1DQLL

Crystal structure of an unliganded (native) fv from a human igm anti-peptide antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKKLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQQNSNWTFGQGTKVDIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGM MEZ IMMUNOGLOBULIN
publication title An unusual human IgM antibody with a protruding HCDR3 and high avidity for its peptide ligands.
pubmed doi rcsb
molecule tags Immune system
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqlL00
1FRGL 1S8DA 1A6UH 5DHYA 4QWWD 4WO4A 3QEHA 3GRWA 4ODWB 4KROD 4LPUA 2X89A 3DXAE 3MLRH 1NSNH 3ELAT 4HJ0C 3RWHB 3SDDD 3WUWB 4Z7VE 1KOAA 1T21B 3BIKB 4R8WL 5K9JL 4WEUD 3RVUC 5FA4B 3BQUD 1UKQA 1I8LA 3O6LL 2KPNA 1JPTH 2VDNH 3D9AH 3O8XC 1JPST 3NABH 3KWWA 4K94C 4PJ8B 4AMKL 1S5HB 4JY5L 4Q9BA 4TULL 3T3PF 1B0WA 4TRPL 3D0LB 5IMLA 5I1AB 3HZKA 3LV3A 1KG0A 4QRQA 4P2OB 5I30H 4RMUA 1UM5H 4NO2A 3F5WA 2JIXA 4HBCH 3MLVH 1RIHL 4RMSA 2EIZA 3UTTA 2JJTC 4PGCB 5I8KL 1IKFH 3MMEB 2H41A 1NEZA 1VCAA 1UG9A 1YDPA 3UTPE 3QIUC 4MNQD 5EN2A 5C0BB 5L8LB 4XGZB 2EKJA 5FO8B 4WO4D 5DJ2A 3WYRA 5BV7C 3RUGA 2X89D 2VLJE 3P4MB 5FXCH 5AUMA 3S96B 1FO0A 3B4NA 5D1XC 1BREA 2EO1A 2EXYC 3KYMB 3ULVL 1TCMA 2LABA 3V52H 5D7SL 1UZ8A 3B6SB 3DROA 5E5MB 2G9HB 5F96L 2NPLX 4GMTH 1QQDA 1XGTB 1FAIH 1HHJA 2NY0B 3U79A 1HI6B 1UACL 4GW4A 4YUEH 2F5AL 3MUHL 3D3VB 2JIXD 2H8PA 4NCC2 1HQRB 3UTTD 4XVUD 1S9KC 1F4XH 4NC1E 1FNEA 3QBTB 4KXZH 4XBGA 4F7TA 5BW7A 3FN0H 4WUUB 1KJ2A 3DETC 4BZ1H 2P24A 1JJUA 2AEQH 3AREB 1MRDH 5T3ZD 2D7OA 4Z78A 3W81A 5IWLA 4ZODA 1KUMA 3J8F7 4N8CL 1M7IA 4P2YA 3H2WA 2C5DC 2A9ML 4DUWA 2PO6C 2JJWA 3FOLA 3SDYH 5TQ0H 5TFSL 4MSWA 5KW9L 1AXSB 1RZJL 4WV1A 3BEWA 1X5ZA 3HE6D 3O3UN 3AMKA 5DTFB 3P0GB 2NY7L 3MRJB 25C8H 1XGRB 2CJUL 1BFOB 2BSRA 4U1KA 1AHWB 1LO3L 1SYVA 5E94A 2O93L 4QOKB 4X9FA 5DRWA 1CL7L 3BISA 1KYOJ 4HH9B 3FO0L 5DVLA 2W9DH 1H3PL 1EHLH 2NR6D 1F8TL 1MCPH 4PJIA 2GIYA 1J12A 4S1SH 1C08A 1AD9B 5FEBA 2GT9A 4JAMA 4HWBH 4Q6IB 3NH7L 2G75B 1X44A 2YS4A 1WT5C 3S34L 2WNGA 1HXMB 1TJIH 3FQTB 1KSRA 5D1ZA 1IEAB 2B1HL 4BFEA 5H94A 1G0XA 4O2FA 3CFKA 1TITA 3LMJL 5EDXA 3L7FA 4JJ5A 4P9MH 2F54E 5J57B 3UROR 4MWFA 2VXVH 3EDDA 4EDXA 2DKSA 4NUJB 4X7FC 3CU1A 3F7YB 5D7JC 3VXRB 3TO2A 5FUZH 3O9WC 4PJDE 3FO2A 1IGMH 3IT8D 4GLRH 1D6VL 3BHBB 4GUPB 4HWZA 1GAFH 4CVZA 5SV4A 2ITCB 4BM7A 1IC5L 3BYTA 3E6HB 1IZKA 1TQBC 2GEEA 5T3ZH 3KHQA 4OI9A 1YNKL 2KKQA 3ZO0A 1CR9H 3R0MA 4ISVB 3TO4A 2IQ9L 3FB8A 1CE6A 5J13C 3OKEB 5EORL 1O5DT 1JZ6A 2ADIA 5IR1B 1T5WA 4ZUSB 4XI5D 4D8PA 4M3KB 4XXCC 1Q1JL 5I1KH 1IQDA 2VR4A 3JTSA 4YR6A 3S98A 1S7SB 4PJEA 5D1ZD 4R7NA 2AW2A 1AGDB 4L8SC 3VXNB 1J5OL 4H25A 5I1CH 1S9XB 4ERSH 4X6CB 3GSWB 4NN5C 1U8LB 4NCDA 1G7LB 4CMHC 3IKKA 4CNIB 3G6DH 3BPNB 1GRWA 4R7DA 2VAAA 4Z7QF 2DJUA 5ANMB 2OTUA 2W92A 5DEFB 1CGXA 4ZO9A 1IM9B 1UADC 3SBWC 2Q76A 2YK1H 4KRPB 4UQ3B 3MRMA 1JK8B 1YNTB 2ESVB 5CIPA 3ARFA 2DQCH 2E9JA 1KLFA 5MI0C 1QFWL 2FZ3B 4O02L 3GMRB 4MX7A 4FFWD 3FT4B 1BECA 4PJHE 4Z7VF 1MFCL 3P73A 4A6YA 3D0VB 3DGGB 4GXUN 5FGBC 5GGQL 1KEML 2AEPL 1U3HA 5J9PB 1GZPA 2X9WA 1PVHA 1WCBB 4L1HA 5H37G 3VWKB 2QL1A 4A2MA 4PB0H 1R5WB 1VHPA 4KMTL 4MAYC 5E2TL 1BAFH 1LK3L 1YJDH 4JZJC 4RMRA 4RGOL 4FFYL 3QUYC 3KJ6L 1X4ZA 4KY1L 1LWRA 5ICZA 2QQKH 3WUZA 1C12A 4O51A 5EBWB 1WCQA 2VL5B 3RBGA 1RZIB 4QRSB 1ZKAA 5EIQA 2XN9A 2WP3O 4UU9B 3NACL 1T7VA 1MIML 1N59A 3MRLA 4LARH 4MB4A 5CLTA 4GG6B 2VRAA 4JCLA 1UEMA 2E8YA 1JZ3A 1LO2L 2BFVH 4KUZL 3V4VH 1DANT 2XZCH 1VFAB 5ALCL 3H42H 4JQIH 1J7VR 4MXWL 3WO3B 2YRLA 1LP9A 3UPRB 1CD0A 3ARFD 1I7RB 3O3BA 5C0AA 3V5HA 3VXTA 1H15A 4YXKH 1I1AC 1JZ8A 5I71B 2V17L 4YNYA 4IBLT 5CEZD 4CVXB 2DLGA 1FLRH 2IBZX 3NPZB 5C0RL 3BP7B 1U3HD 4JDTH 1HHKB 4LSVL 4KZEH 3RHWF 4M6NH 4XNQA 4DKFL 3O8XA 3GSNL 1CICB 2GAZB 4X98A 2OK0L 1QBAA 4WI7A 2UYLA 4JFQA 3P4NB 4X6FB 3W9DA 4X7TB 4ODXA 1ZHKA 3FFCA 1BJMA 3MOAL 2JJTA 1MJ7H 5KVDH 4MA1B 2XN9D 1DBKL 4OZFG 1EO8H 3BRGC 3B9KD 4D9RE 3O11A 5L6YH 1VSCA 1IAIL 2HTLC 3QIWA 1NBZA 3QIUA 1XGUA 2EECA 4NJ9H 4YQXH 2ITDA 4B53A 5DJAB 5EU3A 3K7UA 1MELA 1MUJB 1VFBB 2X4UB 4GAYB 4DTGL 1J9CT 5HHXL 3ZKNC 3G5XB 2HYMA 3VXQB 2ICEA 5JW4Q 5D1XA 5E5RB 4E42B 3OHXB 4M7JL 1YEJH 3NIDE 4HJ0D 1OLZA 1DLFH 5E8EA 1BBDH 1EGJH 4HUNB 4I2XA 1KB5B 1E4KC 5TE4H 3RVUD 4C59B 1KFAL 1DQDH 4ZPVA 4M43L 1OP3H 2GCYA 2A77H 3O81A 3O8XD 2H45A 5DSCB 4UUJA 1IL1B 3UZVB 1CF8L 2RR3A 2C4FU 4LDEB 1ZEAH 4HBQA 4N0YL 1OF2B 3FO9B 4OLWL 3UBXG 3VCLB 5K9OB 4OLYL 1NDMB 3FFCD 3LEYH 4EJ1C 4XMLH 4RFOH 4HH8A 1ZHBB 3FT3B 1RU9L 3SCMC 3LRSA 1FL3B 3OGCA 2FX7H 5E6ZA 5KZCB 3TCLA 3S3SA 3QIUD 4F3FA 5C0CB 3K2UL 1CL7I 4GSDL 1BHGA 3JV0A 2QKIA 4Y5VB 5IKCA 4OTXL 1CDCA 5HPOA 4NO5A 3IF1A 1AH1A 2HLAB 1CDYA 3M17A 3V9FA 1PQZA 1G9MC 1NC4A 1LNUA 5D1XD 3VGEA 1XH3B 5AZEL 2WUCL 5L8JB 3MACL 4PJDF 1FSKB 4D0CA 1LVEA 1LEIA 1Q9LB 2YPVL 4KVCL 5IQ7L 1F11B 4PRIE 1U3YA 1IAIM 3SY0B 5HGGS 5KJRL 4QRUB 1NBQA 4N0CC 1RUKH 4FQPA 5HDQL 1D5ZB 5MEQA 2PW2A 4K23L 5CJOH 3A0OA 1E27A 4LMQI 4ZFOA 3RWJB 4F7CB 3DETD 2IH3A 1A6TB 1V3KA 4L3CA 1R3LA 2QSCH 4UAOB 1PGRB 1WT5A 4RFEA 3B2VL 5D2NE 2PN5A 3Q6FB 1H5BB 1E4WL 3LKPA 2PO6D 4NO0B 1MCQA 3ALWA 5I1IH 3U30B 5GS0L 1NC4D 3BZEA 1X6NA 1VGKA 5IK3B 4LIQH 3MV9B 1GJIA 4BZ2H 5FK9A 3O9WA 1TZIB 3MRHB 4OLXL 4EN3C 1H0DA 4KQ4H 3JWOL 5HYQB 5GJSL 1JPSL 2E9WA 3QUZC 2O26U 3C2AL 3MBEB 3S5LA 2X6MA 5IM7A 3IXAB 4Z7VA 2Z8RA 3CFEB 1W0YT 4IS6A 3VG0L 3CMOL 4PJHF 4YHMH 4CN1A 3MQIA 3O6FB 5HD8C 4N5UA 3MRFB 5DUPH 5EIIB 4G6JL 5BV7H 2E9IA 4LSDA 3EYFA 5TDOB 2IG2L 3QJFA 5FCSH 4XXCA 4OM0H 2D03L 3HLAA 1I7ZB 4G8IA 2FR4A 3QAZB 3MJ9A 4QHKI 1PG7L 4D2NA 1QFWI 4P4RA 4MMXC 5DJ8B 1LDPL 4JO3L 4ETQB 4L8SA 4MZ3A 5EU7C 3SEPA 3CVIH 3CFBA 1KN4H 2EDXA 2EE9A 2APBA 1WFOA 3S88H 4YHNB 2UY7A 4HK0B 1A9EA 3ME0A 5D7JD 5DWUH 4JQVC 2WUBH 3VXMA 5F72S 3O9WD 3W0WD 1IGIL 4HJJL 3TBVB 4KK5C 3P77A 1F2QA 1I85C 2BNQB 5T1LD 5I15H 4QXTB 3ZLQC 3DXAB 1XGYL 4J3WA 1BQHB 4GG8B 4WW2C 3VGHA 3ZSSA 4G3YH 1N5AA 1A3LH 5FGBA 2X1XR 3VJ6A 1PJ9A 4Z7UE 2M1KA 1KTLB 5FCUH 5BZDB 4K8RC 1N8ZB 1R24B 1WAAA 4JFDD 4NDMB 2ZCKL 4MAYA 1E0OB 2UY6A 5GRYA 5TH2A 1D9KD 3OL2A 3QUYA 4XNXL 3B5TA 4Q9RH 3CX5J 1YNLL 5TDNA 4W4OC 1NFIB 1XIWC 4JE4B 4PREA 4WHCA 4PV9B 2OTPA 3QXDB 3UXFA 1S9YB 1BGXL 4YHLL 1N64H 2MQ0A 1GHFH 4K3EH 1IFHL 2CSPA 1W8NA 3P4OB 5DMIH 2ZUTA 4FZ8L 3VXMD 4ODHL 4MNGB 5IHZA 4CBPA 4NN6C 3LH2H 4OLVH 3ZDZE 1J1XL 1P2CB 1QKZH 2E7LC 1C5BH 2FB4H 3OKLB 1J86A 1PLGH 3O6MH 3P3YA 1I1RA 1EPFA 4K7PL 3GMMA 2VLJB 1WWCA 3QYCA 4OF0A 5K59E 3NIDF 2Q87A 2BJML 3Q1SL 5H35B 3ALPA 4NKMA 1CLZH 3PIQA 1CGSH 1I1YB 4ZQKA 1KJMA 4Y4FC 3SKMA 1CBVL 1D6EA 2P8PA 1FFOA 2DQHL 2JLLA 3SKOB 1FGVH 1R3JB 3EW3B 4MNHA 1A21A 2AJVL 4WFED 2I9TB 2PR4L 5EC1A 2AV7A 4XCFL 3WHXA 2RGSA 4XNMB 3RAJH 2COQA 1T6WA 5SWZD 2XTJD 2R29L 3I2CL 3BRFA 4P2CG 3IFOB 1RI8A 1CLOL 3FJTA 1PG7W 3UTSD 2RFXB 3PDOB 3S8WA 1FIEA 3P0YL 4F2MA 3GK8H 1M05A 4PRHA 5A16B 2R1YB 3HN3A 4XCCH 4AIOA 1N6QL 4EUPA 2FATH 4PBVC 4PG2C 4Y4KB 2E27H 3PWUB 1I8KB 4OD1L 2F54A 3QDAA 3OPZL 4PRPA 1SJHA 2C3VB 3C87A 5CMAB 1YQ2A 3VFSB 3RVTC 4JFPA 2X4NA 1F6FB 3W39B 5E1HB 3QH3B 1LK2B 1P84K 4XB8A 3TNMA 1J1OH 2OSLB 1I1AD 2ZUQB 1ND0B 1HSBB 3CC5A 4OV6F 3IDYC 2CO7B 1E4KA 5FUCE 3GJEA 1JHKH 2X4PB 2E8ZA 2AK4D 3F7VA 4PJFA 3RWDA 3OZ9H 4OM1L 4WVRA 1OB1B 1F2XK 1Q0YH 2DWDA 4F9LC 1K3ZA 4OCWL 4JPWL 1RK1A 1V7ML 5FHBH 5ESVA 3U0WH 2ZCLL 1NCDH 4PRHD 3SCMA 5EOTB 1INDH 2HTLD 5AD0B 1L7TH 3ZSTA 5J7CC 3STLA 2YUXA 4PRPD 4WDIA 5GGVH 3HPJB 2NXYB 4S1DC 1NMBL 3ZKND 2ORBL 3ARGC 2MKWA 3KYOB 4RGNE 1ITCA 3MLUL 3V0VB 3EKCA 3ULVC 3DSFL 3CFJA 4PJDB 1G7IA 3SKJL 2EYSB 1GPOL 2EDQA 1NC2B 1I3GH 1ZVYA 3OKDB 3LSOA 5JHDA 3VGAC 5L8KB 2EDDA 5JUEH 2HVKB 1FCGA 1BOYA 3LEVH 3QEQA 4GOSA 3RPIA 1OSZA 5CD3A 5JORA 2VDLL 2FWOB 5DZLA 3ARDC 1A9BA 4CMMA 3SO3B 1T7WA 1FVEA 2F5BL 3B9DA 1Z9MA 3TVMD 1A5FH 4Q7DA 5GSRA 4CL7A 3SCMD 1ZE3C 3HS0A 2NW3A 3MODH 3E3QC 1VDGA 5T1KD 3CXHK 2G5BB 1T4KA 4BUHA 2EICA 1HHIB 5GGUA 1R3HA 4PG9B 4AG4H 4H20L 1WBXB 4RIRA 1XGPB 1BQSA 1R5IB 2XKNA 3NCEB 5C2BH 3TNNA 3EO9L 5E2JA 4P0DA 1JCKA 4YJZL 1CU4H 4TSBL 4OIIL 4OV5B 1I9JH 1H3VA 5E9DE 1J0ZA 1HILA 4GBXC 1IC7H 4GRLC 4J1UA 1R0AL 5HGDA 3FT2A 2NW2B 5I6XC 5JHDD 2CR6A 4EXPX 4TUJA 5SWSB 3QEQD 2R56L 5I16A 4N0CD 2L4OA 4Y8AA 4FQXC 1FNSH 4Z7UF 4PJHB 1IAMA 5F1NB 1NCBL 1W0VB 1L0YA 5A2IH 4S1RH 5FO7B 3Q5OA 2FYYA 1ES0A 3O3EA 1IAKA 1CK0H 4N1CA 4KH2A 3U9UB 4TSCH 1JVKA 4ZYKA 3A6CH 4DK3A 5E08L 3KYKL 3GBML 4LPWA 5GRZA 1QR1B 3PWJA 1YEEH 1K9TA 3NPSB 4OGZA 3QZWB 4HT1L 2A83A 2C3WA 3QDJE 5GRWA 4HK3N 5IEKA 3T8XB 4M6OH 5E6IA 1DEEB 3HMXA 5DJ0A 3DX8A 2W65B 5EBLA 4OLUL 3FTGA 2FSEA 5HHOE 3ZDZF 4EN3D 1P7QB 1KJ3H 2R2BA 5I1LA 3H3BC 2X9XA 5E4EC 3QUZD 3MUZ1 4OSUL 4ZSOA 1S5IL 2BDNH 3FONB 3L3HA 4HC1A 1XF1A 5D70H 5K59F 5L0QC 4WW2A 3DOSA 5HD8D 4RNRA 4X5WA 4KHXH 3O4LA 4LSTH 4DW2L 4HKZA 4EQ2A 4WU7A 3MCLH 3DRTA 3BPOB 4NWTH 4QRRE 1ZSDB 4GFTB 4DFHA 3W11C 3MUJA 1MCNA 3QO1B 5K9QI 5I66B 4E41B 4PJBA 3L3KB 2OMBA 4IRSB 5KN5A 3EDFA 1XIWA 2YXMA 1JF1B 2J4WH 1DANU 4G43B 1D5IL 2I9LB 5C08D 1AR1C 5B39B 3O45A 4ALAL 3RWFB 4PJ5A 1AC0A 4P59L 2NLJB 2IANE 1T22B 1YPZA 2RIKA 4JN2B 4DCQB 1IC1A 5JIKA 4GQPH 4EI5C 3LKSA 3ULUE 3OMZA 4JM4L 2EKSA 5DJDB 1KCSH 4TOYH 4KK5D 1QA9B 5BCAA 2E7LA 2E6JA 4N68A 1RZGB 1INEL 1U8IA 3V6BR 4F8QA 4CADA 3UTOA 5CEXA 4UDTB 1RJZA 1UYWL 5LCVL 3TBYB 5GS2D 5E03A 5EU5B 4PRIA 3DUSA 1EDQA 5FF6A 3OKYA 3VFRB 4K8RD 5F7DB 5I1DA 4JFYB 1KIPB 4XP5H 5D2LA 3SGKC 5IHBA 3WIIL 4LIQE 4RBPK 3CX2A 3MJGX 2NYYC 1YMHB 2LAGB 1NCAL 3NIFE 2P8LA 3KPQA 4G6FD 1F6AB 2VLRA 1BF2A 1TCRB 1AXTH 5D93C 2CUMA 1XIWD 3RNKB 5IB2B 1JTPA 2H26B 2V5TA 3CDFA 5DHVH 2HAZA 5E1AA 4O2EA 1KT2B 3DX9A 1KLGA 2ARJA 4PJ5D 4OF5A 3HI5L 3L9RB 1Y6MR 2R39A 3IVKA 1FE8L 5KAQF 5EU6A 1GGTA 5F1KC 4R90H 2A0LC 5IT2L 1EK3A 3NFNB 2DQFB 4JM2D 2WINB 5E0QA 1A7BA 3STBA 3IDUA 5ACLA 3WKNA 3MGAA 4BFBD 3OAUH 3U6RB 3TIEB 1TVBA 1UKTA 3TH4T 2J7LA 4Y4FD 4NYLB 3QEUB 5C0IA 5F3BA 1F13A 4P2RE 2VISA 4RX4A 3U0TB 1TDQA 2QQLL 4F9LA 4XPAH 5T1DL 3B83A 1WIUA 1A6ZA 5KBNC 1CLYH 1KYOK 1MRFL 1OAKL 4WCYH 4M8QB 4XRCB 3OGOE 3LB6C 5D1QB 5DQDL 4LKXB 2FH6A 4M3JA 1CD1A 4OZGA 1K4CB 1AKJD 5GS2H 3VFMB 4V1DD 1RFDH 2BSED 2DQJH 3LPGA 3T0VA 2ZG2A 4U7MA 4WEMB 4WY7L 3KLDA 2EEDA 1S9WA 1N5YL 5D2NB 3MR9B 4ZFFA 5EOQH 3RVTD 1U8MA 3ARGA 1IGYB 1SYSA 1JWMB 1T1ZB 3G08A 3RL2B 4MQSB 8FABA 2DQEL 1ERNA 2O5XH 4LCWB 2O5ZH 5I18H 4OCNC 4LHUB 4KPHL 3CAFA 2XQBH 3DURA 1MFNA 1KELL 3IDGA 4WHTB 1K2DB 1MFAH 3GMNA 5CEYB 5LXGL 4O4YH 4XWGH 4RX4D 2VN7A 5CWSB 5IP4A 4NO3B 2X4SB 3PHOA 2R4RL 1TIUA 4BQ6A 1PG7X 1ACYH 4YDJB 5DT1H 3ARDA 3LKNB 4HZAA 5KVGH 5DLMH 4NFDA 1X5FA 1A7QL 5GS1B 2DDQL 3HPLA 2FIRT 3MTRA 4R3SA 3WLBB 1J0KA 4JHAL 4F37K 1DQMH 5BXFA 4G9FE 1ZTXL 5FB8B 3KGRA 4IOIA 5EPMB 1OL0A 1AP2A 4UT6L 4AY0A 1MIEL 3UJJH 1P4BH 1FNLA 3C60B 1P4IL 3VE0B 3WNLA 2VXUH 2YPKA 5D72L 4S1DD 5ESQB 4OZIB 4PJ9C 1KF9B 3ARGD 1GL4B 1EHAA 3L3JA 4OQTA 2VZ3A 3RP1A 3ARUA 4JKLA 3ULVD 3DUUA 1T1WB 5C71A 4KROB 4GBXA 4ZUUB 1QRNA 1Z9LA 4GRLA 3PGDB 2CIKB 3MRDB 1LEGA 1OPGL 1EZVY 4KKAC 2DD8L 3SDXE 2R0ZL 5DO2D 2WBJC 3EUUA 3SDDB 1NDGA 2BSSA 4HIHA 5HHQA 4FQXA 5TF0A 3BQUB 3MFFB 1ZLSL 1FRGH 4JFDE 4DN4L 2IFGA 4Z7UB 1MJUL 2BNRD 1FAKT 4JZNB 5ID0B 5HGBB 2Q6WB 1LD9B 1TETL 4ODUA 5HYSA 3Q2CA 4U6XB 2PCPA 5K9JH 3U82B 3FL7A 1ETZA 3BGMB 4YX2L 2A2QT 1A1NA 3O6LH 3GUTA 4NBZB 5TQ2L 1MFEL 5KS9A 1OM3L 4AMKH 4JY5H 5EZOL 4JFHD 4MNQB 4TULH 1YECL 4K7PX 3MRNB 3VXUE 4TRPH 2Z31B 3S36L 1EEUA 3ULUF 3S4SA 3D39E 4GQ9L 3A6BL 5HYJA 4GBXD 1QRND 4KUCF 1NKRA 1RIHH 4GRLD 3JWOC 1BJ1H 4JCMA 5I8KH 3SQOL 1UVQB 3FRPA 2M2DA 4AQOA 4F7PA 4OCSL 1JV5B 2Y5EA 1CFSA 2XNAA 1J88A 1GGBL 3VXOA 4FQXD 1RHHB 3BD4A 5LWYH 3OV6A 4JPIA 2XZQL 5IUSA 4O58L 1U2CA 5SWZE 2XTJE 3ULVH 4FP8L 1RMFL 1Y0LB 3DLQR 3NIFF 1DUYB 1XR8A 1A47A 3LN5A 4XBPB 5D7SH 3IFPB 5CSGA 3GSOA 4R97B 5D6CB 4P5MB 3IJHB 3ZMRA 5F96H 2W38A 1T83C 4UTAL 1KC5L 1YC7A 3C5JA 4YBQD 4OF6A 1C5DA 4JHBA 1UACH 4EI5A 2F5AH 4I0KA 1CCZA 5FYLE 2NY5L 5HYJD 1CI5A 5TDPA 1BX2B 1AJ7L 5HHPB 1UT9A 1MCOL 1GYAA 4TUKL 1BIHA 2J8UA 1XF2B 3HE6B 2AK4E 3DVFA 4P9HC 3I3BA 4N8CH 4QYOA 3R06A 2IPUK 5GRVL 2A9MH 4L3AA 4ZDHB 2IMMA 4LGSB 4MJ6A 4NSKB 1FZKB 3SGKA 4C54A 2EDNA 5TFSH 1BBJB 3W11D 1K85A 5KW9H 3F12B 2GY5A 2OQJB 1RZJH 2OS7A 4C56D 3L6FA 3JUYA 1C7SA 2VWEC 4NQED 5IQ9B 4UBDC 2NY7H 3H7BA 5IVXB 5I0ZA 1AR1D 4HHAB 2XIDA 1CFQB 4P46B 5K33A 1WFNA 2CJUH 1LO3H 1AD0B 3VFUA 4JFOB 43CAB 3K74B 1AY1L 1CL7H 4EI5D 2AVGA 3FO0H 2AABL 2GFBB 2XZAL 3L1OL 3GNML 3RVXC 3MLPA 5B21A 4PGEA 1H3PH 4NQTA 2EDEA 1NANI 1F8TH 3VA2C 3FOLB 4CDHA 3S5LG 2Y5TA 4MSWB 1S7XA 3OJMB 2AXFB 3EYOA 4LBEB 3I6GB 2VITA 3NH7H 5SX4I 3BEWB 3BIAX 5E9DA 3V5KA 3S34H 2BXYA 2VLKD 4S0SD 3IAPA 2B1HH 3OTTA 4M1CC 2BK8A 3ZDYE 4JVPA 3ZHDA 3LMJH 5JW4M 5JR1L 4J6RL 4F7MB 4XCNA 1JHTA 5SWQA 4ZG1A 1AO7A 2NYYD 5HTSA 4JHWL 4LSRL 2LU4A 1CFTA 3EYVA 2H32A 5HPMA 1K8DA 5HHNB 4KK8C 3B8SA 1ADQL 2OTWA 1D6VH 5F93C 1WTLA 4OFYD 4WTWA 4HIXL 32C2B 2R0WL 1IC5H 5J12B 2Z93A 1HXYA 2K1MA 2NY3C 3QDJA 3MROB 1YNKH 3H9YA 3WCYA 2DLHA 2A0LD 3M1BB 2IQ9H 1IGCL 1L4IA 5EORH 3FB7A 3ILQC 4YC2B 1YY8B 3Q0HA 1LILA 1Q1JH 3C5ZC 4BSVA 5HVWA 4UDUA 1N26A 2CDFA 4MDIA 3LKOA 3BPLC 1J5OH 5E95B 2AKRA 5F9JB 1C5CL 4Z18A 4Y19D 4PP2A 4WU5B 3C2SA 3ILPB 3SDXF 1BWMA 3TCXA 5ISZE 3PJSB 1XCQA 3QWRA 5HXMA 3C6LB 2B5IB 5FKAA 4IIQC 4P5TB 5I9QB 5DRXA 1JGVL 3LB6D 1MHCB 5C9JB 4PUBL 2EIEA 4GW1B 2BZDA 3OJ2C 4F58L 1QFWH 4O02H 2KH2B 4JANA 1UWEL 1MFCH 2Q20A 4HIJA 3ZKXB 3CDCA 5GGQH 1KEMH 4X9IA 2AEPH 4QRPE 4CAGA 3O4OC 4FXKB 3RWCA 3MRRA 4PJ9A 2CXKA 4KMTH 3TJEL 5E2TH 4NKOA 1LK3H 3X13A 3KPNB 5C0EA 3U4EB 4RGOH 4FFYH 3KJ6H 4XNZB 5FOJA 2HFEB 4KY1H 1MWAL 4P5KB 5HHOB 3L5WA 4GKNA 2FIKB 3PWPA 5DK2A 2V9RA 2CIIA 5DI8A 3NACH 1MIMH 4OUUA 5IMOA 3VFTA 2WBJA 1ZS8A 3D85A 1LO2H 4Y5YC 1MCHA 5DC4B 4KUZH 1G1YA 3HAEH 4Z95L 1J10A 5ALCH 5GXBB 4PJXB 3BOVA 4OCLC 4MXWH 3QFDB 2FEDC 4HUUB 4JY4A 3HTLX 3HNTL 2PTVA 5DFWH 1VACA 1M7XA 4HUWA 4QRRB 3KXFD 1HHGA 2V17H 4M5ZL 1X5YA 3OKKB 4KC3B 4XP9L 5C0RH 3CX5K 4LSVH 3FAXA 3IYLW 3OR6A 4PJ9D 4DKFH 4XMKL 3B9KB 4ELMA 1ZHLB 3GSNH 1UH2A 2EYRB 1WC7A 3RGVC 5FYJL 1BIIB 3MRPB 2OK0H 5JQ6L 4IRJC 2IANB 4AIZB 1Q9OA 3EDKA 4QRTB 3GSVB 1QLFA 3PWPD 1HHHA 4IMKA 4Q0XL 3MOAH 3F8UB 5I8EA 3O3BB 1DBKH 4KKAD 5EIVA 1IAIH 3D85D 1BFVL 1RIUL 1TVHB 1RSFA 4BKLA 5F8RC 4HSQA 4JFZL 4Y4HC 3U4BL 3QHFL 5GRUL 5J8OA 5FDYA 4IJ3C 4DTGH 1JPFB 2GTWB 5ESAB 5HHXH 4RWHA 3KPPA 1H8OA 3MJ8B 4PJGE 3QIBC 2UYLB 3GMOB 4M7JH 3GSRB 4EZMA 3UZQA 4YEFA 1TNNA 1KFAH 4HUVB 5IJKC 3KDMB 4M43H 4U6VL 3IFLL 2XRAL 2E7MA 1CF8H 5GS0D 1CGUA 1VFMA 2YXFA 4HFUL 4N0YH 4UNVA 3GBLA 4ETYA 3EYQD 3OQ3B 2HFFB 4OLWH 4XCYA 1BZ7B 3PV6B 5BV7B 4OLYH 4Z0XB 1NH6A 5B8CC 1RU9H 1PEWA 1LE9B 4XXDA 3D18B 1X4XA 2Z92A 4JHZA 5EO9B 3QNXB 3K2UH 3ZE1E 4GSDH 3ZDYF 2W59A 3EHBD 4MJID 2P43B 3T65A 4OTXH 5JO5B 2HJFB 5GJTL 3QNYB 3QZWG 1RJCA 3QDHA 2FO1A 1UB6A 4P2RB 2N4IA 2DYPB 4IDLA 1W72A 1JNHB 5AZEH 3IKCB 2EEAA 2HMIC 2WUCH 4RBPH 3MACH 1J8HA 4YHPB 1Q9WB 3ZTJH 1OSPL 5HYIA 2RCSL 4HXAL 4FFZL 2YPVH 4KVCH 4G9FA 5I17B 5IQ7H 3ARSA 4DVRL 3LRSB 1DSFL 2X7LB 3DMMB 1A7RL 4H5SA 4J3TA 4NQDA 1LQSR 3AU1B 3R8QA 2XWTB 4PYHA 1UXWB 3FB5B 2Q86B 4LLMA 5KJRH 2CR3A 2E7HA 3VI3E 2VTFA 5HDQH 3IF1B 2DKUA 4OAWB 2PO6B 3SJVE 4K23H 3CZJA 3H9SD 1R5VA 1NC4B 4PLNC 4D0BB 4JREB 5ACZA 3ROOB 1A2YA 5HVHC 1K6QL 2YR3A 3IETB 5D7IE 1UXSA 4PRBB 3B2VH 4XP4L 3RDTC 3WIHL 3BN3B 5JDSB 5IG7A 4NQSB 5IB4B 3MLZL 1WBYA 1E4WH 3LD8C 2V2WA 1QSZA 5GS0H 1V7NL 4NM8L 2BERA 2BVPA 1G7PB 1J8HD 4G9DA 3AM8C 1L0QA 1AGEA 5C09E 4OLXH 5F88B 5F1IB 3JWOH 4UBDD 5C6WH 5GJSH 1JPSH 2I60L 3P2TA 2FD6L 4NQDD 3C2AH 5I8CA 5CAYB 4OJFL 4MJ5B 3VG0H 3CMOH 2X4OA 4HZLA 3RVXD 4G6JH 3H0TA 3KPTA 1K8IA 3MLTB 3VXUA 4PRDB 2IG2H 1OLLA 5D7JB 4ZO6A 2VXQL 2D03H 1B0RA 1EFQA 2HWZL 3C5ZA 4QHNA 3W0WB 1PG7H 2FJHB 5IB5B 1LDPH 4JO3H 4YHKL 3HCVA 4M1CD 2J8HA 5T1LB 3V0WL 1INQA 4X6BB 3O41B 2F9BT 3WS3A 3ESVF 1G0YR 4IS6B 2XOTA 2EE2A 3KYNB 3VRIB 3SDXB 4I1NB 5EUOF 2P49B 1IGIH 3EYFB 4HJJH 4IIQA 4XVJL 3WV0A 3KPRE 3LKQA 4JFDB 4GO6B 2NNAB 3GEWB 2I26N 1D9KB 3UBXI 1JRHI 4G8GE 4ZO8A 3BT2L 1XGYH 2NY3D 1ZLWK 3PWNB 3UX9B 2D7TL 4NN5B 3DO3A 3S36X 3ZT6A 4CMHB 5I2IB 3FQUA 2OR7A 3CJJA 3H7LA 4MGXA 3TH3T 1KEGL 4ZO7A 4JRYE 3E6FB 1FYHB 2ZCKH 4C58B 1O7SA 5IB1A 3C5ZD 1OD9A 3HUJE 1XGQB 4XNXH 2BX5A 1H3GA 3EOBB 4YHYB 1YNLH 1FZOA 1U2HA 2GSGA 1HEZA 3QISA 4NKDB 3BZ4A 3X14B 4Z9KB 1BGXH 4YHLH 4XH2B 4QNPE 3QDMD 1A6AA 1IFHH 5DQJB 1EVUA 4JKPL 2R1WB 4FZ8H 4Y5YA 4ODHH 5JNYB 1U3ZA 1T89C 1V3MA 4LDOB 3OKOA 4KHTL 4L4VE 1J1XH 2JB6B 4BSWB 4JZJB 4OFVA 4K7PH 4NOFA 1B2WL 4PJGF 5DD6A 3EOAB 2XXCB 3PP4L 2A6KB 1TQCC 4U3XA 2BJMH 5SWZB 5MENE 2XTJB 1D5BB 3Q1SH 1G7JB 1KTKE 4LLAA 2X4TA 3UTSB 5LGHL 3LN9A 1CBVH 2DQHH 2F8XC 4UNUA 3QXUA 2IAMC 5L7XL 3QEGL 2AJVH 2PR4H 2A74B 3RGVA 1BPVA 3BXNB 3HZYA 1G7QA 4HS3B 4XCFH 3P4LA 4JPVL 2ZUUA 3QUMA 4IRJA 5L2JA 3QQ3A 1WZMA 1CGYA 4JM2F 5C86A 2R29H 4LMQE 3I2CH 1IEBA 1QO3A 4UIMA 1LMKA 1CLOH 5E6YA 3K4AA 3UAJC 4YAQB 3MNZA 5JOFA 1KPVA 4RFNB 3P0YH 4WFGD 1I1AB 5EFIA 1ZGLP 4OD2A 4PGDA 4I18B 1N6QH 3RWEB 4Y2OA 3KHOA 4L9LC 3ZE1F 4OD1H 4Y4HA 3I6LE 3OPZH 2AK4B 2GJJA 4L8BB 3VFPB 1A4JA 1EEZA 4MNHB 3SDAA 2FEDD 3G5ZB 3GRWL 3QIBA 1QBLL 4U1HA 4ZUVA 5IB3B 3FKUS 1NCUA 4YPGB 2ZUVA 1EV2E 4OCYL 3PQYE 4AEIL 5IJKA 1RHFA 1N3NB 4NNYA 1EAPA 5FOBA 3WJLC 3WJJC 4OM1H 4KI1A 1A6VL 2R23B 4F15C 3RGVD 3VI3F 1T1YA 3ISWA 3GSUB 2P8MA 5JQHC 2YA2A 3HC0A 1MLCB 4FFVD 2H6PB 3D1MC 3T4YA 5KSBB 4OCWH 4JPWH 1V7MH 4PJ7F 1JZ5A 2P1YA 5J89A 1KB9J 2ZCLH 4CVUA 4TVSa 1II4E 4HEPG 5D7IF 1JNJA 5D6DC 4YDVA 4Y2DC 2B0SL 3KVQA 1IRAY 4Y4HD 4L3EE 3TPUA 4IHOB 4B5EA 5ISZA 2NX5D 5FA3A 1NMBH 2ORBH 1QEWA 1NQBA 3L5JA 3LKRA 2AJUL 5DJZB 5JW5A 3QIBD 3X11A 4M1GL 5I75C 2IALA 1HSAB 3MLUH 5DJYB 3MZGB 1MREL 3JV6A 3OAYK 3T1FA 1FO0L 1V3LA 3VDBA 4D9LL 3K0WA 3DSFH 2ZPKL 3Q6GL 2OXGA 5DGRA 3SKJH 3TVMB 1GPOH 2WW8A 3UTQB 1I8MA 4JB9L 3IDNA 4IOFC 1U58B 2ADGA 5T1KB 4EIGB 1F90L 2JJVA 3BPCB 3B2UC 4QRPA 4DVBA 1D7FA 3RY5A 1OAQL 5BQ7A 4N8VB 2VDLH 2GUOB 2R8SL 2CKBA 4LNRB 4Z7WA 4U4BA 2QSTA 4NRXB 4NM4L 2F5BH 4WNQA 2VN4A 3BAEL 2VXSL 1NUFA 3U83A 3PGCA 2BY1A 4ZOCA 4EEEA 1KJ2L 4YEEA 5ENWA 1JF6A 4OIAA 3UDWA 1W0WB 4H20H 2ADJA 2E7BA 1NFDE 1NMCC 1U92B 3MLYL 2PW1B 5KOVC 3VRJB 3MRCA 5LKNA 1GC1L 3T3ME 3EO9H 4IRZL 5LGKA 5HYSG 5BJTA 4ODSL 3GMLA 5GIRA 5ITFA 1YEHL 4WFFE 2HMID 4OZ4B 4TSBH 2ARJQ 2YEZA 4OIIH 2G2RA 4CMMB 3AM8A 4TUOA 4L8CB 1E6OL 3GGWB 1EJ6A 1R0AH 2K7QA 1WSST 2H1PL 2F53A 4U1NA 3T1WA 5DMKA 2R56H 5FECA 5F8QC 4Z77A 1RZKC 1NCBH 1RUPL 1HQ4A 4R4BA 4B0MM 3QCVL 1LEKB 3FRPG 5IBTL 1HDMB 1I9RL 1FZJB 3ARPA 4JGMA 3PV7A 3WMSA 1I7UB 4JFFA 2DWEB 3TGXA 5FKPA 3HUJF 5TGBB 5E99L 5BOPA 3KYKH 5E08H 1OAXL 1P4LB 2VERN 4EN3B 3GBMH 2OJEA 2DMKA 3RDTD 1AR2A 3OX8A 4HT1H 3MUGB 1EFXD 5CZKA 1RVFL 3WN5C 4OGAC 2D4DA 3CDGB 3QUZB 3HNSL 5DHVB 3ZKSD 1A4KB 2PXYC 1EIBA 1TZGL 3DV6A 1C8PA 5GZNC 4KI5E 1IC4L 4QNPF 1BOGB 2ZOLA 1RUMH 3BP5A 3BH9B 4OLUH 1FIGL 1U8NB 2Q1EA 5CGYC 1IMHC 3OWEA 1MHEA 3EGSB 2FYYB 5ETUB 5EUOB 3WS6C 4X4YB 4PJGA 5E8NA 1ZMYA 4OSUH 1ZV5A 5KAQG 1S5IH 2F53D 4U1MA 4M6ML 4FZEL 2HFTA 2P7TB 1J0JA 2DAVA 5F1OB 2XWJA 1BVLB 5MERA 3AY4C 4DW2H 3MRQA 5HVGB 5C08B 3WFEL 2VC2L 4YLQT 4P48A 1FP5A 2DMCA 5EBLB 3FQNA 2C1OB 1E28A 4JFFD 2O5YL 4NN7C 1P5UA 4XHQA 2W1NA 1IGTB 5INCA 1DQTA 1BVKB 5KG9B 5IEHB 1FVDA 1D5IH 2I25N 3PL6A 4XPFL 4CU7A 3MV7E 4ALAH 4G8FB 2NY4B 3CH8A 4P59H 4KZDL 2LV4A 2J88L 2P5ED 1M7DB 1JMZA 5IFHL 2APXA 1WEJL 2A73B 3EYUL 1CG9A 2HP4A 4JM4H 2V7NA 5D7LD 1INEH 1N2RA 4Z76A 4PR5A 1ZGLA 5ADPL 1OGTB 1UYWH 4XZUA 5LCVH 4M00A 3TBTA 5IFAL 2PYEA 2A38A 2DTML 1WJ3A 3I75B 4P2QA 5SV3A 5IW1B 4A6YL 5D4QA 5CEZL 1R3KB 1PEZA 2IAMA 2KDGA 2AI0L 4J3OC 3WIIH 5CGMA 3CK0L 3MPCA 3IXTA 3QNZA 3AVEA 1ORSA 1FYTD 1NCAH 4GKZB 4MHHG 3CVHA 3GMQA 4M5YL 2DTSA 4H26A 5F1SA 1Z6JT 1J0IA 2W0LA 3C09C 4NRZB 4BH7A 4JM2B 2ZZUT 4O5LL 3LVEA 3GMPA 3N85L 2WWKT 2WANA 3HMWL 1S7WA 3IDJA 1FNGB 3ULSB 3HI5H 3WFCL 3ARZA 3BH8B 4N9GB 5FO9B 1QSFD 3VD9A 3KPSA 3D6GA 5FF6B 4L9LA 1OP5H 1FE8H 1RZ7L 1T7ZA 3I02B 4Y4FB 5I1DB 5IT2H 1ULVA 2W0FA 4U05A 2BRRL 2XV6B 3KLAA 2YZ1A 2YPLA 2PYED 5HI4C 1ONQB 3V7MA 2JK5A 1WFTA 4P2QD 3EFFB 4K71C 4PLJC 3U2SB 5J11B 5IVZA 4ZTOL 4GH7B 2QHLA 3ES6B 1YEFL 3WJLA 5EUKA 1PY9A 2C1PA 1AKJB 4LHQB 3STZB 3WJJA 2IAMD 1DR9A 3SPVA 2BOCB 4U2ZA 4V1DB 2CDEB 3GHEL 2I07B 2QQLH 3VXSA 4K94L 4KKNA 5T1DH 2X4RA 2P46B 4LQFL 1EERB 4FNLL 1EJOL 5DK0B 1NANH 5DMGC 1MRFH 1OAKH 5F7YC 1HOCB 4NQXB 4U1SA 3UAJD 5B38B 3DVGA 1JHLL 4X4ZA 5DQDH 3SJVB 1Q72L 2V7HB 2OL3A 4PJ7B 1KB5H 2CLZA 3VFWA 2ICWA 2EYTB 5D6DA 3KPSD 5D7IB 3CFCL 4Y2DA 1LDSA 1AGBB 3RWIA 2Q7YA 4WY7H 1NFDF 1N5YH 1ZT4A 2CKNA 2OLDA 3T3MF 3QFJA 2NXZC 3FRUA 3QCTL 2YPLD 1CQKA 4JFXA 1A6ZB 1YYLL 2ZJSL 1U42A 2DQEH 5CJ5A 5MHSE 4LLVB 3KPOB 4HKBA 3ARQA 4KPHH 1VKXB 5C09B 4DJMA 4G8GA 1YN7A 5L2KE 1CDBA 5BVJB 1KELH 1FL5A 3SDCC 1IM3A 5LXGH 2GJZB 4ZUWA 1OTUC 3BMWA 2P4AB 3TT1L 3G6JB 3VXSD 4U1IA 3TN0C 5C0FA 1QSEE 5EBGA 2SEBA 4JRYA 4KRMB 2EDLA 4QTHA 4ZFFB 1A7QH 3NCBB 2DDQH 1VA9A 1I3RA 1QBML 4PGZA 4JHAH 1EEQA 4FTVA 1ZTXH 4MD4B 8FABB 3GM8A 2DQDL 5MEPA 4ZOEA 4Y2DD 3G6AA 4NGHL 4UT6H 2ZG3A 1MIEH 4EI6B 1P4IH 1DVFB 1IKNC 3REWA 5J56B 1Z3GL 5D72H 2CLVB 5EWIL 4KI5F 4M7LT 4X6DA 3QFJD 4J12A 2OX5A 3VGAB 3GB7A 4Z5RA 1F3JB 4ELKA 2EE6A 3BP4B 1BWWA 1RAMA 2HLFC 5BZWB 2BNRB 3L95B 1RD6A 4ZAKD 4HULB 1A64A 3GIVA 2D0FA 5BRZE 1OAUL 1GSMA 5DMYA 1X7QB 5IMKB 4IOFD 4ENEC 3KPRB 4YK4C 4LCCC 1OPGH 3JTTB 4P3DB 2DD8H 2NTSP 2F74A 2R0ZH 4U1LB 4HPOL 1SBBA 3FO1A 4OF3A 3DVNA 4WWKC 4YFLI 3MRGA 1ZLSH 5HSFA 4DN4H 2Y36L 2YBRA 1MJUH 3HG1A 2BNUB 1P5VA 4FTVD 5D71L 1TETH 4FQLL 1X5LA 3MGTA 3RWGA 4ZFOL 3DYMA 4PJCB 5MEOA 4O9HL 3QXWA 1YMMA 4GBXB 4M61B 3WN5A 4YX2H 5C92A 3BKJL 3ARBC 5F6IB 5JXEA 2PXYA 5I6XB 3BP6B 1QUNA 5TQ2H 1MFEH 1UB5A 3ABZA 3NFSL 1YEDA 1OM3H 2V2XA 4AL8L 2A1WL 5EZOH 3RQ3A 2WSKA 1YECH 1O0VA 2IH1B 4PY7A 3S36H 1AGFA 5F9OH 4YGVB 2IBBA 4JJHA 3WNPA 1NAMA 4GQ9H 1IGFL 3DTXA 1X5GA 5J6HB 1VEMA 3A6BH 3EJYC 3MXWL 3QQ9C 3WS6A 2X70B 3O2VL 3SQOH 2CRMA 3H3KA 4OCSH 1FL6A 2Z4QB 1F6LL 4LCYB 4JFEA 1GGBH 3U46B 5MENB 1S9VB 1ZLWH 1NCWL 3WFHA 4JN1L 5F7HA 2BVOA 3ORJA 3HG1D 2B4CC 5KS9B 3BZFB 2FBJL 3PP3H 2XZQH 5T33L 4HCRA 4O58H 1PYWA 4MB3A 1PKQB 1NGYB 1YUHB 4FP8H 1RMFH 6FABL 1T20A 1FVCB 3MJ9L 1YMMD 1EO7A 5E4EB 5DS8A 4OGAD 4YHIB 4WFGE 1M71B 2PXYD 5GHWL 4D9QE 5GZND 4NZRL 4YHZL 3DV4B 2UZIL 4YDLB 1KC5H 1UCBL 4RAVB 4LRNH 3FQWA 4RAUA 5CGYD 2I5YL 4MDJB 1UENA 3MRBB 1F3DJ 2XPGB 4MCZA 2NY5H 4PRAA 4JRXD 1AJ7H 4MLSA 4N0RA 1MCOH 4X4XB 3PHQB 4TUKH 4YIQA 4C56B 2R2HA 4YE4L 4U1JB 2F19L 4NQEB 4JFED 5D5MB 1Y6NR 4OLEA 1MAML 3NA4A 1EEYA 1DUZB 5JPNA 4J4PC 1HINL 3CZFB 3PQYB 2EC8A 2RHEA 1JWUA 1NJ9B 3E1F1 3OKMB 5EO0A 1JYNA 2DL2A 1QYGL 1RJLA 5GGVY 1J0YA 4L4TA 4WENB 3GSXA 2BSTA 1B90A 5C0NC 4ZNEA 4HKJB 5E8PA 3ESUF 4ZNCD 2VLKB 4KJYB 4OFKA 1NFDA 3HR6A 4YFDB 2VLLA 5ERWA 4K7FA 1AY1H 2BOBB 4RMTA 5EC2A 2AABH 3VXRE 4Y16A 3OF6D 2XZAH 3L1OH 3GNMH 2YC1B 2F8OA 2GTZA 4L3EB 3G9VA 3GIZL 1CIDA 5D9SB 3TLRA 2R2CA 2OM5A 5HHME 4HS6A 2XY2A 1UQSA 5H37H 4AEFA 3IDIB 3OJDA 4UZGA 2JCCA 4KRLB 1KLUB 4AK1A 4JLRA 4OUOA 5E00A 5JR1H 1OQOA 4J6RH 3MRIB 2X1PA 4XB7A 5CZXC 5J0BA 1C1EL 4JHWH 3CCHB 3BDYL 2FHFA 2QR0A 2C7UA 4LSRH 2ZSWA 4PTTA 4P2OC 3HAEB 2ENSA 3RNQA 2P5WA 4LF3A 3NA9L 4L4TD 4WGVB 4MD5B 1ADQH 4LHJB 2H2PC 2YA1A 3UMTA 5CGTA 4X6CE 1DQJA 2W9EL 4HIXH 4LKCA 4R96B 2R0WH 4ORGA 5DRNB 3WLWC 3C9NA 2X1QA 4R6UA 3BW9B 5EZIL 4WI5A 5JA9A 2VQTA 1J05A 4PGBA 2VJXA 5EH1A 5ANME 3RZWA 1IGCH 4Y19B 4HFWA 4N0FA 3QI9B 3GSNB 3JV4B 4EQ3A 4HGWB 3QA3B 3E8UL 3ROLB 2H32B 5HI4D 2XICA 3MXVL 5CP7B 2APFA 3LY6A 12E8L 2VDQL 5I74C 1NLBL 5J3HC 4PLJD 3OAYH 2ZUWA 4XWOC 1C5CH 5DC0A 1U8PA 3SDCA 3U0PA 5IMMB 2B2XL 5ACMA 1I8LC 1L6XA 3FN9A 2D4FA 4OZFH 2DF3A 1CN4A 1ZA6A 4F7EB 4LEOA 3X12B 1T1XB 5JOEA 3MBXL 3MRKB 3MYJB 2F58L 1JGVH 4IMLA 2W60B 4JO4L 4PUBH 43C9A 4LPXA 3AAZB 3AREC 4F58H 1U91B 4UDUB 3GJFA 2BMKA 3PG2A 4Z7OE 1UWEH 2YSSB 4G8EA 3FFDA 3KS0H 4MA8L 1IKNA 4I77L 1AIFB 1KNOA 1D5MA 1MPAL 2NXZD 3HR5B 3TJEH 2VZSA 3TFKC 1G7HB 3GI8L 3BX7C 3VGDA 1TZHA 1G9ML 4X5XA 2Z8VC 5FKAB 1MWAH 3FCTB 1K3IA 4YO0B 3TBSB 1Y18A 3PWLA 5B22A 3DX7B 2VZTA 5ICYA 3SDCD 2XQYG 1U41A 1OTUD 3T0XA 1QG3A 2FJGA 3DBXA 3LEXA 3KXFB 1NEUA 3TN0D 3QWOB 3DO7B 2Y72A 1IARB 1ZA3A 3S37L 4Z95H 2XTLA 3U36B 3T4AB 4ONFL 3UC0L 4ZFZA 3CH1B 4HUKB 3O2WL 2A9NL 4ZUTA 5HGHA 1JGUL 3QXAB 3HNTH 4Q6IC 1J0HA 1XZ0A 5IW6A 4M5ZH 4U2YA 3VWJB 4XP9H 1IAOA 1I7TB 3ARBA 3WL9A 1YEIL 4OUUB 4XMKH 5H8DA 1KXTB 2P5EE 3MV7B 2BHUA 4UT9L 4UV7L 3RU8L 1OTTC 5FYJH 2YD4A 4I9WD 1P84J 4H1LA 5A3IC 5JQ6H 3D25B 4U31A 2HLFD 4P3CL 2MPAL 3DRQA 5B3NA 1KPRA 4XAKD 1SEQL 4U33A 5GGRB 4Q0XH 4ENED 4N8VG 5CBAA 3HZMA 3TBWB 4AENA 3MV8D 1DN0A 2BVTA 1KIQA 1BFVH 1RIUH 1NGZB 3O3DB 3V4PL 4WWKD 5E8OA 5IF0B 3MREA 4JFZH 3U4BH 2EZ0C 3QHFH 5GRUH 4BH8B 1MCCA 2R1XB 1JNLL 1P1ZB 3T2OA 1FYTE 1FNAA 3TIDB 3WD5L 1ZWIB 2MHAB 4NT6B 1R3IL 3IFNL 1BZ9A 2X05A 4P57A 1Q9OB 1BD2E 4UOW0 5D7KD 5DJ6B 4NNXA 4NIKB 3L5HA 3QUKB 4LLDA 1I1FB 3CFDB 5C0CE 3ARBD 4DEPB 4KTDH 4RA3A 1MEXL 3Q3GA 3BPNC 3LPWA 5CP3H 4U6VH 2XFXB 3IFLH 2XRAH 1MCJA 3BWAB 3HMXL 2IADA 3UYRL 1A0QL 2C9AA 4HFUH 4APQB 4MJIB 3CPLA 1RPQA 5DJCB 1QOKA 1LO5B 3EJYD 4GKSB 3QQ9D 5IHLB 4KRPC 3QT2A 2GJ6D 2BVQB 4XVSL 5FV1L 1CT8A 4X7EC 5C07E 1WTGT 5BS0A 4HC1L 2KQNA 4MCYA 2JB5L 1W8OA 1JWSA 5IJVB 3G04A 2K3TA 3VWKC 5GJTH 3TZVA 3VXPA 4K8RL 1T0MA 3TO4C 4R4FL 1QSEA 4QHKJ 3HC4L 3U7WL 3UEZA 3IU3A 2OP4H 3C8KA 4DN3L 3RVVC 1Q94A 3CXHJ 1OSPH 2RCSH 4HXAH 3BZDA 3H9SB 4FFZH 2A6JB 1A1MB 4X6CF 4X8XA 4DVRH 3QDGA 4LLYA 1DSFH 1QPXA 1A7RH 5DEGB 4MXVE 3VFGL 1JGLL 1KB9K 2KUTA 3WFBL 1GZQB 2FL5A 2VDRL 3FZUD 5JXAL 3VDAA 3L3GA 1K5NA 1AQKL 4V2BA 3L3OB 2MQ3A 5DR5L 1RIVL 5DD3L 4KK9C 3R0NA 4ODWA 2Z91B 3T0EE 4LVNB 1N6VA 1K6QH 3RWHA 3CMGA 2DIBA 5DD1L 3WUWA 5BS0D 2AJZB 4XP4H 3TV3L 1T21A 3BIKA 4BELD 3WEXB 1RJYB 4MB5A 1OGAE 5FA4A 5T3XD 1QFPA 3MLZH 1RULL 4J4PD 2FJFB 4CKVX 5L2KB 2WQRA 1CICC 3H9HB 1S5HA 3REVB 3O0RL 3D0LA 1V7NH 5I1AA 1PAMA 4NM8H 5JW3L 5CKAA 1XCTB 4P2OA 1TLKA 4CW1B 1HYSC 4PPTA 4JZOB 3S35L 1NMAL 1DE4B 1JMXA 5C0ND 4PGCA 1G84A 2I60H 3QDGD 3MMEA 2HKHL 3TEUA 5J1SC 2FD6H 2D9QB 3UCRA 4NCC1 4OJFH 2AJ3B 4Z7OF 5C0BA 3HZVB 4XGZA 5FO8A 3D87B 4AT6B 3V0AC 4U1GC 3D9AL 1TTFA 1Q9KB 2VIRB 4HEME 1QPPA 3V6ZB 3KPLB 2VABB 3EBAA 3P4MA 3S96A 1B9ZA 2BVPB 2CGRL 2VXQH 3KYMA 5CINL 2HWZH 2BNQE 4UOJA 4XTRC 3O3AA 1U95B 2UUDK 4E0RB 5F6HI 4YHKH 5I1JL 1T03L 3B6SA 2V5MA 1MAJA 5KSUB 4OCRL 4I5BB 2G9HA 3V0WH 3RRQA 5BRZB 3ZT5A 1WBZB 2NY3B 1XGTA 5CZXD 5F9DC 4Y8DC 5CJ8A 1HI6A 4P2OD 1MLBB 2ILLA 3D3VA 5EZJB 1PX3A 3DYOA 4XVJH 2H2PD 1T0PB 2E7CA 4Y89A 4WUUA 4DUVA 4N1HB 4X0KB 2NTFB 3BT2H 3AREA 3WLWD 1MCEA 4NFBA 4E5XA 4MQ7B 2D7TH 4Y5VC 1G1CA 4Y1AD 4MNGE 1HIML 2O61B 3QIWC 2A6IB 5E24E 1KEGH 3QDMB 4W6YB 4N90D 1NGWB 4OZHB 4RQQB 1AXSA 2VR5A 1TPXB 2BY0A 3KNBB 4IIQB 2GK2A 5JTWA 3NZ8B 5DTFA 1JI2A 3MRJA 1XGRA 5KTEL 4PJAE 3HI1B 1BFOA 5FM4A 5C6TL 1AHWA 3BJ91 3ARXA 4QOKA 3QUXB 4JKPH 5B38G 5FAAA 4YWGL 1Q8MA 1T3FB 4HH9A 5IIEB 4AQ1B 1B88A 3O4OB 3D3VD 1LE5B 4H88L 1S78C 4KHTH 4N5EC 5JLZB 4LOUD 4M9OA 2CRZA 4QT5B 2MCG1 5LG1A 4WUUD 1AD9A 4N8PA 2JJSC 4P3WA 4OIBA 1B2WH 4LP5A 4Q6IA 4UAOC 2G75A 3ARED 1MVFA 5KANG 3PP4H 1HXMA 2PYFB 3E0GA 3FQTA 1IEAA 4JVUA 5DVMA 5J1TC 2FO4B 3P9MB 2G60L 5ICXB 3KPMB 5M7QA 4LLQB 5LGHH 2WM0A 4MA3B 3U30C 1UH3A 5L7XH 4NUJA 3TFKD 3KAAA 3QEGH 3F7YA 4FOMA 3VXRA 3HE7B 3I84A 4JPVH 1I75A 3MGOB 4JRXE 4OQTL 2DLIA 1VENA 1X5XA 3VFOB 1MI5E 3BHBA 4GUPA 2ITCA 3MBEC 3E6HA 2UWEB 1QP1A 4QOKD 4X99B 3O6FC 3RIAK 4NZUL 5C0JB 4ISVA 1GGUA 1ORQB 3BUYB 3OKEA 5IR1A 3AS3A 4K55A 4ZUSA 3BO8B 3NTCL 3HZYB 1G7QB 1UA6L 1FJ1B 1MF2L 3GRWH 3QAZC 1U8KB 1G6RA 1NGPL 1QBLH 5INDB 3QULA 1S7SA 4JVWA 1REIA 4ZTPL 4MJ2A 3VXNA 1AGDA 1SY6A 5CD5C 1S9XA 1YN6B 4MLIA 3GSWA 4OCYH 1U8LA 2VKWA 3ARTA 2GITB 4AEIH 4CNIA 3LRGA 3SQBA 4MXVF 1A6VH 4TNWK 1OTTD 5EO1B 3KLHC 4FG6C 5A3ID 1CTOA 2EDHA 5DEFA 1WK0A 1DQQB 2HTKC 4IJ3B 1IM9A 2NX5B 4MD0B 4UQ3A 4HIEB 3MO1B 1JK8A 1YNTA 2ESVA 3AGVA 2NY6C 2FZ3A 3C5SB 2ZSVB 3GMRA 3FT4A 5HHMB 2HJKB 3TT3L 4TYUA 3D0VA 3DGGA 5FYKE 2AJXL 2B0SH 4M02A 5J9PA 4I48B 2EZ0D 1WCBA 3VWKA 4C4KT 5MP6L 1R5WA 1FN4B 4NWUL 4ONGL 1KGCE 1FPTL 2AJUH 1I3VA 4M1GH 3OR7B 1MREH 3D69B 1FO0H 4WTXA 4HG4J 4D9LH 2Y23A 3IDMB 1ZHNB 2ZPKH 5B8CB 3Q6GH 5EBWA 2BY2A 2VL5A 3LRHA 1RZIA 4QRSA 5DD5L 4NQCE 4IDJL 3AS2A 4JB9H 3INUL 3LZFL 3N1GC 4UU9A 4GG6A 2YD5A 2QTEA 1F90H 4F57L 2PTTB 1VADB 1OAQH 2IMNA 2CXGA 3BDXA 3MCG1 1VFAA 4KRNA 2R8SH 2CUIA 3B5HA 1IM9D 4BFIB 5DFVC 1NUNB 4KRPD 4NM4H 3UPRA 2ESVD 3BAEH 2VXSH 1I7RA 1T7YA 3N9GL 2DQIL 2YUVA 5IFJB 1KJ2H 4CVXA 1GGIL 35C8L 1Q0XL 1I8MB 3BP7A 5SWSE 3MLYH 1ZVSB 3VWKD 1GC1H 4M62L 3TO4D 1CICA 2GAZA 4BK4A 4IRZH 5FYJE 1KV3A 3V4VL 4FABL 4ODSH 1YEHH 3P4NA 4X6FA 2HA1A 1WISA 3OJVC 4X7TA 3RVVD 1SVCP 4XHJC 3QWQB 4W81A 4YHOL 1CXLA 1E6OH 4TVPD 4WUKL 2VAJA 4NC1C 5HVHB 4HGMA 4LSQL 2H1PH 3RDTB 4Y4KC 1VERA 1EFXB 5DJAA 1QFUL 1MUJA 3QQ4B 1RUPH 5C0DB 4KK9D 1VFBA 2X4UA 1CGVA 3LD8B 3QCVH 4GAYA 3VH8B 3L7EB 5ITBL 3G5XA 5IBTH 3GMLB 1I9RH 3VXQA 4E42A 3OHXA 2VKXA 2YEZB 2Y06L 2R2EB 5E99H 3RI5K 1OAXH 2QADD 1KB5A 1OAYL 3S37X 3SE3C 1RVFH 3HNSH 4PJAF 1TZGH 4W70A 2AQ3A 4ZS6C 1VB9A 1CICD 1IC4H 4M48L 5DSCA 2XKSA 1IL1A 1HH6B 1FIGH 1OF2A 2HT4C 1RK0B 3FO9A 3VCLA 5K9OA 1HYSD 1NDMA 3MA9L 5BO1L 4E41E 2IPTL 1ZHBA 5LAXB 4HLZH 3FT3A 4O2CB 4G80B 5FKPB 3V5DB 1FL3A 4AZ8A 2OJEB 5C7XL 4EBQL 4M6MH 5C0CA 4FZEH 1QFWM 2Z35B 1U8JB 1N4XL 1DLHB 4Y5VA 2CUHA 5JMOC 3DV6B 2NXYC 4KWUA 3WFEH 2VC2H 1PD6A 3PWVB 2HLAA 3V6OE 4KDWA 5C70A 5ID1B 2VZOA 1CQYA 4OF8A 1XH3A 2O5YH 4XTRD 2P5EB 3F65A 4XAWL 1KENL 1Q9LA 5ILTL 5C0AD 5D7LB 1CDHA 5DZOA 1WF5A 1F11A 4HWUA 3IU4L 1SVZA 2OZ4A 4NRYB 4XPFH 5CLWA 3SY0A 5I76B 5EZLB 4M93C 5DJXB 2Y4SA 2ATPB 4KKLC 4QRUA 4KZDH 2BHZA 1T6VN 4KDTA 1N7ML 2J88H 5IFHH 1D5ZA 3EYSL 1U9KA 1OY3B 1WEJH 1UEYA 3EYUH 3SO3C 4YFEA 5FM5O 5FM8A 3O2DA 5DEZA 4OI7A 3RWJA 4F7CA 1JTOA 2JJSA 1A6TA 5ADPH 1KCRL 1QVOB 1FYTB 5KZCD 2IPKB 2GQHA 5IFAH 2D31B 1IJ9A 2DTMH 4OFDA 5CIPH 4K3JL 1BD2B 3KR3L 1B6UA 1ZT1B 3QJHB 3Q6FA 2J6EA 1H5BA 3QIWD 4A6YH 1MCWM 5A40E 2YN5A 1MJ8L 5CEZH 2VQ1B 3BYYA 4NO0A 3RX7A 4OCMC 2AI0H 1KCVL 3CK0H 1QSFB 5IK3A 3UJIL 3MV9A 4U6HB 1NL0L 1TZIA 1WGOA 3MRHA 4M5YH 3ULUL 2BRQA 2EXYD 3RL1A 4O5LH 1EXUB 3MBEA 3N85H 3TBTB 3IXAA 1OVZA 3CFEA 3HMWH 3WHE0 4S1QL 3B9AA 3H6JA 3WFCH 2C3HA 3HRZB 3O6FA 4P4KB 3MRFA 5EIIA 1RZ8B 5C07B 1MCWW 1S78D 1RZ7H 3O6KL 4M6AA 1ZK9A 2JELL 3BJLA 5TDOA 2YD1A 1WITA 3L3IB 3MNVB 1PFCA 4PD4J 2BRRH 1I7ZA 1CFNB 3VD4A 3FOMB 5DVKA 5L9DL 5DJ8A 3T2NL 4ETQA 3NPSC 2H9GB 1XR9B 3QO0B 4ZTOH 1JZ7A 1YEFH 4UOW1 2AXGB 2CLRB 2GK0B 4YHNA 2HN7B 4HK0A 2L7UA 5F7NC 3MV9D 3GHEH 4K94H 1S7RA 4LQFH 4FNLH 3TBVA 1GH7A 1EJOH 2Y1VA 1MVUB 4LCWE 4LCUB 4P99A 2BNQA 4QXTA 1JHLH 3MBED 1U93B 1Q72H 2IGFL 1PW3A 3T0EB 2VZUA 3DXAA 4GG8A 1NAKL 3T0BA 3GO1L 2ADFL 3O6FD 3DX6B 1NGQL 2VLME 4DGVL 3CFCH 5F3HB 3OB0K 1CYGA 1KTLA 2EEBA 5BZDA 1N8ZA 1R24A 1GGCL 1OARL 1OGAB 1NGXB 3ZTJG 3S35X 4NDMA 3BPOC 3FB6A 4N0UB 3EFDL 4C55A 2IFFL 3VD7A 3QCTH 3RGHA 1KJVB 4WFHD 4GW5B 1YYLH 2XG5A 3OXRB 2ZJSH 4IRSC 1LHZA 2ZOKB 5CD5D 1UC6A 3K2MC 3TYGL 4NBXB 3NN8B 1NFIA 3T0AA 3P0VL 4PV9A 3QXDA 1S9YA 5HY9B 4XBEL 4LVHB 4Q9CA 4OZIE 3P4OA 4HUMB 3CIQA 3TT1H 3KLHD 3RWIB 4FG6D 5E6IC 1DDHA 4S2SB 5EBMB 1NBYB 1SEBB 1C7TA 4QHLB 4W6WB 2HTKD 1P2CA 1FFPB 3P9LB 3OKLA 1JUFB 1QBMH 4QHMB 4NC0B 3QRGL 2VLJA 3DXAD 3NCJL 4UB0L 2NY6D 5K9KA 3V6FB 5E2VL 4TQEL 3BVNB 2V5YA 5H35A 2DQDH 4JGUA 4NGHH 4R0LB 4ZAKB 2MNUA 1I9EA 1JN6B 3LN4B 4HV8B 1I1YA 4P23B 5K93A 1Z3GH 5EWIH 4P9HL 3SKOA 2EH7L 1R3JA 3P40A 2I9TA 4MQTB 2WQ8A 2X9YA 2ZP0T 1L9NA 4A2LA 4DOHE 4G6ML 2FBOJ 1E4JA 1W72L 1JZ4A 5FDWB 2V2TB 3IFOA 3MLSL 4K9EL 2MKLC 1UJTA 1OAUH 2N56A 2RFXA 4MHHI 2DL9A 1XF3B 5EOCJ 3DARA 2EO9A 1MHHB 1EH9A 2R1YA 3BGFB 4HPOH 4KVNL 1MNUL 3WDJA 3VFNB 1ZANL 4H1LG 4Y4KA 3PWUA 3UTPD 1I8KA 3S6CA 4MNQE 2DJSA 3B3IB 5JZ7C 3UTZA 2Y36H 5DFVD 5CMAA 3WXVL 3MNWB 4Q9QL 1CXKA 2CMRL 3SKNB 3VFSA 4BFGA 4M7ZB 3W39A 2VLJD 1M6OB 1OT2A 3QH3A 3RAJL 1J87A 1LK2A 5D71H 1EUTA 1L0XA 4FQLH 1OOAA 1ND0A 3FQXB 1VEPA 1HSBA 1YYML 3ZHKA 4X80L 4O9HH 3SE3A 2UUDH 4WW1B 2X4PA 4L29B 4K7PY 4I3RL 3BKJH 5E8DL 4AEHL 2X1WL 4PJAB 3NFSH 1OB1A 2A1WH 4AL8H 5HDOA 2B1AL 1ZT7B 4MAYD 4XHJD 5CBEB 2A6DB 3RPKA 3U7YL 2J5LB 1IGFH 3QUYD 1IGJB 1SHMA 1E4XL 3MXWH 4X7SL 4M1DL 1VFUA 3VG9B 3O2VH 3UTTE 4HJGB 2R4SL 1XF4B 5EOTA 5AD0A 4Y4KD 1G7MB 1B3JA 5T3ZE 3ZKQD 1NCWH 2PXYB 3HPJA 4JN1H 4LL9A 5D2NC 4NBYB 1CD9B 4LVOB 2ZUXA 2FBJH 4X6EB 3D2UB 5CUSL 3RUGE 3R4DA 5T33H 3KYOA 3VFVB 3SHSA 1CVSC 3BKCL 3V0VA 1NFKA 2HRLA 4ODBD 4KKBC 4POYA 4GRMB 6FABH 4I4WB 4PTUB 4L1DA 2KBGA 3MJ9H 4PJDA 4PV8B 4JRXB 2EYSA 5DYOB 1NC2A 4WI3A 5GHWH 4ZS6D 1MI5B 5DF0A 4NZRH 2C3XA 3NCYS 4YHZH 2AERT 4QXWA 3OKDA 2UZIH 4XCEB 5DRZB 1UCBH 1OCWL 1MCLA 4QGTA 2YN3A 2HVKA 1X5IA 3M07A 1ZLUK 2FWOA 2I5YH 1FFNB 2HT4D 1QNZL 5AYQA 5GS1C 4I8DA 3W5NA 5E2UL 1KN2L 4HUXB 4XPGL 5IVXE 4YE4H 2G5BA 2F19H 1HHIA 4PG9A 4YXHL 5GGTA 4RZCB 3QG6B 1WBXA 3JSSA 3L3DB 4LU5L 3T77B 4G7VL 1MAMH 1XGPA 3C60C 4NZJA 4PBXA 4JDZB 4Q2ZB 2NXYD 1R5IA 2Y7QB 1C16B 1HINH 1T04B 2F54D 5LGJB 1EVTC 5IROC 4HPYL 3WUWG 1QYGH 4OZFB 3JWDL 4OV5A 2BC4B 5HGAB 5JHLL 3ARRA 4FXGB 3TA3B 5GGSB 5FYLL 1MY5A 3ARVA 4D0DB 2XXMB 2NW2A 4JO2L 2DLEA 4XP1L 3W9EB 1V3JA 1MCIA 4MAUL 5SWSA 4L8DB 3J7HA 4U7SA 4PJHA 3BQUC 5F1NA 3ARYA 1W0VA 4GS7C 2VOTA 4QLRA 4S0TD 4G42B 4DZ8B 3GIZH 4PJIE 3TYFB 4U6YB 3U9UA 4FA8A 4NPYB 4OD3L 5H2BB 5I73C 1EBAA 2IQAB 1QR1A 2LAAA 4QF1B 1NLDL 3C09B 2NZIA 3QZWA 1MWAB 4TTDC 1JPGB 3C6SA 4PY8J 4CGTA 1ZLVK 1AQDB 3T8XA 1FGNL 4WJ5B 1DEEA 4NQCB 3UBXB 5KSAB 5IOPB 2W65A 4OZIF 4FQHB 1JZ2A 1FHGA 3HC3L 1C1EH 4AM0A 2Z31C 3OXSB 1CTNA 5EC2B 3BDYH 4EXKA 2EIBA 1P7QA 1ED3B 3V95A 4QXUL 3NA9H 4JEGB 3QUML 3AXLB 2W9EH 4PP1C 3FONA 2MFNA 3G5YB 2OI9B 4K71B 5EZIH 1P7KB 3TPKA 4HAFA 1M1SA 3CXDL 4EUPH 4JGJA 3G5VB 4YZFE 4BQ8A 3GSQB 3KG5A 4TNVK 4NHUB 1ZSDA 3V7AE 1JNNL 3E8UH 3QO1A 5I66A 3MXVH 3QB7C 4E41A 1N0XL 1UWGL 3L3KA 4IRSA 4HW6A 4PJEE 12E8H 2VDQH 2YUWA 1NLBH 1JF1A 1Z5LB 1U8HB 4G43A 2I9LA 1TJHL 5B39A 3UJTL 1K4DB 3OKNB 5E4IA 3RWFA 5LJYH 8CGTA 2NLJA 1S7QB 2B2XH 1KTDB 1T22A 4JN2A 4LGRB 4DCQA 1S7VB 5GRJL 1P7QD 4PRNB 5DJDA 1QA9A 5M95B 3MBXH 1RZGA 2F58H 4UDTA 4JO4H 1A6WL 1JGEB 3TBYA 5EU4A 5A2LH 2CK0L 1URLA 5EU5A 5J6GB 4BJLA 4NJAL 2RBLA 4EKXA 4NQVB 1RY7B 2CK2A 2HJLA 3IAGC 2ATKB 3IJYB 3VFRA 4WTZG 5CEZE 5FUCC 4MA8H 5F7DA 5T1MB 3RY6A 4I77H 4DQOL 4JFYA 1KIPA 1MPAH 3VMPA 4PJXE 3PHSA 3CUPB 3TN0B 1YMHA 2XG4A 5DUBB 1U6AL 2YRPA 3GI8H 1NCCH 1F6AA 1G9MH 4IRSD 1JGDB 4DK6A 4LEOB 1TCRA 1I8IB 4OFPA 1SM3L 3RNKA 5IB2A 43C9B 2H26A 4FQQB 3SGDI 3RJDA 1KT2A 4P46C 1S7UB 4TSAL 2XN9E 3L9RA 4D9RD 4URTB 1BLNB 4J3VA 5DK3A 5E6ID 4HKXB 3S37H 4HWEL 2Y9RT 4GXVL 2BCKB 3NFNA 2DQFA 4ONFH 3UC0H 2WINA 1FV1B 3O2WH 2CKBL 1J1PL 1E4XI 3RUGF 2A9NH 1JGUH 1YJDC 2FEEL 1TZHB 1LP9E 3KJ4B 3X3GL 4X5XB 4ZMAT 4RGNC 1T0NB 1CS6A 5GRXG 3U6RA 3TIEA 3FHAA 2CH8A 3WO4B 2XYCA 4NYLA 4TPRL 3QEUA 4YK4B 4X8JB 4LCCB 4GMSL 1YEIH 3MV8B 3MCKB 3DBXB 3O4LD 4XPHL 3U0TA 4UV7H 4UT9H 3RU8H 4WWKB 2P44B 4JY6A 4P3CH 5EOCL 2MPAH 2VYRE 4M8QA 4XRCA 4PLKC 4DKEL 1SEQH 5D1QA 4LKXA 3FFCE 4JDVB 1K4CA 4JKWA 3MA7B 5IVXF 4RISL 3V8CA 1H9VA 3VFMA 4LLUB 5CILL 3V4PH 5JZ7D 3S3PA 1UJ3B 4M9PA 5D2NA 3SE4C 3MR9A 4LAQL 1JNLH 4U0RB 5JMRA 1HH9B 1EHNA 1IGYA 3WD5H 1JWMA 1R3IH 4OGXL 1T1ZA 3IFNH 4LLWB 3RL2A 3AS1A 5HI5C 5HBBA 4X9GA 2Q8BL 4HX1A 4LCWA 5IHUL 3QCUL 4I2XE 4WWID 1KIRB 3E2HB 2GJ6B 3PABB 4WHTA 1JYVA 4ZXBB 1MEXH 4PRID 5CEYA 2VDML 4FFWC 4M4RA 3WIFB 5CWSA 3HMXH 4NO3A 4R4NC 1I9IL 3UYRH 1A0QH 4YDJA 3C6LC 5ALBL 5J1AB 3LKNA 2B5IC 5I9QC 4P5TC 3NFPB 4JKMA 5GS1A 3X3FL 3ZHLA 2R0KL 2BVYA 2VLRD 5TPWL 4PJIF 3WLBA 4Y5XB 1A1OB 4XVSH 5FB8A 5EPMA 5GZOC 3VH8G 4NKIL 2XZZA 4LLDB 2HT3C 3ZKXC 4HC1H 2VSCA 4QY8B 3C60A 3VE0A 2JB5H 5ESQA 2XWBB 2OCFD 4OZIA 5F7UA 5EU6D 4K8RH 4ZPTB 4R4FH 3U7WH 3HC4H 3I6KB 4ONHB 4YFLF 5IROA 3CLEL 1AC6A 3IJSB 4KKBD 4XNZC 4DN3H 1T1WA 5C3LD 1HWGB 3WE6B 2I24N 3KS0J 1NBVL 4ZUUA 2B7DT 3PGDA 1DBAL 2CIKA 3MRDA 4EOWL 3C8DA 4HDIB 1PZ5B 3FQRB 1F3DH 4LSSL 1X3DA 2CDGB 1GVIA 5D8JL 3RZCB 3SDDA 3VFGH 1JGLH 3WFBH 2VDRH 1QLRB 4FMKA 1KTRL 2NY2B 4FRWA 5JXAH 5HJ3B 3BQUA 5KSVB 3MFFA 1AQKH 3P9WB 4DWHA 4YBLB 4K3DL 3EIFA 4K07A 4Z7UA 5DR5H 1X5HA 1RIVH 1U8QB 5DD3H 3VXPB 4YZFF 2ICCA 4JZNA 5ID0A 3ZZ1A 5CSZB 1VGEL 1MH5A 4J8RB 5HGBA 4E9LA 2Q6WA 1LD9A 1D5XB 4HD9A 2X4QB 1ZAGA 3BIBX 5DD1H 2F8VA 4PJEF 4U6XA 5I1HL 3TV3H 4R2GB 5C9KA 3C60D 2HRPL 3BGMA 4HG4K 4QCIB 4HK3J 5F89B 1RULH 1FLTX 1R6VA 4KTYA 4LFHG 2AV1B 4N1EA 4QHUB 4F33B 1LGVA 5JIHA 2FL5B 3O0RH 2Z31A 5JW3H 5DQ9B 4F80A 2ED8A 1U8OB 2AGJL 2VE6B 4YH6A 2XT1B 3W0WE 4HIIB 4AH2B 3ULUC 3S35H 1NMAH 3CGTA 3CVHL 3RTQB 5E2WL 1UVQA 2HKHH 5AYUL 2AEIT 1JV5A 4HWBA 1H8SA 4KAQL 5IBUB 2FH8A 2X44D 1I4FB 3ECBB 2D7MA 4C83B 2H3NB 1MJJB 1RHHA 3WNKA 3OB0H 1SMOA 1FG2B 4EVNB 4PJXF 3ARDD 2WP3T 2CGRH 5CINH 1Y0LA 5KVFL 3OSKA 1HZHL 1T66C 3IGAB 3IS1X 1DUYA 3LQZB 4OLZL 2BHYA 4XBPA 4DOHB 5I1JH 5DDHB 2HG5B 1T03H 3IFPA 4TTDD 5F7KC 5D6CA 4OCRH 4P5MA 2ERJB 2EH8L 3IJHA 1B0GB 1OWRM 1MCSA 2VB5A 5JPMB 4R8WH 1ZOXA 2HVJB 2Z31D 3CDYA 1WWBX 3ZYJA 4Y1AB 3VXME 1XF5B 5LWYL 2LVCA 3OAZK 1BX2A 5HHPA 1S8DB 3F7RA 5DHYB 4PP1D 1ZGLM 4WO4B 3TESA 1LP9F 3QEHB 5F9WC 3O3AB 5I1GL 2OL3L 4IMKC 1XF2A 1OD7A 5I74B 3HE6A 3F6IA 3ZYOA 1HIMH 5DFTA 4CJ1A 4ZDHA 1AI1L 1WAAE 4NSKA 1FZKA 1HNFA 1BBJA 4RGMB 1YEGL 2FEEI 3F12A 4WFEE 2OQJA 3KWWB 1L7IL 5IMLB 5JIIA 3HZKB 5IQ9A 3LV3B 1KG0B 5IVXA 4QRQB 4HHAA 5KTEH 3DMMC 1CFQA 3MX0A 4NO2B 4P46A 3F5WB 2JIXB 3UTSE 5C6TH 1AD0A 4PS4L 2EIZB 3UTTB 4E5XB 4JFOA 43CAA 1FFQA 4YWGH 1NEZB 2GFBA 1YDPB 4H88H 3NGBB 5EN2B 1DBBL 4QXGL 3QXTA 4JREC 5DJ2B 2AXFA 4LBEA 3VD3A 1S7TA 3I6GA 3RUGB 2LTQB 5AUMB 1FO0B 1KBGL 4JRWA 4MA7L 5DHXB 2G60H 3AB0B 4YXLL 4F7MA 1UZ8B 3DROB 3DHMA 3QRFM 4G6KL 1QQDB 4OQTH 5HHNA 4U7KA 2R69L 4BZYA 1HHJB 5IV2A 3LAFA 4GW4B 4K9EC 4P46D 3ZYIA 32C2A 2HKFL 5AAMA 2H8PB 1FNEB 4XBGB 4F7TB 5AG9A 4PRHE 3MROA 1KJ2B 5TJWK 2P24B 4NZUH 3M1BA 4GRWH 3DYPA 4OFIA 3SE4A 4PRPE 5F70A 4Z78B 3F7PC 1H3UA 1RZKL 5KSBE 1YY8A 3NTCH 1FH5L 1F3RB 1M7IB 2DIJA 1UA6H 1BQHG 1MF2H 1NGPH 4RGND 4KJPC 1O7VA 3WSQL 2ZKHL 4ZTPH 3H3PL 1QZ1A 5F9JA 2M26A 1A22B 4WV1B 2XKUA 4WU5A 3K1KC 3ILPA 4NQUA 3UPCA 3SOBL 4PJFE 1MFBL 2XQYK 2OXHA 3PJSA 2WWMC 5DVOA 2BSRB 4U1KB 1SYVB 5E94B 3C6LA 5DRWB 4P5TA 4NP4L 3GZKA 1ZLUH 3N1QC 4UIKL 4PLKD 5C9JA 1MHCA 2ZG1A 2VNCA 1QD0A 1UGNA 1NAML 4Q6YA 1D9KC 2MQCA 1G6RB 4GW1A 3QULB 4PD4K 4PJIB 2JJUA 1C08B 1X9QA 3TT3H 3T04D 1EGJA 5L88L 2ZCHL 2GT9B 4JAMB 4ODTL 1PY4A 2AJXH 4MZ2A 1NCNA 4FXKA 5D1ZB 1UM6L 3U1SL 1OTSC 5H94B 1Z2KA 2VQUA 1FBIL 5MP6H 3THML 4NWUH 4O2FB 3CFKB 1X4YA 4ONGH 3KPNA 1FPTH 3U4EA 3L7FB 4JJ5B 4LEXL 1OHQA 5HI5D 4NNPL 4MWFB 4HCRL 1FZMA 4EDXB 1UWXK 2HFEA 3BKYL 4YHYC 4P5KA 5HHOA 3TO2B 2FIKA 5DD5H 5E9DD 3FO2B 1JL8A 4IDJH 3INUH 3LZFH 4L4JA 1FNFA 3LS5L 1KXQE 1PBYA 4HWZB 1X6LA 1MRCL 4CVZB 5JHDE 3OBAA 4F57H 4R4ND 2L0DA 3C6LD 1NPUA 3QEQE 5CSBA 3SE9L 1AO7D 4P5TD 4PJXA 3TO4B 4RWYL 3FB8B 5C3TA 1CE6B 3QFDA 4HUUA 4B7IA 2ADIB 1T5WB 4QRRA 3N9GH 2DQIH 1PZUB 4D8PB 5GZOD 2XTJC 1BM3L 5GGSY 1IQDB 3DSNA 3JTSB 2HT3D 3OKKA 4YR6B 3T09A 1GGIH 35C8H 3W5MA 1Q0XH 4PJEB 4FQJL 4R7NB 5KANI 3QDJD 4H25B 3B9KA 1ZHLA 4M62H 2EYRA 2HT2C 1ZLVH 2Y6SC 3QPXL 3WDHA 1BIIA 2FRGP 3MRPA 4FABH 4R7DB 4PY8I 2VAAB 2IANA 4AIZA 3JWDC 1GIGL 5HHOD 4QRTA 1QR4A 3K3QA 4I13B 4YHOH 2DM4A 1P9MC 2OTUB 3GSVA 4BQBA 4XX1E 4WUKH 4RFNC 4NOBA 4LSQH 4LDLB 2Q76B 4U49A 3UO1L 3BE1L 3MRMB 1TVHA 4I18C 2QADB 2GHWB 5CIPB 3ARFB 2DLTA 1JRHL 3NMEA 1FCCA 4MX7B 1QFUH 3T0DA 3OB8A 3P73B 4A6YB 1JPFA 2GTWA 1WAAF 4KKCC 5ESAA 3QWRD 5ITBH 1U3HB 2AXJA 5EUOE 1GZPB 3MJ8A 4QRRD 5DGQA 3GMOA 2GW5A 2AQ2A 2Y06H 3GSRA 4KTEL 4NFCA 2ICWI 1OAYH 4RDQF 4FQCL 1JBJA 5EU7E 4HUVA 3KDMA 2LQRA 5ICZB 5FUOL 2I27N 1C12B 4O51B 1EAJA 5C08E 4M48H 1T5XA 3QSKB 2XN9B 4X7DC 3MRLB 2FX9L 1N59B 5ADOL 2IAND 2P45B 4U1GB 3RIAF 2HFFA 2CPCA 1BZ7A 3PV6A 4G6AC 4Z0XA 3ULUD 3MA9H 2H32H 5BO1H 2IPTH 3DVIA 3EZJB 1IILE 1CZ8L 2K9UA 4KUCD 1XFPA 1BEYL 1SBSL 4M4PA 1LE9A 4ZSOE 1LP9B 3D18A 5C7XH 2FHBA 4EBQH 1GOFA 5EO9A 3MOBL 5C0AB 3V5HB 3VXTB 1H15B 3QNXA 1MFDL 1N4XH 1RURL 3NAAL 2X40A 2WBJD 1OP5K 4YNYB 3O4LE 5JO5A 2HJFA 2X1OA 3QNYA 4UI2A 3M8OL 5BVPL 4P2RA 3AFLA 4XNYL 2DYPA 4TNWF 4XNQB 3O8XB 1JNHA 3IKCA 5DD0L 1T66D 4XAWH 1P7HL 3SDAC 4YHPA 1Q9WA 4X98B 4PJBE 3JXAA 1KENH 5ILTH 4JFQB 3TVMC 5I17A 3W9DB 2GSIA 3IU4H 2X7LA 3DMMA 4ODXB 1ZHKB 2R9HC 3FFCB 3AU1A 2XWTA 1UXWA 2Q86A 3FB5A 1A7NL 1EA9C 4PJ5E 1A7OL 2DQUL 4K2UL 1N7MH 3O11B 1A3QA 4LQ1A 1F5WA 1YPZE 3EYSH 3QIWB 1NBZB 4JG0L 1QLEL 1XGUB 3QIUB 4OAWA 4DGIL 2PO6A 5FIEA 2ITDB 5KSBF 5EU3B 4D0BA 3ROOA 1KCRH 2QJDA 3IETA 3WNMA 4JR9L 2YRZA 2QQNL 2ICEB 4PRBA 4F8TA 5D1XB 4K3JH 5GSVA 3KR3H 1DTUA 5JDSA 5E8EB 4NQSA 4EDWL 5IB4A 1CFVL 5I1EL 4I2XB 2YD2A 1MJ8H 2OMNA 3A67L 4PJFF 4P2RD 4ZPVB 2DYPD 1EX0A 1G6VK 5D2LE 1KCVH 2GCYB 4XC3L 3UJIH 1G7PA 2K7PA 4UUJB 1NL0H 4S11A 1SJEA 1FG9C 1B4RA 5F88A 5CFHA 2VLRE 5F1IA 3ULUH 2E6QA 5C0GA 3DMMD 2D0HA 4D94A 2Z0BA 1TTUA 4S1QH 4MJ5A 2XA8L 1EMTL 3OGCB 4V1DE 3PXJA 3TCLB 5EU6E 4F3FB 3O6KH 2JELH 3SO5A 3MLTA 4PRDA 2QKIB 5D7JA