1DQIA

Crystal structure of superoxide reductase from p. furiosus in the oxidized state at 1.7 angstroms resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
b'MISETIRSGDWKGEKHVPVIEYEREGELVKVKVQVGKEIPHPNTTEHHIRYIELYFLPEGENFVYQVGRVEFTAHGESVNGPNTSDVYTEPIAYFVLKTKKKGKLYALSYCNIHGLWENEVTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Structures of the superoxide reductase from Pyrococcus furiosus in the oxidized and reduced states.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2000-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1dqiA00
3QZBA 4BK8A 2JI3A 2JI2A 4BRVA 1DO6A 2HVBA 4D7PA 1DFXA 2JI1A 1DQIA 4BRJA 1VZIA 1VZGA 4BGLA 4BFFA 4C4UA 4BFJA 4C4BA 4BFKA 4BV1A 1Y07A 1DQKA 1VZHA 2AMUA
chains in the Genus database with same CATH superfamily
1P7QA 3KLAB 4GUOA 3W9DA 4JPIA 4Z7QE 3JVFC 5J13B 4KFMA 4MXWL 4WU7A 1S46A 4OJDH 2XWZA 1AZUA 4FFWD 1WG3A 1U8KA 3NJNA 2ZXGA 3FN0H 4KZCA 1JZHA 5KVGH 1KXTA 3OLEA 5CUSH 5HGDB 1EZUA 4NZRL 1S3KH 3H2PA 5DJ2A 4N1EA 4NRZB 3P0VH 1GZHC 4Q9RL 1KC5L 4YPJA 5AEAA 2EXYC 2FWOB 5IJVA 4IQHA 4F9PC 2JJUA 1K6QL 2HKFH 2JCWA 1PD0A 3WOVA 2XN9A 4OGXH 4JFFE 2PMZA 3EHBD 1SN2A 4LSVL 2WLIB 3REWB 1SJMA 2O5ZH 2XPZA 1RK0A 3VGHA 3C09C 5B1KA 3V5KB 3L5WA 4JB9L 4CADB 1FPTH 3C6LA 3CFDA 1R3KA 4ODBD 4EKXA 5IP4A 2VLME 3VNZA 2YD9A 1A4AA 1JV2A 3CD4A 1QW9A 4IKIA 4WGWB 5CINH 3EHBB 3MHZA 2EH8H 3DX9B 1WD9A 3UYRH 3PWVA 2ZP9A 1RK1A 4DQAA 4JRLA 5GRVL 5D1ZC 4N0UA 1ZKAA 2X6CA 3CVIL 4KPHH 4PRHA 4U3SB 2Z7WA 3FU9A 4XWOD 3QZNA 5IY5B 3O4LD 3B2UD 1QD0A 1Q9LB 5LO7A 3FU6A 3WFEL 4N8VG 4PRIE 1TETH 1RJYB 4KY1L 4BDVB 1TQBC 2AJZB 4X7FC 3KPSB 5DRXA 1CJYA 1TENA 3FCSA 4XAKE 3RWHB 4PIBA 1N9PA 3A6CL 3FC8A 4K5OA 3TEWA 3WMSA 4ZS7L 3FN9A 4WDIA 4YX2H 1EFXD 3F7PC 4UILL 4DTGL 3ZRFC 3FFCD 4IMLA 1XGZA 5FFLA 2DQIL 3QNZB 4OGAD 5FA3A 2K45A 5A16B 5I0DA 3QNXA 4CGUB 1F6FB 5IEHA 5DO8A 5AKVA 3PQYD 3KH3A 1ZY9A 2DPKA 3H3PH 4F7MA 4M1CC 4HK3J 4EEEA 4AUYA 1EFXB 1WAEA 1ZANH 4MCZA 2VO5A 5ANMA 3T4AB 1QRNB 2WTOA 3FFCB 1FL6A 1UQSB 1I9RL 1U3NA 1YPZB 2FHFA 3EOAA 4Z7WB 5CZVL 3GMOB 3BDBA 4BWUA 1YPZF 2YC1A 3PQYB 4HPOL 1N6QH 2CKBH 3O4OB 3P2TA 4UU9A 4ZMLA 3CLWA 3KPRE 1THAA 2FEDD 3CUPA 1MRCL 2C7UB 2OR9L 3TNMB 5F7LB 1GZQA 3HE7C 3QDMD 5I1AB 2AQTA 2A6JA 3EUDA 2XY1A 4OM0H 3O45B 4LLDB 4LSSH 4O2EB 1XGQA 2EYRA 5CCKL 3V6BR 4PGDB 2WP3T 2XTJC 5I19H 1AR1C 4MA3A 4WWNA 1J87A 3OKYA 4KOBA 2JSFA 3D12B 3V6FB 2I5YH 4PUBL 4XMKL 3FSAA 5FKPB 4ELME 4LVOB 3EYQC 1PZ5B 2QVFB 2VLRB 4XCEB 4CDHA 2Q3ZA 1KELL 4P3DB 3CNKA 4UUJA 5DC0A 4ES8A 4RA3A 3ZYJA 4UI2A 2PO6A 4D8PB 5DWUH 3UP6A 3QZLA 5CS7A 4JREC 2Z0BA 4AGNA 1DO5A 2NX5A 1R46A 1A7OL 5I8CB 2OULB 4X2UA 3QFJD 2X4TB 4QCIB 3NZHL 4OJFH 5A2LH 2YUWA 4BV1A 1H9VA 3ML8A 4ZDHA 5E7FA 1QA9A 1SOXA 3PXHA 1DBBH 4WU5B 4PR5A 5B4MD 3AUWB 5KYYA 2QHLA 4JLRB 2NW2A 2PTTA 4BCZA 4ZQKB 4JKNA 5HGBB 2ICCA 3ARVA 2H9GB 1KG0A 2DQFA 5CGTA 3QFJB 4BRVA 4N0CC 2DH2A 4F7EB 4WY7L 1R4XA 1AGEB 1B0RB 3FU0A 1E9QB 2CCWA 3US0A 1JZ2A 1L9QA 3UJTL 5HYQB 2P80D 4KRPC 1DBAL 2DWXA 3QPQC 3HNTL 4WO0A 3N0PB 5GGQH 3X1GA 1PX3A 3JVGA 1CU4L 3HMXL 1X4XA 5J7CC 3KH4A 1ERNA 1YEJH 1OCCB 4PHXA 3W9EA 3CZFB 4HUVA 1II4E 2XWBA 3QXAB 2XFGB 4TNVF 1TZHB 4W9FC 1OZUA 1NTDA 4HKJA 2CLVA 1OCRB 5HI5C 1AC6A 3M17A 4AJVA 3MCLL 4J8QA 3C5JA 1W16A 4OKVB 1BYOA 4OFKA 4UM8A 1T21A 2FO8A 1WVZA 3FCTB 1CR9L 2GJ6D 3K3QA 2CK0L 2PXYB 4OUOA 4L0ZA 3H53A 3SDCD 5MENA 3K6IA 4CVXB 4DK5A 3T6ZA 2X1WL 1H6UA 2R2CA 1D7FA 2YSSB 5D8JH 3QWRA 3Q06A 1A7NL 4NN6C 2BCKB 2G3XA 3MJ7B 3B37A 3RY6A 2WPGA 4HH8A 4JPIB 3W9DB 2H4EA 4K8RL 4ATTA 4JM4L 5IFHH 3DIFB 2QADD 3LRGA 4AEHH 3RQ3A 3VQMA 1OWWA 3WDJA 3MZGB 3UTSB 1A4BA 5C0EA 1KGJA 4I8DA 4GFXA 4GPVA 4DGIH 3CFNA 5H94A 4I77L 5IB3B 5AW0B 5I82A 1N5YL 1JHKH 2DQCL 3DETD 4UBDC 5DJ2B 5JHLA 1UACH 1KCBA 2A74A 1JF6A 5IJVB 4PGEA 1LO0L 1BZ9A 4XBGA 2EICA 3SGKC 5IESL 5D7KD 3IMWA 2PCXA 1HI6A 3ZDZB 1HCVA 2WBWB 3RJOA 1L6PA 3TA4D 3MJ9A 1I9IL 4I3RH 2A2QT 1QQDB 4A7QA 5KBKA 1M57B 4PJFA 1NIBA 4RNRA 3L5WB 1FYTA 4MJ5B 2AK1L 1SDAB 3RVVC 1GRWA 4ONHB 3IDMB 4LCYB 1A1NA 5GGVY 5AWNH 4U7MA 2C4FU 3BZ5A 4A37A 3ZUNC 2XQBL 3NSJA 2XWRA 1JBJA 5CZKA 3H0TA 4G70B 2IPUG 3KHQA 2BSTA 5DYOB 4MAYB 4OFVA 5GISH 5FGBC 4PS8A 3UTZA 1XCTB 2B3RA 2MCPL 2BVQB 4LPUA 4XH2A 4DVRH 2VDNB 2AP2A 1S7XB 4HU2A 3SCMA 1MNNA 3JTTA 3P9LA 3B3BA 3E8UH 2D7MA 1MFEH 1KPUB 2A83B 3LSOB 1U3YA 2V9TA 1IVTA 1GS6X 4KBPA 5EOCH 3MV8A 6PCYA 4EO5A 1KTDA 4Z7AA 4ZX3A 1T0NA 4L3EE 5L4IA 3P0YL 1SJEB 4IMLB 3C5XA 1MF2L 1BIHA 1F11A 2Z91A 2WINA 3O6FB 2R0LL 3QNXB 4KKRA 2WVSA 4WZ9A 1UD3A 2UZPA 1R19A 3EXJA 3APDA 5J1AA 3BFOA 2L04A 4HUMB 1CL7L 5K9KB 1JZEA 4F7MB 2VZ1A 2VQUA 3NIDB 4IEFA 3SPJA 3DO7A 3CHSA 4NQDD 5EA0L 3NIDF 4Y4HA 2FB4H 4CNIB 1G7QA 4LF3A 1WF5A 1FLRL 3S35H 1ILSA 4GIOA 4JPQA 4Q0XL 4KJPD 4K23H 2Y7NA 2WVUA 1AQDA 1NIEA 3ASNB 3GO1H 5FV1L 2YC1B 4E42A 2NW3A 5CJXA 1PZUB 1ML0A 2HWZH 4KUCF 3FYEB 5G4MA 5HYJE 3F62A 1NAML 1ZVSA 1ZA3A 2NMSA 2WBJA 1AZZC 4JBSA 4QOKE 3UBXA 3FT3B 2AJ3B 2A6JB 1UKQA 1K8DA 2OR7A 1T4KA 3C60D 5GS2D 5GS0C 5JOFA 3KVQA 3QO1A 1N7MH 3GHEH 2Z34A 2EYRB 3VFNA 1NDGB 1EAQA 1YEEL 4JHAL 4TRPL 4WTZA 4E9TA 4LCCC 2VDMB 2IQ9H 3LD8C 3V0WH 2GI7A 2PW1A 4MA3B 1XIWB 5DGRA 1FNHA 4S1QH 1OKEA 5KVEE 5J6HA 4MA1B 1MCWM 1PG7H 5GJSL 5KYUA 2WLHA 4BFOA 4LAQH 3NCJL 4FCHA 4PJ7A 1XZWA 2D9QB 2ENYA 2PP8A 1RZIB 4EDWH 1WAAE 3BSZH 4WCYH 2JJTC 3W82A 4GEIA 1LEGB 3GSUA 3QXDB 3A67H 2OBGA 4DZBA 3O3BA 3NMEA 3NZSA 4OLXH 1C8QA 3D2TA 3MV9D 3GGWB 1VFBA 1BSIA 1GCYA 2YGQA 2VAAA 2FE0A 3FONA 1T89C 2ILLA 4U49A 5DO2D 5DUMH 1BLNB 2BY1A 4RFOH 3RWEB 3J2PA 4X6BA 2ERJC 5ECGA 3ULVL 2EVFA 3CLEL 3GLEA 4MASA 4NQSB 1KGUA 4JRYE 5EU4B 3DVNA 4XVUD 1JGUH 1XGTB 3N1FC 4JG1H 4JN2A 1JGIA 4NKMA 4XO4A 3CPLA 1CO1A 3MV9B 5ACZA 4K7FA 1S5IH 2NY4D 1NCWL 3MCYA 4GNKB 4FQHA 4X80H 1AE6H 5CN2A 1QHQA 4FS0A 4YH6A 4TLSA 4KRNA 4LSTL 2PR4H 3V6OA 3BUBA 1RUAL 4QJ4B 2CRZA 2VXTH 4ZQTA 2B1HL 3WEXB 2OL3B 2A99A 5MI0B 1BECA 2XLLA 1IO4C 4IOSD 6FABL 3LS4H 2FCBA 4TQIA 4JE4B 4NP4H 2WGXA 3K91A 2DD8L 5TDPA 3MROB 1I8MB 1QFWM 2R1WA 4YHKH 3VXPA 4HUVB 3EFOB 3OG4B 3RPBA 4ZFOB 1A64A 4OM1L 4JRXD 3V9EA 1XGYH 2D7OA 5JNYB 3X3GH 5DRWB 4HSAC 4K9EH 4AQ8C 1QVOA 3WFCL 4UM8B 5BCAA 4I0PD 2ZSWB 3BKCL 4Y4FB 3K81A 5I5RA 1LO5B 4NQVB 5DVNA 3E0GA 5C0FB 1S78C 5C0IA 3BGFB 3RB5A 2WKOA 3LKOA 2H32B 2ZIDA 5TQ2L 4P46B 3P4NB 1N26A 4X5QA 2Y7OA 3R18A 4HK0B 2BIMA 1YY9D 4I0PB 5IV2A 1M6OB 5FEBA 2MEJB 4O2CA 2P8PB 4MB4A 1J1XH 1X5GA 4P2OD 4XP6L 5GZOC 1U8CA 5C09D 4L29A 4ENEC 1RERA 5IROC 3V0EA 4G1EB 1D5XB 1YNLL 3MOQA 2GW5A 2PWGA 8FABB 4WW2B 4AM0A 1MNUL 1C12A 1Q9KA 2Y2TA 3LN9A 4M8QA 3HTLX 2VRKA 4J6RL 1WEJL 4UTBL 1D5IL 4ETQB 3PP4L 2C26A 2A74B 4P2OB 3C5ZA 3AS2A 4PLJD 4POZC 2DDQL 2VDOB 1A5FL 2RIKA 2YKLH 4OCYL 4PJGA 4XBGB 3B34A 2ITDB 5C8JA 1T2QH 3QIBD 3FSOA 5I1DB 2C3HA 4Y16D 4UQAA 3ROLA 2BK8A 3EO9H 1SFDA 1MLCB 2WN2A 1HE7A 3HC0A 3KYNA 2H45A 4PJFB 5EF0A 3GSOA 1N67A 3NABH 4J7RA 5HJ3A 3MLYL 2B77A 1XR9A 2BX5A 2DTSA 2FL5B 3Q1SH 4QR7A 4PJIE 1OY3B 4PJFF 3MLZL 4X6DE 2XWDA 3X3FL 7TAAA 4CAGA 1JIBA 1JPGA 1ZHBB 1IIIA 3Q8FA 3CZKA 5GIRB 1SY6A 1LO2L 2OSXA 3WTTA 2FR4B 1LNUB 3HRZA 3ZY7A 4B50A 1JF5A 1J8HD 4Y16B 3DIVA 5D1XE 2R69L 4OFQA 3FQWA 2IEPA 4X9FA 5LGHH 5IJKA 4I85A 1U8MA 4IU2B 3UTZB 5FUCC 1CF1A 1E65A 4HAKA 4QRSA 1A3QA 1S7TB 3CQQA 3DX4A 1L9RA 1BVOA 5FOJA 3QEQA 4WFFD 3UX9B 1MRFH 3SE9H 2P5EA 5IBTL 1QWUA 1J5IA 5C0ND 1C08B 5GGTH 3OGOE 4C56E 2CXGA 3OQ3B 35C8L 1XGUB 4FA7B 2IBGA 4NUQA 5C08E 2BVPA 2CK2A 5EUKA 2EECA 2GCYB 4QAWA 5EZLB 4LHUG 1D5ZB 1KJMA 1NIAA 2X2UA 2A6DA 3Q6FA 4OJEH 2VSKB 1T0PB 4CA4A 3BI9X 1ULVA 1ZPLA 2DV6A 3A4FA 5D6DC 3IDJA 1TJXA 4JFTA 4MB1A 2FT7A 2WINB 5IQ7H 3O0RL 5D1QD 3ZE0B 4Y19A 1UVQB 4TMPA 3OKEB 4Y2OA 3Q48A 4ZW3A 3VFUB 2F7IA 5DUPH 5C86A 3FO1A 3NCYP 5TQ0H 5SX4I 4Y4HB 3VFPA 3SD2A 2YQ3A 3JV4A 4N24A 3ARGD 5GGVH 3JT0A 4GAGH 3QR0A 1IE5A 4R5VA 2EC8A 3Q5OA 4RISL 1JZ3A 1VEMA 1JYVA 3LZFH 2BERA 1ZV9A 5ESVB 1UZ6F 2CHNA 2YPVH 4OIBA 2WBJB 3ILQC 2H8PB 5IB2A 2XG4B 5JOFB 2NR6D 4K15A 3HB3D 3UTPD 1Z9NA 4UYQA 2EYSB 5AKSA 3O2DA 4D94A 5DHMC 3NRFA 5F89B 3L4UA 4NUGL 5EC1B 4TVPE 1PY4A 3QXTA 5CP7A 2UV3A 2GJPA 2PW1B 3EBAA 4HC1A 4NP9A 2EE3A 1F6AA 5KAQG 3SO5A 3QZBA 4F7CA 3B5HA 1FFOB 3IMVA 3WFHB 3Q2CA 5JXEC 4QHLA 1MCLA 1HXYB 3L7FA 4G72B 3NP3A 3LJ3A 2HRHA 3FT0A 4PJ7F 4RZKA 4GXVH 5BQ7A 1NC2D 1VGKA 1URZA 5ADOH 2I7OA 2QFPA 1GS8A 2F1AA 1QZ1A 1BOYA 2ZOWA 4OD2B 5TF1H 3TO4D 1CLZH 4BFJA 2ZYIA 3ARSA 4IRJD 4WJ5B 3ATFA 3MJ8B 3CSPA 4I18B 2E9BA 4J4PD 4X6BB 2W92A 2PXYC 3GC3A 5E08L 5JIIA 4JFFD 5JYMA 4AX3A 2KT6A 3N85H 4XMPL 4F7KA 3HUJA 4OV5A 3IEAA 4B96A 3RVUD 1SBSL 5CLZA 2ODHA 3EKCA 1ZGLM 1CL7I 1M4KA 2XWEA 3TO4B 1CICD 3O6MH 2WVVA 2GT9A 1O9VA 1CDUA 3RX7A 1YRKA 2ZX5A 2VLMD 4K3GA 4AY0A 4FXGA 2DQMA 5LNDA 3W56A 1K3IA 2XCMC 4KXBA 4XBPA 2GKIA 4AQ1B 3O3AB 2C3VA 2C9PA 3GSXA 1A3RL 1Q9OA 1JGLL 3A47A 1BD2B 1FZKA 2WLYA 2V5SA 3ILPA 5ALCL 3U2JA 3V0VA 1CXKA 3GSNB 3RPIB 1UT1A 5LAXA 3GXUB 5DMYA 4OSUL 4JK0D 3DX7A 5C0CD 4ZK8A 3SDXB 4LLQA 1LWRA 3D50A 4XO9A 5D7JA 3EJJX 4PRID 1BF5A 1HWGB 2QSVA 3SDXF 3I84A 3TIEB 1CBVL 4F3FA 1T1XB 2R2HA 4XAKD 3ZOAA 3IGUA 4LP5A 4RGNB 4KV5F 2A6IA 1DYZA 3T0VA 3ZMNA 4QF1A 5GS2H 4XNBA 4LLWA 3TBYA 2FBOJ 3R4RA 2AQ1A 5GRXG 1AXTH 3G5XB 5C0CB 4G8IB 1U42A 3P30L 3WG7B 1BVLB 5LBVA 3SBPA 1NBCA 2EKSA 1J1PL 3WCYA 2UZYA 1T66D 3C6LC 2WKOF 2VIRA 2EO1A 3ZE1B 1IC7L 3U1SH 2Z1PA 1DQML 3QRLA 4D9QD 3ZE1F 4E9LA 5JPNB 1LJMA 1T1YB 4MAYC 2ORBL 4PJAB 1EHLH 2AV7B 3OSKA 3QRBA 1SJHA 4PJAF 3FQ1A 5L4MA 4EZMA 3B8YA 1OF0A 3K2KA 5GRJL 5IK3A 1OP5H 3NBNA 1IM3A 3V0HA 3OZ9H 5BV7B 3WJJC 1Q9KB 3S96A 2VL5A 4GW1A 1UHVA 2YGNA 4Y7MA 2NUPB 1IX2A 2J5WA 2NPLX 2R9HC 1ADWA 2N3JA 3K72A 3HE6A 4PJGB 1DJYA 4U0RC 4A6YA 2ZOUA 5KBPA 3FUFA 4ICWA 1OSYA 2OKMA 4PJGF 1PAZA 3BP6A 1FC2D 4M5YH 3ROLB 1R34A 2E0PA 3D3VE 3KYNB 4R90L 3HBQA 1DVFD 4M7LH 4FG6D 5F6IB 4S1RH 2BRRH 4HUWA 3IJ9A 2DBLL 4GI6A 3AB0B 4Z3TA 5JR1L 1O0VA 5GSVA 2HKHH 2A9AA 3OMIB 4IMKA 2ZJSL 4HIXH 5GXBB 5CD5C 4Z5RB 4HLZG 5KOMC 3LZLA 1X44A 4RAVB 4TN9A 4F7PA 3FQWB 1I75A 2F7QA 2KUTA 5EC2A 4OTXH 2JI2A 3AWFA 2RD0A 3J7HA 4JO4H 5IT2L 3KLHC 2FNWA 2XETA 1T1ZA 5GGRB 4CMHC 4N2MA 1ACXA 5HDWA 2Q86A 4EAEA 2BVPB 1U8OA 4QTHB 5JXAH 4NZFA 3SPVB 2AMGA 2FYYB 3POCA 5ISZB 1AZBA 4RMRA 3U7WL 2VISA 1MCDA 3NJHA 2G2NA 1UOLA 4Z7UB 2DEYX 4EI5B 4OZGB 2WC7A 5CKAA 4HF5L 3MRIA 3P4OA 4Z7UF 4DP8X 3GHBL 4OZGF 1OOWA 1XIWC 3U4KA 3BPNB 3IDJB 5F88B 5L7XL 4GRLD 2I27N 5ESAB 4YL9A 3ARPA 1AKJB 1DFXA 5TH2B 3PV7A 2ESVA 4JZOB 4P5SA 4Y19B 2X6MA 4QT5A 2CKBA 1IAMA 4QWWD 1OGTB 2HVJB 5HYFA 5F9JA 1OP3H 3IPFA 3T0EB 4F57L 5KTEL 5LUMA 4PBXA 3P11L 3U7YH 3NJVA 3NT0A 2WN3A 3JV4B 4XVTH 3W0WE 4UIMB 1UCBH 3CFQA 4M5SA 1BMGA 2V9UA 5I76A 5HYIA 2HN7A 4PJXE 4IBVA 1Z3GL 2VQ4A 5EFIA 2OSLA 1B4LA 3M1BA 4GS7B 1BYNA 2XRAL 4R0LA 1GY2A 3OQRA 3B5GA 1GAFH 5KG9B 5I73C 1LLAA 1FORL 2ZWSA 2YEVB 2RMNA 3BKJH 2CIKA 1ZS8A 1U3ZA 3SDDD 3NFSL 3IAPA 5E4IA 5IB2B 3FQ4A 3DA0A 3VI3E 1IAKB 1NGWB 1HKLL 5IHUH 4KMTL 4QXGL 2IADA 2ZKWA 5DK2B 4RWYL 4Q56A 2LTQB 3PAYA 4XPTH 1ZLEA 1H3WM 4NO0D 5GPRA 4QHMB 4RX4A 5TE4H 4IOFD 4R96B 2ED9A 4GAJH 4HPHA 2AEWA 3N0AA 1RFDH 3JVGC 3WN5B 2J25A 4S1DD 5FO2A 3QUXA 4FYRA 1E5YA 4M8VA 1J10A 3MUGB 1QBML 2YBRA 3D85A 4PWKA 2WUBH 5HY9A 4GMSL 5KJRL 2F2HA 5E6IB 3TP4A 1U93A 2XG5A 5KSBB 1VGKB 2ZX6A 4JHWH 3ZHFA 2B1AH 4LLUB 1FG2A 4RGOL 4F58H 2B39A 4NO0B 4QEGA 3M1OA 4K7PX 5KSBF 5LGJA 3QE5A 1IGCL 5IMOA 1IC0A 4WWPA 4JO5A 5HJGA 1EEYB 3CTTA 2XY2A 3PABA 3QZMA 4Y4FC 4WK4B 3NCYS 5BPPA 2WUCH 4UOJA 4HWEL 4X9BA 1SM3L 3DO4A 2X3AA 2AJYL 1TFPA 3W39A 4UINL 4BSWA 3MU3A 2HVBA 2BS9A 2AXFB 3HUJF 3LHPH 4KRLB 1XO8A 4IBQA 5FYLE 5CLXA 1UWEH 3GBML 3WKMH 4XPGL 1UT9A 1B6UA 3EYUH 2ED8A 3AITA 2ZP0T 3ILPB 2ENSA 4I4WB 3B1UA 3WUZA 4D0DB 4Z6AT 2QPFA 4LARL 1L9TA 3GI8L 4LHUD 2X89D 3PDOA 2W07A 1WCBB 5DUJA 4Z76A 4ZMXA 4H0GA 2A74C 3KWWB 2Y69B 4IJTA 4NT6A 1PLBA 4TOYL 4QIRA 3P3SA 4ZO9A 4EXKA 1WJ3A 4R8WH 3LRMA 2AEQL 5ICUA 3QRGH 4ZMTA 2VB5A 4M29A 4ONGH 3VGFA 1HYSC 1E7UA 2ZOLB 3DBXA 1TMQA 4WWKD 2EZ0C 2IQAA 1WZ1L 2B08A 5F93C 2MQGA 4KZDH 1WE5A 1DCEA 3AT9A 3HHSA 4GO9A 1KPRB 4KI5D 4DN4H 3A4DA 3QI9A 5IBLD 3TGXA 4HEMA 1KPVB 4ZS6D 1XDTT 4IGBD 3FQTB 3L4WA 3OPZL 4MCMA 4DUXA 3KR3L 4U05A 4Y8DC 3UTTB 3ZKMC 4HKZA 2F0CA 1SJHB 4CMMA 5CD3A 1C9SA 1HH9A 1DLHA 2YJQA 4YSPA 4DH2A 1IBGL 2HJFB 1FVCA 1KDIA 1OT4A 2XXMB 4L4VE 1OALA 3SCMC 5FOBB 3DUHA 3BWUF 3H9HA 3QRFM 3VFWA 1UXLA 1FFNA 3MO1B 4QXWA 4GG6A 5TFSL 4DEWA 2OW6A 3GJEA 1OGAE 2RH0A 5HYJD 5TPWL 3EOYG 4GKZB 1VHPA 4P2QE 3H85A 2PW2A 4OZ4B 2CRYA 3WGVB 5ITFB 3EIFA 4WGVB 4EBQH 3DJ9A 3WLBA 1OGPA 2Z4QA 3QS3A 5EV7A 4XPFH 2A0LC 3LPWA 3GBDA 3DJSA 1S7RA 4G43A 1J1OH 3RZCA 4IHOA 4PB9L 1YJDC 2EDOA 5B38G 1CGTA 5HGAA 3ARDD 3B9AA 2VDRH 3LIZA 4OLVH 4Y4HC 1JZFA 4GQ9H 4XPBH 2PTUA 1R5IB 3LKQB 4WI7A 1PG7W 1PBYA 4HUKB 2D0FA 2WO4A 1RUMH 4FG0A 3TYFB 4HS6A 4NM4L 3RGVA 3VFGH 4EN3D 1T1ZB 2YWYA 3IDYB 2EADA 1X5ZA 1NC4D 3PWPE 1UD5A 2L7EA 3MFFA 4RMBA 2Q86B 3TNNA 2WBJC 1F3JA 1L7IL 2F19H 2HJKA 5DJ6A 3VXSA 2FAUA 3MGTB 4QAMB 1MFUA 3V6ZA 2H6PA 2XJLA 4LL1A 4S2SA 4ZO6A 4L8SA 3H3KA 4PWHA 4N68A 4EN3B 4DP4X 1XF5A 2XSKA 2VABB 3P4OB 3IDNB 4KU1A 5DZPA 4I88A 1KB9K 2ADIB 5IVNA 1F18A 4ERSL 1OAQH 3EJSA 4YHYC 2FIKB 3SO3B 3T2NL 2XPYA 4JKPH 4KHTL 2Q8BL 1GOFA 3QORB 5IHLB 1UOKA 4OUUA 2ESVB 2WQUA 1PD1A 2CGZA 1BQLL 3SKNB 1N5AA 5HHPA 4OD3L 1LWJA 2CO7B 4XN1A 3F05A 3VI4E 3CDCA 2WCSA 3KZ8A 2V5RA 3VMPA 1CXHA 1CDYA 1H15A 3CHPA 3NOIA 4G7VH 3PL6D 1K5NA 3N1QC 3THML 3VFRB 4HJTA 5I76B 4KNUA 1PYWA 1WZAA 1HL4A 1Z5LA 1P2CB 4U6HB 3OKOB 1EIBA 3ARWA 1FGNH 1TJGL 3BE1H 2RGSA 3WAJA 3CCHA 1CI5A 2DTML 5EMYA 3BEVA 3CV5A 1VIWA 2CIKB 3LCYA 2J8OA 4ZMYA 1AQKH 5FF6A 5ETUB 2ZCHH 4P0DA 2EIJB 4E9RA 5DD5L 3X1EA 3ZDWA 4A7SA 5FDYA 4AGPA 3BSZA 1K4CA 4X6FB 4Y0GA 1MW3A 1H3VA 1HX0A 3FJTA 3O4LA 4JM2D 4UT6L 1NFIA 1IV8A 5E6ZA 2L7JA 5HD8D 3KBFA 4NAMA 4MNGB 3V6OC 3B7SA 3K6OA 3NFNA 4AQ1C 1R24B 1UWXH 5FIEA 1WD8A 1QFWH 3BJLA 5E99L 3S34L 3S4SB 4HGWA 1MWAH 5GHWH 3QUXB 5GRUH 3RUGB 3SZKC 5JIDA 1D5BA 2WCGA 5HY9B 5JIPA 3EOTH 1OK0A 5I18L 1EZVX 1CGSL 4U1KB 3WMPA 2NXZB 4P23B 1XF2B 1KXVA 4FMVA 4Z7VE 3I74A 2AVFA 1N64L 3VDAA 4APXB 4C83B 1VFOA 1X7QA 3GBLA 1AS7A 2AJXL 4RGNC 5F7EL 3VMOA 2R0WL 1IC5H 2AV1B 4GB9A 3M45A 3MUUA 2VERN 3F12A 4N2FA 5ERWB 3Q6GH 4YBLC 4QPEA 1KXHA 1VGEL 5KYWA 2VLJA 1N8OE 4GMTH 1UOVA 2LT9A 25C8L 4LNRB 1AMYA 5EWIL 3WY2A 4CKQA 5T5FH 3ESPA 4X6CA 1QRKA 4QXUH 4BSWB 5C9KA 1XCQB 3EO1B 4FULA 4MS8D 2HFGL 5KSVB 2ZF9A 3O2WL 5JPNC 2IALA 2P8LA 1MY7A 1DL7L 1FRGH 4MJ6B 2CBOA 5D1XD 1PZ3A 2QHRL 1OTUD 3QDMA 2OMVB 1JPTL 2C7FA 5TDNA 1TYEB 3WUWB 3ZJAA 5A1AA 3BZFB 4HGMA 4L9LB 1YLBB 1UKSA 5JA9A 4D0CA 3A6BH 4PI2A 5IG7A 1Q4NX 3HIZA 3OAUH 5DT1L 3ROOA 1U2CA 4W9JC 5BMFL 2EYTB 4H88H 3WXVL 2R23B 4OQTA 4C56D 1TU2A 3WNOA 2Z92B 5DJDA 3C5ZC 2VITB 3TEUA 5C08D 4WEMB 5C0BA 4JFPA 3RU8L 1GGIH 3CLFL 2MFNA 4HSQA 4JM0A 4X4KA 4A7TA 1W2KT 1KCSL 1TZGH 3CMOL 3V4PL 5BRPA 1A4CA 2BOCB 2YN3A 2GUOB 1FHGA 2WB1A 3WFBL 2DKUA 5HVHC 1EJOH 5F6IC 3VUAA 2E7LA 3VJ6A 3DGGB 4KKBD 3MMEA 3AB0C 2OK0L 1MFVA 4J3VA 2YRBA 3PGFH 2PCPB 1HINH 3CVHL 3QI9B 1Y6MR 3HRZC 3UABA 4LLVB 4IS6A 4FLQA 1D6EA 3TEYA 1QSEB 4JO1L 2ZUQC 3OXRA 3QQ4B 3T3MB 1TQWA 4JFOA 3Q44A 5IJKC 4ZUUA 4UNIA 1BPVA 2J1KA 3W11D 3FQNB 3VX0A 5CNHA 1TVBA 4X8CA 1PPIA 2ADGB 2OJEA 2OMWB 2DOCA 4DAGL 5EPMB 1OCZB 4RIRA 5GGSY 5EBLB 3RIFK 3GK8H 4JJ5A 5LVEA 4V33A 4YFDB 1YEDA 2JCCB 5AYQA 4B9FA 4GG6F 3CDZB 3EFFA 3E3QC 3BISA 1FV1A 2P80A 3BAKA 3TONA 2AZAA 1NGXB 4P2RE 3PXLA 4UV4L 3D4GA 3EZ8A 4PBDA 2EDWA 5F9AC 3BPNC 3U9UA 4TVPD 4MWFB 2C4XA 1FZOB 1C5CL 3QGVA 2HFFA 2PWEA 1JPFB 2Y1ZA 3U2SB 1PDKA 1TKWA 3FO0L 5DZLA 3QUML 4P3WA 5HGAB 4LP4A 1IGYA 3DIDA 4IKLA 4YDIH 2YJLA 2OSWA 2GJ6A 1KENH 1TF4A 2Y2YA 3KGSA 3OJ2C 5AW8B 3SDCA 1YNKH 4DP6X 2A1WH 2X2HA 3L3KB 1SFHA 1UUSA 3LXUX 4W4OC 2OMBA 5DC4B 5LXGL 4PB0H 2ZX9A 5DD6B 5JDJA 2XDHA 4BHUI 4HDIA 1NFDA 3S5LB 4RRPG 1ILUA 3DROB 4JPWH 4N2BA 1ACYH 2X88A 4P3CH 4AJYV 1NPUA 4LU5L 1YG9A 3WS6A 4MHHI 5IKCB 1D5MA 2VLKA 1EMTL 2XX0A 1KWKA 3HC3L 1RCYA 1KN4H 1BFOB 5B39G 2UXFA 5F1KC 3FB7A 3OG6B 4U6VL 1NSNH 1RJLA 2CA3A 4YWGH 2XI9A 4JR9H 4M00A 3EDFA 2MHAB 2IVFC 1OP5K 4M6MH 3IJSA 4BZYA 4KX8A 1QSFE 4LSQL 3VFSB 5E6IC 1I3GL 3QC5X 1IGML 5IIEB 2A7BA 3FQXB 4P9HC 3S37H 3SGEI 3V5DA 3IFPB 3OJVC 2E27L 1KBVA 5DFVD 4Z78A 3MKGA 5F3HB 3P77A 1N3NA 3IBOA 3LRSB 5IFAL 4TSCH 4KJYA 1FFRA 3MVSA 2COVD 1PAMA 3B9DA 4N22A 4PY8I 4WHTA 2F7RA 1A7BA 1TTGA 3V0IA 4ODTH 2DLFL 1DE4B 5CR8A 1BOGA 5DDHB 3BAJA 1TQSA 3QDJA 4JFDB 1U8LB 4KK6D 2HLFC 4M02A 1HS6A 2G2PA 2O72A 2OI9B 5IOPA 1E8WA 2SEBA 4CN1A 2X6VA 3F7YA 3BH8A 4XC1L 3VMNA 3KWTA 3IE4A 2VGLM 2OQJA 5A2JH 3NFNB 1PZBA 3FTYA 2H0PA 1KYAA 5JOEA 1WC7B 4R3SA 2BINA 3W37A 4HGWB 4LKXB 1J05A 2QPDB 1H3UA 1F1AA 1KB3A 3F5WA 4TUKH 4U1GB 5E8DL 4RMUA 1B4JL 2I25N 1LP9B 3CIAA 1ZA6B 4J5VA 5D7JC 1CE6B 3MYJB 2ZICA 3H6JA 3CSGA 4U1JA 1ND0B 1EWHA 4NENB 3VG0L 4B3EA 5T3XL 5FPIA 4PTTA 4WUKL 1NGYA 2R2EB 1CLVA 3GUTA 3ZKNC 3ZTEA 1DSFH 2WQVA 4HVBA 1LK2A 5AKRA 1P6AB 1E4XH 1HHIB 1JGEB 2YZ1A 2IANE 2VLJB 3LN5B 3D3VD 1WBXA 5GS0L 4OF0A 3U4AA 1MVYA 1S8DB 4BEIA 3D4ZA 3SE8H 4X6CF 3VGBA 4PI0A 4N26A 3VO0A 3C8KB 4KROD 4Z7NE 4M61B 5LG6A 1AH1A 3HBZA 2V4LA 3LH8A 4XO8A 1DZ0A 3SDAD 1NLBL 3UG3A 1CF8H 3SJVB 2RAMA 1CFMA 3N41B 3RWGB 4UM9A 1AY1L 4YGAB 5IHZA 1NGQH 3C60A 3N41F 1ANUA 3BWUC 5J12B 3GYRA 3R1GH 2OP4L 5HHXH 5IB4B 5I1JL 3TYGH 5IG7B 3HN3A 1KLUA 3GZQA 2E56A 4N2GA 3HPJB 3BAEH 4XX5A 4ZZKA 1MCSA 5CU5A 4F2ME 3SDAB 2CIIB 4ZSOA 5HTSA 1RU9L 2Y36H 1W72H 2EIZB 3HE6C 4XTRD 5C0BB 2AERT 3LQMA 4HZLA 1IGFL 4MD5B 1ODUA 3HFMH 5A2KH 1AMXA 4LK4A 4Y5VB 4FFZA 4DOHE 4AG4H 1TJHH 1F90H 1F45A 2ALAA 1DHKA 4L4TE 5D72L 4G8GE 4UQ3A 1IC4H 1HXMB 5C0RL 1JHLL 3N42B 4QGTA 3G5YB 4P57A 3CFJB 4IMKC 4ODUA 1NAKL 3MRNA 5JHMA 3A6OA 1D5RA 3BEWA 3ZTJG 2DYRB 5DMKB 4AQAA 3G08A 2A73B 1AYOA 4KZ0A 2X4NA 2Z35A 2MPVA 3UZVA 1NIDA 3JWNE 1E9OB 1HFUA 4Q4EA 1G9NC 4LESA 4YR6A 4ZRGA 3ZDXB 4P4RB 5DTFB 4KHXL 2OZNA 3KJ6H 5AW7B 3W0WD 3UROR 3AREA 4OCSL 3MREB 4HJ1A 1EO8H 1GW0A 2FO4A 1NCCL 5KS9E 2OJEB 3T09A 3H7BB 2BNQE 1NDMB 1S5HA 4WI0A 1CD1A 2W0FA 3ULSB 3AU0A 2XIIA 4ZFFA 5AVQB 3TEZA 1GKOA 4PYHA 3K71A 4NQXA 3BH9B 2YGPA 2R8SL 3I50L 1G43A 1S3RA 3L3OB 3RDTA 1CXLA 3UIYA 1FV1B 4N2NA 5KYXA 3SKOA 2VDPH 2XNAB 5TDOB 2ZD0A 4N8VA 4R26L 4GQRA 1WBYA 5D2NE 4HLZH 4IOSA 3NP4A 3L1OL 2MNJB 4ODHH 2J88L 4L1SA 3UG5A 2EVGA 3KPPB 1OW0A 3CDGA 3SO3C 5I75B 4RA0C 2JH2A 3QORC 4JRXA 5EHFA 1UB6A 3LEYH 1ZLVH 1RIUL 3S35X 4BUQA 3WFDH 7PAZA 4GQQA 4M62H 5I0VA 2AAAA 4DEUA 1T3FA 4G9DA 4J3OH 2J5LB 5CSZB 1G4RA 4AYEC 3G04B 1KIUB 2YAPA 2WBXA 2YD6A 1TNNA 4X6EB 3FB5B 3HG4A 5CEZL 3QARA 4PRAA 1K3ZA 2FJGA 1G1CA 3RVTD 2JQZA 1YDPA 3PU7A 4FOMA 5CKGA 3CH1A 2JB6B 1FDLH 3NA9L 3ULVE 3QO0B 5E9DB 2QZ5A 3NRQA 3PWLB 4PS3A 4ZTPH 5DLLA 3OMZA 1A3LH 4Z8FL 1MIEL 5C0JB 5IJCC 4HJSA 3UC0L 2D31B 5C09A 4FQ2L 4QYOA 5D71L 3RI5K 2RFXA 3HMWL 4FHBD 4YHOL 2FIRT 1PG7X 5DMIL 2O5XL 3EH3B 2XACC 4U6YA 2VLKB 2L0DA 3QUYD 4FABL 5FYLD 2FX9L 3FNKA 3RDJA 2NY1B 2FBJH 4B53A 1MHPH 5JHAA 3VVVA 2AZUA 3MA7B 4OCNC 4B7LA 2CRMA 5F1OB 1M7IA 1G6RB 4L0YA 3QAZB 1H0DB 3QUXC 2WIIA 3GS7A 2ZWZA 3TCLA 3IJSB 1FBIL 1T03L 3QIBA 1PX8A 2NXZC 1BFSA 4P23C 1N0XL 3GRGA 4KVCH 4I48A 5E1QA 3S8FB 4WSGA 2LABA 4ODVH 2B59B 2XKNA 1QBLL 4B9JA 4QTFA 2ZXEB 5HI4D 4OLZL 4R7NA 1RULL 3IF1A 4AK2A 1JGVH 1C5BL 1A8JH 3MACH 1MJ8L 3AQXA 5B8CA 2IPUK 4PMFA 2EDFA 4ZT1A 2IMMA 2NXYD 3TWCL 3S5ZA 1OAXL 3M7FB 1UM4H 2F58H 2V2WB 5E9AA 3KPLA 2B14A 5IOPB 1X9QA 3KCPA 4EI6A 1MG3C 1QTPA 1A2YB 1MSPA 3GWJA 1N59A 2CKNA 3BRGC 1IQDA 5LNEA 1CIUA 3BGMA 3AY2A 4FQLL 4YS4A 4CGTA 1DQJA 1JNNH 4QRRD 1A7PH 3DBSA 3NESA 1VFAB 3C8DA 3H54A 4TUOB 5I0XA 4AZ8A 3GXTA 3F5WB 3R0MA 1I9JL 3EJZD 4PQXA 3AUVA 4L4VD 2F8OA 4FJZA 3RIFF 4WO4D 4FTVB 4YLCA 4HJUA 4EQ2A 4L8BB 4WHCA 2GC7C 4GYBA 4QRRB 3FT4B 3OKLB 5I2IA 3IBEA 4PTTB 1OGAD 2OMNA 3IXAA 5C2UB 1I85A 1V10A 2FSEB 4MQXD 4P2QD 3NJKA 4YDZA 2KC0A 2O6FA 1P4LA 3R7QA 5CP3H 1MAKA 5FK9A 2WWKT 2X9ZA 3BKMH 4JAMB 4UDUB 4TNEA 5ICXA 1KYUA 3UPRB 1ETZA 3BPOB 1J12A 2ZKMX 3P2BA 4LVHB 3TT1L 3I6KB 4KI1A 5EBMA 1A7RH 1MFAH 3ARGA 2PCYA 1NINA 1UB5B 5FYJL 2EVJA 3QI9C 3F2LA 3HZYA 5EOQL 2W81C 5BS0E 4XXDA 3DOSB 2ETWA 1ZXQA 3BIKA 2AGJH 4IBWA 3GMPA 4RGMB 2ICEB 2GSGA 1TTAA 1CFQB 1GTFA 2DBJA 3TV3H 2KI6A 4NPYA 3IU4L 3F64A 5DK0A 1AOZA 4FX5A 3QCUH 1INDH 1KCLA 1M56B 1XR8A 4JFQB 2GTQA 1JWMA 2O5YL 2VCOA 1GYUA 3RVXD 4DPRA 2GBUA 3Q8AA 4TSBL 2OZ4H 1IVLA 1YEGH 4WRLA 3D2UB 4XBEL 3PWPD 2BVOB 2V2XA 4N2DA 3SE6A 4N6RA 2IDSA 3NSXA 1NMAL 3QQNA 4HZLB 3NH7H 1KV7A 5CGYC 4Y4KD 2LE9A 5FHBL 3ZDYF 1K4DA 3NCXA 2VDQB 2A4EA 1MPAL 4MLIA 4EIUA 1I7UA 5JIQA 5DJAB 5HHOB 1L6ZA 5HGHA 1NC2A 4BQ9A 1SXNA 4H0LC 1OK8A 5BXFB 1ZE3H 3KPOB 2CUMA 3FF7A 3RZCC 1MCWW 3DSNB 4YHLH 4G80B 2BJML 3MRNB 4OZFB 4IRJA 5LAPA 3QHFL 3OHMB 4FJYA 3OKDA 1IJ9A 4J4PA 5JQ6L 2TSBA 1OTTD 4JFFA 4PVBA 1W0WA 1Z9MA 3P73A 4GUQA 3LQZB 3T6VA 4KK5D 2G60L 1AXSA 5HSFA 3L9EA 4HCRA 3UCRA 2R7EB 3AREB 3KW8A 4YBQD 5KVDE 4POUB 4RSYA 5EUOB 5GS3A 4NFBA 2B2XH 1CICA 3DUSA 1SHWA 2R29A 3BDYL 3MNZA 3JWNG 3IGLA 5EUOF 1PVHA 5A40E 1OAYH 3X13B 4NQXB 2Z1KA 1N8ZA 3GS0A 3KDMB 4YXHH 2VSDA 3VI4B 1NWOA 3B6SA 1QPPA 4KITB 2F54E 3VRIA 4XO5A 4L8SC 3MRMB 5DLMH 2ZF8A 1WBYB 2WTRA 4FFWC 2BP8B 1G7HA 1AI1H 1GYCA 2JKJA 4HIHB 1CXFA 4JZJB 2ZNWA 3BP4B 4XN2A 5AOMA 2YPKA 1JK8A 3RFZB 4OCRH 1IAOA 2P52A 2VKXA 2YSTA 4PRIA 4JDTL 1HOEA 2Q7YA 1B88A 3MX0A 4N0FA 4M7JH 4PJBA 4HXAL 3IJHB 4IBSA 4JG0H 3QHTC 4V1DE 1EXHA 3FUIA 4QHPA 1CD9B 2VDNL 3CHRA 1CTOA 5F7MC 3NACL 3IGAB 4YSUA 2KMWA 3AY4A 1YDPB 4PV8A 5DGQA 4UYPA 2D0HA 2F5BH 4ZMAT 2WXJA 2W0KA 2YKKA 3T0DA 2Y24A 3L9RA 3OKKA 4BFBD 2ROYA 3WIHL 3EZJB 4XWOC 1JAEA 1X5IA 3FRPG 1UD2A 2Q3XA 1T2JA 4PRNB 4K07A 5EN3A 1CN4A 4IOIB 5FX3A 2IXQA 3S88L 2FJHA 2GTWB 3ERXA 1NEZG 1PJWA 4LSDA 3WHXB 2YWZA 1QO3A 3AACA 4FAAB 3KPRA 4LLAA 4ELDA 2BFVL 1X5MA 5AL0A 1MJUL 4UQ2B 4YHIB 3LYRA 1QR1A 2FD6H 4HWBH 1EERB 2PR9A 3TCLB 1VLXA 3U7AA 1A6WL 2DM7A 1ID5I 1ZOXA 3MA9L 5D93C 4AV5A 5DEFB 1KULA 4WFHE 1Y1DA 4K3DL 2APTA 2IV9A 1IZJA 4I48B 5MEQB 1A6ZA 1RUKH 1KBPA 1DVFA 3L3HB 5ALBH 2OTUA 4I2XE 2GEQA 4KFZC 1HIMH 5MERB 4ELMA 3DMMB 4OD1L 3UIZA 4IW4C 3MRPB 2W60B 4LOVA 1PFCA 3QEUB 1H8NA 3VACA 1FN4A 1MWAA 3K8LA 1EUTA 2J73A 4POYA 2RTTA 4BGDA 2ENPA 2F53E 3FCUB 4HFUH 3MYZA 1RVFH 5E0FA 4BELD 2E9WA 1E4WL 1TEYA 2WCPA 4HT1H 4DVBA 3Q0HA 3VA6A 43CAB 3WIFA 3BAYA 4GP4B 4K9EC 1ZIAA 3CG8A 3TVMB 3PFUA 4TF4A 4X83A 5I8OL 5L6YL 3NPZB 2DLEA 4PJEE 4URKA 1XV8A 1BJ1H 1TEFA 1YQVL 4ODWB 3I9PA 3KXFE 4AXWB 5TE6H 4NDMA 4YDJA 4RMTA 1NIFA 1GOGA 1RKRA 3AROA 3QCVL 2HRPH 4AKPA 4GRLA 2NYZA 3B2XA 3WE1A 3IXAB 2UVFA 2EEBA 4ZPTA 3OMNB 1M1XB 4Y5VC 4P2RD 4KQ4L 5FCSH 4FG2A 5I8EA 2Z7YA 3ZT5A 4NWTL 1NJ9B 2JLPA 3B7TA 4OJAA 1I8KB 4GAYA 5DU7A 3CZJA 1KLGA 1M3IA 5LNGA 3IWUA 3WIIL 4OH2A 3CE1A 4YDNA 4M5ZH 5PCYA 2DQTL 4XNMB 5GZND 5JW4M 4YSSA 5DSCB 1Y07A 4XHQA 2A4ZA 4JO3H 2K9FB 4QRUB 4B97A 1YYLL 2YQGA 2TSAA 3LEXB 3SKMA 1U2HA 3BKYL 3WO4C 4MKTA 1FSKB 1Q38A 4PS7A 2JKXA 2OL3L 4OFIA 2GBVA 3SDDA 3DUUB 5DC2A 5FM5M 2P3YA 1XR8B 4Z7OB 5F3BA 5CZXD 1LEKB 3S2AA 1ZLDA 3LIUA 3RTQD 2DWYA 1ZDQA 4Z7OF 1IEAB 1A4KB 2OMTB 5TF0A 3SIKA 3UAJC 1A6VH 3EJTA 4LRIA 4ZFOL 5L2JA 3OLIA 3ARYA 4UV7H 3S48A 2DIAA 5CJQH 3JTSA 2Z93B 3FUJA 4N6RB 3NG5A 4HJIA 1X5LA 1TTFA 2WMPB 2HX7A 5I1EL 4H25A 1G5AA 1PD6A 4ZYKA 5IFJA 1VEPA 3VXOB 4WI3A 1AO7E 1BQHA 3FRUA 2AJSL 1EHKB 3VXQB 1N12A 4K2UL 5HGHB 2W65B 5F0JB 3TCTA 3BZ4A 1MW2A 3UADA 3EF7A 5DJZB 5L8LB 4UOW0 3QAQA 3LNHA 3QULA 1EXUA 1G7MA 1BM3H 3INUL 4MMZB 3VFVA 5C7XL 5C0AD 3UAFA 3VXUE 4JFXB 1QSFD 3E9UA 2J5LC 4XN8A 3HS0A 3P73B 3SDCC 1FNSH 2PCFB 5I1CH 4GO8A 4K3EH 1BWMA 2R56H 4DKFL 2D8KA 3L4XA 4OFYD 1Z5HA 1FE8H 2WYIA 4DFIA 1B3IA 2AFNA 1NCAL 3HLAB 1I1CA 3CDFA 5IF0B 3DUSB 3CVBA 3MNZB 3R06B 3S6CA 2IWFA 5AZEL 5C0AB 5JHLL 3ME0A 1TZOA 1JK9B 1Y1UA 4WF7A 3GBEA 2EH7H 2VDOL 3V5HA 1CFVH 2QADC 3MRJA 3WIAA 3MRHA 1UXMA 1VZGA 3KD4A 1DDTA 2QQKH 4YDVB 3Q1EA 2VDRB 3WS6C 2WTRB 5DD1H 2NY1C 2X89A 5CN3A 4P5KA 5KJ7E 1UM6L 3DPBA 3DWTA 3IRZA 2X28A 4HSCX 3ZE2E 2OTWB 1DN0A 1JK8B 2J4WL 2X6AA 4OFPA 4YDKL 1YC7A 1OARH 5B1AB 4YXKH 2H3NA 4MBRA 1B0GB 1YMMB 3FOMA 4XHJC 3HNVL 5FC9A 2IFFL 4K8RD 3JXAA 3SEPA 1F02I 1URLA 2ZPKH 1KF9B 2EINB 5IWLA 4L4JA 1KIQB 5F96L 3U30B 4MDIB 4PTUA 4OVVA 1WBZA 1RUPL 4ZUTB 4L3EA 4PJBF 5IQ9B 4YC2B 4WWKA 2PF6A 3WTVA 4NNPH 2Y1YA 5FO9B 1MEXL 3QDGE 3TPUB 4MZIA 3VCLA 1S9WB 2P24B 1E5UI 1NH6A 4Q52A 4Y1AA 4PSRA 1XSIA 4X50A 4IGBA 2AITA 5B1BB 5D4QA 1KBBA 5KBDA 2ZG2A 3CN0A 1SJVA 4MSWA 2KZ1B 3OKKB 2JJWA 2WXLA 1F3DH 4JL2A 4DQOL 3F7RA 4NQCE 1G9EA 3TT3L 3N2JA 1BXAA 4D8OA 3QG6A 5IMKB 1NEUA 1KB5A 2YQ2A 3ELQA 4X4MA 5C07B 5FECA 3QIUB 5E5MA 3LB6C 5HYJA 1MW1A 2Q9OA 3BN3B 2EIDA 4KNTA 4QOKA 2NUTA 4WI9A 1YJDL 3WTWA 3LV3A 1ZGLA 3SYOA 5IR1B 3REVA 1BM7A 4M8UA 1WUZA 1LE5B 3BP5B 1BX2A 1WFIA 4HLEA 4RMQA 1XQ4A 4GJTB 4WQOA 4AIEA 3OV6A 3GRWL 1UWGH 1J5CA 4WUUE 1JV5A 5CLYA 2A9CA 4WW1B 3WNMA 2UZIL 4G6KL 4L8CB 1BXVA 4LCIH 4FQXB 3US9A 3ELAT 1BVZA 4ELMF 3ARDA 1FQ9C 3CFEA 3I6LE 1C8PA 2HTKC 3UZQA 5IHBA 3BPOC 1DJXA 4MVBC 1ZTXL 4X5RA 4GG8B 3IVKA 3BIBX 3BMVA 3QZWB 4L4TD 1YYCA 4G8GD 1ZSDA 1ZLVK 2HT2C 4CC0A 1N2RA 1BEYL 4BA0A 2Y5EA 4ZUVB 1BZDA 2WB7A 1VB9A 4P5RA 5D7EA 5B3NA 3T0XA 3FB6B 4RVBA 1NC4A 2FJFA 1DANU 3BO8A 3FO2B 4AENB 3OM3B 4JRYA 5T5NG 3C60C 5L2KB 4D3CL 1KJVB 5DMJB 4LRNL 3LX9A 4QXTA 4NSKB 5GJTH 3U46A 4FZEL 2I24N 2MRYA 4ETYA 5BVPL 3ARQA 4GRWE 1XF4A 4ODXB 5KSAB 5MHSD 1ZGLP 3N43B 2BNQD 3E6FA 1SN5A 2D7PA 1Y0LB 4PV1C 3EBHA 3N43F 1DQQA 2R4SH 4BFRA 1QABA 1BMWA 3BLPX 1TCRA 4TUUA 4ZPTB 5I1KL 5AVWB 4P59H 5J9PB 4KKQA 2R15A 3VW3H 5E56A 2XPGB 2ZCZA 1TNMA 4FXTA 4JANA 2Z31D 1R3LB 3F6JA 2IOOA 4PRPE 3D39B 4XN4A 3RJQB 4W4NA 4HA1A 1INQA 4KNQA 5K39B 3NQIA 1XCWA 4RMSA 3T9WA 4AGLA 3OGCA 3CX5J 1IB5A 1VADA 1NAMB 1NCUA 4Y2DB 5L9DH 4RZCA 1E4KA 4TULH 2BY2A 5DO2C 1RUQL 2F5AH 3P3UA 4MTMA 3OXSA 4X0KA 1CXIA 2I85A 2DRUA 3LRKA 4PJ5E 1KJ2A 2Z31B 3PJSA 4XVUC 1CDHA 1PKQE 2CXKA 4X9HA 3H42H 4N2AA 1N19A 2BSRB 3AG1B 5JW3H 2ZE0A 3GSNL 3AREC 3L3JB 4N5ED 1PL3A 2BNRE 1P53A 4AIOA 4KO9A 5I1LA 5DQJB 1JP5A 5F3BB 4W6XB 1P5UA 2P4AB 1ROCA 4JM2A 2QQLL 5JPMA 5DQ9B 4X5LA 3NVQA 3O6LH 1YN7B 2YAMA 2WXKA 3NFPA 5E4AA 3RDTC 1AS6A 3RBGA 5IBUG 2FBRA 2WNWA 1DDHA 4XBMA 4TUJA 2D2OA 5E8PA 1YEFH 4ZS7H 4M3HA 1DEEA 2ZUWA 1SLUA 3EH4B 3PJLA 4HV8B 2Y3NA 4PJ9B 3ZRSA 2XZQL 1BQHB 4NI3A 3RJDA 2BZCA 3N06B 3B8SA 1OAUL 1XSJA 4G6FD 4PJDB 1E50A 5ELIA 5IW3A 3JT2A 1KMGA 1E0OB 4NOFA 1PTZA 1IAIM 2JELL 4OZHB 4PJDF 3CBRA 1Z0NA 3ZKQD 3NSDA 3BW9A 2F8IA 3FBQA 3ETBJ 2R83A 4O02B 1KGWA 1XH0A 4ISVA 5FHAL 2BPBA 5E00B 1MHEA 1M05B 2ZYHA 2B20A 3AAZA 1F00I 2IAMD 2MPAL 1HSAB 2BVYA 3X1FA 2AJUL 4M48L 2HB0A 2ZONA 3DVFA 3UGXA 1J5HA 1DUZA 1FF5A 1KXQE 2NTFB 3VXNA 2EACA 3MFGB 5BV7L 3DYPA 1VAHA 4PJIA 2EIKB 3I02A 1S7UB 4X6DA 1MRCH 1B9ZA 3GIVA 3VD9A 2OR9H 4YZFE 1YY9C 3AG3B 3CVCA 5AVSB 2XZAL 3ME0B 2X4QB 4GH7B 3NEOA 1GIGL 4KJWC 3RA7L 1ZSHA 2OXGA 3FYIB 3V5HB 5D1XA 1DJIA 2YK1L 5T1LD 4MMXB 3UJJL 3T6QC 4P5TD 1OSZB 4HJEA 1PSKH 3FS9A 1YECL 5I16A 3BUQA 4JQIH 3TIDA 3MBWA 3B9KB 1PLGH 4H5SA 3D0AA 4PG2A 2E6PA 4C56A 3HG2A 4FP8L 1EGJH 1HOCA 3AXLA 4I89A 5C08A 1SHMA 4I1RA 4XNUL 2FWLB 3I9GH 3IWVA 4LEXH 4JY6A 3NEXA 3DX8A 3FT2A 5FO8A 3TX4A 4YE4H 3GPSA 2W88A 2FJUB 4NKIH 4M1DL 3ULUH 1N4XH 4XOCA 3QA3B 4MQ7B 3VGAC 1A7OH 1JD7A 4HHAA 4U1SA 2X70B 3T3PE 3LMJL 1JYXA 3VCLB 1U8NA 5GGSA 3ATEA 3FO9A 3DMMC 3L3DB 4Y1AB 3CFKA 4U2YA 2ICWA 3H9SE 3LNDA 2ZXCA 4PCYA 3IJYB 5DRZB 2G75B 5JW5B 4H26B 1FO0H 3UACA 1T5KA 3LEVL 4JRWA 2L3BA 5CMAA 4G7YL 3DHMA 2IJ0C 3DVGA 4PY8J 5FO7B 1U21A 5FAAA 2VLLA 3VTAA 5BS0D 1ADQL 1EBPA 4W93A 1DBAH 2XTJE 3QG6B 1SUJA 1S7QA 4HJ0D 5GRYA 2N59A 2IH3A 3TZVD 1HEJC 1RJZA 4FNLH 4PWFA 3ETSA 3CHQA 1FZJB 1E5AA 1RURH 4QRAA 2HT4C 4FFYH 1AFVH 3D9AL 4HKBA 3QBTB 1W0VA 5KAQF 5BOJA 2UY6B 4X4YA 1M2VB 1NBZA 2CBMA 3MCLH 1DVSA 2JJSA 1JV5B 2HLEB 4XVJH 2E7CA 1I85C 4UT9H 5T33L 2DB8A 1A9EA 2FZ3B 5F9WB 4GBXB 3UO1H 2O61A 4FQIL 3ABMB 3X2QB 4OGZA 3K6SA 1IGTA 1E4HA 4FKEA 3W2DH 5FKAB 1N2RB 2YA1A 2ID5A 2BOBA 3DTXA 4AV4A 4PLOB 3PHQB 3ZQXA 3QPXL 3FSVA 3FF8A 3U83A 1J5OL 2MOQA 2FJFB 2HTLD 2JFCA 5G5DA 3BO8B 1IM9B 1JWSB 2DJ4A 1AR2A 3KVDD 4PREB 5C6TH 4ACPA 1EAJA 2UWEE 4HJGB 5I71C 3Q2VA 3IJEA 2PABA 1ZHLA 5LCVH 2N01B 4I77H 5CP3A 1MRDL 5I0WA 4MHHG 2AMUA 4P9HL 2ZOKA 1RHHA 3ISWA 4TSAH 3VWKB 1ZHNB 2VRAA 4ES9A 2ZCLL 4WKXA 3STZA 1P4BL 1DQQB 1S9YB 1SDDA 2OCCB 5E4OA 3GI9L 4L1BA 4O51A 1CFNB 1BBDL 3QH3B 4UT7H 3E6HB 2BWDA 5SWSB 4JANB 4K5MA 3RWCA 1G7PA 1QUPA 2AK1H 2NY6D 1CFTA 2O93L 1BFVH 1J0JA 4QRQB 3HPLB 1THCA 2YPLD 1IKNA 3ECBA 4F8TA 3SOBH 5IVXA 2XA3A 5FDWB 4L18A 3DXAE 5BJTA 4MMZC 2X1XR 4JO8A 5C0GA 2X1OA 2JNZA 3BRDA 1JERA 3HG0A 4G3YH 4PWEA 2Y5TA 1VPOL 3PV6B 4B95C 1W72B 3RX8A 3WXWL 1DUYB 2F1BA 2HJLB 1RZJC 3ML9A 4V2CB 4V1DD 3SKUD 4XNXL 4NQEE 3VRLE 4YEEA 2C4FT 2YPLB 5GS1A 2W38A 3RVUC 1YYML 3EBGA 4LB8A 3PGCB 1CICC 1A6AA 1JE6A 4Q6IA 4UTAL 2WBKA 4BK5A 5JLZB 2VQTA 1T20B 3UBXI 4WIQA 1VSCA 2NNRA 4JM2F 2VZUA 5AD0A 4IIQA 2E5EA 1A6TA 4QY8A 4C54A 2R59A 2P48B 2ZX8A 4G6AC 1O7SA 1I8AA 1AIFA 2V5TA 2C9SA 5E8PB 5INCB 4DEPC 4YXLL 5EEZA 2Z65C 1KCRL 4JMXA 1HSBB 3CH8A 1EO7A 1UWYA 4CRPA 4ZX4A 1U3HB 3GIZH 4YGVB 1ECYA 4ZXBD 4XN9A 2JTDA 3FN0L 2I26N 2CUHA 4U3XA 5KVGL 5CUSL 4JUSA 4PJCE 1S3KL 3MNVB 3JWNH 5HJBA 3P0VL 2RB8A 1AGFB 4ISVB 2PKDA 3JWOH 4YNYA 4J23A 2DQUH 3L1EA 5J6GB 4YC2C 2CDEB 3ARUA 2PPAA 2V37A 5B38A 2VDPB 5J3HD 4ZXBB 4WFHD 3D3VA 5FUOH 2GIYA 1GZPB 2O5ZL 3S2CA 4QJ5B 1A1MB 5JUEH 3AY4C 5D5ME 2QPUA 4C58B 4MQSB 2L8AA 2YS4A 4GW5B 4RESB 4YSDA 2OXGB 4O9HH 4OLEA 5CINL 3WV0A 2K4AA 5KBLA 2UVEA 3HG1D 4MDJB 4TRPH 4EVNB 2EH8L 1G7IB 2F53D 1XHHA 2NNAA 4L1LA 3LKRB 3UYRL 3QQ3B 4C4KO 4EZKA 3LDBC 5L4FA 3RL1B 2OXHB 4I2XB 3TIDB 1BIIA 1CPUA 4KPHL 4MNHA 3BP7A 1UD8A 4Q8BA 3NTCH 4J3OF 1MKFA 4OCWH 4AITA 3D69B 5AKTA 1UJTA 4W9EC 4IK7A 4F91B 1TETL 4XGZA 2FECL 3HG1B 3JBG7 4ABUA 2D2CC 2V5YA 3U0TB 4E0RA 5KWYC 4X4XA 3VE0B 1NCIA 2A6KB 3VWJB 3VFMA 4OIFA 5EDXA 5HDLA 3D25A 4FQPA 3KXFD 1HWWA 4YX2L 2WJ7A 1GYWA 1U3JA 1MZYA 2KQMA 4FG6C 5DA4A 5T3XE 4MQTB 3CLEH 1EDQA 1I3UA 4HCIA 2ICWB 2BSSB 3PPEA 1I4FA 1S6NA 1ZVNA 2GITA 1H8OA 4G42B 5AAMA 5AB2A 1IGIL 4ORGA 1WHOA 1EHXA 2E4TA 1T22B 2PYEB 3AW5A 3H3PL 4NRXA 4QRPB 4HWBA 1ZANL 3W0WA 4QHUA 4P04A 2HT3D 2OMZA 4U1MA 4JGNA 2XVGA 4WSKA 4PJXA 1GGUA 1HAUA 3FQRB 1WS7A 4LDEB 1I7ZA 2KKQA 2F74A 4NB7A 4PSPA 5F0PB 4K94L 2XZCL 1N6QL 4A7GA 1ZEAH 4YEFA 3MRGB 4M5TA 4ZOBA 3VGDA 1MFBH 2Y22A 4Q4IA 4XMLH 4ATWA 2NY3C 4U6XB 3VI3A 5KSAC 5A6LA 3CXDH 4OM1H 1T5XB 3K6NA 3PWNB 4OAWB 4OM0L 4LSSL 2AK4E 5IOKA 3WNKA 4I5BB 4BWWA 4GRLC 2E7DA 2X4SB 3QQDA 3V2AR 3LPOA 3I85A 4JVUA 2X4OA 3VYOA 5I19L 3UFIA 2E6JA 5IJDC 3VD0A 4MZRA 1A9EB 3IKKA 4OCXH 1NPNA 4G6JL 4XNQB 3EO0A 2CR3A 4FLHA 3RX9A 1AO7D 2HMID 3VFOB 3C8HA 4KKZA 1XH3A 1VERA 4LFHG 3UG4A 4Y2LA 3MNWA 1XD0A 1U8JB 3QQ9C 4W9DC 1JFQH 2ODIA 2K0RA 3FSWA 4Y2DC 3ARFD 4PGBA 3FN3A 4GUPA 2DWSA 1R75A 4AH2B 2VSMB 5DWUL 3GSRB 3KLKA 2UXVA 3OWEA 3WFZA 2P7TB 3NUKA 4N8CH 5D7LB 1RLWA 4F80A 3MLUH 3CFCH 2DH3A 4H0IA 3VXUD 4G8FB 4F2EA 2G5BA 4BWTA 3SDDC 2NLJA 4OJFL 1PJ9A 2QSCL 4NZ8A 4C59B 3OB0H 4E41B 1DZBA 1E2VA 4RFEA 1MNUH 3INOA 5C92A 5K69A 1U8HB 3ARFB 1DBBL 4PJ8D 4MMYB 4J8RB 3JZYA 4LRIC 2QKIA 1RLBA 3QUYA 1IC1A 4HWNA 1A5FH 5ESQB 5J89A 4IOFC 1I1AB 4FQJH 3L3GA 3DOHA 4P4KD 1EHAA 5KANI 2CO6B 2JK5A 3IDGA 4PJ9C 2X3BA 1OPGH 4BXVA 3VSQA 3AZUA 3GSVA 4XCCL 2WLLB 2NY2B 5GGQL 2FATH 1CFTB 4MNQB 4ZW7A 1JHTB 4GSUA 1XAUA 4B60A 1KLFB 5K9JH 2WANA 1OF2A 4LCUA 2AC0A 4JO2H 1FFPB 2AHIA 1OAZH 5IVXB 3RZWA 5BJTB 4FYTA 2G9KA 3L4VA 4P4KB 4A68A 4CBPA 5IVXF 2R69H 3V4VH 3I6GA 1BQSA 1FNEB 1PCSA 1T5WA 1VJSA 3N04A 2HG5A 3HS0C 4FNSA 2OAAA 2Y06H 2OMXB 4R4NC 2Q7NA 1E9PB 1HHJA 5FW7A 3KPQB 3HJ0A 1M53A 4MYPA 4N8PA 2VQ1A 3AGWA 3II2A 4ZMOA 1FWXA 3ZGHA 5BUPA 3MXVH 1JVKA 3QDGD 4IRSA 4RH4A 5D96C 4BGLA 1XZ0A 5HHNA 5CEZE 1PIGA 3I75B 1A6AB 4Q6IB 5EZOH 4JG9A 5T1KB 3PHAA 3GT6A 3OKMA 4GKSA 2AS5M 5AD0B 2B3IA 3KPSE 3LRHA 1IEBA 5T1MB 1R3IH 3U0WH 4X8JB 1I7TA 3EJUA 2G9HB 4MFHA 3WO3B 5IFHL 4KDTA 3MCKA 3BUYB 1OP9A 4X9IA 3ES6A 1JF1A 4L4VA 3PWUA 4XOEA 4WO4A 3D30A 2AI0H 5GGUB 5EZIH 3TWYA 2X2YA 4DGIL 1T0MA 1E27B 3TN0D 3GMQB 4I3SH 4LNVA 3TBSB 1JHKL 1OGAA 2AQQA 4A7VA 3G5VA 1UACL 3D0VA 4XCNB 1C16B 1WRFA 2KHAA 2XA8H 3GBNH 4XNYH 2H0EA 5KW9H 1XB3A 3JV6A 3MRRA 1QRNE 3FFCE 4LBEA 3F7QA 5KVDH 1YN6A 4JCLA 1YPZE 2HVKA 4XZUB 4Z7WE 3FQ2A 5FUCE 1SQMA 1HZHH 2FH8A 3GLAA 2W59A 4HCFA 4I3RL 4KVNH 5T3ZH 1G1OA 3UBFA 3PQYE 3QUZB 3CZNA 4ZS6C 1UZ8A 4Z3JA 3BPCA 3J07A 4PV9A 3ZZQA 4QYAA 1F41A 3GMRB 3OR6A 5AWNL 3I6LD 3N1PC 1SF5A 3WTSA 3QUHA 5DEGA 2CUAA 1MCRA 3D18B 3TEXA 4LCWA 2SODB 3TFKC 2BVUA 3CFBB 1LQBC 4TV3A 4GKNB 5GISL 4RRPA 4O4YL 1NCGA 1BIIB 1JOIA 3QHZH 5I17B 5C2BH 2V7NB 3MRBA 4MNHB 3CHOA 5GRVK 1CTMA 2VWEC 5DZOA 4DVRL 1GS7A 1JNHB 2DEWX 3DRQA 2NQCA 3PWPA 4BUHA 4NNXB 5DVLA 4ZOCA 2BIQA 2X7LA 1MFEL 1F4AA 2VLRE 4ZUWB 5B39A 1HHGA 5F7DA 4Y4KA 3EYFB 2I60H 5EOCL 4PJHB 3V0DA 4Y9GA 1AZCA 2GG1A 3T8XB 2IF7A 3RYMA 1R1CA 4LEOA 4PJHF 3B9VA 3SBQA 5T1DH 4Z0XA 2XWTB 3HHMA 3AG4B 1M6UA 2ADFH 5F9WC 5E08H 4GBXC 1JN6B 4IYKA 3DX1A 3ARDC 2K6ZA 1I4FB 3NIFB 3S97C 1QBBA 5J11B 4L48A 3NIFF 1A4JA 4PRPD 1SBSH 2LQRA 1FZMA 4WK0B 3LKSA 2CPUA 2QLYA 1JD9A 3U79A 5IMLB 5FYJE 5DS8B 2FB4L 3S35L 1SN0A 4UCFA 5I1GH 4B6ZA 4K23L 1A22B 3Q01A 2YMXL 2HWZL 4NBYB 3VXTB 2AVGA 4P48A 2BIPA 4A7GF 4W9LC 4KXZH 2R2BA 3H56A 2XT1B 4N3UA 1M71A 2P8MA 4HGKC 5BZXA 3VWKC 5CBAA 3S9DB 1N7ML 3GTTA 4NM8H 3GHEL 1TFHA 4U1IA 2XZZA 4XNDA 1ZT1A 1VZIA 3MZTA 1COBA 4YQXH 4MD0B 1U4FA 5IQLA 3MJ9H 1Q9WA 2EXYD 3V0WL 2IQ9L 3D08A 2FRGP 5F9OH 1TJIH 2QFRA 1E40A 4OIIH 1P7KB 4R7DB 3KPNB 4DO5A 3AFLA 1PG7L 1A25A 1XH3B 3DV4A 1FL5B 2GTZA 3HNSH 4QHNB 3VXMB 1QLFA 4EDWL 1QOKA 4WCYL 3BH4A 3BSZL 5ICYA 2ZKHH 2NT0A 4PGJA 3PG2A 1MG2C 2FECI 1E4KC 3IETB 2Y5QA 3A67L 3CFMA 3CN2A 3PRZA 4TNFA 5H8DA 1L3WA 1LDPH 4D9LH 4OLXL 3WI9A 4OGQC 2HFEA 3ZTNL 5ITBH 1XGPA 4AGOA 2YRLA 1B90A 5DUML 3QUKB 1UA6H 2B9AA 4RFOL 4Y1SA 2H2SC 4P2CG 2WZ6A 5I66A 3C09B 3UTSE 2GBAA 1UTDA 1JGUL 4NAJA 4I1NB 5E23A 4JM2C 4FLOA 1GYVA 2IPKB 5JPMC 3P4MB 1GXEA 3Q05A 4L2LA 2HXAA 4DUWA 1S5IL 2IGLA 3EH1A 1AE6L 2C1PB 3BHBB 4HIIB 5LDUA 1A9BA 3L3GB 1C5DA 1J0IA 2R51A 4G6MH 4MD4B 2PR4L 1IAIH 3DYOA 5INDA 2VXTL 5D1ZB 1G7JB 4R90H 3BD5A 1U3HC 2EDKA 4GO6B 5GQBA 3STLB 3OKNB 3KNBA 2VC2H 1ORSA 2J71A 1MDTA 3LS4L 4LCUB 4NP4L 4ADGA 5I6LA 3OJDB 3PUUA 4YHKL 1E6JH 1TQBB 1L9MA 2ITCB 5CJOH 4HWUA 1UEYA 3U6XA 1XGYL 1JL8A 4OLUH 3KYOA 5D2LB 3TBCA 3X3GL 1UXSA 3CSYB 4M1CD 4U1HB 4K9EL 5E5UB 4MKMA 4BH8A 1MH5A 2EP6A 2FT6A 5F44A 1BXXA 3BAIA 3Q7JA 5G4OA 4G82A 4L9DA 5K5YA 4LO9A 1ORQB 1TTCA 1IILE 1Q94A 4LLYA 2J8UA 4N5UA 5DRNA 3E38A 1F1DA 2QVMA 4TVUA 2RCSH 5E6YA 3H9SD 1UD4A 3GB7A 2VO8A 5D1XC 5F1NB 3EYSH 4GXFA 4R84A 4E68A 2OSYA 3HE7D 2ZQKA 1QBAA 2BC4A 1XF1A 1DBJH 1AD9B 4GSDH 4J3OC 2EEDA 3X12A 3OF6D 1A7QL 1FI8C 2X87A 3ES6B 3FTGA 1FVDB 3GFUA 2XTJD 3L5JA 2PYFA 4JDEA 3CSFA 2VE6B 4IDLA 1TTUA 2CE6A 2ZSVB 2VR9A 1ZHKA 3HE7B 3TBTB 3BWAB 2GSIA 3P11H 1WISA 3EYQD 5FB8A 5JOPE 3BESR 4EUPB 4NERA 3NIDE 3S36X 3TBVA 4GIAA 5J56B 4P2RA 2XQYG 3JV6B 2CHZA 2YKLL 1PX4A 4XR8C 5L0QC 1SLWA 1T2QL 2Y2WA 3LZOA 4FQCH 5KSUB 4LQ1A 2I69A 4D0BA 1AR1B 4RDBA 4FGMA 1SMAA 4LFHD 4IK6A 2BDNH 5MEOB 3NABL 5GZNA 2EDYA 1J11A 4UAHA 5C97A 1FORH 2QSQA 3Q1SL 2QQNH 4HEPG 3U36A 2KL6A 1XL6A 4N9GA 1J9TA 4G9FD 1MUJA 1HKLH 5TK4A 2JLLA 1LEIB 2NDFA 3H9ZA 4LCWB 5LGHL 4JREB 4HLJA 4TXVB 3F00A 3RTQA 3KGTA 3BVUA 3TA3A 3NK4A 4BD4A 2YD1A 2XX1A 3SE9L 5BO0D 2E7HA 1IFHH 2CDFA 4G9FB 4TLKA 4K73A 5I15H 1A6UH 5GGTL 1NUGA 3BYYA 4ICXA 5D7SH 2NY0B 4KRPD 4F8QA 3UZEA 4XE5B 1P4IH 3ZL4H 3SGDI 1DP0A 5AW5B 4R7VA 3NCEB 3PAUA 2AQNA 3KVPA 1FO0A 1Z9SA 4RGOH 3WEMA 4DKTA 5ACMA 3CVHB 1IGCH 3ZSSA 3L81A 5MEPB 3DARA 3NPSB 1E43A 2JJSC 1I7RA 1E5BA 5C6PB 1EBAA 3E1F1 1YC8A 1E67A 1P84J 1D9KB 4R4BB 3DTDA 2HZHA 5HI5D 3VXRB 3PDGA 1V3JA 5IQ7L 1YY8B 3HAEH 3QWQB 2EVIA 3Q9QA 2CO2A 2ZXDA 1QSFA 1QKZH 5HDBB 2YIHA 4YHPA 2IFGA 3MTRA 5EU7E 3DRTA 4J3SA 3D05A 2BS8A 3MV9E 4ZG1A 3BAXA 5DUPL 3GBMH 4OFYA 3BVVA 1I1YA 5DJCA 5TQ0L 3V95A 1XXDC 4FFYA 3BZEB 3OTTA 4GAGL 3VRJB 5FA4B 2ZXBA 5FYKH 3KGRA 3F7VA 1FC1A 1CVSC 3LZFL 2XV2A 1V27A 1MVFA 1BZ7B 4EDXB 1U2YA 2YPVL 3R0NA 4KKLC 3RL2B 1JXKA 3U9PH 2V2TA 2LR4A 4TVSa 5HHQA 4DW2H 4NN6B 1HILB 1AG0A 3QUMB 5DHVH 1I1AC 2OMYB 4AYSA 2CH8A 2AEQH 1L5GA 4UBDD 3QB7C 1NLDH 2CSPA 4HCGA 1R5WB 2NSXA 2YEZB 2EDLA 1JUFA 2NY7H 3H4HA 5D7IB 1SYSA 3LY6A 2NDGA 4MJIB 2NY2C 1YSOA 4JUTA 2K3TA 3RILA 4UQBA 5D7IF 2Z7UA 5I8KL 4NUJB 1IKNC 5LCVA 1SY6H 2FLRT 32C2A 2WKLA 3QJRB 5ADOL 1HH6B 1MQKH 3O3EA 2I07A 1NA8A 1C7TA 3OJMB 3OPZH 5EG6C 3V7MA 3FTVA 5TF1L 1CLZL 2NZ1A 2YAFA 1AHWA 2WWMD 5EIIA 5EO1B 4LEEA 2CLRA 4X0NA 4ZX5A 3TO2B 2BMKB 2P5WB 5GS1C 4NHUA 2IANA 5I66B 3JZ7A 1TO5A 2GJZB 3N85L 3MRFA 4Q6IC 4BK5C 4Z95H 4J1UB 3KYMB 2Y7SA 3DX6A 1S7SB 1ZE3C 1JZJA 2E74C 5IW1A 4K5NA 2DQJH 3K74B 2C34A 4V2BA 5TPWH 3QJZA 4IIQC 5CIPH 3O6ML 1A9BB 4YPGB 3RNKB 2OYMA 4IBYA 3T2OA 5CCJA 1ZK9A 2XXCB 4KKAC 5C71A 1CYGA 3U6RA 1HESA 2Y0SA 5H2BA 1NBYB 1Z66A 3UL4A 2B15A 3O6KH 5DQDH 3C9NA 1OAKH 1OE2A 4PJFE 1C1EH 2DQGH 3MV7B 4GQPH 1I8LC 3QWOB 4XO3A 1L7TH 4WEBL 3FHAA 4F2MA 3RHWK 2YAOA 3SY0B 5FFGA 1OCWH 1O9WA 1DVZA 2VW6A 1U8IB 4PW4A 4JDZA 4Y5YA 2QGEA 2HSIA 3F84A 4A39A 3L95B 5LGYA 2MCG1 1SQ2N 3KM1A 5FGSA 4NM4H 3HEIB 3US1A 3MRKB 1F8TH 4L4TA 5J6SA 3VQLA 1AXTL 4G8GA 5T3XD 4XI5D 2J8UB 3KW7A 2PLTA 3G6JB 2X4RA 1HCZA 3PGDB 1UT2A 2J8UF 2G5RA 4APQD 5E8NA 2MSPA 1WZKA 3QG7H 3O2DH 5CR1A 4U1LA 1KNOA 3O9WA 4WNJA 1YNTA 4GSQA 4LOUC 3D52A 5LXVA 3BCDA 3MKKA 2IDQA 2WP3O 4NAQA 3CZGA 2D3VA 1IUZA 1ZWIA 4X98A 3FU5A 3T2QA 5GS0D 4I0KA 1D6VH 2NNCA 1EHLL 5JZ7C 1NQBA 3HI1A 1CD0A 5C0DA 3SE4A 4AM0Q 5AL8A 5KS9A 2BNQA 1OOAA 4I9WE 3OZ9L 3NIGB 3ZE0E 1EJFA 4E5XB 4E36A 3UTQB 3VGGA 5IHHA 3LNEA 2ZG3A 1LE9A 1GPOH 4M4RB 1M7DA 4OI7A 1L6XA 4YHNA 1XB8A 3FOLA 4LKCB 2YQBA 4AYFA 4HIQA 2AK4D 4AW4A 4M5YL 2D4DA 1O5PA 4LCCB 3LD8B 4P8QA 5KN5A 1ZRUA 3VFTB 5M94B 5DI8A 1EEZB 4KAQH 5CM1A 2BRRL 3ATBA 1J0YA 1NOLA 3DX3A 1O9ZA 3SD5A 3ARRA 2QR0B 1V7NL 4NJ9H 2HKHL 5AVVB 4HIXL 5LWYH 1ZTXE 2GK0A 4BSVA 2R1YA 4JFYB 4UDTB 1U92A 2DQHH 4BQCA 3SDYH 3TA3B 4OTXL 4X5WA 4ANXA 4ZNEA 3FRPA 3EG9A 2CR0A 3ULUF 1QNZL 5HVWA 1FFQA 2FQFA 2ERJB 2YD0A 1S7VB 2R1XB 3R8BB 2DI7A 1E28A 3DK2A 4Z0BH 4IU3B 2XWXA 4HS3B 3QEHB 2E59A 1H5BB 5JXAL 2WXFA 3BXNB 4N6QA 4G8EA 1FO0B 5DHEA 3Q8CA 1LK3H 4A1RA 1FVEB 2VXSH 2W80C 2GIMA 4CSSA 3WKYA 2CDGA 5IVZA 2C1OA 2M1KA 2F8VA 1OIOA 2AXGA 2ZXWB 1X6NA 1HNFA 4D7PA 4MDRA 2XWJA 4H13C 3M7OA 1EH9A 1TYRA 4ALAL 2IAMA 3AU1A 1S78D 5E1HB 3Q9PA 5SWZA 3U7YL 2HKAA 5DJCB 1Q72H 4R6UA 4DP1X 4XVTL 15C8L 3RVTC 2C9QA 1QLEB 3MRQA 3VYNA 3GSQA 3V6OE 4TNGA 3OZLA 1B2WL 4R2GB 3QEGH 4AEIH 2VNCA 1BD2E 5GZOD 4LPVA 3FUDA 5D9SB 5T1LA 4YSQA 1GAFL 1W80A 3ZZ1A 4TTDC 4P5TA 4BKLA 1UADC 7FABH 3BKJL 1G4MA 2WZ0A 4RDQF 3WXVH 5BUGA 1F97A 2F7OA 2QKIC 4JE0A 4MCNA 3QUYC 5CEZD 1X3DA 3SDXE 4A6YH 5IHUL 4P5MB 4XB8A 2W94A 4XNZB 1G9HA 1DVYA 1EX0A 1T7XA 3FQUA 3KPSD 4XPTL 4L3CA 3DGDA 4ODSL 3SKJH 3QJHA 5LDSA 1TZAA 4RGNE 2HYMA 3CMOH 4POZD 5TE4L 3V4PH 1EFQA 1AQHA 2JKIS 2NNFA 4GAJL 1TVHA 3FUEA 3FSZA 5C0CE 1OHQA 1LO3H 1RFDL 3VH8B 2XVLA 3QYCA 4JKMA 3GJFK 1KIRA 2O30A 1G5GA 2WUBL 3NSFA 32C2B 4UB0H 3RWDB 3ZE1E 4JHWL 4KTDH 5HI4C 4DHLA 2B1AL 2I07B 5IB5B 3LVTA 3QZOA 3TH3T 1G9NH 3S98A 2Q87A 3AVEA 4PJAE 4LXFA 3FFDB 5HYSB 2WKGA 5EIIB 5CBEA 1QRND 1TQCB 5AW4B 4CW1A 2L7UA 1KGIA 2WUCL 4IRSC 4JRFA 4LAJH 3BCFA 2ARJA 5JORA 5HPMA 3O3DA 1FL3B 2JWYA 4OLWH 1OAJA 2DM3A 2H1PH 4D9QE 3DURB 1ZLSH 1U95B 3LHPL 5BS0A 1QTYT 2IGFH 3MGOB 1BAFH 1EAPB 3U1PA 1UWEL 2VUKA 2ZAGA 1BQRA 4WJG3 4PJGE 3U1QA 4NBZB 3WKML 4Z7NF 4Y7OC 2R69A 5IM7B 3V4VA 3EYUL 3H8NA 3TZVA 3U6RB 2R4RH 4KDTC 3R4DA 9PCYA 5HI3C 1Y6NR 4PYGA 4TTGA 3CGTA 3RIKA 4EQ3A 1LQSR 1JS4A 2BVEA 4G1MB 2YD2A 3SODB 4QTIH 5DA0B 3Q8EA 4PM1A 1TO4A 3HZVB 3HR6A 1GTNA 3F58H 2VLRD 3X14A 3RWJA 2FVNA 3IDXH 1TCMA 1KN2L 4R8WL 4U0QB 3G6DH 3ARBB 3QRGL 43C9B 2Y7MA 4ONGL 4NN5C 2AKRB 1SXBA 3P1VA 4IDJH 3QIWA 3O2VH 3LXCA 4KZDL 2ATKA 4XP4H 1HEZA 4HUUA 3RWFA 2WSDA 3IFOA 3O9WB 3GINA 3QDHA 1MI5B 3JWDH 5ISZE 3E3QE 3ILQD 1BV8A 4Z7UE 5I5JA 1PQZA 4OZGE 4ABWA 4AYBA 3IYLW 3MRDB 5FYJD 3HI1B 5CWSB 3FAWA 5AUMA 4JFEB 1U58A 3T4YA 3IAGC 1PLAA 2DS4A 2BSED 5B1JA 4GXUN 5DCCA 4LCVA 1I3RB 3JV0A 2NY0C 2X4PB 4Y19E 5C9JB 1KY6A 1UH3A 2APWA 2WLJA 1EPFA 3ABKB 2B9BA 1DCLA 5F70A 3T0EE 2F54A 1DQVA 5JXED 1FJ1B 1HHKA 5FCUH 1UA7A 3K2UH 4GT7A 2G2RB 4HZ1A 1ZLUK 4EMZA 2GAZA 1RZPA 2IIJA 1Z9LA 3NPSC 1M7XA 1S7WB 4Y5XA 4PRBA 1Q0YH 4EBQL 2OMUA 5D6CA 3WEOA 3I9AA 1D2PA 1I8IA 4ABQA 5CHNB 1D9KC 3G6AA 1JRHH 3RWIB 5C70A 1UYWL 4HWZB 1E6OH 1SVCP 5DI8B 4XPFL 2KZKA 5IW6B 2ZCKH 3GJFA 2EDMA 1S9VB 1J1OL 2PXYD 2XOTA 5EDSA 1CGUA 5EF2A 2GFBA 5DJYA 3T65B 4V1DA 4F1SA 1RZFH 5D7HA 1X5JA 4E9WA 2VDRL 4K0OA 3I2CL 4OLVL 4OCLC 5JO5A 4JJOA 1IJNA 1JWUA 3ISRA 4XPBL 3BDXA 3E9TA 3QK0A 4MYWB 3OR7B 5DS1A 3SYCA 2YLHA 1D7BA 4H40A 1NPJA 3EXLA 1J5DA 5E8EA 4JHVA 1T04A 3VFGL 5BZDA 3WNLA 3TJHC 4OF3A 3KGUA 3GMLB 3ULVF 1DVQA 4XCYA 2CLZB 4HIEB 4OLYH 4CJ1A 2F19L 3AGVA 3UTSD 2AAVA 1NBVH 4WTXA 2UX7A 2AEOA 1E30A 4G8EB 3SQBB 1BBJB 4KKCC 5KSBE 1AP2A 1WPCA 3POHA 3BLBA 3TH4T 1OP4A