1DQWA

Crystal structure of orotidine 5'-phosphate decarboxylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
MHKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dqwA00
3SGUA 4CCEA 4IJBA 2X1RA 3RNDA 1PE1A 2WSRA 4QQ3A 1ICPA 1CI1A 3WJZA 3DBPA 1GT8A 4MKNA 3MHGA 3FS2A 3KVMA 3NM1A 4MPQA 1IXQA 2V5BA 3M16A 3E0IA 4CCCA 2CLFA 4AF0B 1S5TA 1TTIA 2VFEA 3M9YA 3NM3A 2XN0A 8TIMA 3L5LA 4PFMA 1D3GA 3QPYA 3GDLA 2OCZA 1W56A 4ZZ9A 3ANYA 3S1XA 1YXCA 4O1CA 2A6NA 1K03A 4XBKA 2Z2UA 5HQEA 2R8WA 1UBSA 1LBFA 2BXVA 1JUBA 3GZ3A 4CCDA 1SW7A 3NQVA 1SZEA 3R12A 1G4EA 4A21A 4U28A 2CW6A 3O16A 3I6RA 5FF7A 2A7PA 1ZCOA 4DF2A 3O6YX 2WQPA 3DFTA 1HG3A 4K36A 3NG3A 4M7SA 2NLIA 3ABOA 5D37A 2X16A 5EKYA 1EWDA 3EB2A 1F6PA 1TPVA 2QEZA 3UWZA 4GUIA 1YXYA 5C6MA 3UPWA 3CWNA 2QR6A 3DI0A 4Z08A 3BG5A 4AHQA 4QNWA 4KFNA 2JKAA 4PA8A 3TK7A 3I7SA 4LT9A 4QNEA 1YPFA 1YDNA 5DY3A 5IBXA 2YPIA 5LNWA 1MEWA 2G96A 2EPHA 3UY8A 3M5YA 3MWAA 4IMCA 4NT0A 3DAQA 4K38A 3W7HA 4U4MA 5TQLA 3H55A 5J5RA 3DKJA 1LOSA 5K9DA 3C2RA 1UJPA 4N6EA 3FYOA 3BGJA 5LNSA 1H50A 3LI1A 1VHCA 4RZ4A 1MXSA 1WOBA 3U2OA 4K7VA 5D2YA 3PSWA 5LNRA 3N73A 3JRKA 4XTDA 3W7PA 4PH6A 1XBXA 3BPWA 3ATZA 3SSJA 3MW7A 4N4QA 2DP3A 5TIMA 3W7NA 4OBTA 1A53A 3EX2A 3LXBA 4GBUA 4MYXA 4O50A 3WJSA 4H3DA 1K3UA 3CB8A 1HUVA 1LP6A 4MJMA 1L6YA 2NV2A 2PC4A 1NF7A 2C19A 2GPTA 3L68A 2ZA1A 3INPA 3T4CA 1TO3A 2CZEA 5BRBA 3N2XA 4O18A 3MP4A 3HO8A 4CLMA 4J9JA 3TIMA 1I2QA 4EOUA 3KRUA 3HJZA 2CFFA 4UTTA 4PTNA 3ZFHA 2ZRYA 3OVRA 2E6DA 2YW3A 3LHWA 1NSJA 5G2WA 1H7NA 1OF6A 4XKYB 3W2UA 3ZS4A 2ZZ6A 1O5KA 3WFAA 1XDMA 4ZQCA 3I68A 3NL5A 1BWKA 2J9YA 4X2RA 1ML1A 4LS2A 4LS0A 2ZZ5A 4WY0B 1KFEA 3U8GA 2FB2A 3W1AA 4NNBA 3SY5A 3W7IA 5AHNA 4DO5A 3PSVA 1P1XA 1I2PA 1TV8A 3LBMA 1TB3A 1ZFJA 3CM4A 4EF9A 5C5YA 5LNVA 5L6UA 3E9AA 2YDAA 5CZSA 3H53A 2GJNA 2PE4A 4BF9A 2NXHA 1VQTA 2FIQA 3MI6A 4UR8A 1R2SA 2Y7DA 5DCEA 5I3HA 3L21A 4JDBA 2B7QA 3DKLA 4JIPA 3W7GA 3P5ZA 2BLEA 3PBWA 5FI8A 3WJXA 3JR2A 1IIHA 3W7LA 1Z44A 1S3HA 4LRSA 1AG1O 5F4XA 5F1VA 1SPQA 2P10A 1SR9A 4NXSA 3SJ3A 3LV6A 5BMXA 3TMQA 3R89A 1X7FA 1BEUA 1RZMA 1I45A 2Y85A 3L0NA 4XBSA 5I3IA 1TV7A 2E5BA 1H51A 1QPRA 2GJLA 4UTLA 5CPMA 3GB6A 1W0MA 1W54A 2NX1A 2C14A 3S42A 2HSAA 2ZA3A 3G8RA 4MY8A 3IIZA 5K4XA 3FKKA 1Z48A 1O4UA 4NNAA 1T8XA 5FF3A 2ISVA 3BGGA 4JYDA 5CGQA 2V5LA 2W79A 5D04C 4JTSA 5D38A 3TAKA 5CPNA 1L9WA 2VFDA 4O1DA 5I3GA 5T26A 5DXXA 4LTSA 3W7MA 1LORA 2LLEA 2ZQ0A 2FPYA 4MZYA 3G1FA 2VENA 2G97A 1W5MA 3BG9A 1L6SA 3VNDA 1K02A 5CSSA 1VYPX 3W1TA 3DXIA 4DBDA 1G4TA 3LTSA 3FOKA 4BK9A 3P81A 4OE7A 1HTIA 2WNZA 3NQEA 4QIUA 1JULA 3CLMA 1FCBA 3TV8A 5EPDA 3L66A 5LSMA 4AWTA 1WXJA 1YADA 2WKJA 4O1BA 4HNNA 3P8JA 2NXIA 1JCNA 4UMCA 3W23A 2QCCA 4NXKA 3FFSA 1OFPA 4IWWA 3V1PA 5FEZA 3STCA 1WV2A 3QM3A 3GLCA 4IMFA 1VC4A 3GXTA 5D2XA 3W72A 1K8ZA 3EWBX 3RLUA 2B7PA 2GQ8A 2C3ZA 4N4PA 3NYZA 1OFDA 4NJHA 2YFOA 1FY6A 3G3MA 1GYLA 2Y62A 4ZMGA 3QH2A 2ZZ4A 2C1HA 1QDSA 3LCWA 4BWLA 3RMJA 3S1WA 1GWJA 2QF7A 1TTQA 3C6CA 3PY2A 1XXXA 3LCLA 5D02A 2V2DA 3GIYA 3EKLA 3VE9A 4O19A 2RKXA 4Q4KA 3M5ZA 3B06A 1F5ZA 1SUXA 3EX6A 3DHFA 1HO1A 3TKFA 4ML9A 1A5AA 3NPXA 4JGDA 4UNKA 1XFBA 4S1FA 4GXMA 4QITA 4A2SA 3BW3A 3TA6A 4GRSA 1W5NA 5AC6A 1QO5A 3H54A 1N55A 3G1AA 3W2JA 1KV8A 2YYTA 4XQ6A 1FXQA 4IX0A 3SZ8A 1F6KA 1YDOA 3KRSA 3TAOA 3CTLA 3KFTA 4AB4A 2NUXA 1WAUA 3LDVA 1B4EA 3WK2A 1I2NA 4FNQA 4Q32A 3TCEA 3W1LA 2VEIA 4MOZA 2A6LA 3IIOA 3GDKA 3LGEA 4ZL1A 3TQKA 4KFPA 4I9AA 4DBEA 3MP5A 3VE7A 3NGJA 2A0NA 3OVQA 2B7NA 4FNTA 1WA3A 1RD5A 1PS9A 5D2WA 4O57A 2F84A 2QCDB 3B8DA 3HPXA 3MMTA 3W1XA 4HSNA 1LOQA 2V2CA 5KSWA 2E09A 1HL2A 1GQNA 3G22A 2E1DA 1O94A 4CNNA 1TJPA 3EXRA 3RK8A 3LTYA 3NQAA 3UWUA 1DV7A 3NOEA 4NJGA 4MJZA 5K9CA 1QPNA 3W83A 1N7KA 2ZTKA 3PUEA 4LC6A 4HNTA 4MZ1A 4LVFA 2Q3RA 3QF0A 4X3ZA 4QISA 5AHEA 3M47A 3NQ2A 1GG1A 1O95A 2BX7A 3NZRA 2H3DA 3ZR4A 2J6XA 2H3BA 3P60A 3HB9A 4MUZA 3HBLA 1B4KA 4LU0A 1EA0A 1ZHAA 1TQJA 1IGSA 4GC4A 3PBYA 2RDWA 2V0TA 3F4WA 5KITA 3DZ1A 1YTDA 5K9XA 3N14A 2WOQA 2YGYA 3S1UA 1TPC1 4NQ1A 3NAVA 4MZ8A 4IMDA 2ZRZA 4TR9A 1H60A 3LHZA 2TYSA 5SWUA 2QDHA 4Z1AA 4G1KA 1WX0A 3TXVA 1AW5A 2GQ9A 4IPJA 4BI5A 1IXPA 1DORA 3DI1A 4MVAA 2E77A 1ADOA 3GKAA 2OT0A 5G2IA 2C0AA 5KZDA 5C55A 1TPUA 5DCBA 3CWOX 4YWIA 1TCDA 3I65A 1OFOA 3E96A 1GTEA 1LM1A 2G95A 4JNMA 2YSWA 3W74A 1I2OA 3G0XA 3IV3A 5F2GA 3IVSA 3PUOA 4YL2A 5G4EA 4O4WA 3N9SA 5CG7A 3TH6A 2PURA 4TU1A 3NQ7A 3QQ0A 3MJYA 3U6WA 3BO9A 2JBMA 3K30A 3BW4A 3G0UA 3ABSA 3W71A 1HFBA 3W88A 4ZQNA 5BNKA 1OHLA 4UCGA 3LCGA 1ONRA 1GVOA 2QUUA 3A22A 1GPWA 1JUEA 3NL2A 3SIZA 4O11A 1A5CA 2NUWA 2TPSA 2EKCA 1G7UA 3UWWA 2QCGA 2F7FA 3WJYA 3USBA 3O63A 4R53A 1TMHA 3LLFA 2J24A 2VEKA 1FWTA 1OFAA 3TQVA 1S5VA 3HPZA 1KM1A 4O1AA 5HMSA 4D2JA 4JY8A 5G1YA 3E12A 4JTFA 2VEMA 3B04A 4DPQA 2E6AA 1LYXA 1QNVA 1RQBA 2ALDA 4GJ1A 3PG9A 2VKZG 3KAOA 2HMCA 4WZHA 4JX6A 4Q33A 1R47A 4FB7A 1Y0EA 3A5FA 1VLIA 1YPIA 3PUDA 2NZLA 1TPWA 1SZGA 4MY9A 1QAPA 1ZALA 3MHFA 3W1UA 5D05A 1A5SA 4HPJA 4NZJA 3BLIA 4BFAA 3IIXA 1EUNA 1B9BA 1FX6A 1T0OA 4O0ZA 5AC7A 4LVGA 1QFEA 2G5WA 1TQXA 4EVZA 4DQWA 3GR7A 3MBFA 3L9CA 2QCMA 4UTWA 1UCWA 1KFJA 1FDJA 4JTEA 2H6RA 5HUOA 3TJXA 4HNVA 4IXHA 1WYIA 1DVJA 4IOTA 1X1OA 4N9CA 1Q45A 2PCQA 1JQXA 2J9XA 2I14A 2PRHA 2WSQA 1DBTA 3TDFA 2Z1BA 3GR8A 4OHQA 1KM5A 2C6QA 5E0KA 2VXNA 2CLLA 2Y61A 4UXDA 5G1TA 3PR2A 2BZNA 4GFSA 2WO5A 3TSDA 1H61A 4KWWA 2RFGA 3MO7A 3LCXA 2CZ5A 3ABRA 1KW1A 1EP1A 2Z0IA 1GYNA 3PB2A 1W37A 3GAKA 3OEXA 2DZTA 2QUVA 1C9DA 1HO4A 1XBYA 3TW6A 3W1NA 3ZWSA 4AHPA 2GOUA 5LZLA 1P4CA 4ORIA 3W87A 2ZBTA 4XZ9A 1NVMA 1Q6QA 4N02A 3TUUA 4RZ5A 3KOFA 1ZENA 1EIXA 1P0NA 4WXZA 5FEXA 2YZRA 3IGXA 1XUUA 1OYAA 3GKFA 4Y8FA 1P0KA 3NL6A 1ZY9A 5CPOA 3G1YA 4JTIA 2YX0A 3PVFA 1VZWA 1H63A 1FXPA 1F2JA 3TFXA 1ME9A 4GUFA 3DFQA 3G1VA 1D9EA 3DHDA 4RCXA 1R46A 1X8FA 3STEA 5ABTA 1LBLA 1VPXA 5D09A 2VFHA 1P5BA 3MHUA 4MIMA 2YYUA 3C0JA 3N2MA 4JTUA 3TSBA 5DBTA 3QQ1A 5H2ZA 3DFOA 5G4WA 5HWNA 1VYSX 1YTEA 3PWAA 2QAPA 1VLWA 4GUHA 4X9SA 5KZMA 3MYPA 3FEMA 4LNYA 2BWGA 4S2CA 3BVJA 1W8SA 3LRLA 3W2NA 1VS1A 3GYEA 3T7VA 1SSGA 3A21A 4Y9AA 2H8ZA 4LVDA 1B57A 3FLUA 2NWSA 3LCFA 1DJQA 1J5TA 2QJIA 4NNCA 3B0VC 3OG3A 4K6AA 1W3TA 1SW0A 3SR7A 3G1XA 2ZDRA 1G69A 5E1QA 1XL9A 1OYCA 4AH7A 4JN6A 3UQNA 3O05A 1QCWA 7TIMA 4UTMA 3W7QA 1JJKA 1OX4A 3HG3A 1TSIA 4S2BA 4R34A 5AYYA 4WX2A 2A2IA 3BLEA 4AXKA 5I3JA 3LRKA 3S8HA 4XKYA 5BOOA 4NX0A 2Y70A 3GNNA 3HGSA 4QJ1A 2X30A 3PBUA 3FA5A 1KM4A 1PIIA 3B0UX 3DU0A 4BWLC 3OBKA 4OV4A 3S9YA 1AMKA 2EAWA 1R2TA 1JRBA 1CX9A 3EX3A 3P7YA 2ABBA 4M6VA 1DQXA 4UNLA 4Z1CA 3S5ZA 5HUPA 1QOQA 2Z6JA 4KFOA 4DEFA 4AWSA 3M5VA 3W2MA 3CEPA 3W2KA 3FJLA 3NR0A 4UR7A 3HGRA 4O14A 3W85A 2A1YA 2DZVA 2FPTA 3PBVA 4LW7A 3TMLA 4RX0A 5CZ0A 3Q2DA 2JGQA 4Y90A 2TRSA 4FNUA 5TBOA 2BSLA 1FDYA 1W3NA 2CLHA 5HR7A 1YLVA 3GNDA 3I7QA 4HN4A 4YXGA 4OGZA 2YR1A 5AHIA 3QW3A 1SO6A 4DF0A 2B7OA 4I7VA 4NJIA 2QAFA 1IXNA 1YYAA 1RQEA 4WOZA 1FCVA 1KFCA 3BV4A 3LOTA 3NVTA 4RV8A 3W7OA 3NQ6A 2WJZA 3PB0A 4NX5A 4MFDA 3EX4A 1C8VA 1OABA 3O1NA 5DELA 3CC1A 5AOUA 1GVSA 1K7XA 3A24A 4K8HA 2J27A 2DJXA 4OWGA 3W1MA 1PCWA 3IGUA 3EEGA 3AO0A 4JIQA 3S5YA 1PVNA 3F1QA 1W5PA 4O13A 3RF9A 4OU1A 4PL2A 1AK5A 4JICA 3UY7A 4O28A 4FX6M 1JCJA 2DU2A 1AL8A 1KM6A 3W6YA 1OFQA 4JS3A 2ZZ3A 3GX9A 5D30A 3TR2A 2W0UA 1BWLA 3VFLA 3VKJA 2ZZ2A 4YLWA 2VEPA 1W31A 2V82A 4K39A 5E93A 3IVTA 2CU0A 4FXSA 3EWWA 4UFKA 4FNPA 4M19A 4IXXA 5AHLA 3FKRA 5F1UA 2WNQA 1KFLA 1WQ5A 3LHTA 3M43A 1SQ7A 3TC7A 3G1HA 2EF9A 4RZ6A 4R7JA 5LGXA 4NJJA 2ZZ1A 5DY2A 3CQ0A 3C8FA 1IIGA 4E2DA 1LRQA 1VJIA 1ME8A 3KX6A 3LM7A 3PULA 4ZQPA 1H7WA 1LTDA 4BI6A 2ZRUA 5HR6A 3L0GA 4Z1DA 4FXRA 5F2IA 2A5HA 1QR7A 3STGA 3C2FA 3L5MA 1LRTA 1SO5A 1EWEA 2W6RA 3OVPA 1W1ZA 4JR5A 3T78A 3LCHA 3QMRA 2FLIA 1ICSA 1TIMA 3SGZA 1JRCA 3W73A 4ICNA 2ZRXA 2Q8LA 3WJWA 3A9IA 1MSSA 5D32A 3HF3A 2Y89A 1KTBA 3ABQA 2ATSA 1O5XA 2AGKA 2OJPA 2ZCGA 2ISSA 4IMGA 1JQVA 1ALDA 1QWGA 4RR4A 1OFEA 3W84A 5MHBA 4DO4A 2YFNA 4JYEA 3OHIA 5CKSA 2X1SA 1OFBA 4TIMA 3IGSA 2V8ZA 3QYQA 4JTHA 1J4EA 4DXVA 1DOSA 4FX8A 2YCEA 3TU9A 3RLVA 2FB3A 4LV9A 4XTIA 5HWMA 1SFJA 4P2VA 1LRNA 3W70A 1KBIA 1TRDA 5HINA 4B5NA 4CQ9A 1KFKA 4Z1BA 3LCIA 3Q37A 1S5WA 4ZQOA 1GVRA 2GVJA 3WK3A 3QRHA 4WOQA 2Z6IA 4ALDA 4YCPA 2RH9A 4O17A 1C29A 3W22A 1W3IA 1TREA 4NU7A 4PODA 1AL7A 5KZEA 1V5XA 2ZRWA 3W1PA 3KVKA 3HOJA 3WK0A 3MI2A 4MFEA 3SI9A 5D03A 4JYFA 3FJ6A 4N6FA 3UXDA 5FF2A 4UFLA 2QKFA 1GOXA 4X22A 1SU5A 3FYPA 1Q6RA 3LRMA 4CNOA 2OT1A 2QCEA 1FUYA 2CLIA 1EP3A 1K8YA 3GK0A 2B4GA 2E6FA 3CEUA 4CQ8A 5D2VA 5C54A 5AB3A 3EWXA 1SW3A 4C1KA 2AQWA 1VH7A 4UMBA 4O54A 1G4SA 3IEBA 3QMTA 3N3MA 3UWYA 1WBJA 5FF0A 1KV5A 4ZQMA 3HG4A 5LHEA 3SFKA 1DKWA 3NNTA 4LOCA 2DORA 3GVGA 3ZWTA 4Z0JA 4FEZA 5CZTA 1ZAHA 1X1ZA 4RLIA 4NZFA 4FNSA 1SZFA 5CPLA 4NVTA 4MLRA 2ZZ7A 2R91A 2Y6ZA 4N9EA 5DXYA 4Y96A 1SO3A 1T99A 2C13A 4UTUA 2C18A 2R94A 4HSOA 3CPRA 4WXYA 4E38A 2NUYA 2HS8A 5IBXC 2WPBA 2VC6A 3UNDA 3LX9A 1EP2A 4KKXA 3QSRA 1GG0A 2R14A 2O7QA 2E68A 1VGAA 3B0PA 4EIVA 4RJEA 5AN7A 4HKPA 2B0MA 1V7YA 1Q6OA 4ADSA 3M7WA 4FX7A 1VR6A 3GXPA 1SFLA 3G1SA 5F4WA 4MLJA 2JKPA 2DZWA 4JTLA 4K8EA 5AFDA 3R2GA 1L2UA 3BK0A 1VRDA 1X6UA 2ZTJA 2NX9A 1ZAIA 3S5OA 3PAJA 3EWYA 1SSDA 2VFFA 2KZHA 3PC0A 3KRZA 5U4NA 1KLYA 3W1QA 1TYGA 4QAIA 5G2HA 4A3UA 2XFWA 4LRTA 1LLWA 3GXNA 2IQTA 4IMEA 3UXAA 3GDMA 1RQHA 2C15A 1GJPA 3UYCA 1M6JA 4O0KA 4H4IA 3UZ5A 3LHYA 4O15A 3NXFA 5CSRA 3DFPA 3RFAA 3UWQA 4WY0A 1F76A 4CNPA 3ELFA 3QJAA 1CW2A 3KXQA 4K7YA 2HTMA 3SW6A 3LHUA 4EWND 1WDWA 1BTMA 2HS6A 2AAMA 5D33A 5KINA 1QOPA 3P82A 3O07A 3TJLA 4M6QA 2ZYFA 4EF8A 3R13A 5HULA 3LTPA 5FEPA 3ATYA 2A7RA 2QDGA 3GDRA 1VCGA 2WNNA 2BTMA 3DH7A 3S0CA 4UTKA 5IM51 4UTJA 2QCFA 4TO8A 2Y7FA 1J2WA 3HGOA 6TIMA 4O8RA 1K7FA 3QSTA 1XCFA 1G4PA 5G5IA 3W76A 1NF0A 5LKYA 3HG5A 3DFNA 4LV4A 2DZXA 3NA8A 3IIVA 3LV5A 3S6DA 3TC6A 3TFCA 3L65A 5AHFA 3A23A 1OG0A 1QPOA 4AF0A 1N8FA 5HJLA 3E02A 3WK1A 3UWVA 3W7DA 3W1RA 3C2OA 3M6YA 5A5WA 4WD0A 3THAA 3G0SA 3W7KA 2A85A 1DJNA 3QPZA 3NQ8A 1OVDA 4FIRA 3F03K 3KVLA 1KLZA 1LDCA 1LOLA 3EX1A 2E5DA 1MEHA 1DL3A 4IQLA 3MP3A 3QEZA 1KM2A 4HT3A 3L67A 4UUIA 2X2GA 3LHVA 2NXGA 5DCDA 2A7NA 3NL3A 2Q8ZA 5LNUA 3G3DA 3O6DA 1SO4A 4LVAA 1XUZA 1OYBA 3P80A 3NPWA 4O52A 1XDLA 4JTJA 1JCLA 1KA9F 2ABAA 4LWWA 4W9TA 2J88A 4RK8A 4O53A 4BI7A 3A5VA 3C56A 3B4UA 4GUJA 1FWWA 3EWZA 4UC5A 1A50A 3UD6A 2RDUA 3PG8A 1TPFA 1OF8A 1FWRA 5FESA 4H6KA 3C2EA 4C1LA 1OX5A 2H8XA 2WV8A 1BKSA 4DO6A 1LLZA 2Y63A 2DZUA 3NQGA 2QUTA 2NWRA 5AYXA 1JCMP 2QCNA 1R30A 1TPB1 1U83A 1H7XA 3TQ0A 1RR2A 4QM1A 3KHJA 4NJKA 1GEQA 3HGJA 2FTPA 3HQ1A 4AHOA 4PC8A 2WSYA 3PM6A 4ONVA 1I4NA 1F74A 3O06A 4LUIA 2I9EA 1H7RA 3W7RA 4UIOA 3M0ZA 3C4UA 3LXAA 4DF1A 3M5XA 1QPQA 1PL9A 1UUMA 3QW4B 4GUGA 1MO0A 1WBHA 3NPUA 4LY8A 3RU6A 3P67A 4UTHA 1B3OA 1T96A 4GWEA 2CLMA 3LLDA 3CIWA 2VFIA 1TTPA 3QC3A 5FEWA 1H1ZA 3CHVA 3EWUA 2OZ0A 2ZRVA 1Q3NA 1F7BA 1EX5A 1DHPA 4AMAA 2CLOA 1XBVA 2C16A 2E6YA 2YW4A 4AEOA 4KWVA 2DJLA 1OK6A 2GQAA 2ZFAA 1UUOA 3W7CA 1QMLA 4QSHA 1VCVA 3W3OA 4E0CA 3P61A 5FF4A 1H1YA 3LBCA 1H62A 4OT7A 1PHWA 3C61A 3SECA 3G1DA 4JXCA 5H91A 3TX9A 2FDSA 3C52A 3QFEA 1Z42A 3C2VA 4N9DA 6ALDA 3W07A 3MI3A 4E2BA 3TROA 4UTWC 4GNJA 4UTIA 1EB3A 3L2IA 1KM0A 1Q6LA 1MZHA 5K7JA 4DPPA 2J9ZA 4LVBA 1OX4B 2QCLA 4L4MA 4WJEA 3S1VA 1ZJIA 1TPH1 3W86A 1VHNA 5AHMA 1TPDA 3B05A 2D73A 3P84A 3N34A 1PV8A 4UFJA 1U5JA 4AAJA 4LUJA 4YCOA 1KTNA 4N9BA 4IGHA 2X1TA 1NAL1 1ZNNA 2QJHA 1GZGA 4Y6GA 3P5YA 3FIGA 3G24A 2CWNA 1VCFA 1DQWA 2FJKA 4L4LA 2I1OA 3NQDA 4BR1A 5F4SA 4UMAA 1TV5A 3HIJA 1H7OA 3DENA 1YXDA 1W5QA 1XM3A 1THFD 3T55A 1EPXA 3P74A 1G67A 4WUIA 3R5EA 2FFCA 1H5YA 4MY1A 3MYOA 3IRDA 1IXOA 3NPVA 3NZ1A 4A2RA 2JKEA 5K2ZA 3Q94A 2CZDA 5EA9A 2A4AA 3TXZA 4GE8A 2CZFA 2NV1A 3EXTA 1ME7A 3MBDA 1OFRA 4FO4A 4A22A 5I3KA 1PHQA 1FDZA 2Q3OA 4OV9A 4JD4A 1M7OA 2TSYA 1I8JA 1FQ0A 2QCHA 4POCA 5DBUA 1KM3A 5A8GA 4TMCA 1OX6A 5LHFA 3I7RA 1W5OA 1AW2A 5L9FA 4XUGA 2PRMA 4M6PA 1JUKA 2ISWA 1K7EA 3C3NA 3P62A 2P1FA 3L5AA 4IUOA 2FQIA 3E49A 1JVNA 2O7SA 2CLEA 1G7VA 4HNUA 1EEPA 5U7SA 4ORMA 3L0KA 5HNRA 2FPVA 3D0CA 2VELA 1KFBA 3IIPA 4JTTA 1FWNA 1KBJA 2E5CA 3P8IA 4O10A 1EUAA 2V81A 3DGRA 2PRLA 1QO2A 3G18A 1IF2A 3N19B 2ZA2A 4FHAA 1LROA 1YTKA 3S5NA 3O8AA 3W7JA 1MEIA 1UASA 4N2YA 1E51A 2Y7EA 3R8RA 2V2HA 5EBUA 5DLCA 1JCXA 4RXFA 3JS3A 4ADTA 3STFA 3T40A 1GVQA 3B03A 4Z0SA 4UFIA 1RV8A 3BG3A 4CQAA 1ICQA 1TTJA 1WOAA 3M41A 3NDOA 5BW6A 4IX2A 4DELA 3V75A 1OJXA 5D2TA 5K4ZA 4I7UA 3W2LA 3QZEA 3PF3A 3CIXA 4JY9A 1XKYA 3CT7A 4LC8A 1L6WA 3M44A 1XBZA 5KTLA 1TPEA 2EHHA 1FCUA 1FWSA 1PCKA 4LS1A 1TRIA 1I2RA 4M7TA 3T44A 1FCQA 2V30A 2OMAA 3NEVA 3TW7A 3AJXA 3O6CA 3G8EA 3BARA 4ZVJA 4O16A 1K8XA 5EL1A 2GVGA 2QCDA 2RHGA 1NEYA 1NFBA 4JDYA 4NUWA 3KVJA 2GUUA 4UFMA 2VFGA 2VOMA 1G6CA 2YXGA 4JX5A 1LZOA 2XN2A 5J5DA 1H7PA 3EXSA 4WQ6A 2V9DA 3NO5A 4MYAA 2NX3A 3UZJA 1KTCA 1TJRA 2DZSA 3HMJG 5EYWA 1XC4A 1YDVA 3EKZA 3W7EA 3BLFA 4PL1A 4FNRA 1XI3A 3HG2A 5C2XA 3HPSA 3O15A 3THQA 4HHPA 1SZNA 5EMUA 3W75A 5EY5A 1JCYA 4PCFA 1RPXA 2CLKA 2JK2A 1ZAJA 3CU2A 2H90A 5AYZA 1RVGA 3VCRA 2XN1A 1OK4A 4JX4A 4YMZA 4I7WA 1JR1A 2QJGA 1FBAA 2X1UA 4RKAA 5CZJA 3TNOA 4A29A 3NQFA 3YPIA 5GVJA 3BW2A 4JTGA 1F05A 4R33A 3LI0A 2DZPA 5BMWA 3UPBA 3OA3A 4IPIA 5KMYA 1M7PA 2JGYA 4HIBA 4FIQA 3NQMA 4O4VA 3MUXA 3NQCA 1LCOA 4UTTC 4XWUA 4JEQA 4M5PA 3Q58A 5F2MA 3LB0A 4TX9A 3TSMA 2ATMA 1A5BA 1GTHA 3GDTA 2Y88A 1Z41A 3DFSA 4TMBA 1GVFA 3OIXA 4UFHA 1R2RA 3M1ZA 4HPXA 4WY0F 4AWUA 4FF7A 5I3FA 2EGZA 2Y7GA 2OX1A 3LERA 3QMSA 1AW1A 2UV8G 4RXGA 3IVUA 4PEKA 3VI2A 3W9ZA 3PS7A 1D3HA 4OQVA 4ZQRA 2A21A 1LBMA 1O60A 3F4NA 2TMDA 5HWJA 4K37A 4ADUA 5DN1A 4O12A 1F73A 2RDTA 5F2LA 5AC8A 1VYRA 3GAYA 4AVFA 3N9RA 1M5WA 1UB3A 3LXCA 3TE9A 5LGZA 5K3VA 4P61A 2GVLA 2P0OA 4JTKA
chains in the Genus database with same CATH superfamily
3SGUA 1WDPA 2FHBA 3RNDA 4QHRA 1GKRA 1QATA 1IT7A 1E6XM 3MHGA 3KVMA 3CGTA 4MPQA 3E0IA 2W63A 4CCCA 3CLWA 2CLFA 3VKKA 1RPKA 3L12A 1NQ6A 4A3RA 2IXUA 4PFMA 2V3DA 5IXEA 2OCZA 4HOZA 4ZZ9A 1KGWA 5DT5A 3S1XA 1YXCA 2PDHA 4XBKA 2VGFA 5AZ1A 5HQEA 1UBSA 1LBFA 2BXVA 4CCDA 1SZEA 2CW6A 1X7IA 4AXNA 2WQPA 3DFTA 4LYRA 1HG3A 2XSBA 4K36A 2NLIA 3ZIZA 4J1OA 4Q8PA 3IJQA 5EKYA 3Q67A 3EB2A 1TPVA 1WKFA 3VM5A 4HCHA 1UWRA 3UPWA 2WMJA 1IYXA 3DI0A 3BG5A 4AHQA 5FCZA 4QNWA 4KFNA 2VZSA 3I7SA 4LT9A 1MRQA 4JNZA 2YPIA 5LNWA 2PDUA 1LQ2A 2OEKA 2ZWZA 1Q8AA 3EZ4A 2WLZA 1CT5A 1RAKA 3OZMA 2VX6A 2J7DA 3H55A 2VC9A 4DWDA 3N3TA 1XR2A 1I60A 3BGAA 1TWDA 5LNSA 3EB4A 1LL4A 3LZ5A 1VHCA 4PTDA 2DGAA 4H6QA 3PSWA 1DWIM 5LNRA 1V0LA 4ZB5A 3NEHA 1XIHA 4K68A 3H2AA 3H2NA 4CN6A 5TIMA 4PBEA 4MYXA 1DTUA 4O50A 2XZ9A 3AU6A 4HU0A 1LJYA 4B92A 4H3DA 2WZEA 3S2LA 2PI6A 3CB8A 5BROA 3S9ZA 3H70A 4MJMA 1L6YA 2Q71A 1NF7A 2GPTA 3INPA 1X6LA 3UXIA 1TO3A 2DEPA 3H2CA 4PTMA 4O18A 3MP4A 3HO8A 4P7OA 1DE5A 3TIMA 2PDWA 4UR9A 3HJZA 4JCMA 3JVAA 4UTTA 3OB8A 1EPVA 4W93A 2D24A 2ZRYA 3LHWA 2UY3A 1NSJA 1H7NA 1OF6A 1HJVA 3VXGA 2HCVA 3VO0A 2GDQA 1D7FA 3E5BA 1BWKA 3UJFA 2XSAA 4EXQA 5F7UA 2WWDA 4X2RA 4AZIA 4B9ZA 1UP0A 4LS0A 2PDNA 2ZZ5A 2A79A 1E3XA 3SY5A 2WB5A 4DO5A 3ITCA 3A13A 1TV8A 3LBMA 3RRXA 4AD1A 1ITUA 4I8DA 4FR1A 2YDAA 4GYPA 5CLWA 4QE1A 3MANA 1Q65A 1R2SA 3SUUA 2Y7DA 4WEVX 5I3HA 3AROA 3W7GA 2ZX8A 5JBDA 3CV7A 3NVDA 3VOCA 1RLDA 4R7WA 5FI8A 3ITOA 1CGUA 1Z44A 2C91A 1R0MA 3EEZA 1SPQA 4NXSA 1EF3A 3SJ3A 3GXFA 3R89A 4DWSA 1RZMA 3L0NA 1W1IE 3CZKA 2GJLA 5AVNA 1BSLA 1W0MA 1W54A 1KQYA 2C14A 3S42A 2HSAA 1OWQA 4FS9A 2ISVA 1KO0A 2H9AB 2V5LA 3LN3A 2YCLB 2RJGA 2VYOA 1JPKA 3MV01 3MA8A 2XVPA 5DXXA 1FH9A 3RX2A 4UNIA 2OEJA 3TYCA 3GXMA 3SFWA 3G1FA 1W3KA 2HPIA 2GQ3A 1KCXA 3DXIA 1V0NA 3LTSA 1LT7A 3P81A 2QPUA 4LF2A 2GL5A 6XIAA 3NQEA 4QIUA 1GVIA 1FCBA 1W9BM 3WG6A 4I90A 1UG6A 2OGYA 1WXJA 4WGHA 4D1JA 1HGWA 4NXKA 3FFSA 1OFPA 3V1PA 5FEZA 1WV2A 1VFFA 4B3LA 1GOMA 5D2XA 1DJIA 3MUAA 2XGBA 3W72A 4FLSA 1K8ZA 3H7RA 5CEWA 2YZ5A 3BICA 3SCWA 2C3ZA 3O0FA 2YFOA 3CQIA 8XIAA 1TR1A 2DH2A 3TP4A 9CGTA 1QDSA 1MZRA 3VDGA 4P8XA 1MQRA 2VVSA 4XVDA 1PZ0A 3GIYA 3EKLA 4MGGA 4FP1A 3M5ZA 3B06A 1F5ZA 3EOUA 3EX6A 1EJSC 4FAMA 3TKFA 3MUZ1 3WKZA 1A5AA 4JGDA 3SQLA 4XD3A 4CUCA 1TUFA 5A8NA 3PZVA 2QJNA 4KPLA 1US3A 2O9OA 4XQ6A 4UZUA 4HNLA 3MSYA 4QDPA 3SZ8A 1F6KA 1MNZA 1JAKA 1R7OA 4AB4A 3R0KA 3CMFA 4HPHA 3LDVA 1I2NA 2DT3A 5I02A 4Q3MA 4GH3A 3VNYA 5BCAA 4S3AA 4IH3A 4UQEA 4I9AA 4I9JA 1RCXB 1DJXA 2NQLA 3VE7A 2A0NA 3LM3A 2IPGA 3N6JA 4INFA 1OZMA 4O57A 3B8DA 1LOQA 5KSWA 5I0DA 3VOJA 3G22A 3PJXA 1GONA 2JF6A 1D7KA 3OBEA 2FGZA 6PTDA 3MUCA 3NOEA 4GYPC 2ZUNA 1ZUAX 2DIKA 4YNGA 4LVFA 2Q3RA 3QF0A 1HKWA 5DFAA 3NZRA 4M0XA 3EKGA 3TYAA 2JQXA 5HNTA 1R3YA 4MUZA 2O55A 4OOUA 3I6TA 2PU0A 1IGSA 1P0DA 1JDAA 3GG8A 1YTDA 5K9XA 2WOQA 2IQDA 3RPMA 3CUGA 4NQ1A 3NAVA 3G6LA 1P43A 1VBRA 1H60A 3LHZA 1Q6EA 1KWGA 2TYSA 4W89A 4Z1AA 3PZNA 4JTAA 2BOFX 1AW5A 4IPJA 3UGRA 4C7GA 4YVPA 2XWEA 4TTGA 3U5UA 4HMCA 5G2IA 4F2TA 5KZDA 1TPUA 4YTSA 1KBLA 3KTCA 2GDVA 3QV8A 1SFTA 4HB7A 1GTEA 4AD2A 1JG9A 3W74A 1VFOA 1I2OA 3PUOA 4YL2A 4DHGA 3N9SA 4DN1A 3KTXA 2PURA 3CUXA 3QQ0A 3DCPA 1MQPA 3MJYA 4J5NA 3ZVIA 3UVAA 2INZA 3BW4A 3W71A 1HFBA 3IJ6A 4MNMA 1XINA 1ZP3A 4UCGA 4V15A 3U3HA 3VIJA 1WDSA 2OELA 4S3JA 1JUEA 1A5CA 3HTWA 1G7UA 1V6YA 4DY1A 4F0KA 3O63A 2J24A 2GJRA 3TYDA 1XLJA 3CYVA 4GVHA 4JQ3A 4I6KA 4Z2HA 5G1YA 3E12A 1S2UA 1EZ2A 4JKLA 2E6AA 3KBWA 2EG6A 4GJ1A 2X7WA 2PS2A 4C6EA 3KAOA 3UJSA 1M53A 2OZ3A 1ELSA 1XIJA 3H2FA 5GNZA 4JHMA 3PUDA 4AX7A 1TPWA 1U1UA 1QAPA 4B3ZA 2SFPA 4QP0A 3CQHA 1VEOA 1UP2A 1LQAA 1EUNA 2AQOA 3S2MA 3UA4A 5AC7A 1DIDA 2G5WA 3CPGA 1TQXA 4Q8VA 4EVZA 4DQWA 3NIYA 3GR7A 4LYPA 4PCTA 1J0YA 1M65A 4NF7A 4JTEA 4J3SA 3TJXA 4HNVA 1RK6A 4TVCA 3VYLA 3AIBA 4IOTA 5DMLA 2F6UA 4IIGA 3AHYA 3GUWA 1Q45A 3DOPA 1JQXA 2WSQA 1TCMA 1HQTA 4FOJA 3GR8A 4QLKA 2Y61A 2BZNA 2VM8A 5CJ5A 3AS3A 3CS2A 3MO7A 3LCXA 2CZ5A 1J0JA 3C2YA 3PB2A 3RMEA 2XINA 4CNTA 1C9DA 3RDKA 4AHPA 1JF5A 2WVVB 2OKTA 1X38A 3SN4A 1PEZA 1NVMA 1UJQA 2FZDA 4RZ5A 3KOFA 3DHUA 2EJAA 3VOIA 1QHPA 1QNRA 1EYEA 1OYAA 2F6XA 3QLDA 3GKFA 3NL6A 5CPOA 3WQ4A 3K1GA 2VWTA 1VZWA 2FHCA 2GJXB 1FXPA 1VEMA 4NAEB 2VP8A 3R0DA 3VD5A 3DFQA 3DHDA 4CD4A 4RCXA 1XCXA 1X8FA 3RM8A 2VFHA 5JUVA 3MHUA 4PRWA 2YA0A 3W0KA 3ZJKA 5DBTA 4ERGA 2VZVA 3PWAA 2WMGA 4X9SA 2DUXA 3T07A 4LNYA 1X39A 3E0FA 1E56A 1VJZA 2BMBA 4GX9A 1W8SA 1AH4A 3W2NA 1VS1A 3GYEA 2BY3A 1O1HA 1XICA 4LVDA 1B57A 1OT1A 2NQZA 2NWSA 2Y24A 4G1NA 1CLXA 1JZ8A 2ZX7A 4BJHA 5E1QA 1LUCB 1EBGA 2QUNA 2HE8A 1JJKA 1OX4A 4C6CA 1XH1A 4R34A 1WE5A 1FVPA 4GK8A 3RCNA 3VD9A 4GOAA 3IAQA 2ANUA 2GJXA 3A47A 4AXKA 4XKYA 4QJ1A 1OCJA 1TR9A 3WZ0E 3FA5A 1XYFA 1PIIA 4W4QA 1RA0A 4IGMA 2GWNA 4OV4A 5JMUA 2EAWA 3P7YA 1E1CB 3GG7A 4CVWA 4M6VA 1DQXA 1K70A 1RSCA 3L2LA 1P0EA 4KFOA 1A5LC 2Z6JA 3W2MA 3ES7A 3VUPA 4ENLA 4UR7A 4ZO8A 2J74A 3W85A 2A1YA 2DZVA 4Q7BA 5CBIA 4MB5A 5AC5A 3BQ5A 2JGQA 4X61A 1TZ9A 4Y90A 4UOZA 2DVUA 2OG9A 1GNXA 1W3NA 2CLHA 1IR2A 5HR7A 3BOLA 3I7QA 3ME3A 4ERAA 3UXKA 2J13A 3T42A 1Y5XA 4OGZA 2V68A 2VDIA 1QHZA 1XIDA 2B7OA 4BZYA 1XIMA 3CZEA 1IXNA 1S2VA 1U1JA 2J75A 3NVTA 1CZ1A 3E74A 2CC0A 5AVHA 1TV2A 4GZ7A 4K8HA 3CV6A 3SUWA 1U5HA 5G4HC 4IQEA 5I7GA 5A6MA 3RJXA 3PZOA 1QI0A 1MWOA 1PVNA 2I7GA 2PDIA 3F1QA 3SCQA 1NDYA 1ADSA 2DU2A 1AL8A 1KM6A 4HYWA 4H00A 1OFQA 4DZHA 4F8XA 2V63A 4WJ8A 3AHTA 1F3XA 3NJ3A 2EKGA 3CV2A 1XLAA 4JFUA 5ECVA 1R3TA 1R86A 3IVTA 2X2YA 3ZVHA 1EXBA 1OCQA 4FNPA 3SB0A 4IXXA 5AHLA 2XFYA 3MKCA 3E0WA 2WNQA 1KFLA 3L2MA 4PUUA 1WQ5A 1FWIC 1TUXA 2C71A 3G1HA 3LEPA 4IJCA 1BG4A 2EF9A 1SR0A 4R7JA 2PP0A 3UF9A 5M03A 4HQVA 2WXDM 2AL2A 3OGRA 5TF0A 4AYSA 3VC5A 3L4UA 4DJDA 3S1GA 2R24A 4XSMA 2NT1A 1V4YA 4F48A 5HR6A 3B97A 4PTVA 4MDOA 2D1ZA 3UT0A 4LB3A 2CHOA 5FKYA 1W1ZA 3T78A 4KQNA 4QJ3B 4Q8UA 2WJFA 3WDQA 1KNWA 3QMRA 5D9MA 1XSJA 2BFGA 1JRCA 3FVDA 5FJIA 2ZRXA 1HJWA 1R6WA 3WJWA 3WO8A 3A9IA 3VK5A 4DVOA 4KS0A 1XPGA 3GH7A 3AJ7A 1KTBA 2Z29A 4HP5A 4HA3A 2ATSA 4CD6A 2ISSA 4IMGA 2E28A 1ALDA 1ZS2A 1QI3A 3OVGA 4RR4A 5AC4A 4JYEA 1OFBA 4GJJA 2V8ZA 4NAFB 1VEPA 3UERA 3O6AA 3AC0A 2V69A 2WWCA 4GLEA 3N17A 4ATDA 4J3XA 4P2VA 4C5ZA 2BNJA 1KFKA 2PTYA 3LCIA 4HMDA 1GOKA 3QRHA 4YCPA 3R25A 4O17A 4YTTA 3W22A 4P5UA 2XSXA 3MI2A 1JPIA 2NV9A 2BASA 2DUAA 2X09A 5D03A 3XISA 2BG5A 4TV6A 4CU6A 4HGXA 1XSKA 3MCOA 1FWGC 4KWSA 3LRMA 2GFTA 1AUSL 4HD5A 2QCEA 2CLIA 1EP3A 1B0IA 2E8ZA 4CQ8A 2EPLX 4X0VA 1SW3A 4O54A 3EMQA 3QMTA 3N3MA 4AIEA 4E3TA 4GA8A 1DKWA 1BXBA 3GVGA 3ZWTA 4GIYA 4WRHA 2Z27A 1ZAHA 3PZ9A 1X1ZA 4RLIA 1SZFA 3AIUA 1VD6A 2PDJA 4MLRA 2ZZ7A 3B9DA 1V6WA 4DZAA 3BANA 3CJPA 2FGBA 4RNHA 3S3GA 2R94A 2NUYA 2HS8A 2VR5A 4EAMA 4ICMA 1FWBC 1W9VA 4QEHA 3RPTA 6REQB 5IBXC 2OYLA 3VC6A 2VC6A 3CUHA 2R14A 2O7QA 4EIVA 5AN7A 4HKPA 1JAEA 1V7YA 4ADSA 3M7WA 1VR6A 5LIUX 1SFLA 3G1SA 4MLJA 4F9DA 2JKPA 2D2GA 4L9YA 5GPRA 3UR7A 5AFDA 3R2GA 1L2UA 4WDXA 2NW0A 1XLDA 1ZAIA 3MSDA 3S5OA 3EWYA 2VFFA 3PC0A 5E6ZA 4B3KA 5EFFA 3GO2A 3W1QA 3M6DA 2XFWA 1LLWA 1G0CA 4KETA 3VNLA 3E2RA 4O0KA 4DZ5A 4QS6A 3A3WA 1XX1A 3UWQA 4IIDA 3WL1A 3IJ8A 2PEVA 3QJAA 3KXQA 1PWMA 3DC0A 2HTMA 3SW6A 5A8OA 4EWND 4GQBA 3PPHA 3RRAA 3BAYA 1G94A 4R88A 4UBPC 3ITLA 3UJEA 1X96A 4DBUA 4H6RA 4EF8A 3LTPA 2QDGA 2WNNA 3WFLA 3KUMA 5J04A 2OZ8A 3DH7A 2WMFA 4UTKA 1JL8A 4KCUA 5IM51 4UTJA 1Q5MA 5EMKA 3SUTA 2ADAA 4O8RA 3T8LA 1VPQA 4WHBA 4MPKA 3QSTA 5XINA 4XAPA 2ZUSA 3HG5A 3EYPA 1AJ0A 4IP7A 4KCVA 3VX0A 3PNZA 3S6DA 4D72A 4GYJA 5GJPA 1UQYA 1DIKA 3VIKA 2PWDA 3E02A 3LUTA 1K6WA 4NRSA 3CQJA 3C2OA 5A6SA 1K1DA 2RGMA 3QPZA 2XH4A 1RBOB 3WBEA 1OBAA 1Q63A 3Q45A 3F03K 1BWVA 1LDCA 2E5DA 4IFKA 1MEHA 5CC3A 2CBVA 4UUIA 3L67A 2ACRA 5DCDA 2A7NA 3UG3A 3PPGA 5KETA 1SO4A 1XUZA 3P80A 4UWMA 3NPWA 2ZIDA 3N12A 1QNPA 3FSUA 2W27A 1JCLA 2HZGA 4GBDA 3EDEA 2CPUA 2G3FA 4LWWA 3UYIA 1F9CA 4G5DA 3ZJ7A 1OC5A 3A5VA 3B4UA 4UC5A 1FWWA 1NP0A 1Q2SA 3PG8A 1CGWA 5FESA 4H6KA 4ACZB 1R3SA 4GQRA 3C2EA 4C1LA 2WV8A 4DO6A 3NCOA 1JXKA 1UA3A 2DZUA 2NWRA 2XIJA 4HVXA 2QCNA 4WF7A 1C92A 4OJYA 1H7XA 3ONBA 3VABA 4QM1A 4HNCA 5A95A 2FTPA 5BU6A 1E9ZB 3AHVA 3PM6A 4W8AA 3IRSA 1R38A 3ZXWA 3MC5A 3LXAA 4DF1A 4IPNB 3WNLA 2ZVIA 3O0KA 2IXVA 4ROPA 1XLIA 1T5AA 3RU6A 3P67A 4D6CA 4MM1A 4UTHA 3VMNA 3WBWA 1DJZA 3C86A 1IHIA 4GYFA 2VFIA 4GXWA 5FEWA 3UBPC 3REQB 3PTMA 3EWUA 4JQ2A 3WMCA 1S46A 2ZRVA 1EX5A 1DHPA 2CLOA 4Y9PA 2C16A 4AEOA 4HU3A 3OG2A 1OK6A 3OHMB 4ZOBA 3CYJA 4FXJA 4W8BA 3W28A 3VGFA 2HISA 5FF4A 2HPMA 3LBCA 1ZCCA 1H62A 1PHWA 3APGA 3C61A 4F3HA 3NOYA 3M46A 4JXCA 2FDMA 1CLVA 3V16A 3LSCA 5CSYA 3C2VA 3BURA 3SUVA 2YOCA 3W07A 1IWPA 1YX1A 1EB3A 3L2IA 2P3EA 1LWJA 3SUSA 1UR9A 1E3ZA 4AZGA 2J9ZA 3UZZA 1OX4B 3N25A 2R1NA 1Y5WA 1QW7A 4WJEA 3S1VA 5ABEA 4D6IA 2HJPA 1VHNA 1TPDA 1A5MC 4IQJA 1Z7AA 1U5JA 3EA1A 4L64A 4LUJA 4YCOA 4HSHA 3GIPA 4B4FA 2BVYA 4AWEA 3L4TA 1NAL1 3ZT5A 2X41A 2QJHA 3UCQA 4HZ8A 1VCFA 3MO4A 4RPPA 4LCSA 3ARZA 3TWBA 1BQCA 4YYCA 4UMAA 3KRBA 4AFYA 2OSYA 3HIJA 3TTQA 2DPEA 1EPXA 3P74A 4NYYA 1HN1A 3D3AA 4XZMX 1E6RA 1BSIA 3NPVA 3ARYA 1J6OA 5B7YA 4A2RA 2JKEA 2O9RA 4F79A 2UY4A 2A4AA 5T91A 3N15A 4GE8A 1J0KA 1CXLA 2XZ7A 4QQUA 2NV1A 1KWKA 3EXTA 2OGJA 5CBBA 4FO4A 1UP3A 4XO6A 4GG9A 1Q7ZA 2QGYA 2UWFA 1RCOB 4IZGA 3GNOA 4OV9A 3IPWA 1UKQA 3GHSA 1BRLB 3LPGA 4XG1A 2PF8A 5L9FA 5JBFA 4M6PA 2FFIA 2ISWA 3UCCA 3P62A 2P1FA 3L5AA 4IUOA 1XLGA 2O4QA 2CLEA 1G7VA 4GIAA 2NVCA 3QXBA 2DT0A 5CSUA 1KFBA 4IFOA 1FWHC 1EUAA 2V81A 1BHGA 1JF6A 3VUSA 3S5NA 4YYFA 3SCNA 2W4XA 4N2YA 4BQ4A 2ZUWA 4NIRA 3V0TA 2ISFA 5HNNA 5C2GA 4RXFA 1GOQA 4UB9A 3T0CA 1L8PA 4Z17A 2Y5SA 1N2VA 3FAWA 1GVQA 4EXBA 1CTNA 1ICQA 1X8CA 3M41A 3XIMA 4LBUA 4QXIA 1JD9A 3W6MA 4U10A 3PF3A 2FMNA 4C1NA 3KZSA 4JY9A 2OO0A 3AZSA 1TRIA 3NEVA 9XIAA 2OMAA 3FHQA 1ECEA 3AJXA 2QMJA 3GR4A 4XZHA 1YE4A 2XWDA 3FY1A 3BMWA 2E67A 1OSEA 4O16A 1K8XA 4AVNA 2QCDA 1Z89A 3V5CA 1NEYA 1XGZA 1VBHA 4JDYA 3KVJA 2GUUA 1G6CA 4JX5A 4PMYA 3MMUA 1LZOA 3THUA 2OODA 1GW1A 3GD6A 3KL0A 2NX3A 4R9XA 1HX0A 4C65A 1KTCA 1OD0A 3N4FA 3N4EA 5EMJA 4P7RA 1GCYA 3EKZA 1VBJA 4XD4A 4Q8WA 2BXYA 3LBOA 3HG2A 1BF2A 1S38A 5C9XA 3HPSA 3O15A 3THQA 4HU4A 2PU1A 3W4RA 1JZ2A 2YB4A 5EMMA 1TKKA 3GBEA 4H19A 2VT0A 2WHLA 1OADA 4L65A 2FH8A 3TTEA 8RUCA 5AYZA 2GYIA 2XN1A 1OK4A 1O6IA 1ESWA 2EXOA 4JX4A 1JI1A 5CZJA 3MSGA 4RKAA 4B5XA 3NQFA 1T7LA 5D8WA 4D6EA 4WVXA 1F05A 2JEPA 1W2VA 2CEQA 4FIQA 1E4LA 3QY7A 1EJWC 4H7VA 3H7VA 1UZ4A 3EOOA 4WKAA 4JEQA 5F2MA 1XRTA 3KOYA 4BQ3A 3LB0A 3TSMA 5JH1A 3GDTA 1WPCA 3VIOA 4TMBA 1VP5A 4F4RA 4G7EB 3T6CA 1NOUA 1LUCA 3M1ZA 1JPMA 1UKSA 4Q7IA 3WF3A 4J35A 3NUKA 3LERA 2W67A 3W9ZA 4OQVA 4AZ7A 1RHCA 2DVTA 4ZQRA 2Z1WA 3DG6A 1LBMA 1O60A 2O0TA 4L6DA 1JFXA 1F73A 1IZJA 4CQBA 4PSPA 4ZE4A 4DXKA 2RDTA 1AH0A 5F2LA 1VYRA 1JDCA 4AVFA 1NOWA 1UB3A 4DJFA 4I5XA 5HAOA 4PBFA 1XKJA 4J28A 4JTKA 4NG3A 4IJBA 2WSRA 3OLIA 2REQA 3RX3A 5C7VA 1CI1A 5D9OA 3FA3A 1GT8A 4MKNA 4MWAE 2NQ5A 1IXQA 3M16A 5FD0A 1S5TA 3M9YA 3NM3A 3WLLA 4H8VA 1QTWA 1HVXA 3VD4A 1D3GA 3GC5A 1EDGA 2D22A 2A6NA 4TXEA 1K03A 4JQ1A 3OODA 1JZ4A 3AMGA 1SW7A 3R12A 1G4EA 2FH6A 3OZPA 4A21A 2EPNA 4KBXA 3I6RA 2WSPA 1J79A 1HGYA 2X16A 4NL1A 1F6PA 4GUIA 1YXYA 5C6MA 3TJIA 4JOMA 4Z08A 3T2OA 3URQA 6ENLA 2PDFA 3RPDA 1UD4A 2I57A 3HFTA 3LD5A 1TWWA 2W5FA 3VVGA 5C2CA 1YDNA 5DY3A 5I07A 4CNSA 1NH6A 2EPHA 1UPPA 3MWAA 4IMCA 4F9JA 4NT0A 3QFWA 1AD1A 2VD9A 5REQA 2O56A 4A6GA 3DKJA 1LOSA 3O3RA 1IEVA 1XG4A 4N6EA 2DZAA 3FAXA 3RIKA 1MXSA 4PB4A 4D6GA 2NSXA 3II1A 5FIPA 5I06A 3JRKA 2FMOA 3OLGA 4XTDA 3PBGA 1AMYA 2PTDA 3VMPA 2OYKA 3ATZA 1UC4A 3SSJA 2E8YA 3AS0A 1A53A 3LXBA 2E9BA 3VNMA 1KRBC 1IWBA 1VF8A 3A12A 4GH1A 1HUVA 1LP6A 1E72M 1HW6A 6CGTA 2ZA1A 3I6EA 3N2XA 4S23A 4J9JA 2CHNA 2P0IA 4EOUA 4WCJA 1DWAM 3KRUA 2DUZA 1BVNP 1UMYA 1OEPA 1NU5A 3ISIX 4PTNA 2QW5A 2J7BA 3MUY1 4XKYB 2YA1A 3S6TA 4ZQCA 2JIWA 4JQ4A 3R10A 2OKOA 4V28A 2ZX9A 4LS2A 4WY0B 2FB2A 2PDYA 1LG2A 3OIHA 1TE6A 3W1AA 3W7IA 3U5YA 2PGEA 1ZRQA 1S39A 2VOTA 1ZFJA 4EF9A 3CM4A 4W85A 1UWSA 5L6UA 4UCFA 3P14A 4BHYA 2O9TA 3CL7A 5I5RA 2Z00A 4LALA 1EGMA 2B7QA 3DKLA 4JIPA 4FK9A 3PBWA 5I00A 5AY7A 3AMCA 5JXQA 3W7LA 4LRSA 4H7CA 1OB0A 1UKTA 2W9MA 3RJYA 2J7GA 4B9YA 1PTDA 4XKMA 3TMQA 4EX4A 5ABHA 2OVLA 2Y85A 5ABGA 5I3IA 1A3HA 1QPRA 3GB6A 1NELA 2NX1A 1W2PA 2PDGA 3G8RA 4MY8A 3IIZA 4BCEA 1ZQ5A 1E1FA 4JYDA 5H1WA 2GLKA 4LUYA 5D38A 2VFDA 5T26A 3GVQA 1KXTA 2LLEA 3SCTA 4DM1A 5FL0A 2FPYA 1JDDA 4UQDA 3UG5A 1L6SA 4DJFC 3K2GA 4S3BA 5CSSA 1FHVA 1G4TA 2ALRA 4A3HA 3WYZA 3FOKA 2WBKA 4DZIA 2XFFA 4OE7A 2WNZA 1JULA 3K4AA 1XRFA 3L66A 3UR5A 5LSMA 3JUGA 3KOWA 3RR1A 3CASA 1US0A 3WD0A 2XIQA 1C9WA 4HNNA 4NI3A 4C6QA 3P8JA 2QVNA 4UMCA 2QCCA 3STCA 3WMLA 4JTQA 4CNUA 4IIHA 1L2QA 1OFDA 5HMFA 4FF5A 4JL1A 3PNUA 1B3ZA 2ZZ4A 2PLJA 2C1HA 4DI9A 4RUBA 3C6CA 4C1NB 1XGDA 3T09A 4HOWA 4O19A 4PMVA 1VENA 1LT8A 3RGTA 4KCWA 3FJ4A 3BXWA 1HO1A 1QPKA 1EC8A 4PB5A 2X05A 1J12A 2WCSA 1EJVC 3CZJA 1E4NA 1ZL1A 2Z1KA 4UNKA 4S1FA 1G5AA 3BW3A 3TA6A 5AC6A 3K8LA 1N55A 5BWAA 5I6SA 2WHJA 1DWHM 3CHFA 5LA1A 1NARA 2JF7A 1B4EA 3WK2A 5FJOA 4H83A 2ZUUA 1KRAC 3W1LA 2VEIA 4GC3A 3IIOA 2QMKA 1FHDA 4M29A 3TN5A 1DJYA 1IE7C 4QLLA 4QAWA 3W00A 1YNYA 3ID7A 3UR2A 4DBEA 3MP5A 1XDJA 1W3LA 3SO7A 4J2MA 1RD5A 4K2SA 4HPNA 2QCDB 3MMTA 4GO9A 3QBUA 3D6NA 4E4UA 2E09A 1HL2A 2E1DA 1TJPA 3RK8A 3LTYA 3NQAA 1DV7A 4IPPA 1QPNA 1UOKA 1N7KA 4Z2JA 3E0LA 4AIBA 4LC6A 1RJQA 3NQ2A 1O95A 4MTVA 4AZHA 3ZR4A 1P7TB 3NDYA 5J8LA 3RM9A 3U7BA 1KFWA 3P60A 2QIIA 1B4KA 1EA0A 1TQJA 4GC4A 3E3HA 4RE3A 4A3QA 3DZ1A 3WBAA 3N14A 1AH3A 1B9ZA 1TPC1 4C6OA 3FNDA 2ZRZA 1GQJA 4TR9A 3W37A 4O0QA 1WX0A 3AS1A 1O5QA 4BY3A 1W3HA 2WZIA 4UOQA 5C55A 3CWOX 4L6OA 2OWXA 4MG4A 1J5SA 1TX2A 2E7FA 2G95A 4JNMA 2XFRA 2I16A 3G0XA 4HZ7A 3PAOA 3EPNA 4O4WA 2DV0A 3T2QA 1W91A 4TU1A 3ZJ8A 2Z25A 2EG8A 4B90A 2JBMA 2PFHA 1GZ1A 3K30A 1AJ2A 4ZQNA 5BNKA 3LCGA 4MMWA 2YL6A 1ODUA 1T6MA 1ONRA 3A22A 1XGEA 3NL2A 3SIZA 4O11A 2WBGA 3QGKC 5KZ6A 3WJYA 2PTXA 4R53A 4W5UA 4H6EA 1PDZA 2WMIB 4WSJA 2GVYA 3TQVA 1S5VA 2WVSA 2ZE0A 4JY8A 3WL0A 4AY7A 1XQKA 3B04A 3T9PA 3EGJA 3N2TA 1QNVA 3LPFA 2ALDA 4MNJA 2D2HA 2IKJA 4H9YA 1IZCA 4JX6A 5GJNA 4AVOA 3GTFA 3BZJA 1GOWA 2OPJA 2WJDA 1R47A 4FB7A 2PLMA 1GKPA 3GM8A 3WLHA 4JQAA 2NZLA 1JNDA 4LYQA 3ZO9A 1ZALA 3MHFA 1RP8A 5HATA 1A5SA 1AZ2A 4HPJA 1GKQA 1FWFC 1T0OA 1QFEA 3O7UA 4I5RA 3UZYA 3A6OA 1MUCA 3NO3A 4G9PA 1TV3A 3GG1A 4HYVA 1UCWA 3FGCB 4H01A 1FDJA 4QG6A 3UZWA 4H1ZA 1EO5A 3R8HA 3M0MA 3CO8A 1WYIA 1DVJA 3BUVA 2W3ZA 2PCQA 1RVKA 2PDPA 2F6KA 3EA3A 4OHQA 1CPUA 1KM5A 4UXDA 1TA3B 4GFSA 3BOXA 1V3KA 4ZEPA 4OUEA 1EP1A 4PUJA 1UD3A 3GAKA 3BMVA 3OEXA 4IFKB 5ABFB 1Q4WA 3KBSA 3W1NA 3ZWSA 1W1PA 4ORIA 4ZE5A 4XZ9A 4NAEA 3TUUA 1EIXA 1P0NA 2Y1HA 5CXPA 4MKVA 5I2UA 3RYSA 1WO2A 1ZY9A 3BQ6A 1UR8A 1EX1A 1PAMA 5BOEA 3QLLA 1H63A 1RK5A 1SZRA 2CESA 4D6HA 7PTDA 3TFXA 3GNPA 1D9EA 4G6CA 1EJ7L 4FXFA 5ABTA 4D8LA 1RY8A 5D09A 5C7HA 3WUGA 2X42A 3C0JA 4JTUA 4L9ZA 5BXPA 5H2ZA 1VYSX 2UY2A 3N2CA 2XH0A 1VLWA 4GUHA 2X0SA 4DX3A 5KZMA 1ISVA 1FWCC 5HPOA 1ZU8A 3DYOA 2WMHA 3KEHA 3EDKA 3BVJA 4URIA 2ZC1A 3WN6A 5REQB 3LRLA 1UC5A 3ITVA 1CXFA 2G50A 3QZ6A 4L1WA 4Y9AA 4ZA0A 2BVWA 5I09A 2H8ZA 1F4AA 3G5EA 1UQZA 4ZOCA 3WH9A 1QK0A 3B0VC 4NNCA 3THCA 3OG3A 4DWSC 4K6AA 1W3TA 2R1LA 4LUTB 3G1XA 3SR7A 2ZDRA 4AY1A 4KT2A 1W1B1 1Q13A 4S2BA 1J6PA 4JIIX 2OO6A 3FDKA 3DFYA 1V93A 5DRIA 3IARA 3UP8A 4UQBA 4DAIA 2A2IA 3H21A 3HQPA 3CAQA 4NX0A 2X30A 3PBUA 3VIHA 2X1IA 3NQBA 1KM4A 3FHAA 5JH2A 1E73M 2PMQA 3UU0A 4BWLC 4J3VA 3BH4A 1R2TA 4HCDA 2X40A 3EX3A 4J40A 5A2AA 5A6BD 4UNLA 4RDVA 4JPGA 1VFMA 3F2BA 3ZSTA 4DEFA 3W2KA 5IDIA 2Z4GA 2ACQA 3HGRA 4O14A 4LW7A 1B30A 5CZ0A 2WC4A 2TRSA 5TBOA 3WCZA 3GE7A 1H41A 1FDYA 2VVNA 2DVXA 3B8TA 2WLYA 4A8IA 1A4LA 5DO8A 2ZUTA 1JZ6A 4HN4A 4C6IA 4XZBA 4S3FA 5AHIA 3QW3A 1QUMA 4DF0A 3D5HA 1E0TA 3GNXA 1RQEA 2VX7A 5AZ0A 1XRVA 4NX5A 1FFQA 4ZO7A 3T0TA 1C8VA 1OABA 3O1NA 5DELA 2ZX5A 1C8QA 2CITA 3MS8A 3AYVA 4ATLA 1Y7VA 3HU7A 3M7SA 2DJXA 3W1MA 4AC1X 3IGUA 2YBTA 5DMMA 4JIQA 3K46A 1W5PA 4O13A 1CGXA 4OU1A 2VC5A 4PL2A 4LX4A 3UY7A 3QR0A 4FX6M 1JCJA 3WNMA 2WPGA 1RBAA 3W6YA 3PP7A 1XYLA 3FK4A 5D30A 3D47A 2ZZ2A 4NKCA 4YLWA 2ASHA 2CNCA 3ARSA 1E55A 1S2AA 2V5DA 2V82A 3HQNA 2YXXA 3B8IA 2VZOA 4MNKA 2VMFA 1KR0A 5F1UA 1QBBA 4HHMA 4D1IA 1UH3A 2J66A 5D9NA 3LHTA 2X0HA 1UWIA 4RE0A 4CVUA 2JALA 4E4PA 5LGXA 1S2TA 1EC9A 1IIGA 2G3MA 3CL6A 4E2DA 5FAGA 3BAIA 1EKOA 1VJIA 3KX6A 4H04A 3KWXA 2Z7KA 1HL8A 1QR7A 5HA7A 4CCZA 2DQWA 4JR5A 4YHGA 1R3QA 1ICSA 1TIMA 3SGZA 1JPHA 3H2OA 4ICNA 3M0VA 3BCJA 3GQYA 3SRFA 5D32A 2WCGA 3V4BA 3ZZ1A 4QG9A 3KHDA 3ABQA 1XWYA 4G7EA 5IHRA 1OFEA 1QK2A 2FTYA 4LCRA 5CKSA 3K13A 1WKEA 2BHUA 3S2NA 2ZXBA 3MPGA 3GVRA 4CD5A 4KF1A 3QYQA 1VB9A 4AZ5A 4JTHA 1J4EA 1EIBA 1W6TA 3TU9A 2FB3A 3NDZA 1L6FA 1P6BA 4PB3A 4IIEA 1F07A 2I56A 1SFJA 4PUNA 4LNCA 4Z1BA 1V77A 3ARPA 4Z2KA 1CENA 3TTOA 1W9UA 4ZQOA 4NP7A 4LUSB 4QEEA 2QXWA 2RH9A 1CXHA 1VFHA 3WH6A 1W3IA 3NZPA 4PODA 4GKTA 1BTCA 1V5XA 4DUOA 2ZRWA 4MFEA 3SI9A 1MI3A 3WF4A 3POCA 4JYFA 4C90A 3FJ6A 4UFLA 3RUBL 3CUIA 4X22A 1VFTA 5I79A 3JZUA 3TTSA 2OT1A 3IJDA 1DXIA 2Z7GA 1K8YA 3GK0A 1HJSA 3GVWA 4DUVA 2GGIA 5C9ZA 2J7HA 5C54A 4C1KA 1VH7A 4H8HA 3N6HA 4IT1A 3IJIA 3GXIA 5FF0A 1KV5A 3HG4A 5LHEA 2R6OA 3NNTA 2XH7A 4YJ5A 1FKWA 3P93A 3UNTA 3NSNA 4L61A 5CJNA 4GX8A 2PDBA 3QN3A 4N9EA 5DXYA 2UBPC 3QOKA 4UTUA 7ENLA 1DTNA 1GQLA 2XG9A 4FLRA 4HSOA 4J2PA 2VDHA 1K8CA 3AUOA 4QROA 4V27A 1B54A 3W26A 3LY0A 3VGBA 3UNDA 4I5UA 4GVIA 1O68A 3B0PA 1VGAA 2B81A 4W88A 4ZXLA 4LF1A 3MUIA 1JD7A 1Q4NX 1EA9C 3VDCA 3EOEA 1E6ZA 3GFXA 5IHSA 4DYKA 3T08A 2WJEA 4JTLA 3U2CA 3UJ2A 5HPCA 1ITQA 3BK0A 1X6UA 4BS0A 3KBNA 4MUPA 2WM0A 5DF0A 1CGTA 4JTDA 1E5NA 2KZHA 4K1WA 4C6JA 2D69A 3KRZA 4XVEA 1KLYA 4JTCA 1IEWA 1TYGA 1B3YA 4QAIA 5G2HA 4A3UA 4WR3A 1A80A 5I3DA 1BYBA 4GYKA 5CC7A 2ZADA 1RQHA 3W82A 1GJPA 3UYCA 1M6JA 4ZOEA 3J7HA 2I17A 3UZ5A 3LHYA 3NXFA 1GEHA 2Q6ZA 5CSRA 1D8CA 3RFAA 1QU4A 3N11A 4WY0A 1F76A 5BXRA 3GG0A 1XHGA 1CW2A 4PTWA 3I3EA 3SN1A 3LHUA 1BTMA 1WZMA 2HS6A 3VD7A 3VIIA 1BVZA 3TJLA 2ZYFA 1SJDA 4GY7A 5M5DA 1Q7MA 2A7RA 2BTMA 2D2JA 3S0CA 2VR4A 3PJWA 1KGXA 1TJ1A 4Q8MA 2Y7FA 4MJ2A 1J2WA 4GQGA 2GVEA 6TIMA 1F3EA 2YBVA 1K7FA 1T8QA 5G5IA 4GMEA 5LKYA 1KCZA 2J78A 2D20A 1B3XA 1V03A 2ZXAA 3IIVA 3NA8A 3L65A 2OSXA 5AHFA 1KCLA 2QZRA 2VZUA 1QPOA 4AF0A 1N8FA 5HJLA 1JDEA 1IEIA 3WK1A 3UWVA 1Z69A 3W1RA 3M6YA 4Q4RA 3G0SA 4GI8A 1DJNA 2YL8A 4FIRA 3KVLA 1RJPA 5E0FA 1LOLA 3VM7A 4IQLA 3QEZA 1HP5A 2BHYA 5EBAA 2X2GA 2NXGA 3KE0A 4Q8NA 4J3WA 3NL3A 3U48A 4KIRA 2Q8ZA 3G3DA 4EK7A 4J27A 4WK9A 3SCPA 4O52A 3GS6A 4JTJA 1XLBA 4PMOA 1JGMA 2VRJA 1FTXA 4W9TA 4RK8A 4O53A 3EWZA 4AD5A 1A50A 1OF8A 2Y4SA 4HA0A 4GQQA 1H3GA 3Q65A 5GJMA 3VNKA 3NQGA 4J3ZA 2D3NA 2QUTA 1KKOA 1JCMP 1R30A 4GACA 3BTNA 3KHJA 5CPSA 4ICCX 1K4GA 3HQ1A 5LA0A 4AHOA 2CBIA 4XB3A 1F74A 2I9EA 3HQOA 3WMBA 1ISZA 2E4TA 3GC4A 2QPXA 1S5MA 1QW9A 1KC7A 2XPKA 4V1YA 2PBOA 2C0HA 3QW4B 5LIYX 1AZ1A 4GUGA 1WBHA 4IM4A 4LY8A 1PX8A 1ZB5A 3LLDA 3TCSA 5C9WA 1PDYA 4P8WA 1H1ZA 3CHVA 2CKRA 3QHMA 5D4YA 4M56A 3M64A 1XBVA 2BXZA 4KWVA 2GQAA 2BODX 1QMLA 2IPFA 4M82A 7CGTA 4XK2A 3SECA 2VEGA 2Z26A 3BLLA 3C52A 4GIRA 3GYCA 3MB9A 1M1BA 1WNOA 1JEZA 4GNJA 4UTIA 4RNFA 3WLIA 4PUMA 1MZHA 2E40A 5IOBA 1F4HA 3PJUA 4QE5A 1BXCA 1LF1A 4HJFA 3OQEA 1I0BA 1TPH1 3W86A 5AHMA 1ONWA 3H4WA 1JCTA 2NQHA 3N34A 3EWCA 4AAJA 4YHEA 1UWQA 2NVDA 4IGHA 5JU6A 3TJ4A 1TG7A 1GZGA 3P5YA 5T9CE 3AIVA 3CHCA 4TX6A 4DUXA 2I1OA 1C93A 5F4SA 4W87A 4H9ZA 2C8NA 4DJED 4A4AA 4ERIA 1TV5A 1FA2A 1BF6A 3T55A 3BOFA 4WUIA 4MAZA 2FYMA 3R5EA 3PUGA 3RO8A 3NZ1A 1CIUA 4Q6XA 3T0DA 5K2ZA 3Q94A 2CZDA 2PZ0A 3CAWA 3H8AA 3ZLGA 1RLCL 1TWSA 3QR3A 3LZ3A 4WSKA 1OFRA 3IS4A 3MKKA 2Y8VA 4MWAD 5LIKX 3W01A 2Q3OA 1F3TA 3NYDA 5CG0A 3PK7A 1I8JA 2ACSA 4E6MA 4E8GA 2PWUA 4A8LA 4POCA 3CBWA 3VOHA 3PZTA 2A3LA 4TMCA 2PCEA 3M0LA 1AW2A 2DW6A 2PRMA 2GGEA 1EHAA 4C6NA 3DYPA 3E49A 1JVNA 4Z2IA 3R8GA 4FPSA 4H8NA 4JTTA 1FWNA 1RD6A 3BMXA 3P8IA 1KBJA 2VWSA 2PD9A 4N42A 3R7MA 3DGRA 2ZX6A 2VL4A 3GFZA 3R94A 1QO2A 1HKVA 2ZA2A 1W3JA 2HV5A 1V0KA 2CHRA 3N1AA 1H09A 3O8AA 1YQ2A 4H9VA 3K1DA 4PCSA 3SSZA 1T41A 4N0RA 3P3BA 3E2SA 2V2HA 5DLCA 3MWCA 3CZLA 4OBRA 1YIXA 4ACYA 3T40A 3B03A 4AG0A 3PZIA 3MVIA 1P6WA 4BF7A 4IX2A 3V75A 3F2DA 1OJXA 1WXZA 1ENUA 5D2TA 5XIMA 1R3VA 2J79A 3W2LA 3E0VA 3AXIA 2INFA 1PZ3A 1JYNA 1E9LA 1XKYA 4LC8A 1L6WA 3OPSA 1NDWA 4JHOA 4KEMA 1XBZA 5KTLA 4H41A 4H7ZA 4QGCA 1OG6A 4ZODA 4LS1A 1I2RA 2DSZA 4M7TA 3BV7A 4F0LA 1P1MA 3TW7A 3W24A 3O6CA 3G8EA 3BARA 3PZMA 4ZVJA 1Q2RA 1ZBVA 2V3EA 2RHGA 4GZIA 3MCNA 1NFBA 4NUWA 3MDUA 4UFMA 3WLPA 2VFGA 2VOMA 1JIBA 2YXGA 1X1NA 3DHPA 4P8VA 5J5DA 1H7PA 3RAOA 3NO5A 1EGZA 1NWTA 1TJRA 3HMJG 5EYWA 1S2CA 1XC4A 2WVVA 3VD3A 2J7CA 1CEOA 3SN0A 4ZO9A 3MMWA 4HHPA 1SZNA 4NZ5A 3IJ9A 4PCFA 1ONXA 3NZQA 2CLKA 2JK2A 1ZAJA 3CU2A 2H90A 2QS8A 3VCRA 3WNOA 1HP4A 3OGVA 1GQKA 1NFPA 4GCAA 4GKLA 2QJGA 1DJWA 2X1UA 2E3ZA 1UH2A 4Z42C 5TAOA 4R33A 3LI0A 5BMWA 2QJMA 3UPBA 5KMYA 1M7PA 3UFYA 1GJUA 4O4VA 3IANA 3TLQA 3C8NA 1GORA 4LUSA 4XWUA 3Q58A 4F0MA 2HNHA 2XTKA 3OP2A 1A5BA 1Z41A 4W86A 2PGWA 3S9IA 4UFHA 4HPXA 3WF0A 1MYRA 2Y7GA 4KERA 3FCPA 3QMSA 4OBSA 1AW1A 2FZNA 1E40A 4QCEA 4J3UA 4PEKA 3PS7A 3CUZA 2A21A 2TMDA 5HWJA 1SMAA 4E5TA 2VQTA 1JZ3A 4IFRA 2DT1A 4JAWA 1GK8A 3TEVA 1M5WA 2A3AA 4PRTA 2WKGA 5LGZA 5K3VA 4AYGA 2QULA 3SCUA 4CCEA 4QG8A 1PE1A 1EEXA 4E4FA 3REQA 3WJZA 4HA4A 3DBPA 4FOUA 3NSXA 3NM1A 3CO4A 2V5BA 2XGIA 3ZLHA 4AF0B 1TTIA 1W1TA 2VFEA 5HXMA 3IJLA 1KBBA 2XN0A 8TIMA 4XD6A 3GDLA 3ANYA 2GK1A 2RGLA 1M3UA 1UBPC 3BAXA 2Z2UA 2R8WA 2PWEA 1JUBA 2Y8KA 1GUVA 4ZFMA 4QX4A 1JZ5A 4U28A 4GJIA 3A3HA 4HZ6A 5FF7A 2A7PA 3O6YX 5AYBA 1GJWA 3E2QA 2C79A 3NG3A 3ABOA 5D37A 3P0WA 3V1HA 1A47A 3VKBA 3UWZA 3L4ZA 1PTGA 3WBYA 2QR6A 1DEDA 3W53A 4EXAA 1EO7A 4KWUA 2VGIA 1JFHA 3TK7A 2JKAA 4PA8A 4L7ZA 4QNEA 1YPFA 3WDJA 2OB3A 3UY8A 4QS5A 2QPSA 3M5YA 4IGNA 3DAQA 3W7HA 1EQPA 3ERPA 3NGFA 3LQLA 4X60A 4U4MA 5J5RA 3CZ8A 3I4KA 3FA4A 3MVTA 3UA3A 4TX8A 3STPA 5A6BA 1EYWA 1UJPA 3BGJA 4GPNA 1H50A 1LWHA 1G01A 1J0ZA 3LI1A 2OWCA 4Q4MA 1KD0A 4RZ4A 1WOBA 3AZRA 4DWSD 3U2OA 4K7VA 3N73A 3QY6A 1ZPTA 3EMCA 4MJ4A 3JU2A 2D3LA 2OFJA 4JHZA 3W7NA 1PYFA 4PBGA 4OBTA 3RM4A 3TVAA 2O92A 3GUGA 1PZ2A 1K3UA 4DJEA 1FWJC 2NV2A 4XSLA 4FI4A 3L68A 8XIMA 2HDJA 3WEOA 3OU8A 3T4CA 1KKRA 5BRBA 3EPOA 4PUDA 1MXDA 3T4WA 1XV8A 3N6QA 3T1GA 1Q8JA 2YW3A 2YDRA 3W2UA 1BD0A 4PGLA 2ZZ6A 3WFAA 3C3UA 1NWRA 1XDMA 4E3VA 4B91A 3AYSA 1QXLA 1ML1A 1B3WA 1KFEA 3U8GA 1V02E 3SDOA 1RJRA 2IPJA 4HBKA 3M0JA 1XYBA 3PSVA 1I2PA 3P6LA 1TB3A 5C5YA 5LNVA 1CXKA 5E09A 4LB4A 2GJNA 4PZVA 2PE4A 2VUYA 3WX7A 4BF9A 1VQTA 4UR8A 3OLEA 1TZZA 4DJDD 5DCEA 4R9OA 3ALGA 3GRIA 4M80A 3L21A 2ACUA 3EDJA 2BLEA 3P5ZA 5BZAA 3WUEA 4QCFA 3GHTA 3V0UA 3AS2A 3JR2A 1CCWB 1FOBA 1S3HA 5A94A 2C1IA 2P10A 3EOLA 1KXVA 2HBVA 4GCXA 5BMXA 1Y8BA 3QYSA 1I45A 2E5BA 3WLQA 1H51A 4J7RA 4UTLA 5CPMA 4CKQA 3WQEA 5CGTA 2QJJA 3F4CA 3SJNA 4Q4OA 1JPDX 3FKKA 1Z48A 1T8XA 3BGGA 2P50A 5PTDA 5D04C 4LAZA 4IJRA 4PMUA 3AIWA 4LTSA 3W7MA 4DLFA 4ZCWA 2ODOA 1LORA 2BY0A 3KCLA 3AAMA 4MZYA 1NIUA 4AIUA 2VENA 3GIQA 1W5MA 1E15A 3VNDA 4DYJA 1K02A 1VYPX 2Y2WA 4DBDA 3KDNA 4DM2A 1PO9A 3BJTA 1OT2A 2GSJA 3AALA 1VBUA 3TV8A 5EPDA 4B5VA 2KAUC 4MB4A 1FHUA 1YADA 1N82A 1S3TC 1ADDA 3NXLA 3ZJ6A 1NJJA 2NXIA 4GY1A 3W23A 3WQ6A 1SMDA 4Q8OA 4Y7EA 3AU2A 1QRQA 3GLCA 3VINA 4B4HA 3BJFA 3EWBX 3A64A 1W9DM 2XGZA 1VAHA 2P53A 2GQ8A 3B9OA 1HF6A 4IL2A 3S6OA 1JYVA 3NYZA 1IWAA 2JEQA 3QPEA 1SFSA 3G3MA 5FJTA 1GYLA 3RN6A 2J62A 4JKKA 4ZMGA 3QH2A 1HJQA 3KZPA 2KX9A 3QTPA 1H4PA 4RPQA 1V02A 3LCWA 4BWLA 3RMJA 3LQGA 2QF7A 1TTQA 3DERA 3PY2A 1XXXA 2ICSA 2DZBA 2V2DA 2RKXA 3CZGA 1P7TA 3CAVA 4Q4KA 5HOSA 3N13A 1SUXA 3DHFA 2CLPA 2P3ZA 4DNHA 3TC3A 3NPXA 3N2BA 1M03A 1UD6A 1E4IA 4DXXA 4XX6A 4QITA 4A2SA 4GRSA 2D0FA 4IQDA 1QO5A 3N2OA 4M24A 3G1AA 3W2JA 1KV8A 1FH8A 4ZSUA 1FXQA 3GNRA 3TAOA 3CTLA 3GSMA 4YTRA 2NUXA 1GHSA 1BVWA 4JCLA 3VGDA 2P8BA 1U1HA 4E8DA 3MCMA 4Q32A 3SCOA 2BGQA 2FTWA 5JIPA 4MOZA 4IP4A 1OC7A 2G0WA 1K9TA 3VAVA 4PMQA 1XIEA 4FA3A 3NGJA 3OVQA 2B7NA 4XZLX 1WA3A 4OTKA 1PS9A 1ZLPA 4L4OA 3HPXA 4HSNA 2V2CA 2YL9A 3LMYA 1QNOA 2HRWA 2PDLA 4ZGYA 1O94A 2EPKX 4XV0A 4CNNA 3WLSA 1J0IA 1HZYA 4GFIA 2UY5A 4KRZA 3RCYA 2FZBA 4NJGA 4MJZA 5K9CA 2BV9A 2ZTKA 1JI2A 2R1MA 3SBFA 1UIOA 3DC8A 2Q01A 4UQCA 3HFYA 4X3ZA 5AHEA 3M47A 1GG1A 5FACA 4Y9OA 2H3DA 4MF4A 2PDXA 3FGCA 4TUFA 2J6XA 4EPDC 2FZ8A 2H3BA 3HB9A 4HTYA 3WQWA 4LU0A 3AHXA 3LSBA 4S39A 2RDWA 2V0TA 2YB1A 4X63A 3TONA 5KITA 3EMZA 2J8GA 1E0WA 1F8IA 4EE9A 3MSRA 2E1WA 3OQ8A 4LFYA 4MZ8A 2GWGA 4IMDA 1Z3NA 4QJ4B 2WQDA 2QDHA 3KS6A 2DIJA 3TXVA 3V35A 4PCPA 4L56A 1GOIA 1IXPA 1DORA 3DI1A 4MVAA 1XPYA 1C91A 2CXGA 2OT0A 5DCBA 3MMDA 4F0RA 1KXHA 4YWIA 3I65A 1A0EA 3QGVA 4CD7A 1ZJAA 1UZ1A 1OFOA 3E96A 1LM1A 2YSWA 3IV3A 5F2GA 3IVSA 3VDAA 5G4EA 1V3IA 5CG7A 3TH6A 3NQ7A 3FW6A 3U6WA 3BO9A 3R0UA 3MU7A 1EQCA 3G0UA 4PMNA 4WLCA 3W88A 5E9AA 4DNMA 3BCFA 1OHLA 1Y5VA 5FJJA 1GVOA 5I78A 3BAKA 3VKDA 2QUUA 2PDKA 4XZWA 1GPWA 3H24A 2TPSA 3IV8A 2DSWA 2EKCA 4AD3A 3ECQA 3UWWA 2F7FA 1V7AA 4KGLA 1TMHA 3LLFA 2XVGA 2VEKA 1EDQA 1FWTA 3WD2A 4K1GA 4AUBA 5HMSA 3HV9A 4JTFA 4DPQA 2F8QA 2AKMA 2H9AA 1YNQA 2VGGA 3PG9A 2VKZG 4MDPA 4DWSB 2HMCA 4DJFD 3ZLFA 4PYSA 1IGWA 1P0BA 2R1KA 3OA5A 2AAAA 2AKZA 5BYWA 1SZGA 1WUEA 3H6OA 3CHDA 4NZJA 1U30A 2FKPA 4PULA 5JIWA 2X8RA 2D0GA 3WQCA 2BBFA 1B9BA 3LG3A 4EPEC 4LVGA 3PANA 1QI4A 1DIOA 2EPOA 3MBFA 4UTWA 1KFJA 5HUOA 1MDRA 2XIMA 4AZBA 1RXOB 2J9XA 2I14A 3TDFA 4F2UA 4Q6JA 5E0KA 2IKIA 4PMDA 5G1TA 2WO5A 4KWWA 1AVAA 3ABRA 2OU4A 2Z0IA 1GYNA 1DQUA 2Y0FA 4NZ3A 2DZTA 2PD5A 4IG2B 1XBYA 4GISA 5E5CA 1Q6DA 2WZHA 3W87A 3TOPA 2ZBTA 3GDBA 4DO7A 4S3GA 4TVDA 4MAVA 3OZOA 4WXZA 4HHHA 2DIEA 1R85A 1P0KA 3G1YA 4JTIA 4LAUA 4CEXC 3PVFA 2HK1A 1RUSA 4H2CA 4AIOA 2O9PA 2VD8A 3GW0A 4B5SA 1AODA 4RE2A 3A3XA 2HEJA 1ME9A 1V3MA 4GUFA 3B9AA 1R46A 3STEA 1LBLA 1VPXA 1P5BA 1MW3A 3KOXA 4MIMA 5M1TA 3KCJA 2YYUA 1DWGM 1HKKA 3N2MA 2O4MA 4A3YA 3DFOA 5G4WA 5HWNA 2QAPA 3MYPA 3TN6A 4YVXA 2C7FA 4KWOA 1EOMA 1QT1A 3WELA 2OLHA 3B3DA 4GABA 1EFZA 3T7VA 4U31A 4S3DA 2OTDA 2VQUA 2BGNE 1KQZA 1D8WA 1TMQA 2CZVA 3GU9A 1H0GA 3NZGA 4QDMA 1A5KC 3LCFA 2QJIA 3CH9A 3ORWA 4EWJA 1SW0A 4AH7A 2QGHA 4JN6A 4O1EA 3RX4A 3O05A 2WM1A 1QCWA 4EANA 4UTMA 3W7QA 3SM0A 3U7VA 2HVNA 3HG3A 4L6HA 4LQ1A 5AYYA 2J6VA 1PBGA 2PAJA 2VZTA 2NVAA 3S4TA 5IFTA 2IW0A 3BLEA 5I3JA 3S8HA 1PIGA 4W7VA 3LPOA 5BOOA 2IMRA 5AECA 1R3RA 1A5UA 3ITGA 3GNNA 2QDDA 4XAFA 4OVXA 3BSMA 3GY1A 3B0UX 1UR0A 3OBKA 3S9YA 4IUGA 1RCQA 4GGBA 4I9TA 1JRBA 1CX9A 4GI9A 2VHLA 1E9IA 1HKJA 4Z1CA 3QTGA 5BWFA 4AWSA 3BC9A 3CEPA 3RITA 2UZ9A 3PBVA 4RX0A 2FVLA 4ES4A 2OEMA 1MW0A 1UZHA 3GNDA 4QLJA 3RILA 2GGJA 1Q6CA 5A8MA 2YR1A 4JZ5A 1SO6A 4C7FA 3CL8A 3I10A 4I7VA 2W92A 1W1YA 3ZT7A 4NJIA 2QAFA 3KS5A 4NZCA 3K8KA 2PP3A 3E2VA 3R6IA 1UOZA 2PODA 3B8WA 1ITCA 3LOTA 4RV8A 1DJHA 2WJZA 1R5YA 1F3WA 4R3UA 5BU9A 5HJYA 5AOUA 1GVSA 5HANA 4BEQA