 2H26A 5F9JB 1S9YB 1QFWM 4NQXA 5KS9A 3WEXA 3RDTD 4MJID 1HHHB 1DLHB 4TOYH 3C2SA 3QNXA 4CU6A 3DHMA 3CMOL 1P9MC 2AI0H 3FL7A 4K3JL 5EZIH 2EXWD 1GGYA 5T3XE 1DEEB 2UV3A 1KOAA 3O9WB 4OLXH 2DQTH 3HE6C 5FA4B 1WSST 3WKML 1HQ4A 3GNMH 3TNMB 1S7WA 3LKSA 4K3GA 4D8PA 3ORJA 4X6EB 3VFWB 4YE4L 1FZKB 3P4LA 3ULVD 1V05A 3HMXH 2HKHH 4OLWH 4KMTH 1OLLA 4JRXD 4XCYB 1PEZA 5CGYD 4JY6B 3D9AL 5D1QD 1FV1B 2DWDB 5CJ8A 2P24B 1Z6JT 4Y2DA 1IMHC 5HHMD 4PV8A 3UJJL 1YY9D 4X6CE 2YXFA 4YUEH 3RX5A 1MWAL 3IDXH 1VFUA 4XC3L 3OKOB 5E94A 5AG9A 4D3CL 3S8WA 3GBML 4P49A 1OL0A 1FVEA 3ZKNC 4Y89A 3BH8A 3RTQB 1FAIL 5MENB 1BF2A 2LQRA 1RJYA 4WIQA 4LGPB 5FK9B 4GAFB 4LCWB 1F11A 2JJSC 4ZTOH 4JFHD 1MRDH 5FO7A 1YMME 2CK0L 1OP5H 3ZSTA 1A7RH 1ZHNB 2ATPB 1LDPH 3KJ4B 4OD1L 2Z93B 5KSBF 3TGXA 3U6RA 2B20A 5TE4H 1HIMH 2EYRA 3B5TA 2GEEA 1A2YB 4ZS7L 4D0BA 4PGCA 4Z0XA 3V95A 1INEH 3CVIL 2A0LD 4OZGE 2OP4H 2YD6A 5GS3A 4TUOB 4AY0A 4DN4H 4XHJD 5IWLC 2BERA 3VI3E 3RVUD 4FOMA 1ZVHA 5I8OL 5F8QC 4UTAL 3WFHB 3MRPA 2W91A 4PLKD 5GGRA 1HXMB 3O6MH 1DDHB 1NQBA 4EI5C 1FNSH 1ROWA 5HY9A 3F6LA 4PB9L 5INCA 1CI5A 2W9EH 4E41D 4NQUA 4Y5YB 3MRMA 4Z7UB 5KSUA 4O2EB 2X4PA 3MA9L 3RHWF 3PL6C 5ICZB 3KXFD 4RGNB 1RU9H 2PKDA 4HBQA 3MNVA 4FZ8H 1E4XL 1MHHB 1RIVL 3ZT5A 1DQMH 43C9B 2V2XB 1XZ0B 4FXGA 1WCQA 3DTXA 3FRUA 3ARUA 3QUXB 4KROB 4XRCA 3DJ9A 3QG6B 2GJ6A 2AJYL 5AD0B 4MNQA 2YPLA 4CN4A 4P2QA 2XXCB 1NGZB 2GSIB 4UDUB 1IGJA 3X3FL 4XNYH 1T1WA 3BD4A 1BPVA 3K2UL 3SY0A 5GISH 3MRKB 3DYMA 5EO9B 1EZVX 2FCBA 3D85D 4XHJC 3T3PF 2IBGA 5C92A 1NKRA 5C6WH 3Q48A 5EWIL 1T7XA 3VFPA 5DJXA 4OGXL 3RVWC 1R5WA 4RWHA 5IMMA 2HRPL 1OPGH 1CZ8L 2NXZD 4V2CB 4H26A 3SOBL 4CVZA 3GMQA 5EIIA 5ENWA 4Y19D 3FHQA 4L1HA 1S3KL 2BVPB 2IADA 4M43H 4F33B 1ZLUK 3IRPX 4PTUB 4ZTPL 5GXBB 1R3HA 3U2SB 5FA4A 2HFFA 2AEPH 5K9KB 4HJJH 4JRYE 4EDXA 3IJSB 2ZSWB 2JK5A 1ZLVH 1MRCL 2NQCA 1CT8B 4GMSL 1PX4A 3SE3A 2BNRB 4YR6A 4QHKJ 1ZAGA 1EMTH 1DLFH 3QDJD 3DVIA 1AO7B 1B9ZA 4ODWB 1GHFL 2HFFB 3N9GL 5EORL 4OZIF 3BHBB 5JORB 5F1OB 3LEVH 5IOPB 2ZP0T 1VFBB 3QUYA 4PV9A 3V6OE 3P40A 2EE3A 3JZ7A 1LNUB 3Q3GB 5J7CC 2R56L 2YPVH 1N5YH 1WWWX 1MQKH 3LV3A 1PKQE 3QISA 4YHIA 1M05A 3BKML 4P23D 4DFHA 2ZSVA 3FKUS 3D0LB 4FXKB 5EO0B 3I6GB 4BQCA 3ARBB 1QBBA 1YECH 5T1LD 1X5LA 2NXYD 5GGRB 4CRPA 5HVGB 2FL5A 2QSQA 5E9DE 1JE6A 3T2NH 1JNJA 3HLAB 8CGTA 4HKZB 1E4KA 2JJSA 3BWAB 5EU5B 4YWGL 3SKJL 1YPZB 3WS6A 4YHNA 3BEWB 5BVJA 3LQZA 4PUBL 4OLWL 3VXRD 3BXNB 5IROA 2JJUA 3ES6A 3V4UL 3QDMB 2R0WL 4DGVL 1CGWA 4JRXA 1OTSD 5DURD 4H1LA 4WUUD 4OQTL 5TQ0H 2ICWB 4NN5C 4N0UA 3VI4F 5HHOD 1F5WA 2CKBH 1WGOA 4OF3A 4NKDA 3LRHA 5GGRY 5DEZA 3GK8L 5B39A 4PJEE 4PRNA 4UV7H 1FAIH 3MRRA 3MRFA 1A21A 4EBQH 4XAWH 4DWHA 1IGIH 3EOBA 3LQAC 2ZPKL 4X7SL 5J12C 4GW4B 5IROC 1YJDL 3CSBA 4ZOAA 3ARGB 2P8PA 4OLYH 4ENED 3U0PB 4PJGE 4NQDA 4O02H 3U36A 4NZJA 2XWTB 2XN9B 3P30H 2DBLL 3QP3A 2NY2C 4DAGL 2XYCA 5KSAB 1EAPA 3KPLA 3PL6D 3BKJL 3IFLH 5EOCL 2ICWJ 5DD0H 1U92B 4KJYB 3F7RA 2DOCA 3Q6FA 3TCLB 1FG2A 4KTEL 2IADB 4R4BB 4JANA 2NW3B 5EC1A 3GMOB 3DYOA 2DF3A 2M2DA 5BVPL 3MXWL 1KJ2L 1FVDA 1EXUB 4H88L 1NUGA 3KYAA 1FL3B 1MCDA 2BC4A 3GHBL 2NY3B 3I02B 3D69B 1IVLA 3IDUA 4QRTB 1NLBH 4AENA 3SDAD 2BVYA 3IKCB 3CFKB 4MSWA 3U4AA 2O26U 5DDHB 2E9BA 2ZG3A 4LLDA 4NJ9L 4OLVL 4NNYA 4RA0C 1WFTA 1I75A 5I74C 2B7DT 4V1DD 1IJ9A 3WIFB 1OT1A 1SEQL 2B2XL 5HYJB 4HJGA 5C0AA 3S34L 3VFUA 4YH6A 1CGVA 1WTGT 4TOYL 5D7IA 1YY8A 5I8EB 5J0BA 3TT3L 4PJHB 5DD6A 4FMFA 4CMHB 5FYJU 5GISL 5T1KB 1I1FB 4ZFOB 3R0MA 1MCOH 3SO5A 1V3MA 4LVHB 5GHWH 2AJXH 2EIDA 4M00A 4G6FD 1J9CT 1LEGA 2D7TH 5L2KA 1VPOH 5ISZB 3BP5B 3L1OH 1DQJA 3RL2B 2VLKA 5GGSA 1G9ML 5D70L 3QDGA 3H9HB 5GRUL 2BDNL 3D9AH 3OAYK 1KIRA 2EDXA 2ADGB 1CGTA 3C2AL 4U1IA 5DJ0B 5E8DL 1X7QA 5M7QA 4KK5D 4KDTA 3NCFB 5I1IH 1HSAA 4JM4L 5CJOL 4Y5YC 3ZTNH 1D5ZA 2V2TB 4WI3A 35C8H 1YPZF 3D3VD 4M7JH 4WWKD 4HJ0D 3L5IA 2YA2A 4PRHA 2HP4A 3DVNB 2DN7A 3BZDA 3BE1L 4UAOC 3KPMB 4POUB 4NUJB 4OUOA 1R6VA 1T0MB 2HN7A 3GI9H 3BN3B 3TJHC 3WHE1 3ZHKA 3DMMB 2LAAA 2UZIL 4WWKA 1QNZL 4JVWA 1FVEB 1PZ5B 3RGVB 5GGQL 3LN5B 2QSVA 3DI3B 1BX2B 3DURA 1KEML 4B7LA 1K3ZA 4RZCA 1J1PH 1HKLH 1N8ZB 3RNQA 3P4OB 1BEYH 5DWUH 1UKTA 4WTZA 2M8XA 4DKFH 1AY1L 2EXYC 3ARDB 4UAOB 5I8KL 1U3JA 3RIFK 2V5RA 1L6XA 4DVRH 5GJSH 4X8XA 1U95B 2NLJA 5GS0L 4Z7QE 1J1XL 1FJ1B 5KSBB 4UT7H 2EYRB 5I6XB 4NQED 1JRHI 1C08B 3SOBH 3EYUL 4OT1L 3DX7A 3ULSA 5KANG 3BP4B 3QFJB 1O5DT 3AXLA 4JFDE 2J8UB 4CADB 2NX5E 4MDJA 1NFKA 1DL7H 2HFTA 3KPLB 2X70B 3ZDZF 2DQDL 2PN5A 4M5YL 3T65A 1RUQH 3CVHA 1GZQA 2Z31C 4NQTA 1B90A 4CJ1A 5I2IB 3CJJA 2NY2D 2HJKA 4LIQH 2HT4D 3MGOA 4XP4L 1EK3A 1UJ3A 3OAUL 3EO0B 4OD3H 1DLFL 3OXRA 1DSFL 4NQCD 2BP3A 2VDQH 4QGYA 3ARQA 2X09A 1G6RB 2BSSA 4PJDF 3WXVH 5L0QC 4WJ5B 1C5CH 5A2LH 5JW4N 3G6JB 2EDWA 4PY7B 1NCCH 4TNVK 3CMGA 4XPHL 5BRZD 1JHLH 4DAGH 4OFVA 3CFJA 4X7TA 5C08E 1RURL 1E4WL 1EZVY 2DLEA 2VZTA 4EXPX 1MI5D 5K93A 1QQDA 1U93B 2IAMC 4HK0B 1MCLA 4MD0A 2DQFB 3SJVE 3SDYL 4M1DL 4F58L 2AXFB 1H3XA 1ZMYA 3FONB 2AEIT 2EZ0D 4YWGH 3SKJH 3VXPB 2PCPA 5I75B 4M6AA 1Q9LB 1UWGH 3QRGH 4NKMB 4U2ZA 1N6QL 3H9YA 4HJJL 3HAEH 3B5HA 1Y0LA 4E5XB 3GSNL 3CFDB 5MERB 2CKBA 2VR5A 3MRLB 3NACL 3TBVA 1VSCA 3SDCC 1FV1A 3TC9A 3PWJB 4RMWA 2E8ZA 2HJLA 2VLKD 3O41B 2H32B 2XZQH 2C3GA 4JHAH 2BK8A 2Y7QB 3I2CL 4LSRL 3QJFB 4C56E 2YPVL 4RDQF 4EBQL 5JORA 4ZO6A 3VWJB 4TVPL 4JGJA 4CU8A 2AW2A 1PX3A 5D1ZA 3MPCA 2DJUA 2YN5A 4PJXE 2PXYB 1NFDA 1K9TA 4ZD3L 3SQOH 4LLWA 1H5BB 25C8L 1G9NL 2HWZL 4JPVH 3BIKB 4KV5E 3QUYD 1RK0B 1O0VA 5HHXH 3IFNL 1AJ7L 1S5HB 5BXFB 5DR5L 4GAGH 3ECBB 3R0NA 1GRWA 4XBGB 2IAND 4NRXA 3F65A 3FQXA 4GRWB 5TE6H 1YYML 2AKRA 3MLTA 4NNPL 1MRFL 4PJ7A 5BZDA 1LHZA 2YSSA 4GS7C 1DBAH 4WW1B 1R5VA 4KRPB 2Q7NA 4ELMB 3OG6B 1EGJA 3GSOA 3GJFB 3HC4L 1LO5A 4IHOB 3S5LB 1FFNA 1TENA 1UA6L 1QHOA 4OZIE 2ZNWA 4QOKE 2VDPL 5IHUL 1JGLL 4ODVL 1A7QL 3LQAH 2OJEA 1JBJA 1KENH 1KELH 5DT1H 5ID1A 4YBLB 3V52L 1J1PL 1F97A 4XCFH 1QO3A 1RJLB 1P7QB 3SBWA 5CBAA 1AFVL 1FJ1A 4HXBH 1NMBH 2R23B 1KCLA 1HNGA 3QQ9D 3BRGC 4HUXB 3HUJB 2QADB 3HS0A 4JFFD 1IL1B 3RX8A 2KZWA 2P5ED 5ID0A 3WEXB 4KJQC 1OW0C 4MA7L 3RUGB 3QDJE 1YPZE 4B7IA 3JWOC 3N1GC 5IVXA 4HQQH 4RNRA 3HI1A 1OP3K 4UIKL 3S97C 3STBA 1WBZA 1D6EB 3FJTA 4Z9KB 4ORZC 4BKLA 4U6HB 4WFGD 4KVNH 4I1NB 4I9WE 4OM1H 3U7WL 2VXTH 2WBKA 5F70A 3C2AH 1KB5L 5FCUH 2BJMH 4P2QD 3RJDA 3T4YB 4ETQA 3OB0H 2IAMA 1CXKA 2B8OT 3E6FA 3MBEB 1RUML 2WANA 4W6XB 5E00B 1QUNA 4JY4B 4ODUB 1QFWI 1ZHKB 2Z8SA 5EOTB 4OFDA 3CH8A 5EH1A 3CX2A 4PRBB 2F8OA 1MQ8A 4JQXC 3ISWA 1NLDL 5GRXG 3SDXE 2AJZA 3UO1H 1X5ZA 4Z7WA 4GW5A 5I17B 1U3HB 1DEDA 3GSRA 1N64L 2P49B 2EIEA 2MJWA 4QXTB 4Y4HC 1J8HB 4YHPA 5BO1L 4K23L 4N8VG 5HGBA 4YDKH 5JW4Q 1DE4B 5JUEH 2DM2A 2DL9A 4J8RA 4XP9H 4PJ5B 3BIAX 2C7UB 5D9SB 4XBGA 1QOKA 1A1MB 4R3SA 1YEDB 1WISA 5CP7B 2AK1L 1ZT4A 4R97C 3UPRB 1YEHL 5F9DC 3HG1A 4AIOA 2ED7A 2P8MA 5GS1C 2Z8WC 2YN3A 5KS9E 3QRGL 5D8JL 4TQEH 4HD9A 1NFDB 4MAUL 1GIGL 3KPQB 1NPUA 2Z93A 3O2WH 4F15C 1LWRA 1X44A 3P9WB 1IEAB 1CU4H 2PXYC 5EU6A 2FATH 2D9QB 4WFHE 3OKKB 4XCEB 3ZT7A 4XNMA 1ZA6A 4QTHB 5ESVB 3WFBH 4NQXB 5I8CB 3LHPH 4KZEH 5DHYA 4M5YH 5K9OA 3ARFC 4A2LA 4YO0A 4GO6B 3ARGA 2XRAH 2C4FU 3T0AA 1UB5B 3UZQA 3L5WA 1EEYA 2EKSA 1NDGA 4HCRH 3NFNA 3KPRB 5F7FA 1KUMA 4XCNA 1I9JL 5JW3H 5K9QG 3PWUB 3UTOA 3ZZ1A 1H8OA 4ZUUB 3B2VH 4K8RC 2WINB 5JXEC 3BZEA 3FT4A 3WFDH 1G9NH 2HWZH 5DYOB 2IALB 2V7HB 3SGDH 5IQ9B 5HJ3B 1BFVH 1YEJL 1T20B 5D7LE 3L5XL 3GSXA 8FABA 5HHNB 5FYLH 1I3RB 4OTXL 3NFSH 5EDXA 2A9ML 3DUSA 3RIFF 4OZGB 2IAMB 4KJPD 3F58H 4X6DA 3O3AA 3OKEB 1EO8L 3ET9F 3GSVB 5B3JE 1BECA 1RK1A 4PJFB 3GMQB 2ORBL 1S8DA 3QDAA 3ZKMD 4EIGB 5FM4A 3IFOB 3H8NA 1CDGA 4RAVB 5F1IB 3IT8D 1XIWA 1NFDE 1SEBB 3TBSB 1N2RB 3Q6GH 3RKDC 1OW0A 5IF0A 2Q7YB 1UCBL 1KCSL 1M05B 4XVJH 1P4LB 4GMTL 5F9JA 2CSPA 4BQ9A 3QUML 4HC1L 4YEFA 3LIZL 3MGOB 1PQZA 3NH7H 4PV8B 1E4JA 5DJ8A 1OAKL 5LAXB 3WJLA 3H3PL 3WSQL 4H5SA 2GTZA 5F72S 4AL8H 2HKFL 4X6CB 1FE8H 4ZTOL 1FPTH 2JIXA 4NNXA 3O11A 2BNRA 1ZVSB 2IH1B 4X6BA 1HEZA 1RUAH 5LWYH 1EFXA 3VI4E 1LP9E 1OGAA 2FX8H 5E24E 3S3PA 1AR2A 2VLRD 1P7HL 4QOKA 2J8UF 2GY5A 3C60D 1JV5A 5HDQH 3T77A 1A3RH 3K1DA 2V9QA 2I9TA 1P84J 2YBRB 1LEGB 1CE1L 5HHQA 4KUZL 2DQUL 2CIKA 2X40A 1RZ7H 1EEZB 2IH3A 3IXTA 4ZUWB 4R2GB 1M71A 1J0JA 1ZSDA 2A74B 5ESVA 3F7YB 4C58B 4IDJL 2Z91A 2HG5A 5D7IF 4HZLA 3P4NB 3MV7D 3B3IA 5KVGH 1T22A 2R15A 1CICC 4IS6B 3G6JE 1WQVT 3EOTL 3QFDB 3ZDZE 4HFWA 2H1PH 5E6ZA 2Z91B 4TUJB 1MCCA 4G6AD 4P2OC 1QR1B 5CGYC 3B5GA 5IV2A 4LRIA 5HYIA 1OLZA 3RA7H 5KAQF 2D9CA 1U2CA 5HGDA 4G9DB 3GMMB 3S36L 3B9KA 5C2BH 1XGQB 2V2WA 1LGVA 4ZD3H 5IWLA 2YA1A 3QJHB 3WN5A 3PNWB 1FL3A 3HN3A 3FHAA 5IJVB 3TESA 3CX5J 2NY4C 4NZRL 2CMRL 2I07B 1MLCB 3ZDYF 4HWEH 3QQNA 4GSDL 5D1QA 1YEEL 2J6EA 2ZWLT 2I5YL 1IAIM 3ZHDA 5DHXB 5KOMC 4R96B 2OR9L 3DUHA 3FN0H 1T2QH 3V4PL 4Z76B 1JP5A 3R4DA 4FQIL 5MEPB 3RWFB 3SHSA 4KVCH 2X1WL 4L3CB 4LARL 5EA0L 3BEVB 4KJWD 1ORSA 3MNVB 4GRWE 3U1SL 3LSOB 4Q6IB 4EKXA 4I0PB 2PYEA 3ZT6A 1R24A 4NBYB 3TT1H 4M9PA 3BAEL 1GPOH 1N5AA 3HI6L 5F1KC 1IC4L 1MIEH 1RZIA 3GKZA 4JO4H 5EOCJ 5DQJB 4WEBH 5DDHA 1BM3L 2LTQB 3DRQA 3BPOC 1J0ZA 4QY8A 1MHCA 2CQVA 4NRZA 5D2LA 5E95B 5BO1H 3C6SB 5DJDB 1EEQA 3IJYA 3S88L 2PETA 2EDDA 4GQ9H 4FQQB 4PJFF 1WIOA 3NFPB 4AK1A 4D0CB 5E2WH 3OXSA 1OB1B 5FYJH 4FQCL 2AVGA 2WSKA 1OAYL 4AM0A 1NMCB 3LRSA 3AFLA 3DV4B 3NCEB 1PYWA 4ORGA 4OZGF 5FYKH 3T8XA 5GS0D 1A7PL 3ESUF 1KTKE 4PRIA 4HUUB 5L8KB 1CFVL 2YD1A 3SDDA 3A6OA 1JZ2A 1KB5H 3VFMA 5D7JB 2EIZB 4BK4A 3VFGH 2FH8A 2XKNA 4AIZB 1U8JA 4X0KB 4GMTH 3WFBL 1MWAA 3BRFA 2AP2A 3QUMH 1B0RA 5IIEA 5IFJB 4DTGL 3QEQB 1IBGH 3MV9D 1P1ZA 2OS7A 3EO9L 1D5IH 1NLDH 4X6DE 5F7NC 4ZFZA 3UO1L 4PGJA 5C0EB 4XVSH 3QI9D 1KNOA 1OAXH 1IKNA 4I2XB 1FN4B 3QIWD 2BNQE 4K23H 4NGHL 4PJ5D 3U6RB 2VQTA 5GIRB 4HHAA 1WWAX 4WVRA 3V6BR 5JUEL 1FGNL 2MPAL 2D7TL 1T0MA 4G42B 4LVNB 2MQ3A 4L3CA 3KJ6L 3BWAA 1S5IH 1LEKA 3WDHA 5DJ2B 1DE4A 5CGMA 4Y4HD 3QDGD 5C0AD 3WFEH 4Q6IA 5IUSA 1YQ2A 2GTWA 1CE1H 4Z18A 1CLYL 1FNLA 1HK6A 3NAAL 3QHTC 2XZZA 4LSTH 5BVPH 3SE8L 1H3UA 2C3HA 2NX5B 4G6FB 5F7LB 5ALBL 1MJ7L 5CEZD 2QKIA 1U95A 2H3NB 1F3RB 2XPGB 3RIAF 3OAZH 4MWFA 2XN9E 4ZPTA 2XWBA 1V7NH 3D25B 4RSVA 5IBLC 3TIEB 3VWKD 5CLTA 2HFGL 3GMMA 4AQ1B 1XH3A 5FGRA 4BSVA 1BX2A 4G6ML 3EYSL 1Q0XL 5IB2A 2ZPKH 4PB0H 1CD1A 2UZYB 3UBXB 2NY1C 4MJ6A 4G8FB 5LCVH 3P4MA 3MREA 5CHNB 5DJAA 4L9LB 4G6KH 3MJGX 4OLYL 4OKDA 4JM2B 1EUUA 4LOUC 3FTGA 3B6SA 43CAB 4U0RC 1P4BH 2I9LA 5F88A 4MQXD 1WUNT 5IVXF 2YEZB 3DROA 1QRNE 4KJWC 3X17A 4Y1AA 1M7IA 3IFLL 1P7QD 5I0ZA 1RZFH 5GS0H 2KL6A 5HJ3A 1QSEA 1MCRA 4KTEH 3MRIA 3QDME 1U0QA 5T1MA 1NCAH 2F5AH 1JGUL 1IL1A 4WV1A 4AENB 1GXEA 5DJXB 3VFNA 1RJZB 5FYKD 3O4LD 5F1SA 3QUZD 5C0FA 2WIIA 1HI6A 4X7FC 3E6HA 1AP2B 5CEXB 4XPFH 2NY6B 3MV9B 1E27A 2W60A 3OJMB 5EBWA 5FF6B 2W0FA 2FH6A 3VU2A 5C0BA 2Y6SD 1ZK9A 1UM4H 2WUBL 4H1LG 5IB3B 2P46B 4ETQB 3LMJL 2SEBB 4XBPA 5E5MB 3M1BB 3TBWA 3IU4H 5EBWB 5JO5B 5IR1A 4YDLB 4JHWH 1QNZH 5DO2C 4U7MA 2EIZA 4TRPL 2FNBA 3FQWA 2EZ0C 2R1WB 4PJ7F 4PJHE 3MRLA 4P59H 3MV7A 5D6CA 4ZSOB 5TFSL 1XEDA 2A38A 3S7GA 3VCLA 3P11H 3DV4A 3QEGL 5DHVH 2GJ6E 5GS2H 3RP1A 1YN6A 3UTQB 1FQ9C 3M17A 4KHTL 4JFED 2F8XC 4U2YA 4IMKA 1GGUA 1KFAH 2FX9L 2BDNH 3O45A 1I1CA 4PGCB 3PXHA 3HTLX 4U0QB 1ZWIB 1JJUA 1ED3B 1I7UA 2OBGA 5ACMA 4IEFB 2G9HB 4KQ3H 3P9LB 3W81A 1WVZA 5T1LB 2YC1B 2P45B 1DVFA 1DUZA 3I3EA 1DL7L 5J1AA 3ULUH 1HDMB 4ERSH 5MHSE 2UYLA 4LSQL 2D03H 4NCC1 5GRJL 3O81A 4G7YH 2XFXB 1Q72H 4AQOA 2IANE 5IBLD 2VDKL 5KVFL 1AXSA 1AGEB 3SJVA 4U7SA 2ZUTA 5M95B 3OPZH 5J06A 3QO0B 1MCKA 5CZVL 4HBCH 1BJ1J 1FLRH 1CD0A 1DSFH 4Z77B 3MUGB 2QR0B 3RWJA 4N5ED 4I4WA 5DEGA 1QBMH 4X4XA 4L8DB 3MV9E 4HW6A 4NZTH 3W39A 1JF1B 2R0ZH 4K3JH 2V5SA 1P53A 1BZ9A 3MYZA 3QPQC 4NRXB 4D9QD 5EU6D 5FEBA 1FZKA 4E0RB 3MV7E 3IFNH 4JHBA 4YQXH 1Q9LA 1TDQA 2J5LC 1J1XH 5DRXA 5FYKU 2DQTL 4PJEB 3K1KC 4ZS6C 3D3VE 1QLFB 1ZHNA 4P46C 1BBJA 1E28B 1MJUH 1OD9A 2F5BL 1BIIB 2VXVH 2F53A 5I1GL 4MNHA 1MEXH 1K3IA 5IB1A 5T1DH 1F4AA 3I50H 3DX8B 4EI6B 1N6QH 1C1EL 3IDJB 1OAZH 4X6FA 3SO3B 1KCVL 2B4CC 3SO3C 2WWMD 3IDGB 1SYSB 2DD8L 2FEEI 2CD0A 5JPMB 2D31A 4D2NA 3WYRA 2VXQH 5FO8B 3MV7B 3DBXB 1Q0XH 1ODAA 2IANA 4I0PA 4OF8A 4PR5B 5AWNH 1PD6A 4QXUH 5IB4A 5I1EL 5E7BA 4JAMA 5E8PA 1A4KA 5LGJB 4XVSL 1DN0B 1VB9A 1RD6A 1MF2L 1OSPH 4HUWB 1S7TB 4OZFH 2ATKB 5CSZB 5ECJE 3WJJA 3F5WA 5CIPB 4MD5B 1P4IL 1U36A 1T4KA 1SYVB 2VZ1A 5DRWA 1XZ0A 4HH9B 1U91B 4Z78B 1RULL 3H9SB 5BZWA 3PF2A 3JTTA 4PBVC 1I7TB 4HIXH 1KCKA 3JV6B 4RRPA 5KW9H 2L7UA 5C0FB 2FIRT 1F4YL 1MPAL 3N1MC 3KNBA 3WUZA 1AD9A 4RWYL 2ESVA 2FYYA 2XQYK 4WCYH 2CRYA 3FQTA 3H7BB 4JFFE 4A6YL 1CGUA 3CSPA 4QO1A 4L8CA 1RVFH 3HI1B 2Q6WA 4UB0L 1CLZH 1W2KT 3HZKA 1WF5A 2GJ6B 3NN8A 5AD0A 4Z7WB 1QR4A 1TQBB 2HTKC 4I0KA 1N6UA 5SWSD 3KPSA 1F6LL 3HHRB 3O9WC 4LPYA 5MEND 5HDLA 2OL3L 3V2AR 1U8LA 4C55A 1EERB 3U48A 3NIDE 3QIBC 5CCKL 2GJZA 3IAGC 1SQ2N 5DUMH 1CLOH 4OD1H 5J56B 5CIPH 1FGNH 3UTPE 1BQUA 4GKZB 4YDKL 4BQ6A 3DWTA 4PJFA 2IAMD 4OFKA 4ONOA 2VXUL 1FIGH 3W0WD 5J6HA 5IEKB 3PG2A 1A6TA 1TITA 4WDIA 3WFEL 5EU3A 2E5EA 4G7VH 1C16B 4AIXA 4F7EB 3WN5B 5D8JH 2ITCA 1NC4B 3W0WA 4MAUH 1PLGH 4N0RA 4AMKL 4MJ4A 4R4BA 2NY0B 1G7QB 5D2LF 5IQ9A 2RBLA 4RMSA 2VLMD 5E2UL 5FAAA 4XNZC 5EU4A 1UGNA 3S37H 4HPOH 3SDCD 5SWZD 1TZIB 4ZFOL 3F6IA 4JN1L 4CMMB 3MO1B 4KGJA 5HYEA 1V7NL 1TCMA 5I1DA 1B4JH 5LXGL 4KKBC 4PGBA 4WI2A 4Q9RL 1WLHA 5FGCE 1FL5A 2WBJC 1GJIA 2FECI 4NN6B 4XX1E 1CFTB 2KPNA 1LVEA 2MWCA 2FO4A 2ZKHL 2YA0A 2AJVH 2X1OA 4BSVB 2YPLD 4PFEA 4R0LA 2BRRH 1K8DA 3VRLF 3VWKC 4YDJB 3K4AA 4UDTA 5DQDL 2X4UA 3MFFA 2CK2A 5E94B 4IOFC 2VLME 4M1CC 1CCZA 5EWIH 4Y19E 1FH5H 4NKMA 5SV4A 1JNHB 3LEXB 3L7FB 4CVXA 4KHTH 4HXAL 3V5KA 2FX9H 5BCAA 2R39A 4WUUA 4JCMA 5DJZB 2WUCH 3L3IB 3OXSB 1YMHB 2BJML 2CDEB 4P2RE 2A6KA 4KMQA 4F7TB 1L0XA 3L5WB 4NWUL 4XP6L 3QEUB 4G3YL 3QUKB 1R3JB 2YD2A 5IB4B 3T0DA 1D6VH 2A6DA 3QJFA 2P8LA 4MNGA 1T66D 2OTUA 3MGAA 1WBYB 4N0UB 1PG7W 4LGSB 4KQ4H 5C0CE 3F62A 3M45A 5ILTH 5JXAH 4OCXH 3OR7B 5ITFB 1JTOA 3L6FA 1CS6A 2H26B 1TPXB 1DUYB 4F7PA 4YGVA 5JMRA 1MFEH 3QXUA 1X5XA 4X6DB 5EC1B 1SJVA 4M3JA 5EUKB 3WFDL 4U1GB 2ADJB 3AU1B 4XAKD 5JOPD 5DGQA 2FJHB 2MNUA 1ZT4B 1BD2D 3UC0L 2F54D 2J12B 1F4YH 3BEWA 1YDPB 1A3RL 3DPBA 3T0EE 1MPAH 2R29L 2EC8A 5F9WB 2APBA 4QRRE 1NCBL 3VXTA 3PWPE 3BKCH 4QRPA 3GIVA 4OI9A 3G5YB 3QUZB 4U1LA 5EPMA 2R0WH 1G6RL 2HLFD 1RZGB 5D1XA 2FATL 1H3GA 4KK5C 3MRQA 3PHOB 2CLZB 4BELD 4N5EC 2P1YA 3EOBB 2JB5H 5KJRH 4JHZA 1CQYA 4F57H 4F7EA 1MHEA 3RWEB 1NJ9A 1OARH 1W72H 1OM3H 4M4RA 2EICA 1ETZB 5KVFH 1GCFA 2B4CH 1UCBH 2EDQA 2FO4B 4DVBA 3U9PH 4OZHF 3RPKA 2XFXA 1UWXK 2VISA 4HC1H 1N2RA 1J05A 4DKEH 1XR9A 5DFWH 4NOFA 1N4XH 1ZANL 1I9JH 5JW3L 4JDTH 4K7PX 5IKCA 4LQFH 4OCSL 1Q0YH 1EJOH 3JV4A 5D1XC 1A6UL 3TBYB 1CT8A 2NY0D 5CSBA 2UVEA 3UPAA 5A2JH 3EOYG 3CSYB 2I60L 3DMMA 2IC2A 2HTLC 3VWKB 1KLUB 1A02N 4PJIE 4K07A 5I66B 3KYOA 3L3JB 3QSKB 2W92A 4MCZA 3LS5L 5GSVA 4XVTL 2QQLL 3ABZA 3MJ9H 2C4XA 4JEGB 4ZOBA 1DZBA 5EU4B 1PLGL 4H8WC 3MXWH 4PJGA 4YFLI 3H9ZA 3OKYA 4NQEA 5EC2B 4LEXL 1T2QL 1M7DB 4JJ5B 5L7XH 1Z0MA 3VWJD 3FT3B 2VDNL 3V8CA 5KBNC 3V7AG 2CLVA 1PAMA 3MSPA 2HFEA 5F21B 3FO9B 3PDDA 2XA8H 4N8VB 3U1SH 3QDGB 5HPOA 3PGCA 2R0KL 4LSPH 4E41B 4NJ9H 3M1BA 2R69L 3MLPA 2BY3A 4UB0H 3VA6A 3VFOB 4WY7H 3OB8A 4Q9CA 3AXLB 2BSED 5JHDA 5MEOA 1GPOL 1MJJA 4KTDL 5FK9A 1AE6L 1WITA 1MCPL 1T03L 5DJ6A 2YHGA 4HFUH 2B5IC 2E6JA 3PWPB 1BM3H 1T3FA 1UJ3C 3ESVF 3I3DA 2EYTB 2JELH 3T0EB 1NGYA 1MCOL 2E9WA 2ZNXA 1VENA 4LPXA 2PYFB 2KUTA 1VEMA 5TF1L 1OCWH 3VXNB 1I9IH 1B88A 1L0YA 5T3ZE 2P8MB 1FNEB 1BEYL 5HYJA 2Z8RA 1XCQB 4HIEA 1KJVB 1MI5B 5ETUB 1M6OA 2PYEE 3BVNA 2FWOA 4NZRH 2RAMA 5DJCB 4FQCH 3E3QE 1URLA 2X1QA 4CBPA 1QG3A 1KN2L 4P23C 2VTFA 3EO1B 4AT6A 1AQDB 2O5ZH 4YGVB 3JWOL 1CN4A 2HJKB 3TP4A 1X5JA 3VD5A 4MMZC 3TFKD 1AD9B 4HIJA 4TUKL 5JNYB 3FN0L 1IAIH 3MLSH 4MS8D 5ITBL 3D5OF 3T2OA 5EA0H 3LKOB 1A14L 3ULSB 1A6ZA 4ELMF 3DVGB 2P5EE 5T3ZD 1VDGA 4YDIL 3VXOA 1JGVL 1V3KA 4XMKL 1MAJA 2VUYA 2OL3H 4LNRA 4Z95L 3L3GA 4DGIL 4MB5A 3B8YA 2BSRA 4EZMA 3AM8A 1JPST 2DMBA 1B0RB 4S2SA 4MYWB 4XH2B 4RDQG 3V6FB 5CKAA 5B39B 3VDBA 1KIQA 1A1NA 5DWUL 4NQEB 1NANH 4GRLD 3MR9A 3O9WD 1JRHH 3DX7B 3K4ZA 3TWCH 1AGDB 4OQTA 3T0BA 4ORGB 4S0SD 4BUHA 4NP4H 4K55A 3ETBF 4HUXA 2C9AA 1OTUD 2D4FA 3P73B 2BMKB 2JCCB 4ODXB 3QCVH 2GSIA 4M6OL 1WAAA 4M1DH 1HH9A 3CD4A 3REWA 3VXSB 5HPMB 1XF5A 1EAPB 4NO3A 4I3SH 1UB6B 2IWGA 3RX7A 2X4SA 3V79C 3KYMB 3L95A 1Y18B 15C8L 2ZCLH 5EU6E 3DMMD 5BVJB 3MXVH 1V8HA 5CZKA 4LOUD 4MAYD 4QHLA 1OF2A 5DMGD 4NWUH 3WL9A 2XOTA 3QULA 1U8IA 3D69A 3CFCL 1LE5A 2MTPA 1JL8A 1R5IA 2VDQL 2XXMB 3BUYA 2AJVL 3FT3A 3QT2A 2XKNB 4BZYA 4ELKA 2XICA 4JO4L 3O8XB 4F7MB 3BYTA 1HSAB 2DQCL 3W11D 5IT2L 4OCXL 3RTQC 3KPRE 1DBBH 1JF6A 5EZIL 5IVZA 2IG2H 2NW2B 1GVIA 3O3EA 5K9JL 1T1XA 3DUUB 1A7RL 3BP7A 2W0PA 1MFEL 5CWSB 4HUWA 5FOJA 3OKNA 1NCDH 4JPWL 2DIBA 2P8PB 4GG6E 1EX0A 4K2UL 4O51B 5MI0B 4DKAA 3P77B 5J1AB 2GY7B 5TE4L 3HUJF 4QNPF 4PJCF 4K3EL 5I30L 2E7HA 1N8ZA 1UWGL 3QB7C 4NWTL 5IVNA 2GITA 3RWGA 1IC7H 1N59A 3O45B 3RTQA 4GUPB 3HKFA 4G8GB 2P4AB 4RISL 1KJVA 4HK3J 3SGKA 3O6ML 4WI9A 3M17B 1MJ7H 5HYJD 5IFJA 1CVSC 2XWJA 5TDOA 2GT9B 1NGQL 5IV2B 3QUMB 3RWDA 4WEUD 4F57L 4UZGA 5HGDB 3GBMH 4JKPH 3QXWA 3EO9H 2FB4H 1TTFA 1U58A 1UA6H 4BH8B 4PGDB 5EZJB 2XZAH 2VLJD 3BWUC 1J8HE 4DQOH 3EYSH 5CUSH 5IHUH 1M4KA 1S7UA 4IS6A 5DUBA 5JQ6H 1GZPA 1HHJA 5F6IC 4TNVF 2A73A 3VXUA 2R4RL 1Z0NA 4EN3C 3S35L 5IEHB 4JFPB 4JQXA 5IW1B 2Y72A 2F8VA 4XNYL 2N56A 4Y4FC 2VIRA 2ZUSA 4LLMB 3SPVB 3AAZA 2G5BA 1U8PB 2RHEA 2NW3A 3VG9C 4R7DA 4YLQT 5JHDE 1TVHB 4QRSA 3S3JA 5GS2D 2VWEE 3C6LD 3KXFE 3MLTB 3NPSC 2VIRB 1I1AA 2DBJA 3QQ4B 3ARDA 3D2UD 3QWQB 2VRAA 1JNLH 3GSUB 3OSKA 1HH6A 4YGAB 4OUUA 5J11C 5C8JB 3WNPA 1A4KB 1ITCA 5F7HA 2BNQD 3BISA 4K9EH 1GL4B 2AEPL 4WHDA 5C3TA 3NA4A 5DRZB 1E4XH 3HUJE 3RUGF 3BUYB 3HE7C 1KB5B 5E4IA 4WY7L 5D1QC 4YXLL 2ZJSL 1KV3A 4P5KB 4R26L 1ZANH 1ZA3B 4APQC 1BMGA 3MCLH 1EVUA 4L9LA 4R97B 4YHLH 4I0CC 1I1AC 2I24N 3IKCA 1IM9B 1HYSC 5KG9B 1CXFA 5EG6C 5KVMC 1KTDA 2X4PB 1UWEH 4AEIL 4RFNC 1WFUA 5EIQA 4XPAL 1JRHL 3PWJA 3C6LC 4K71C 2P5WA 1ERNA 4WU7B 4QRUA 2YS4A 2NCMA 4ALAL 3GSQB 1ZTXH 3JXAA 2Y5TB 2CR6A 3MJ9L 1X4YA 3P0VL 3P11L 1ZT1B 3RFZC 1NFIB 1K4CA 1FFOB 4MQ7A 3DV6A 2DKSA 3QZWB 2ATKA 5CSZA 1S3KH 4YX2L 5KVEH 2YK1L 1KFAL 1UQSB 3VXMA 1KPVA 1T1XB 4MJIE 2UUDH 5BQ7B 5DLML 4F3FA 1HQ4B 3TNMA 1JNHA 4PRPE 4F80A 4CNIB 4FA8A 4HK0A 4WFEE 4PJDB 5I73B 4M62H 3N1QC 1BD2A 5CBEA 3HPLA 2O5XH 2V6HA 1VGEH 3IDYB 4O58H 3ZTJG 3MV8D 2DD8H 4PG2C 3RHWK 1HYSD 3NFNB 4ERSL 4LCWA 2GKIA 4KJPC 2VKXA 3VJ6B 3BN9C 3TV3L 4J3TA 3B9VA 5KZCB 5GIRA 3BW9B 2J4WH 4HFUL 4PJCB 4NOBA 4S10A 5K9OB 5IIEB 5BRZB 5I1AA 3IAQA 5CEZH 3LKQB 5A1AA 7FABL 1T7WA 3O3UN 1OCWL 1IEHA 3HFMH 4LSVL 3PGDB 4NQCB 4O02L 1IEAA 3N50A 4L29A 1INQB 5MI0C 4PJGF 5CD5D 3OJ2C 3QG7H 3VW3L 3QEQE 3NFSL 2XKSA 5JMOC 2NY2B 3WFZA 4PUBH 1A3QA 1YEGH 2ED9A 1U91A 3EYVA 4F9PA 2VXVL 3SKUD 4LSDA 2YMXH 4NKOB 2QBWA 1VA9A 4YJZL 1WICA 1I3GL 3QFJD 1V7MH 2YD9A 5HHPA 5AG8A 1AHWC 3QWRA 4JDZB 3ZE2F 1XGUA 4PRPA 5HDBE 3UYOD 4XCNB 3TYGH 1UM5H 1BD2E 1MCWW 4LVHC 3MCKB 4FQXD 1K5NA 1NL0H 3V7MA 5BV7C 2IH1A 3MJ8A 2J88L 1G6RA 3DVGA 4HBCL 4RMQA 4X6BB 2CO7B 1SVZA 4NZUH 4APQD 4YZFF 4LEOA 1ZA6B 1DBML 2B1HL 2X9WA 1BVLB 4OGZA 1FO0L 4E9LA 3T0XA 4WW2F 4U3XA 5BJTB 1PQZB 1XMWA 2E8YA 2BNQA 3GB7A 3TPUA 1KB5A 3L5XH 4TTGA 4CVZB 5DJZA 5K9JH 4MJ5B 1SJXA 5FM5M 5H35B 1CBVH 1MIML 3F7QA 1E0OB 4YHZH 1SY6A 5T5NG 3J8F7 4MD5A 1UQSA 5KW9L 2NNAB 5LG1A 4YXHH 4KRPD 4ZUUA 5EO9A 1SJEB 2NZIA 3GSNB 4JZNA 1AR1C 4JFZL 1BWWA 1EUTA 1QBAA 2QQQA 2AJUH 2Y5TA 1IAMA 3TYFA 4QHNB 2YBRA 3RTQD 4A6YH 5B39G 3QHFL 2CRZA 3FZUD 3SDDB 2J5LB 4H1LH 3QUYB 1UCTA 3NMEA 2B2XH 3CLEL 3RVTD 4ODSL 5CJ5A 1N3NA 3FAXA 3TYFB 2FR4A 5KSUB 4DUWA 3WXWH 5T3XD 2BVEA 2W9DH 2VZ3A 4YEEA 3GSWB 4JY5H 3O11B 1RMFH 3LCYA 1UJTA 1EAJA 3RVVD 3G6DL 4YK4C 4TUOA 2PF6A 1CE6A 1P84K 2ZOKA 4PREB 3HRZA 3UBXI 1NCDL 1X5AA 4JPWH 5ICYB 3V5HB 1SBSL 3SGJA 3SGEI 1NDMA 3RU8H 1HHKB 2PW1A 3LB6D 4YHPB 1QPPA 1UEYA 2VMFA 3E2HB 5FUOH 1ZHLB 1AD0B 1T89A 4GAJH 1QSFA 3ZE1F 3ILPB 5DZLA 5F7YC 4YXKL 3L5HA 3TBTB 3O9WA 3VXMD 1H5BA 2VC2L 3IAPA 1ORQA 3RDTB 3WNKA 2DS4A 3RZCD 1U92A 3D18A 4I18A 5ACLA 3IDYC 5AUMB 5JOPE 4ZPVA 5J3HD 3QUXC 4JM4H 4KROC 4Q7DA 1AIFA 1D5MB 2AABH 1ZLUH 1BVLA 1QFUL 2DQDH 4CDHA 4U1MB 3GFUA 5TPWL 1RJYB 4JDVA 4JKPL 4XT1C 2NY6C 1P5UA 1NEZA 2VNCA 3UTPD 1AGBB 1C5BH 4L8DA 3D18B 4I18B 4OKVB 3BPNC 4EDXB 1QFHA 1VFAA 4NCC2 4Y2DB 1IC5L 2FD6H 1WEJL 4W6WB 2OQJA 4AYFA 4EI5B 5I19L 3MRMB 1OGTB 3R1GL 5F3HA 5GJTL 4AEIH 3MRRB 5GGUB 2OZ4L 1NAKL 1EEYB 1HQRB 3VXTB 3UBXG 5M94B 1IM3B 3CDYA 1JGDA 3ZDXE 2KQNA 3ZDYE 2E27H 5E8OB 4EN3D 4M7LT 3CVHL 3O4OC 5IB5A 4IJ3C 4RMRA 2ED8A 4HXAH 3B2UD 3GSXB 3BPCA 4OZHB 2H8PB 4EOWH 1IM3A 3WMSA 5IK3B 1W0VB 1Q94B 4FQJH 3AB0B 5D1ZD 3KPRD 5KJRL 1EBAA 3MCKA 4M6ML 2RQ8A 1S9WB 4OSUL 1MFCL 4M62L 4YAQA 2BSSB 3VWJC 1SVCP 4U1HA 3PUCA 5D2NB 4Q9RH 2D7OA 2ZSVB 3MV9A 1CFTA 4YXLH 3MYJB 4Y5XB 4DKEL 1NAMH 4YHKL 4WNQA 4D3CH 3FOLA 2NXYB 3Q3GA 1H15B 1WFNA 1JWSB 3CFDA 1D5IL 4OIIH 1EJOL 3PP3H 5HHME 3Q1SH 5IGXL 3H3KA 4UMGA 1CTOA 5JXAL 2BHUA 1S7XA 4Y5VC 2P24A 1WFOA 4I3RL 4TVPH 2DLFL 5DSCA 3CK0H 3EYOB 2PR4H 3D39A 3NABH 4HT1L 4QXWA 4HEME 3JWDC 2ILLA 4HGMA 5SWZE 4LSVH 3NCCB 1AO7D 3DYPA 4I9WD 2VL4A 4CVXB 1VESA 3A6BL 1XF3A 4S1DC 4ZXBD 2BNRD 2W65A 4KJQD 4ZS7H 1YC8A 2YK1H 4OFYD 3BJLA 5C0BD 3WIHA 1RIUL 2MMXA 2VERN 1J8HD 1F3DH 1N7ML 4L3EA 2PNDA 5E4EC 2HT2D 1U3HD 1IRAY 3QXAA 5DUPH 1IILE 3L7EA 1R5WB 2JCCE 1FZJA 4MB3A 1FNSL 2DYPB 2K7PA 3KPOA 4FXLA 1FVCA 5D7IE 3GJEB 1W0WB 2HAZA 3B4NA 4M7LL 4HLZG 1NC2B 3N1PC 3IKKA 3I6KA 1VFAB 1ZLSL 4WGWB 2XZQL 3SDAA 3C9NA 3VGGA 4FQXA 5E8NB 1BGXH 1JK8B 2W9DL 1FCGA 3VFTA 1FP5A 1IEBB 1AXIB 3KPNB 3L3GB 2CK0H 1N0XH 4NGHH 4CW1A 4PRPD 4DVBB 4JM2F 1TVDA 4EN3B 4HGKC 2G5RA 3SQOL 3X3FH 4NKQB 1ADQL 4XTRC 3QUXD 4GLRI 4KROD 1T7ZA 1QFOA 2ADFL 5IFAL 5KVDH 3KJ6H 1S9KC 4DOHE 4HXBL 1XGPB 4LFHD 1QSFB 2P5EB 3DRTA 4ODHH 3VXRE 3WIIL 5TE7H 1EFQA 1RJZA 2PW2B 2QKIB 2VSDA 4L4VD 1YMMA 3K7UA 4ZAKB 1MVFA 3EYFB 1CBVL 2CLVB 4IHOA 1PBYA 2AQ2A 3CAFA 5TE6L 1EFXB 1CXLA 2IPTH 1B2WH 3CFIC 1QEWA 1T0PB 5IBTL 3LN4B 1G9EA 1QSEB 4JR9H 2EE2A 3MRIB 1JZ7A 1HSBA 3FO0H 3ARYA 4JFZH 4J1UA 2Q3ZA 3G08B 1FC1A 1UM5L 2VDNH 5KSVB 4NQVB 5L9DH 4LLYB 2XQBH 2W0LA 2NY7H 1JGVH 1MI5E 3DMMC 4HJ0C 3ARZA 5CINL 5CFHA 1CR9L 1OY3B 4MJ6B 2FX7H 4Y4KC 4PJFE 4M9OA 5FO8A 2OYPA 1INDH 2NZ9C 5EULV 3LRGA 4X4YB 4PGZA 3G04B 5FOBB 3TA3C 5GJTH 1T03H 3ZSSA 4JY5L 4L4VB 1CGSH 2XWBB 5DVMA 3MJ9A 2I60H 3IGAA 1I8MB 3FQRB 4FRWA 4JFQA 1MNUH 3GJFH 3QIWA 1UKSA 1Q9KA 5D6DA 2ENSA 3ZMRA 4ENEC 2EXYD 4P2QE 1JUFA 1SBSH 2E27L 3KS0J 3VDCA 2DWDA 3JTTB 3KR3L 2D7PA 5IJVA 4X99B 2P44B 3ZYIA 2BY1A 5HHMB 1KEGH 3ZLQC 5H37H 1I8IA 1S9XA 4PLJD 4GBXB 4PGDA 4U1SA 2WM0A 1GIGH 3IFPA 1J0KA 3NFPA 3DV6B 4OCLC 5T5FL 2HA1A 1F02I 1LE5B 2VAAA 1J0YA 2E7LC 4S1RH 1KACB 3FOLB 1CVRA 3GMNB 3HCVB 3PABB 1FORL 3N9GH 1S7QA 5CJXA 5LVEA 1RPQA 4IRJD 4YDIH 1KXQE 3IDNB 5F7UA 3CLFH 5DGRA 5TDPB 3O8XD 5CJQL 3SE9H 1WIUA 4UT9H 3VJ6A 1BLNA 4QRQA 1E6JH 4ZPTB 2RFXA 1QVOB 3B2VL 1FL6A 2NY3C 3BO8A 4XP9L 1OSZA 3NBNA 1XCTB 1YEJH 2YD7A 32C2B 2AK1H 3DGGB 1YEHH 2MQ0A 3PHQB 3RWCA 1KN2H 1FO0A 3BKJH 3BGMB 3P2TA 5CEYA 3LN4A 4HUKB 1SYVA 1VKXB 4YXKH 3C60A 1CLCA 1ND0B 1INQA 1FFNB 1EEUA 4KUCF 2Q8AL 4MD4A 1U8IB 1A64A 2BCKA 5IHZB 5CP3H 2DI7A 2YUVA 5C0BE 1MLCA 1U58B 1U8QA 4PGEB 2V17H 4I4WB 3NCYP 4LSQH 2L0DA 1MELA 4ZUTB 4QGTA 3CFEB 1X5KA 4TSBL 1JHKL 4JN2B 2VDKH 3SJVB 2DIJA 1KCRL 1YEIL 5CMAB 3RIAK 1BGXL 4GXUN 3UTSD 5LJYH 4OIAA 5F1NA 2DB8A 4YHKH 2VXSL 3P4OA 3D85A 1N0XL 1QBML 1MCQA 4P5MA 3RY5A 5E8EB 1G7PB 3S4SB 4HKJA 1DBJH 1GZQB 1XR8A 1RSFA 3VRJB 4PR5A 3VMPA 4F37F 1J1OL 4OQ1A 2HT3D 4RNRB 5T3ZL 4LHJB 5CLWA 1R3IL 1ACYL 4NNYB 4UILL 2BVPA 1MOEA 1WC7A 4HKBB 5GHWL 3SDCA 3LOWA 1HQRA 3GSUA 4K7FA 1QBLH 4AM0B 3GIZH 5AAMA 1HEZB 2DMCA 4OJFL 4WFED 5FO9A 3NTCL 3TVMB 4XP5L 1ES0B 1G9MH 5D70H 3FT4B 4I3SL 3HZMA 3WLBA 4LF3A 4X9GA 1ZLWK 4GRMB 2VLRE 3CC5A 1ZGLB 1K6QH 4QOKB 5HXMA 2A0LC 3QHZH 3GUTA 1UM6H 3L5JA 1L6ZA 4PJEA 1K85A 4YPJA 1GAFL 1CFNB 4YIQA 3AREC 1AGCB 1A3LL 3TO4A 2VXQL 3ALPA 2YKLH 1KN4L 1KJMA 1EHAA 2YWYA 5TDPA 3MLZH 4N8VA 5FFLA 4LLVA 4QTIL 4IOFD 2BX5A 3KXFA 2YC1A 1LK2B 5IGXH 3LS4H 4XNMB 3D25A 1YNTA 5D2NE 4WNQB 4JKKA 2NMSA 4LHQB 1P6FA 2DLFH 4PJIB 1I1YB 1GC1H 5B38G 1M6OB 3BVNB 1RUAL 2X4NA 3ILQD 3K2MC 4GXUM 3K8LA 1BVZA 1YN7B 3QQ4A 4R0LC 4HC1A 3F7YA 1GGIH 4PJIA 2QQKH 4LAQL 1Z3GH 4QHUA 4R4NC 5CBAB 4HWZB 4YX2H 1IGML 4PREA 3DROB 3E1F1 2NYYD 1ZXQA 4CL7A 2FJGA 4C56B 1HNFA 1UEMA 4CDGC 4X4ZA 5IHZA 5EU3B 5CGTA 5E8DH 3H6JA 5I73C 4M1CD 1S7RB 1WBXA 3V4PH 3BSZH 4FQIH 3FO0L 3UTTB 2BVOB 4QF1A 3U4BL 4XNUL 4RQQA 1NGQH 5F93C 3OGCB 3TFKC 3AC0A 1MCBA 5DI8A 1NMCC 4HX1A 1ZLSH 4EUPB 4FNLH 5DRNA 3OB0K 3MOAH 3T4AB 2DQEH 4KHXH 4DW2L 1VADA 1FL6B 3SDAB 1A22B 3N1FC 5E8NA 5H2BA 5I1JL 1IC4H 3GDBA 4MMXC 4PJ9C 3P4NA 2X7LB 5FCSH 5HBBA 2C4FT 3KWWB 1MH5A 4OZFG 1U8OA 2DICA 4JFOB 4DVRL 4Z7WE 4X6DF 5HYJE 1Z2KA 2C1OB 1MSPA 5KSAD 1XGRA 4OM0H 3EDJA 3EJYC 3FOMB 1UC6A 5LBSH 4UDUA 4PGBB 4AMKH 4OZ4B 2OR9H 3B6SB 43CAA 3CNKA 4JR9L 3ARGD 3STZA 3BIBX 1OGAB 3HMXL 3FB8A 4EUPH 5B8CA 4OGAC 1D7FA 3NIDF 4PRHD 2QQNH 3MJ8B 1HHGA 5DFTA 5HI5D 4W70A 4ONGH 1AC6A 1NC4A 4F7MA 2IF7A 5T33H 4JZJB 2ZJSH 4ZDHA 3K74B 5FYLD 4PRPB 4CGTA 5IR1B 2AEQL 4NJAL 1HXMA 4TULL 4AIZA 4J4PD 3RI5K 3CLFL 3EDDA 5DURB 3AUVA 5JR1L 2WK2A 1ORSB 1I8KB 4XPHH 3WHXB 1L9NA 3RWHA 1MRDL 1JHLL 4PLJC 4FP8H 2FBOJ 1PYWB 1RZKL 5AZ2H 1C8PA 4HLZH 3S98A 5DA4A 2ICES 3O4LE 3QIBB 3GIZL 5E2WL 2VLLA 3V5KB 4G43A 2E9IA 4HGWB 4M7ZC 3ZE2E 4Q97A 1N6VA 3ARBD 1HIML 1JZ8A 1JUFB 3T1WA 1KEGL 1ZGLM 3MLWL 2KZ1B 1FVCB 4RBPK 1I3RA 4PTTB 4L8BA 4YFLF 1FFPA 5FDWA 2XA3A 3O2VH 4OLZL 1I3GH 5ID0B 2VDLL 5EUOE 4Y16B 1D6VL 1RHFA 3EHBD 1K2DA 1TTGA 5GSRB 4M93B 1CYGA 2FHBA 4ZFGH 4PY8J 3TV3H 3QO1B 1I8LC 1DQQB 3GSWA 3RKDD 1KTLA 4XC1L 3QCTL 4QTIH 5E9DB 3GSRB 3AMLA 2LVCA 4XWOC 4IRSD 4I5BB 2Z9TA 1BZ7A 3TH3T 1IGYB 5E6YA 1DQML 5DD5H 3X11B 1E6JL 3LB6C 1GSMA 3W2DL 4PB0L 3IS1X 5CJXC 4NRYB 1JTTA 5A3IC 1PKQB 1UACL 4LKXA 2VISB 5ISZE 4OCYH 4EUPA 4XCFL 5CD3B 4FFWD 2FO1A 1A6AA 4X5XB 5IBUB 5LGJA 4HWBA 3K4DA 2ITDB 1G0YR 2FJGB 4P5TB 4C56A 2VKWA 2XACC 4WFGE 4F33A 3JSSA 3TBTA 3MRCB 4GRLB 5AYQA 3LS5H 2XTJC 1ZHBB 1F6AB 2HJFB 4JO2L 2DKMA 3PNWA 4LDOB 1LD9B 3EJZD 3PDOA 3NTCH 4MXVF 5H35A 4HDIB 1DDHA 3AMKA 4LFHG 4QYOA 4XP5H 4MCZB 5GSVB 4NN5B 1J12A 4TN9A 1YNKH 4U6TA 4KGLA 5IMKB 4UQ3A 2EDBA 4EJ1C 3O3BB 2VWEC 3MRKA 2Z92B 4PJXA 4ZTPH 4X5WA 4UTBH 3MLUH 2R23A 2D3VA 4J6RL 5FECA 5FCUL 1AQKL 2R2HB 3H0TB 2R0KH 4LSPL 3W9DB 4NM8L 3D0VA 5IB5B 3RNKB 4X6CF 4ODTH 1C5DB 4G80A 5HDOA 2GI7A 3BH9A 4JDTL 3QIBA 2UWEB 4IMLA 5FKAB 1FZMA 1Q8MA 5HHVL 3V6OC 1IQDA 2P48B 3MGTB 2YPKA 4LSUH 4YNYB 3RWEA 4U1KA 5F89A 3U4EB 5JW4R 4RA3A 1I7RB 4J3SA 2DQFA 2BY2A 3EFDL 3FB6B 1JMXA 1DJSA 1LO2H 2DI9A 1HILA 1NGWA 4KPHH 4QRRA 1KJ3H 3GMPA 1JV5B 2Y06H 4Z8FH 4YNYA 4HUUA 3BZFA 2J3SA 3LDBB 3I6LE 3HC3L 4P9ML 4P2OA 4OF6A 1DVFC 1FG9C 3U0PA 2GIYA 1H3TA 3T3MF 4GAJL 1K6QL 1T20A 3U9UA 1NFIA 1BQSA 1BZ7B 2HVKA 2XA8L 3MRBA 5E4EB 1CWVA 5FGSA 5DK2B 5DQ9A 4K7PH 1F4WH 2CXGA 4N90E 4HFWB 5LAXA 5T33L 1FHGA 1FRGH 4G8GD 4JKWA 1ZEAH 4KZEL 2YRLA 4TVSa 1W0WA 5FGBC 3DX9A 1AE6H 4Z7QF 3CCHA 1AH1A 3SGJC 3V0AC 5IVXE 1EHXA 1H3PL 1RMFL 4JHWL 1XIWB 2OR8A 2X41A 3L7EB 4M48L 3LPFA 3TBSA 1HHIA 1MHEB 2AGJH 1LO5B 1A6VH 5JPNA 5I1LA 4UOW0 3NZHH 3OKKA 3WFCL 1BVKA 4DGYL 5GRVL 2ITDA 4P5TA 1I7ZA 2R2EB 4ONFH 4Z7VA 2V7NA 2JKXA 3DHJA 1C7TA 3G5ZA 5C0ND 2OTWB 2QHRH 4UNVA 1T21B 2Z35A 4BZ1L 3NZ8B 2A9NH 3MTRA 3P30L 4PRID 4K71B 4BFBD 4ACPA 4OTXH 3VFVA 3L9RA 3W39B 4HS3A 4XWOD 2XWTA 3OQ3B 4IRSC 5F7DB 1G7IA 4ZFOA 5D2LE 5JIHA 3TZVD 3EJZC 5DUPL 1T2JA 1JPSH 3MLRH 4OLEA 2WINA 1SM3H 2VQ1A 3MA7B 1MHPH 3UCRA 5FB8B 2I07A 2JIXD 1U8NB 2ORBH 4XP1H 3WNMA 2MHAA 5E5RB 1R0AH 5F1NB 2ARJB 4ZFGL 5FYJD 4PY7A 4FG6C 1B0WA 4A6YA 4XTRD 3CUPB 3BMWA 3GBNL 4G6JL 2UWEA 1QFWH 4MLIA 3FMGL 4PD4J 1K8IA 3BQUA 3N0PB 5C0NC 1FLRL 1IQDB 3CPLB 2A6DB 3MJ7B 1BAFH 5I71B 3I02A 5JTWA 3QEQA 3MUZ1 2YUZA 3IXAB 5FECB 4FQXB 1A1OA 4HMDA 1Z9MA 4K7PY 2PYEB 1R24B 4Z7VE 4M1GH 3UBXA 3VFMB 3TH2T 3F7VB 2AJXL 3QIUA 3E8UL 5GGSY 1RULH 5C1MB 1FYTE 4U1IB 5DJ0A 1CQKA 4Z76A 3BH8B 5MENA 1ONQB 5CJBA 2BXYA 1KIQB 1EPFA 1LO0H 4YHIB 5I8EA 2YXMA 5D7LA 2WWKT 4N8PA 4HCRA 2FEDC 3P77A 5I18H 2G60L 1UXSB 2Y1VA 2XZCH 4GBXD 4JZNB 3BHBA 5F96H 3LD8C 4LF3B 1CDYA 3CSGA 5C07E 5JO5A 4JPKH 3MNWB 1JFQH 3KYKH 4MHHI 4UV4H 3WUWG 5IMLA 3WD5L 1NH6A 5AWNL 4CU7A 4MDIB 2ARJQ 1TTUA 2Z4QA 1T6WA 3GI9L 1HN1A 5FF6A 5D72L 4PRHB 5B21A 4I3RH 2IG2L 3CK0L 4XMLH 4BH8A 5LGHH 4BSJA 5DVKA 4MA3A 1HKFA 4F2MA 5C71A 1QRNB 2V2TA 3DBXA 3S35H 4PJ7B 4MZ2A 4KTYA 1FYHB 5DVLA 3MV8B 1QEWB 1JNNL 4URTB 4XXDA 2F19L 3M8OL