1DQWA

Crystal structure of orotidine 5'-phosphate decarboxylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
b'MHKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dqwA00
2VFHA 1GVSA 3DFNA 5HR7A 5HULA 3G24A 1QPRA 3N14A 3W2UA 1SW7A 4AXKA 3KFTA 3TXZA 4TR9A 3GDKA 5AC8A 3PSWA 4LV4A 3O07A 1KTCA 4OWGA 2VEMA 1VC4A 5AC7A 2ZZ5A 4LC8A 4OBTA 3MJYA 2C1HA 3RNDA 3TA6A 1GOXA 3NXFA 2V82A 1PHWA 1LOLA 5CSRA 3W7HA 1X8FA 4YLWA 2V9DA 4NNAA 3GDRA 3NL6A 1ZFJA 5AC6A 4Q32A 3PF3A 1OG0A 2Y7GA 4LS0A 1GVQA 4QNWA 4E0CA 5HWJA 4IUOA 4Z1CA 4R33A 1EP3A 1YPIA 3JR2A 3HGJA 3CEPA 1VHCA 1OYCA 2ATMA 4UMBA 1H1YA 2OT0A 4UR7A 5F4XA 2V2DA 1C9DA 4PC8A 1TIMA 1WOAA 3NAVA 2I1OA 5EBUA 1RQBA 4KWWA 1YXDA 3T44A 1PE1A 1TV7A 1SSDA 4O19A 4IMGA 4NUWA 1ME8A 2B0MA 1KM3A 3M5YA 3MP3A 3SR7A 1KM6A 1WXJA 3EB2A 4AWUA 2DP3A 3HG4A 3DH7A 2G95A 5I3HA 3QEZA 4MYXA 3TMLA 3T7VA 3A5VA 4I7VA 4E2BA 2ZA1A 5K4ZA 2GPTA 3F03K 3C61A 5DN1A 4DPQA 3NQ8A 1FX6A 1GQNA 4FF7A 3WJSA 1QMLA 2ZRVA 3NQMA 4BR1A 3PWAA 5TBOA 2H3BA 3LRMA 1JR1A 4XKYB 1S5TA 3O06A 3O6CA 2JKPA 4NT0A 3W6YA 1LDCA 1HO4A 2HMCA 5D2WA 2TRSA 2C19A 3FJLA 3BVJA 1JULA 5AYZA 2E6YA 2E77A 3W2KA 4LWWA 3B04A 1O4UA 1YXYA 5MHBA 1OFPA 3MI6A 1IGSA 2A7NA 1R30A 4G1KA 1KM1A 4UFMA 2V5BA 4UUIA 1OYBA 4UFHA 4UTIA 3RLUA 4IXXA 4AVFA 3E96A 4HPXA 4JTKA 4UC5A 3MWAA 5LGXA 3NPWA 2CW6A 5D32A 4WY0A 4UIOA 5TQLA 3TC6A 3B0UX 2W79A 4PL1A 4H4IA 3I7RA 3L67A 2ZZ2A 1JQXA 2TMDA 1W56A 3DFPA 1E51A 5FF4A 1XBVA 3Q94A 3VKJA 3W7CA 3GDMA 4UFIA 1YTEA 4BK9A 3DI0A 4OE7A 4PEKA 1A5AA 5HR6A 2VFEA 2HS6A 4Y90A 3W85A 3W7IA 5F2IA 3TNOA 1EA0A 5BW6A 1VCGA 2WQPA 3NPXA 1I2NA 1AL7A 3OA3A 3TROA 1WX0A 3JS3A 5G4EA 3TJLA 3PC0A 4JTTA 3ABOA 1FDYA 3OIXA 3W7QA 1VRDA 1OK4A 4UTMA 4AF0A 3DHFA 1SZEA 2WSRA 1GZGA 3NQ7A 3EX4A 4GWEA 5BRBA 2VEIA 3W88A 3W76A 3P62A 2J9YA 1W5PA 3TAKA 3GYEA 3E49A 4FX6M 4EWND 1ADOA 1EPXA 3MBFA 2QCHA 1H7RA 2ZTKA 1FWNA 1LCOA 2VEPA 3EEGA 4RV8A 3EWWA 3I7SA 4FNRA 5CPMA 3UQNA 1H51A 5SWUA 3CTLA 4O18A 4TIMA 3HPZA 1WYIA 5TIMA 4JYEA 3IGUA 1XUUA 4Z0SA 1OVDA 3N2XA 2PRHA 2PRLA 1EIXA 3P67A 4RZ4A 3R5EA 4UR8A 4J9JA 3S6DA 2JKAA 3KVMA 3W72A 4FNSA 1O95A 1W3NA 4O0ZA 3NQ2A 1KW1A 3QH2A 5LNRA 3IVUA 2AQWA 4DXVA 1ZALA 5EMUA 3VI2A 1XI3A 3S1VA 3DKLA 3NQGA 3A9IA 2VENA 4JTEA 4DO6A 4LS2A 3O63A 1K7XA 3GR7A 2CLHA 4R7JA 4D2JA 1M7PA 2GUUA 2QJGA 4MUZA 2VFDA 4A29A 3N2MA 4HKPA 2JGQA 3DI1A 4O1CA 1OF8A 1PVNA 1VCFA 2R14A 1O94A 4A3UA 3S5OA 4ORIA 4JTHA 3W9ZA 2X30A 4PCFA 2TPSA 5AN7A 1CX9A 5AB3A 1ZCOA 3TQ0A 1H1ZA 2ZRZA 3BO9A 2AAMA 1UB3A 3UWQA 2OT1A 3OG3A 3KXQA 4DELA 2FLIA 1LORA 3SI9A 4JYFA 2Y70A 1BWKA 4N9DA 4N9CA 1ZAJA 4CQ8A 2C13A 2ZYFA 4I7WA 3SW6A 4UTWC 3I68A 3PB0A 3UY8A 2WNZA 2QCGA 1CW2A 3PG8A 5DCDA 1ME7A 3LB0A 2FPYA 3TSBA 3TKFA 5K4XA 1W8SA 1LOSA 3LHTA 2FJKA 2QEZA 4NJKA 5CZSA 3USBA 4O4VA 2GVLA 3G8RA 3W1PA 4GBUA 3F4NA 1YTDA 3W71A 4GUIA 3ZS4A 3MHUA 4O13A 1P4CA 1VJIA 1TQXA 3EX6A 4YCOA 3WK3A 3NGJA 1RVGA 3B4UA 5D38A 5EKYA 3W74A 4FIRA 5DCBA 3LI0A 4JTLA 4MFEA 1RR2A 3G0XA 1W3IA 3DFOA 3I65A 5D04C 7TIMA 1TPUA 1W5QA 3EWXA 1MXSA 1W5MA 3T4CA 2YCEA 3FIGA 5A8GA 2ATSA 4JTGA 1QO5A 2RDTA 3LXBA 3W1UA 2WJZA 2A21A 2V2HA 4CNOA 1EWEA 1DBTA 4JXCA 1BTMA 3L0KA 3PG9A 5F4WA 3IVSA 3ABRA 3Q58A 4MOZA 1VS1A 1OFEA 1FCVA 1DQWA 3W73A 1QWGA 4LVDA 4WOZA 3SJ3A 1G67A 1SSGA 3MP4A 3KRZA 1L6WA 3PULA 4L4MA 4GE8A 3NO5A 3IIZA 1JCYA 3C3NA 3MUXA 1HUVA 4RR4A 3S5NA 2YW4A 3BPWA 4EOUA 1YTKA 1M6JA 5E0KA 3NG3A 2C14A 5EPDA 1T0OA 1XBYA 1PS9A 4TMCA 5LNUA 3P81A 2C16A 1QFEA 3LI1A 4B5NA 4IMCA 2WOQA 1F2JA 1JVNA 2XN2A 1YDVA 3EX3A 3S1WA 3FYPA 4ZQRA 2YX0A 3BLIA 2CU0A 2ZA3A 1WBJA 2A0NA 2V2CA 2Z2UA 5D05A 4O52A 2X1SA 3TJXA 3LTSA 3TV8A 4HN4A 3NL3A 4A22A 3HBLA 2GQ8A 2Q3RA 3HO8A 4HNNA 3VFLA 1S3HA 4QM1A 4JNMA 3QC3A 4FNQA 2BX7A 4Y96A 3W1MA 3S5YA 1S5WA 5I3FA 5AHFA 2C15A 1TSIA 4PA8A 3P84A 3LHVA 3P61A 3TMQA 1U5JA 1J2WA 5G1TA 3CT7A 3L5AA 1D3GA 3O16A 4GUJA 2NX1A 1L6SA 4LUJA 4RX0A 3FS2A 4O50A 2VC6A 1L2UA 5DLCA 3HQ1A 1FDZA 4DF2A 3W1XA 4NX0A 2ZFAA 2A7RA 3DENA 3LHZA 3W1LA 2YXGA 1I2PA 1W5OA 4LW7A 4XTDA 2QKFA 3N9RA 2VELA 2F84A 2YYUA 1H7NA 4O1DA 4RZ5A 3FYOA 3LXAA 2DZTA 2DZVA 3GKFA 5D2XA 1TPDA 1XCFA 5BOOA 5KZMA 5AHMA 2LLEA 3CU2A 3G1XA 3W7OA 1F73A 3W07A 4M7SA 1RV8A 3E0IA 4R34A 1XM3A 3S0CA 2OX1A 1LLWA 4MIMA 1R2TA 1WOBA 2CLKA 2E68A 2QCDB 3RLVA 1KA9F 3B8DA 5IBXC 1JCXA 2B7QA 1AK5A 5H91A 3B03A 1EUAA 3STCA 3SSJA 4O12A 1P1XA 1VYSX 3PM6A 5FEWA 5K7JA 1K8YA 1Q6RA 2NV2A 2VFIA 5LNWA 4EVZA 3AO0A 1H7WA 1AW2A 1DHPA 1KLZA 3TQVA 3GNDA 3W3OA 4O10A 3LCFA 5F2LA 4HNVA 4O11A 4ZMGA 3W7DA 1GEQA 2RKXA 2ZZ7A 2ZRYA 3NQVA 4O1BA 2B7PA 1B9BA 2CLMA 2VOMA 4IPJA 4KKXA 3LHUA 1TPFA 3IIOA 5DBUA 3CB8A 1MEIA 1A5SA 1NSJA 2FDSA 3IGXA 4KFNA 5EL1A 4X22A 1NAL1 4IMFA 2WNNA 4ADUA 2D73A 3WJXA 4QSHA 4HPJA 4LRSA 1JCMP 1I2OA 1FY6A 1Z41A 5DY3A 2OJPA 4N4QA 4XBSA 2AGKA 5CPNA 3C2FA 5C55A 2E5DA 3WK1A 2J9XA 1TPB1 2NX3A 2A85A 4L4LA 2E6FA 5D03A 2ISSA 2CZEA 2RFGA 4H6KA 2QDGA 3RFAA 1ME9A 1OFRA 3BV4A 4O16A 3NQ6A 3THQA 2DJXA 2A4AA 1XUZA 3GXTA 1LRNA 2RH9A 5F1UA 2Y7FA 1UUOA 5DBTA 2DZXA 4K8EA 1TPWA 3M0ZA 3O1NA 3H53A 3INPA 2NV1A 1GYNA 2VKZG 3LHWA 4PL2A 1H62A 1UBSA 3N34A 2HTMA 2V81A 2FB3A 2DZUA 2Y62A 4RK8A 3IIXA 4MJMA 4O14A 3UXAA 3W2MA 2XFWA 3JRKA 3UWUA 1PCWA 3BK0A 3CIWA 5DCEA 2J88A 3G1DA 1WAUA 4FX8A 5D37A 2HSAA 3SGUA 1DV7A 4AWTA 1P0KA 1RZMA 3NL2A 4O17A 5CZJA 5U4NA 3W7GA 5HUOA 2W0UA 4UMAA 1DJQA 1QPQA 3QMRA 1HG3A 1TPEA 3PVFA 3T78A 4ZQCA 3HG5A 2QCLA 4W9TA 4K39A 3L5LA 5F1VA 5E93A 1QNVA 4BI7A 4WZHA 4YL2A 1SZGA 3PS7A 2NXIA 3LCGA 1B4EA 4UNKA 3P7YA 1SQ7A 4JIPA 4LVBA 3EX1A 4HSNA 5L6UA 1O5KA 2YZRA 2J24A 1XL9A 3NOEA 2R8WA 1K03A 1YYAA 1W5NA 3BG5A 3P60A 4A21A 1LP6A 3KX6A 2BLEA 2BTMA 4MJZA 3DAQA 1ICQA 4FO4A 3MI3A 1LM1A 3VNDA 1UUMA 5HWMA 4WY0F 3GAYA 4P61A 1P0NA 2YFOA 3PUOA 2Q3OA 4JTSA 2PRMA 4OV9A 3UPBA 2QJHA 4U4MA 3G0UA 3NZRA 4PODA 2DZSA 1Y0EA 4IJBA 3UWZA 1ICPA 1SPQA 2FFCA 3M5ZA 5K9CA 2QAPA 2B7NA 3HB9A 3M47A 1Q45A 3P8IA 4NJGA 5K9XA 2QCNA 3MYPA 1KTBA 1TB3A 2W6RA 4N6FA 4RJEA 4FEZA 4UTKA 4GJ1A 3GXPA 3NNTA 3W70A 1V7YA 1VH7A 3ATYA 3W1NA 3G1AA 4AMAA 1O60A 1TTIA 2BXVA 3PUEA 4K37A 5C5YA 2Z6IA 4JS3A 2GJLA 4IPIA 2CLFA 3ABSA 5AHEA 3UZ5A 4NQ1A 3PSVA 4POCA 1Q6LA 1XBZA 3M43A 4NU7A 1VPXA 3G3MA 1MEWA 4HSOA 4EIVA 2A1YA 1TTPA 1WBHA 3HGRA 1SO6A 4NZJA 3UXDA 1VR6A 2ZQ0A 5D2VA 1B57A 3TSMA 2H8ZA 3NL5A 3KRUA 1Q6OA 3GVGA 3W22A 3N19B 3CEUA 2QUTA 3HMJG 4GUFA 2G97A 3GZ3A 4O1AA 4NNCA 3G1HA 4IWWA 3L68A 4TX9A 4CQ9A 1D3HA 3MMTA 2FB2A 1JQVA 2EKCA 5AYXA 1VGAA 2WKJA 5LKYA 4LOCA 2QF7A 3C8FA 1RD5A 5BMWA 1I4NA 1QPOA 3LGEA 5I3KA 4M7TA 5AYYA 3M16A 3WJZA 4TU1A 5A5WA 4DBEA 3R2GA 4UTTC 1W0MA 4MKNA 2WSYA 1HL2A 1OABA 1SFJA 5FEPA 3FOKA 2QCMA 1ALDA 2HS8A 4M5PA 1LYXA 3S1UA 1AW5A 3CC1A 1RQHA 1KM5A 4Q4KA 1H7PA 1AMKA 1JUKA 2NZLA 1DQXA 1K02A 4ONVA 1FDJA 2QUVA 4IGHA 3GR8A 2Y85A 3FFSA 3C4UA 3THAA 3PBUA 2R94A 3DBPA 3HF3A 2YGYA 4UMCA 1ZY9A 4WD0A 5E1QA 1N55A 4K7VA 5KMYA 1LRQA 4CQAA 3S5ZA 4UTWA 2ZZ6A 5I3JA 4O28A 4LUIA 4FNTA 1G4EA 3E02A 4FHAA 3W1RA 3W87A 3W1TA 4NJJA 4XTIA 1JCNA 3C52A 2UV8G 4NVTA 5K3VA 3LOTA 4N6EA 3NM1A 3TK7A 3DXIA 3C2EA 5CZ0A 3RMJA 1A50A 3Q37A 4MVAA 3RF9A 5LHFA 5CPLA 1IXOA 1KM0A 4JEQA 3HPSA 5KZEA 1SO5A 1SUXA 2G5WA 1IXPA 3LTYA 3A21A 1FXPA 1SFLA 2E6DA 2QDHA 4ML9A 4O53A 2FPTA 1LZOA 1QPNA 4S1FA 1TPH1 4P2VA 4Q33A 3L0NA 1SW0A 4JYDA 4O4WA 2Y7DA 1GPWA 1WDWA 1XC4A 1FWTA 3VE7A 3KRSA 2QCDA 1R2RA 1FCUA 1HTIA 2QCEA 5KSWA 2ISVA 3C56A 4IMEA 3QQ0A 2ZTJA 3ELFA 3M1ZA 1QCWA 3M44A 2EAWA 3DKJA 1EWDA 1Z42A 1OFQA 1ZENA 3GB6A 3KVJA 1VYPX 3T55A 4BI5A 4YCPA 3W7PA 1J5TA 2V5LA 4WXZA 2CFFA 1FWRA 1SZFA 3BG3A 1U83A 1V5XA 3MI2A 1KBJA 4ZL1A 2ZZ1A 3SZ8A 4JICA 4BWLC 3OVRA 3QW4B 1R47A 4KFPA 4BFAA 1X1OA 1Z48A 4UNLA 5FF3A 2PCQA 1G7UA 2EF9A 4K36A 4LTSA 1YDNA 4JTJA 1KFCA 1EP1A 4DO5A 3G0SA 3EXRA 1MEHA 4YWIA 4RZ6A 1OJXA 3W7EA 4WUIA 1IXQA 4X9SA 5FEXA 4JTUA 4N9BA 1QAPA 2QR6A 3EWYA 3QFEA 4UCGA 5DXYA 2P10A 4QIUA 3IVTA 1MSSA 2EPHA 1GJPA 3QPZA 2QCCA 5G2IA 1TCDA 1G6CA 3I7QA 4UXDA 4EF9A 4MLRA 4MYAA 2I14A 2DU2A 3LTPA 1GTEA 2PURA 1EEPA 3NDOA 3VE9A 3B06A 5FEZA 3E12A 2NLIA 2VEKA 3H54A 2ZRUA 3DZ1A 4MPQA 1JRBA 3SGZA 2A6NA 1W37A 4OU1A 2X16A 4LNYA 1K8ZA 4MZYA 4ZQPA 2WSQA 4FX7A 1MO0A 4NJIA 1B4KA 5LZLA 3NQFA 5T26A 3W75A 1SO3A 1TPC1 4IX0A 1G4SA 2ZZ4A 3TIMA 3L2IA 3LERA 2JKEA 2BWGA 1KBIA 4AH7A 5CSSA 4FNUA 3I6RA 3Q2DA 1SW3A 1THFD 1KTNA 1TRIA 1GYLA 1ML1A 1Q3NA 2I9EA 4E38A 1OFAA 3QMTA 3MO7A 3S1XA 3L5MA 2VFFA 5IBXA 2X1RA 1JRCA 3UPWA 4CCCA 3L66A 1FQ0A 4XWUA 2QAFA 3HJZA 2JK2A 5KTLA 4DEFA 4DO4A 4LVGA 4IOTA 1TO3A 2A5HA 4NXSA 4UTLA 2Z0IA 1FWWA 4FXRA 1KV5A 4XKYA 4QITA 3BLEA 3QQ1A 5J5DA 4O0KA 3NM3A 3TX9A 1YXCA 4LS1A 1DOSA 1I2RA 1GVOA 3TDFA 1SR9A 4HIBA 3GXNA 3FKRA 2OMAA 1WQ5A 1EP2A 4IX2A 3NEVA 1F76A 1FXQA 1JUBA 1QDSA 3GAKA 4AEOA 4AHPA 3QMSA 1GVRA 4FXSA 5KZDA 2P0OA 1F6KA 1M7OA 2YDAA 3KVLA 1D9EA 4DF0A 2G96A 4JTFA 1F6PA 2BZNA 3KHJA 1H7XA 1PHQA 1XKYA 2GVGA 2ISWA 2WV8A 3P5YA 3C2RA 3EXSA 4O57A 2B7OA 3WFAA 1LBMA 3L65A 2CLIA 1NFBA 3W2JA 4LVFA 1ICSA 5BMXA 3UYCA 3HGOA 4ZVJA 2C18A 4S2BA 1H63A 3STGA 2GJNA 5FI8A 2VFGA 3QM3A 3C2VA 3C0JA 5HJLA 4JY9A 1G4PA 4OHQA 3LBCA 5G2HA 1G69A 4MY9A 4LT9A 1W3TA 3HG2A 1L6YA 3BGJA 1XXXA 4K8HA 1OX4B 4RXGA 5C2XA 5CPOA 1Z44A 3N9SA 2RHGA 3LRLA 2CLOA 4N2YA 3BARA 3W7LA 4PFMA 1QOPA 2V8ZA 2ZDRA 3DFSA 5F2MA 1YPFA 2H6RA 4HHPA 3QW3A 3YPIA 3V1PA 3FA5A 3U2OA 3NVTA 4DBDA 3BW4A 3LRKA 4ZQNA 3QF0A 4RLIA 2EGZA 3PY2A 3TR2A 3NA8A 5G2WA 5D33A 1VYRA 1RQEA 3U6WA 1NF7A 3B0VC 3PBWA 3CQ0A 4I9AA 4WOQA 3STFA 4EF8A 3G1VA 3DGRA 3M41A 4OT7A 1SO4A 3M9YA 4WX2A 3H55A 1A5BA 2QJIA 2Q8LA 3CPRA 4JX6A 4JN6A 1IIHA 3LCLA 3R12A 3R13A 1XFBA 4GRSA 2X1UA 3G3DA 5EYWA 5I3IA 1G4TA 2ZRXA 4QQ3A 6ALDA 4LU0A 2F7FA 3W2NA 1XDMA 1W1ZA 3EKLA 1QR7A 3O15A 1OFDA 4GUGA 4ORMA 3DFTA 3OBKA 4M6PA 5LGZA 1KM2A 1H7OA 1LLZA 1TRDA 2CWNA 3PBVA 5EY5A 2DORA 3IIVA 1DL3A 2BSLA 1LRTA 5FESA 4GXMA 1GWJA 3QSRA 3R89A 1X7FA 3LDVA 2V0TA 1DJNA 6TIMA 3DHDA 3QJAA 4DPPA 1P5BA 4GC4A 3C2OA 5LNVA 3M7WA 4HNTA 3IEBA 2QCFA 3GDTA 1LBFA 1F05A 4UTUA 3QRHA 4Z1AA 3ZWSA 3ZR4A 3SFKA 1XBXA 2CZDA 2YW3A 3BW2A 5HMSA 4K7YA 2NXHA 5D02A 1OF6A 4XBKA 4CCEA 1TYGA 2WO5A 1AG1O 3TC7A 2CLLA 1LROA 3ZWTA 4M6VA 3NQDA 3T40A 1KFJA 1N8FA 1ZHAA 1TTJA 4GFSA 3M5XA 2A7PA 4ZQOA 1JCJA 2CZFA 1EB3A 3LLDA 3G8EA 2YPIA 4DQWA 3L21A 1DORA 3L9CA 4NZFA 4OQVA 4IXHA 4MY8A 3GKAA 3MBDA 4WXYA 4X2RA 2XN0A 3VCRA 3PUDA 1YDOA 1KFLA 5L9FA 1X1ZA 4JY8A 2C3ZA 5D2YA 2FPVA 5CZTA 3G1YA 5F2GA 1PL9A 1EUNA 3HG3A 2WPBA 2C6QA 1K8XA 3KOFA 3A22A 1PIIA 4QJ1A 1TV8A 3GDLA 1LBLA 3U8GA 1T99A 2GQ9A 4WJEA 5F4SA 1ZNNA 4RKAA 2E6AA 5EA9A 3TXVA 3HPXA 4KWVA 3TFCA 1OX5A 3QZEA 3W7RA 3W86A 5AFDA 3C6CA 1ZJIA 5LNSA 2PC4A 3TQKA 3UNDA 3UY7A 1DKWA 4WQ6A 1R46A 4NNBA 3RU6A 3K30A 3HGSA 4N9EA 1UCWA 3W7KA 1I2QA 5FF0A 5CKSA 5C54A 1EX5A 3W23A 4Z0JA 3O8AA 4RXFA 5G5IA 1CI1A 1K7FA 3A5FA 1HFBA 3TW6A 1C29A 2CZ5A 3TCEA 4JTIA 4ALDA 4UTTA 3B0PA 3MHGA 4IQLA 3TW7A 4M19A 4UFLA 4ICNA 3DFQA 1N7KA 1OX6A 1ZAHA 2E09A 4O54A 3TE9A 2ZA2A 3MP5A 4JX5A 3WK2A 2O7QA 4AAJA 5AOUA 3N73A 2NX9A 3TUUA 1IXNA 2ZCGA 4XZ9A 2XN1A 1BWLA 1H60A 5ABTA 1TJRA 1OK6A 2J6XA 4JD4A 2OCZA 3TFXA 2Y61A 1NEYA 3O05A 2Y88A 1O5XA 1NF0A 3FEMA 3G22A 2J9ZA 4LRTA 1TREA 1X6UA 2Y63A 3NQCA 1IIGA 3V75A 3TAOA 5KINA 2J27A 2Y7EA 5DELA 1DVJA 3NPVA 1L9WA 1RPXA 2NUXA 4K6AA 3QPYA 2FTPA 4LY8A 2YR1A 3QYQA 1FCBA 3KVKA 3LLFA 1GG0A 3W7NA 1AW1A 4Z08A 4U28A 5G4WA 1PCKA 3MW7A 4R53A 5GVJA 3W7MA 3FJ6A 5J5RA 1JCLA 5D30A 1VLIA 4FNPA 1F5ZA 3GLCA 1SU5A 3CIXA 4H3DA 3DU0A 3NYZA 4NXKA 2TYSA 4JGDA 4AHOA 4BI6A 2VXNA 5HQEA 4HT3A 1KFKA 2GVJA 2DJLA 3PBYA 5KITA 4JDBA 3QSTA 1FCQA 1QOQA 3IRDA 1TPVA 2E1DA 5FF2A 5H2ZA 1KM4A 5HNRA 2C0AA 4AHQA 2NWRA 4M6QA 3ANYA 3CLMA 2DZPA 3LXCA 5D2TA 3W7JA 3CWNA 4ZQMA 2Z6JA 2A2IA 3CHVA 3NR0A 4WY0B 4CNPA 1VQTA 2H90A 3W84A 4FB7A 1KFEA 2V30A 1F7BA 3P82A 1GG1A 1VCVA 3CM4A 1UASA 5AHIA 1OYAA 3PAJA 3BW3A 1JUEA 3LCIA 2NUYA 2YYTA 2H8XA 3N3MA 3P8JA 1SZNA 3LHYA 2O7SA 3TH6A 3EWBX 1KLYA 3G18A 4BWLA 3M6YA 4XQ6A 2X1TA 4Y9AA 3W83A 4I7UA 4JIQA 4A2RA 2ZRWA 4LVAA 1NVMA 5HWNA 3STEA 4OGZA 1H50A 2NXGA 1R2SA 2ZZ3A 3WJYA 4AF0B 5LSMA 4O8RA 1FUYA 3F1QA 3UD6A 4N4PA 4GNJA 1WA3A 5G1YA 3PR2A 1LOQA 1W31A 4K38A 4FIQA 3LV6A 2FQIA 3LCXA 3S42A 4AB4A 3NQEA 2GOUA 4PH6A 3P5ZA 1YADA 3UWVA 1FWSA 2RDWA 4MY1A 4QNEA 1QO2A 1GT8A 1OFOA 1WV2A 1OFBA 1HO1A 4LV9A 4YXGA 1OX4A 1AL8A 5D09A 1C8VA 3BLFA 1TV5A 5HUPA 5K9DA 1IF2A 3EWZA 4MFDA 3SIZA 1B3OA 8TIMA 3LCHA 3EXTA 3SY5A 1A53A 1GTHA 2JGYA 1PV8A 3P74A 1A5CA 3GIYA 3W1QA 5HINA 4QISA 3ZFHA 3MYOA 3LM7A 3O6YX 1BKSA 5C6MA 2IQTA 4CNNA 5U7SA 2CLEA 3GK0A 4MZ1A 3KAOA 4Y8FA 3WK0A 1J4EA 3RK8A 5I3GA 2NUWA 3FKKA 1VLWA 2RDUA 3MHFA 4HNUA 4XUGA 3OVQA 1TMHA 2NWSA 1GVFA 1VZWA 2OZ0A 2A6LA 3ABQA 4ADTA 4KFOA 1OHLA 4MZ8A 1ONRA 1I45A 2DZWA 4PTNA 3M5VA 3TSDA 3UZJA 4CCDA 2QUUA 2GQAA 1W54A 3E9AA 4Y6GA 1LTDA 3EX2A 3FLUA 3EKZA 1M5WA 2E5BA 4BF9A 3TU9A 4C1KA 3LCWA 3UWWA 2ALDA 2E5CA 4ADSA 3HIJA 4UTHA 1TQJA 2B4GA 4UTJA 5DXXA 3CWOX 2YFNA 4X3ZA 1K7EA 1K3UA 2PE4A 4N02A 4AWSA 2KZHA 1F74A 1T96A 3B05A 4NX5A 3W2LA 4YMZA 3IV3A 4C1LA 1JJKA 3F4WA 1I8JA 1YLVA 3UWYA 4QAIA 2Y89A 4OV4A 5BNKA 5CG7A 4JR5A 3NQAA 2Y6ZA 1MZHA 4NJHA 4TO8A 2P1FA 3D0CA 3G1SA 1TJPA 4S2CA 1Q6QA 3NPUA 2TSYA 2X2GA 3GX9A 2R91A 3EWUA 3IIPA 4GUHA 5AHLA 2H3DA 3ATZA 1TTQA 3OHIA 4IMDA 4A2SA 3R8RA 4JDYA 4DF1A 1KV8A 1H5YA 2JBMA 3OEXA 2ABAA 4JX4A 3L0GA 4E2DA 2ZBTA 5IM51 3HOJA 1H61A 3PB2A 3IGSA 3W1AA 4CLMA 3S8HA 3BG9A 4ZZ9A 4Z1DA 1VHNA 2Q8ZA 3LX9A 3OVPA 4Z1BA 2ABBA 5CGQA 1UJPA 3GNNA 5FF7A 4MLJA 2WNQA 3LBMA 3A24A 1BEUA 4UFKA 2FIQA 5AHNA 4TMBA 5LHEA 3BGGA 5DY2A 3P80A 1ZAIA 4RCXA 3LV5A 3G1FA 1G7VA 3NZ1A 3O6DA 1T8XA 1FBAA 2EHHA 1XDLA 1KFBA 2YSWA 3WJWA 3A23A 5K2ZA 3S9YA 3SECA 3AJXA 4UFJA 4LC6A 4O15A 1S5VA 2Z1BA
chains in the Genus database with same CATH superfamily
1GVSA 3DFNA 4B4FA 4KF1A 1SW7A 4AXKA 4TTGA 2PSNA 4LV4A 3SURA 3FA3A 4LC8A 3MJYA 1GOXA 1TJ0A 3HM7A 3ARYA 2V82A 3KHDA 4HZ8A 1KBLA 3LPPA 1GKQA 4NNAA 1MQPA 3THUA 1TV3A 2XIIA 4LS0A 1GVQA 4V15A 1J0ZA 4R33A 1OQFA 1HW6A 2DUZA 2ATMA 3FN9A 1H1YA 4N0RA 2WC7A 1W1TA 2V2DA 1C9DA 2R1MA 4L7ZA 1TIMA 1CGYA 1WOAA 3NAVA 5I02A 4KWWA 1YXDA 3A4XA 1A4LA 2GGEA 3IAQA 4IMGA 4R7WA 3N2CA 1ME8A 3L4UA 5ENLA 3MP3A 1JZ5A 1KM6A 1WXJA 1SZRA 4BQ2A 3H4XA 2XIQA 4ZENA 2DP3A 3IANA 4WDTA 2G95A 5HBFA 5BRQA 4B2DD 5JBDA 1OGBA 3T7VA 3A5VA 3LNMA 4E2BA 4B5VA 3MVTA 5K4ZA 1FX6A 3VTRA 2WLYA 1GNXA 2ZRVA 3PWAA 4M56A 4U3CA 5TBOA 3VDGA 3LRMA 1RCQA 3EOEA 2ZXDA 3MKVA 3G77A 3W6YA 1LDCA 4REQB 1U1UA 1PX4A 2TRSA 4IP5A 1TZ7A 1YIXA 1AA1B 4H7ZA 4D72A 3IJ7A 4AX6A 3DCPA 5IXEA 3R8HA 3KUMA 1AFSA 3UGRA 4UFMA 2V5BA 3SN0A 4QCEA 1OYBA 3FJ4A 1YQ2A 3GHRA 1IWPA 1UKOA 5LXXA 4UC5A 1CGUA 2HNEA 3MWAA 3NPWA 1F8MA 4UIOA 3TC6A 3A13A 3AMLA 4PL1A 3ZVHB 2VC5A 3L67A 1JQXA 4BZYA 3W82A 1W1VA 4JFWA 1QI3A 3W7CA 3GDMA 4UFIA 5A6SA 2YCLA 2XIMA 3DI0A 3RJXA 4OE7A 5HR6A 2HS6A 4Y90A 3W7IA 2E8YA 1WE5A 1EA0A 4GGHA 3NPXA 3TROA 1B3XA 1EPVA 3OHMB 3FGCB 3TJLA 2DZBA 4PB4A 4LYPA 1E4LA 3OIXA 4XZHA 3W7QA 1NJJA 4CN1A 1OK4A 1R6WA 2WSRA 4O1FA 3NQ7A 3VD9A 4L6HA 3EX4A 3V5FA 4ZOBA 4F2UA 1JFXA 3W76A 4A8NA 3UCQA 4GCXA 2V3GA 3DFYA 2Q02A 1ADOA 1W9PA 2CPUA 4WCJA 2VR4A 1PXGA 1FWNA 3EEGA 4WGHA 3EWWA 4GYPA 4O18A 3GU9A 1P6WA 1Q8JA 1WYIA 4QE4A 3A3HA 1XUUA 3NZGA 1OVDA 3N2XA 3GXDA 3R5EA 3NO1A 2D0HA 3GVVA 2JKAA 2J7BA 1XLFA 1KW1A 1VJZA 1CIUA 2BY0A 1FFRA 3DYMA 3IVUA 3RCNA 4ZTXA 2AQWA 3NEHA 5BROA 5EMUA 1PTAA 1W2VA 4RE2A 4DO6A 4P7NA 1JI2A 4JQ4A 3GNOA 4Y2WA 2OQYA 4LYQA 3N12A 1M7PA 2GUUA 4MUZA 3ZZ1A 4A29A 4ERIA 4HKPA 4O1CA 3DI1A 3TYUA 1MQQA 1O94A 2V5DA 3BJSA 4G7EA 3KOYA 3ZMRA 1IZJA 3BAYA 2TPSA 5AN7A 3TQ0A 4MWAA 3EA1A 1QOXA 3OG3A 3VINA 2VVNA 3ZIZA 1ZBVA 4DAIA 3WQ4A 2XHYA 4AUBA 2Y70A 4N9DA 4N9CA 4QE1A 3WUFA 1V3LA 2C13A 4ML4A 3SW6A 5JH1A 2BVTA 4FLRA 4X2PA 3I68A 3PB0A 1YNQA 2QCGA 1CW2A 3BMVA 3PG8A 1ME7A 2FPYA 4UQDA 1H09A 1QTWA 1XV8A 2FJKA 4NJKA 5CZSA 4DZHA 4O4VA 4B5UA 4UQEA 3W24A 3M0VA 4GBUA 1PAMA 3F4NA 4B3LA 3VU2A 3EBVA 3ZS4A 4FK9A 4O13A 1P4CA 1VJIA 1TQXA 5MKGA 1R3YA 1RVGA 4RW3A 1YNYA 1NELA 3SY1A 1Q4NX 3NDYA 4JIEA 1J6PA 4DIAA 3SQSA 3RCYA 1PKLA 1W5MA 3FIGA 3VPLA 2OXNA 3ZXWA 4JTGA 3F5JA 5I7GA 2RDTA 3E0FA 3W1UA 1ZS2A 2VP8A 1JG9A 1KRBC 2I7GA 1X97A 1DBTA 1YE6A 5F4WA 3IVSA 3H8AA 1I9CB 1M65A 3TTSA 4D8LA 3IACA 1DIDA 3GG1A 1FCVA 4G5DA 4HP5A 2CITA 4WOZA 1SSGA 1DTNA 4MUPA 1CGTA 3H7VA 2OLAA 3NO5A 4S3KA 3MUXA 4NY2A 3S5NA 2YW4A 1T7LA 1JDCA 4X60A 3NG3A 1OC6A 1T0OA 3E5BA 1JDAA 4GH3A 1XBYA 3W37A 5HK4A 2VCBA 1VKFA 3B9DA 3PZGA 4IMCA 1YDVA 4YHEA 1LL7A 4WF7A 2CU0A 8A3HA 2A0NA 2V2CA 3RR1A 5D05A 1GVIA 4UOQA 3TJXA 3TV8A 1XLHA 3B9AA 3JUGA 2CXEA 2GQ8A 2Q3RA 3VFLA 3W01A 1UKTA 1S3HA 1JZ6A 4HA1A 1S5WA 2DY3A 4H8UA 5I3FA 2C15A 4PA8A 2DW7A 3T8LA 3CASA 4DYJA 2ZUNA 2G3NA 5CCZA 3L5AA 1GUVA 2GSEA 4FS9A 1OD0A 2VC6A 3IJ8A 3CZJA 5D8ZA 3HQ1A 4KRTA 2BY1A 1SMDA 3ALFA 3W1XA 4GIAA 2A7RA 4EXAA 3KBJA 4DX3A 6ENLA 4UTFA 1I2PA 3AAMA 4DBWA 3E0VA 3H4WA 2VELA 2F84A 3AIVA 4PMRA 4R27A 4CD4A 4FA3A 3GFZA 1Z7AA 3WF2A 2J62A 4PTMA 3G1XA 1E43A 1F73A 3UXKA 3U4AA 1RV8A 1Y5XA 3LPFA 1C8YA 4Q4SA 4B5TA 1WOBA 5GJNA 2E68A 1PUDA 5I6SA 4CVWA 1FWEC 2FZBA 4AZBA 3B8DA 5IBXC 2B7QA 3FHAA 3R11A 1IZCA 3GVWA 4YJ5A 1ONXA 1EUAA 1ZLPA 4KPLA 2XSXA 5EMKA 2WZIA 3PM6A 1CBGA 2VFIA 3ICJA 2XM2A 2GUBA 2Z1SA 1NOWA 4ZO9A 1BF6A 4MHBA 2IMRA 3AO0A 1AW2A 1AQ0A 4DJEA 1QU4A 3GNDA 1W9XA 4EPBC 3LCFA 4B5XA 4O11A 1AQMA 4AY7A 4O1BA 2B7PA 1B9BA 2VOMA 3PN8A 3LHUA 4H9YA 4NF7A 5DBUA 5ABEA 2J74A 3WL0A 2XWEA 3REQB 3IGXA 1NSJA 2QYGA 2ACSA 1QATA 3N1AA 3IJ9A 3EDKA 2R1PA 1XYAA 4U2YA 2Z28A 4J2PA 3CQJA 3OYXA 4JFUA 3AXXA 4BQ4A 1UD6A 2W61A 3QYSA 1Z41A 4HHLA 5DY3A 4N4QA 2AGKA 3C2FA 5CC5A 1H3GA 3N29A 1GZ1A 2E5DA 3WK1A 2J7FA 4H6QA 2A85A 5A6AA 2DSZA 3OYZA 1JNEA 2CZEA 5E0FA 4H6KA 3L12A 1OFRA 3GH7A 1C93A 2NQZA 3MUIA 1TZ9A 2NVDA 3PTKA 1IV8A 2A4AA 3GVQA 4YVPA 4LBSA 3HQPA 1RALA 1LRNA 1TVPA 2PDLA 1E15A 5LYRA 4PMZA 3GTIA 3S47A 1U22A 4PL2A 1H62A 1UBSA 3N34A 4XO7A 4XSMA 4AYGA 3C0SA 2V81A 2DZUA 3QY7A 1W3HA 1JZ3A 3W2MA 4HU3A 2XFWA 3UWUA 2BNJA 2J88A 3DC0A 3MV11 2HSAA 3PJTA 4W8BA 1P0KA 3VNLA 4O17A 3VCCA 1Y7VA 1A5UA 1UH2A 4M29A 4EK7A 2AQVA 3VDCA 4WKFA 3L5LA 1GKPA 4Q8TA 2ODOA 4TTUA 3AS0A 4BI7A 4HVXA 3V35A 4YL2A 1SZGA 3H2OA 5FJJA 3LCGA 2XH2A 4AD3A 2VD9A 1W2PA 4H41A 2V38A 1A5OC 1UR3M 2AGTA 3C8NA 3QR1A 2PDFA 2R8WA 3NOEA 3AMGA 1S2AA 1WKFA 1LP6A 1FHVA 2QJNA 2Z2AA 3KX6A 2P5NA 4P8WA 4Q7NA 4AXNA 3M07A 4GMEA 2BTMA 4MJZA 1ICQA 2Y8KA 2J25A 2CKSA 3MI3A 4LEFA 4PZVA 2WM1A 1EJ7L 1ISXA 4P61A 1UKSA 3GSMA 4OV9A 1XYMA 2PB1A 3WQFA 2NLYA 4U4MA 3F4DA 4PODA 1BYCA 1UP2A 2DZSA 4IJBA 2Y5JA 3AIRA 1QW9A 1SPQA 1FHUA 1KD0A 2OELA 4W86A 4RDYA 1I1WA 4PUDA 3HB9A 3P8IA 4NJGA 1AJ0A 3EPNA 3GC4A 1G01A 2QCNA 2HNHA 2PGFA 4FEZA 1VFOA 2RJHA 3CK5A 4UTKA 3UG4A 4Q8OA 3W70A 4CNTA 1GOMA 1W3LA 4XD6A 3AI0A 4QG8A 4K37A 2PDIA 3C86A 2ICSA 5C5YA 4FALA 3BUVA 3WDRA 4WSHA 3HFTA 4N42A 2Z2BA 5AHEA 3SCUA 2HV5A 4H01A 4Y7EA 1JZ8A 5HOSA 3PSVA 4GQGA 1GOIA 1Q6LA 3WELA 1XBZA 4GQRA 3B8TA 4ZR8A 1DWJM 4HSOA 1AD4A 2XYLA 1MZRA 2W9MA 2BVDA 1Q7ZA 3OQ8A 2XDFA 3H2FA 2PWEA 3M0LA 2ZQ0A 5D2VA 1B57A 1C9WA 4WDUA 4C6LA 2E8ZA 3GVRA 3GVGA 3UA4A 4TX6A 1CDGA 2D1ZA 4O1EA 3S2NA 1ZBCA 3ITYA 3EZ4A 1EJVC 3TC3A 1R8LA 4IWWA 1LUCB 3L68A 4TX9A 4DWSC 1D3HA 3MMTA 1U30A 3ARXA 1JQVA 3KBNA 1VGAA 2WKJA 4LOCA 3QHOA 3C8FA 5HA7A 4GZEA 3CUZA 4PSRA 4EWJA 4S3JA 2VI0A 3M16A 3TWBA 1C91A 4UTTC 3WUEA 4GGBA 1OABA 1SFJA 2QCMA 3MCNA 2OZ8A 1KR1A 1LYXA 3S1UA 4PMOA 1KM5A 4Q4KA 2ZWZA 4ONVA 4IGHA 3GR8A 3FFSA 2VL4A 5HNUA 1OWQA 3PBUA 2AMGA 3UZZA 4MJ4A 4UMCA 1XDJA 5E1QA 2FZMA 2CLPA 3GNRA 3QFWA 3CV1A 1DQUA 1OSEA 3FDKA 4H2CA 3T09A 3BOXA 2ZZ6A 4DBUA 3CMGA 4YTTA 1F3XA 4H9XA 4A8LA 4FHAA 3CZLA 3C52A 3NM1A 1H49A 1GOKA 2R1NA 4KWUA 3T07A 2CIPA 4BQ5A 1MFVA 4M80A 3NYDA 3GXFA 1RAKA 3SY8A 1OM0A 5LHFA 1VENA 1UA3A 1KM0A 2X1IA 2G5WA 3LTYA 3T81A 2XSAA 2E6DA 1GOWA 4JN8A 9RUBA 1TPH1 2A3CA 4Q33A 2AL2A 1SW0A 4XAZA 2E9LA 4JYDA 2HWGA 3DOPA 5XIAA 4D6IA 2QCDA 2G50A 1HKKA 4F9DA 3C56A 3QQ0A 5AZ1A 3LQGA 1V0MA 3M44A 2CXGA 2EAWA 3DKJA 1PSCA 1EWDA 5ABFB 2E9MA 3GB6A 3L4XA 1VYPX 3U7VA 2DSWA 4WXZA 1RJQA 1HGWA 1PDZA 2ZE3A 1V5XA 1KBJA 1XLDA 3SZ8A 2VX5A 4MAZA 4PMDA 3QGAC 1R47A 2PD9A 4C6QA 3PAOA 4GISA 4H8VA 1P0DA 4H2HA 3RRAA 1YDNA 4DO5A 4FXJA 3E38A 3OZYA 4HA4A 1GONA 1IXQA 1SJBA 2QR6A 3BLDA 3DIPA 2P10A 1MSSA 5DT5A 5G2IA 3OVGA 2GFTA 1G6CA 3BCDA 3FXGA 4IMAA 4LGXA 4J3UA 3V4BA 1DIOA 3D6NA 3MSRA 4UXDA 1M53A 4JFSA 1SYTA 3C2YA 2DU2A 4ZE5A 2PURA 3VE9A 3B06A 1U1JA 3EOLA 3KP1A 3H54A 2ZRUA 1SJDA 1XSIA 3TYAA 1JRBA 3WQCA 1CZ1A 2A6NA 3W00A 1SVDA 5FA5A 4C60A 4F0MA 1IT0A 3OGVA 1F3WA 4L6OA 3OZOA 4ZO8A 4MZYA 4ZQPA 2WSQA 1V3JA 3QY6A 1FH8A 1WP6A 1KXQA 1MO0A 1Z69A 5LZLA 2XU2A 3ARVA 5T26A 4LAZA 2O4QA 1TPC1 3BH4A 1G4SA 4U33A 1PYFA 1TR9A 2J7GA 4DB7A 3UWEA 4Z2GA 1TG7A 1XH0A 3I6RA 4MNLA 3HA1A 3LSBA 1GYLA 2I9EA 1Q3NA 1KRAC 1QWKA 1E5NA 1OFAA 3QMTA 3WQ5A 4LUYA 3PPHA 1VFHA 3L5MA 2BXZA 1KFWA 5IBXA 2X1RA 1XLIA 1JRCA 8XIAA 3ORWA 1FQ0A 4XWUA 2QGYA 3HJZA 3NGFA 1TVLA 3UEQA 4X61A 3TJIA 1JPIA 4RPQA 2A5HA 1UWSA 4NXSA 4UTLA 4W5UA 5JIPA 1HL8A 3R10A 2GJXA 3WH9A 4FPSA 1CWYA 3I3BA 2IXUA 5J5DA 1PIFA 3NM3A 3ZO9A 4IPLA 3TX9A 1I2RA 1GVOA 3TDFA 1KGWA 3GXNA 1JUBA 1QDSA 3CUFA 4AEOA 4AHPA 3TZFA 1G5AA 3BGAA 3SEPA 1LL6A 3HTWA 2V6AA 5CBIA 4R85A 1F6KA 3SCPA 3KVLA 4DF0A 1RXOB 4QG9A 3CAQA 2BZNA 3KHJA 1S2WA 5LIUX 1F6YA 5CH9A 1XKYA 4DI9A 4O57A 1LBMA 1ONEA 3ZVHA 3UZXA 4LVFA 1ICSA 2B81A 1WNOA 1RP9A 2BOFX 3J7HA 3E0WA 4CEXC 3TTQA 5FI8A 2H9AA 4JY9A 4OHQA 4LT9A 1XXXA 1ZP4A 4LX4A 3B8UA 3P14A 3B4YA 3BARA 2QMKA 3W38A 1LF1A 2H6RA 4AZ7A 2OQHA 3S4TA 2PMQA 4DBDA 3NVTA 3QF0A 2ACUA 3PY2A 3TR2A 1EHNA 5G2WA 3U6WA 1NF7A 4WOQA 3STFA 1J12A 1G0CA 4OT7A 1SO4A 1OD8A 4WX2A 1UMYA 3K2GA 1TWZA 4GX9A 5HDRA 1XFBA 1FP9A 3UVAA 2X1UA 4ZGYA 3QV8A 5M17A 3W2NA 3LPOA 4PYSA 4NASA 3RR4A 4GUGA 3DFTA 4QJ3B 3OBKA 4M6PA 1QNQA 1CENA 1LLOA 1EJUC 2VUYA 3PBVA 3SN1A 3IIVA 3ZT6A 1LRTA 3TR9A 1X7FA 3LDVA 2JALA 1BXCA 3NO3A 1WDDA 4DPPA 2VZOA 1UQZA 2G3MA 1W9VA 3M7WA 4YPJA 1NARA 3CHCA 1ZZMA 2YBUA 3MZNA 1OF6A 3EB3A 4N7QA 2BOGX 4JKMA 1AG1O 2X8RA 1PZ0A 4M6VA 3T40A 1OT1A 3B9OA 4U5IA 4KMQA 3COTA 2WHLA 3O9NA 4ZSTA 1TTJA 4Q4OA 2NT1A 2WHJA 3N13A 2PF8A 2CZFA 2PWFA 2X40A 4OQVA 3L9CA 1M7XA 3MBDA 4X2RA 2XN0A 3VCRA 3PUDA 3U5UA 3GW0A 1YDOA 4L1GA 5L9FA 7PTDA 2WMIA 5CZKA 3G1YA 2DUAA 2PF0A 3HG3A 5JBEA 4PMJA 2C6QA 4M24A 3KOFA 2OR2A 4QJ1A 3TVAA 3KLKA 2WWCA 1XG3A 4GLEA 2GQ9A 3K46A 2E6AA 2ACRA 2JF6A 3TXVA 4J3WA 1OX5A 3W86A 3F2BA 4GCAA 5AFDA 4EKJA 3BJTA 3KZPA 3SRKA 1O66A 1R86A 1DKWA 1E6XM 4WQ6A 7A3HA 2OEKA 1IWBA 3RU6A 4FOKA 3WNLA 3LMYA 3DC8A 1UCWA 3PANA 4X0NA 4DWSA 4NAFB 1FWDC 2D3LA 5FF0A 3RHGA 6XIMA 2PAJA 3AZRA 1K7FA 3UR8A 3T9PA 3OIHA 4QRNA 4UTTA 2IKJA 1M01A 4XISA 1E0WA 4IQLA 4M19A 3UERA 2ADAA 3P6LA 1CLKA 2PDJA 3MP5A 1N2VA 1R9ZA 3QLLA 2WJDA 2QMJA 2XN1A 3O3RA 1BWLA 1H60A 1F9CA 1TJRA 1OK6A 3TFXA 2Y61A 4M82A 1M7JA 1NF0A 3ITTA 4B5WA 3E2SA 1TREA 1X6UA 1Z3NA 3B9EA 2Y7EA 1DVJA 1CEOA 3B8WA 6REQA 4H00A 1K4HA 5C9UA 1EJRC 2A3HA 4URIA 1FCBA 3AIUA 4OFCA 2Z27A 3UA3A 4EACA 5G4WA 2YL6A 5GVJA 2WXDM 1Q4WA 3AXMA 1VLIA 3GLCA 1SU5A 3CIXA 3QR0A 1GJUA 1UIPA 3VYLA 4HOZA 4DZIA 4JGDA 1UZ4A 2WPGA 4LAUA 1KFKA 2GVJA 1J93A 3PBYA 1RP8A 4JDBA 3QSTA 3IRDA 2VCAA 1HQTA 1Q7QA 5H2ZA 3S2MA 3AXIA 4BF5A 4M6QA 3LXCA 5D2TA 2D69A 3CWNA 4ZQMA 2Z6JA 3UJRA 4J3VA 2EJ1A 1W9BM 1ZJAA 4XSLA 4ICCX 3U2EA 3QN3A 3RCMA 3DG7A 4HPHA 1KFEA 2WMGA 3GTHA 3CM4A 3GC5A 5J8LA 1UASA 2OGJA 2XVPA 2RUSA 1OYAA 3PAJA 1JUEA 4QP0A 4MB5A 3LHYA 3G18A 4HHMA 2X1TA 1UWQA 3ALGA 4Y9AA 3S6TA 2WBKA 4A2RA 2VHLA 1XPGA 1CB7B 3W6MA 5HWNA 3H2AA 2CBVA 5H8MA 3WLHA 3KP0A 4AF0B 1IE7C 3BAIA 2D2OA 3HJEA 3DG3A 1QNOA 4AW7A 4N4PA 5G1YA 5CBBA 3WZ0E 1HXJA 5C70A 3MV01 5CG0A 2W62A 2X0YA 1AH4A 4GK8A 4K38A 4I5UA 3LV6A 4JFVA 3NQEA 2GOUA 4DNMA 4F40A 2VM8A 3P5ZA 1JAEA 3T42A 3UWVA 2RDWA 3GTNA 4PMUA 1HO1A 1BQGA 1OX4A 1V6TA 3GS6A 1EDQA 2OSWA 4C1NA 2C0HA 5K9DA 1WZKA 4LCRA 1EQPA 3PTQA 4FSAA 1PV8A 3O7UA 1DWFM 5HINA 4QISA 3ZFHA 1WDQA 2IQTA 4CNNA 1CXFA 2ESCA 4W7UA 3T0AA 4Y8FA 3WK0A 1RD6A 1E9IA 3UXIA 3PPCA 2QZRA 4RUBA 4LNCA 1AVAA 4JHOA 1BPLB 3N4AA 5DEZA 3KOXA 4HMDA 3SCOA 1HNYA 3OVQA 1AZ2A 1MWOA 1OG6A 4QX4A 1V93A 3F5KA 1I0DA 5DO8A 1I45A 2DZWA 3TSDA 3UZJA 1MDLA 1XLKA 3VZXA 1O1HA 2Z1XA 4DUXA 1LTDA 3FLUA 3EKZA 2BOEX 3TU9A 3DBNA 1XIIA 3LCWA 2VX7A 2VC7A 3SRHA 4ADSA 3HIJA 3IARA 4UTHA 4IFKB 4W8AA 3KCLA 2PE4A 1F74A 3W2LA 4HYWA 5EFDA 1XRFA 4GI6A 2E40A 1YLVA 2J6VA 3A4JA 3UWYA 2Y89A 3KS5A 2ZWYA 4EPEC 4OV4A 1N8WA 3EOSA 5CG7A 1XLLA 1MXDA 4TO8A 2EPMX 4GIRA 1Z9AA 1ISVA 3B3DA 4JHZA 3NPUA 2NW0A 2X2GA 5AHLA 4GUHA 2F61A 1XG4A 1TTQA 3OHIA 1E55A 3A4WA 2J47A 4DF1A 1FTXA 5EBAA 1KV8A 4HZMA 4TOQA 3UVIA 3XISA 4D1JA 3L0GA 4ZB0A 4UZUA 3ZYZA 3GXMA 1UPMB 3AMKA 3AYRA 2ZKMX 1DP0A 3PB2A 1GK8A 3W1AA 1BYBA 4EPKA 2YA0A 1OC7A 4ZZ9A 2C1GA 2PGEA 1E1CB 3LX9A 4HJWA 2CERA 4MLJA 3ITXA 2F6UA 3A24A 4PUWA 4UQCA 4IISA 1WZAA 5DY2A 3P80A 2PUZA 1AJZA 3LV5A 4FLSA 1G7VA 3CZ8A 1LWIA 1T8XA 2VGIA 2DVUA 2XGBA 3VABA 1G94A 3WJWA 3A23A 1GZJA 4NI3A 3HN3A 3CQKA 4O15A 1S5VA 3URNA 8XIMA 4EANA 3G24A 2WZMA 4KRZA 1V3IA 4QGCA 3N14A 4I6KA 1Q66A 3NVDA 3TXZA 4TR9A 3WCZA 3GDKA 3BE7A 3W28A 4LANA 5AVNA 5AC8A 2SFPA 3H2EA 4E4PA 1O5QA 2ZZ5A 3THDA 4OBTA 2C1HA 4GY7A 2REQA 4I5RA 7REQB 1LOLA 3W7HA 3WLNA 3QKEA 4DZAA 3NL6A 1ZFJA 2E25A 4QS5A 4Q32A 2Y7GA 4QNWA 4IUOA 3OQEA 1YPIA 3JR2A 2HVMA 3BURA 4UMBA 4K1GA 4UR7A 3H2NA 4KCUA 4PC8A 3AHZA 5A8MA 4DVOA 1XLJA 1SR0A 2I1OA 3W27A 1PE1A 4QR6A 3EB4A 3WL1A 3PZQA 2B0MA 5B80A 1KM3A 3SR7A 4I8DA 2BV9A 1B30A 1SGJA 3QOMA 1LWHA 4QFUA 4BF7A 3QEZA 4J28A 4H1ZA 2QVHA 1X6NA 4LBUA 2CHNA 4PUKA 3VM7A 2D2HA 3CUHA 2GPTA 3NQ8A 1GQNA 4FF7A 1QMLA 3NQMA 4BR1A 2XGZA 3PZIA 1JR1A 3AUOA 4D6JA 1HJSA 4RL3A 1S5TA 3AMCA 3CMFA 3CUIA 5D2WA 4YYFA 4DXXA 3FJLA 3BL3A 5DRIA 3LD5A 2V63A 3B04A 3ZSTA 2PI6A 4LBRA 5MHBA 1LT7A 2XFYA 1IGSA 2A7NA 1RBAA 1NH6A 1RLDA 1MDRA 2HPIA 5GJMA 1DEDA 4MKVA 4UUIA 2C71A 2HEJA 3E96A 4HPXA 1K8CA 1WDPA 3S2CA 2WLZA 5LGXA 2CW6A 4WY0A 1PTDA 3B0UX 1PZ3A 4H4IA 3QQWA 3I7RA 2ZDSA 1B3ZA 3WD1A 3OBAA 1E51A 1J11A 1XBVA 2VZSA 3Q94A 1A3WA 4PBGA 4IFOA 3VILA 7CGTA 3TTOA 1A5AA 3VDHA 2OYLA 5BW6A 3M7SA 4US5D 1AL7A 5G4EA 4JTTA 4LF2A 1IGWA 4UTMA 2W63A 3DHFA 1ZB5A 1QK0A 1UR8A 4JCMA 5BRBA 1US0A 2VEIA 5TNVA 3RPDA 3P62A 4AG0A 1DJZA 3E49A 4FX6M 1B3VA 2PDCA 1H7RA 1GQLA 2KX9A 3NZPA 1B90A 1W91A 4QS6A 2VEPA 4RV8A 3NXLA 2O92A 3CTTA 3CTLA 1QI5A 4TIMA 3HPZA 2Q71A 1XGDA 4F0LA 4R7OA 4MNJA 4R9XA 1LT8A 4Z0SA 3RPTA 2ZC8A 3RIKA 1XIFA 1EIXA 3ES7A 3P67A 1J96A 3NOYA 5BZAA 3ECQA 1S38A 2ZUMA 3S6DA 3W72A 4FNSA 1O95A 5DMYA 3ARPA 1RCXB 3SQMA 1V3HA 3NQ2A 4Q8QA 2HJPA 3GG8A 2VC9A 1TKKA 4DXVA 1ZALA 4OKDA 1J8VA 3NQGA 3CQHA 2O4MA 3U57A 2AKZA 3O63A 1DE6A 3IPWA 3S6OA 3GR7A 4R7JA 4D2JA 2QJGA 3N2MA 4AWEA 1VCFA 2R14A 4A3UA 3S5OA 1C7SA 3W9ZA 1E73M 2VZUA 2Z1KA 2DT2A 2PODA 2DT1A 1REQB 2AAMA 2VMFA 1CXLA 2PTYA 4PCSA 4U10A 4O8AA 3GG0A 4NZ3A 1LORA 3MQTA 5C8BB 3TWAA 2E67A 4UQBA 1A0CA 1BWKA 3KEHA 6XIAA 2ZYFA 3USZA 1OZQA 2G37A 1PKMA 3ARTA 3TTEA 3LB0A 4Z2IA 3TSBA 3TKFA 1LOSA 3E6EA 3USBA 3VA8A 3G8RA 2XG9A 3WYZA 5C0QA 3BC9A 5G4HC 4GKLA 1M68A 1YTDA 1J2BA 3DDMA 3TA9A 1S2CA 3MHUA 1P48A 3NGJA 3B4UA 3W74A 3AHYA 3MMDA 4FIRA 5DCBA 4GVHA 3IRSA 1CT5A 1UWAA 2WZEA 1BAGA 1RR2A 4EAYA 3DFOA 3WFLA 4PTVA 2JEQA 3I65A 4XZLX 4FOJA 3V1HA 3EWXA 4GG9A 1BSLA 2XPKA 3TOYA 2NQJA 4J1OA 3IJDA 3LXBA 2WJZA 2PS2A 4C91A 3E2RA 4IG2A 1L2QA 1ITUA 2P8CA 4Z1YA 1VIZA 1U5VA 2PBGA 3Q58A 4MOZA 1VS1A 4OBRA 3W73A 3VOCA 3CGTA 3SJ3A 3UU0A 1G67A 4JOMA 2XIBA 4ZODA 3C3NA 4XZWA 1HUVA 3BPWA 4EOUA 1YTKA 4INFA 1ISYA 2C14A 1M9HA 2PLKA 4TMCA 1XLMA 5LNUA 3A12A 1B1YA 1EF2A 3O0KA 4IIHA 1F2JA 5A95A 2XN2A 5PTDA 1VRXA 4MSSA 3S1WA 3FYPA 4ZQRA 1JNDA 3V7PA 4D6CA 4TV5A 4AZCB 3BLIA 3OGSA 3U9IA 4D6DA 1XH1A 3WIJA 3BMXA 2OKTA 3TZNA 3LTSA 4FLOA 1B3YA 4HN4A 3NL3A 1F3TA 3HBLA 3HO8A 4CD8A 4QM1A 3UCCA 4A35A 2O9PA 2YA2A 3O2LA 3W1MA 3VO0A 3S5YA 1VJSA 4ZA0A 5AHFA 3LHVA 1U5JA 4K3ZA 5G1TA 3IUDA 4E2OA 4W93A 2XINA 1D3GA 1WXZA 3M6DA 1Q5MA 4G8TA 4IHCA 4LUJA 4RX0A 1R87A 3BICA 4O50A 1L2UA 1N8IA 3SB0A 4QDWA 5DFAA 5A3HA 3VZYA 2F2HA 3D5HA 2X42A 3WD3A 3WH5A 3GZAA 3N9RA 1X6LA 1H7NA 4DLMA 4RZ5A 3FYOA 3LXAA 4AU0A 3GKFA 1XCFA 5KZMA 1M04A 2PDGA 2V67A 3DFHA 3EYPA 4Z2KA 1O5RA 4M7SA 2J75A 3EPMA 1RBOB 4MIMA 1R2TA 2ZUWA 3FSUA 1E0VA 1JCXA 1S5NA 1PO9A 1AK5A 1NFGA 3B03A 1MYRA 1K1DA 3SSJA 4O12A 1P1XA 1VYSX 1OT2A 3MUY1 5FEWA 5K7JA 1JD7A 4KERA 2NV2A 3BZGA 5LNWA 1UKQA 3QY8A 4E4UA 1TCMA 1KLZA 3TQVA 4GI4A 4O10A 4YTUA 3URAA 3AIBA 4ERGA 5CAKA 2FZ8A 1GEQA 4IZGA 3FAXA 4IPJA 2CLMA 4JIHA 5HANA 1EHAA 1OIFA 4XV0A 4RE0A 4HJFA 4MMWA 1V51A 4IL2A 3WMSA 2IKHA 4ADUA 2NQHA 4XB3A 1HT6A 4MJ2A 3BCFA 4QSHA 4IGMA 2QF8A 2V3EA 1JCMP 1FY6A 3RAOA 4AIBA 1FP8A 5CPNA 3WQGA 4LUTB 3H24A 4OBSA 2QLYA 2RFGA 4JKKA 4Z2JA 3N11A 3VKBA 4DJDC 2ZUSA 5CLTA 3TNBA 4L4PA 3ZOAA 2Q01A 3RM8A 4BJHA 3V36A 4GABA 2AQOA 3WMCA 4DBSA 3OPSA 3M0ZA 5CBJA 3M4HA 1AODA 1VD6A 3LHWA 4WIWA 2WVVB 1T6MA 2WJEA 4GO9A 4BEUA 4B2DA 4TVUA 2BVYA 4MNMA 3KL3A 5BRPA 4AMCA 5JVLA 5BOFA 3UXAA 3WMBA 2NQ5A 1QT1A 4GIYA 3TN6A 2G3FA 2VR2A 3BK0A 3CIWA 5G1MA 4MPKA 1ZPTA 7ODCA 3R43A 3G1DA 3FW6A 4FX8A 1CXEA 5D37A 1YHTA 3SGUA 1DV7A 1PZ2A 3NL2A 5CZJA 4TX8A 2PLJA 2W0UA 1V3KA 2ON3A 4UMAA 1DJQA 1VBUA 1QPQA 4JKLA 1V6UA 4A8IA 2OYKA 4YTSA 3A3WA 1IR1A 3HPAA 5EMYA 1P1MA 3HG5A 3KLLA 3UG8A 1XSJA 5CSUA 4QAWA 2J8TA 5E93A 4FOUA 4B16A 1UOZA 3KM8A 3AS1A 1B4EA 4JIIX 1SQ7A 1UC4A 1A3HA 4HSNA 5L6UA 3VNZA 4AISA 5HJYA 2HDJA 5BXPA 1DHKA 1K03A 3P60A 4Q8UA 5DT7A 1V02E 2OLSA 3L23A 4XZMX 2IXVA 5HMEA 1QRQA 3ERPA 4FO4A 1LM1A 1CGWA 1O1ZA 5HWMA 1DJYA 3EWCA 1P0NA 1QUMA 2OODA 2YFOA 2Q3OA 5FJPA 3G0UA 1Q2SA 4UCFA 2FH6A 2WYSA 5JXQA 5REQA 1Q45A 1I0BA 5CEWA 2Z1VA 3MYPA 3UJSA 3UZWA 2W6RA 1EDTA 4RJEA 4LAKA 3PHAA 1RHCA 2IQ0A 1V7YA 4A3YA 1UA7A 3W1NA 1YEYA 4A4AA 1O60A 5JU6A 4XIAA 1TTIA 1TV4A 4F9JA 3D3FA 2D0FA 2Z6IA 1YBQA 4H9TA 1FOBA 4JS3A 4ZFCA 4IPIA 3ABSA 3UZ5A 1R7OA 1BYAA 3KDOA 4D71A 4J3XA 3VD4A 4POCA 3M43A 2VX6A 1VP5A 3PP7A 3G3MA 3CPUA 1MEWA 4EIVA 1E0TA 3VX0A 3VGBA 4RDZA 1TTPA 1WBHA 3UJFA 1ADDA 2QS8A 3ZLHA 1UPPA 3UXDA 3K13A 1VR6A 3MUZ1 2FVLA 3A6OA 3TSMA 2H8ZA 1EL3A 3NL5A 2ZVRA 3N19B 2X7WA 2QUTA 3HMJG 3DX5A 4O1AA 2CBIA 1HJXA 4C90A 1JDDA 4J2MA 3O0FA 4CQ9A 1TZZA 1TMQA 2FMOA 3KCJA 1XD1A 3HU7A 2CCRA 1RD5A 5BMWA 2CEQA 3WJZA 5C9RA 3APGA 2WZHA 4MKNA 4S3BA 3VGDA 1UP3A 3FOKA 4KQNA 1AW5A 3CC1A 1QI4A 4X63A 5LIKX 2D0GA 2NZLA 2DZAA 2QUVA 3VD5A 1DWIM 3THAA 3DBPA 4QJ4B 2YGYA 4IPPA 1FWBC 1UD3A 1N55A 4K7VA 4DN1A 5KMYA 4CQAA 2J66A 2WSKA 3VNIA 5I3JA 4O28A 1LG2A 3EOOA 3QPEA 3TONA 3E02A 2CHRA 1MW2A 4OZOA 3W87A 3ZJ8A 2PA6A 4XTIA 5K3VA 4GYFA 1ZJBA 4CN6A 3DXIA 3C2EA 5CZ0A 1PWLA 3GRIA 3Q37A 3HV9A 2UY2A 1F8IA 5CPLA 1TWSA 3HPSA 4Y9MA 3U0HA 1FXPA 1UIOA 4ML9A 1Z32X 1EJTC 1QPNA 4S1FA 1UBPC 3VOIA 3QV9A 1BG4A 2Y7DA 3CNYA 1TA3B 1HKJA 3WLOA 3UG5A 5BOEA 1EC7A 1FCUA 1HTIA 3EGJA 2BG5A 2W5FA 3MANA 1XRTA 3CS2A 1B5TA 3NCOA 3BSMA 4UBPC 3M1ZA 4KCTA 4AZIA 4CGTA 1Z42A 1OFQA 1PJ9A 1ZENA 3WDQA 3QVQA 4YCPA 2CFFA 4HYVA 1F4AA 3BG3A 1M3UA 4L9YA 3ARZA 5ECUA 4ROQA 3GM8A 4ZL1A 2WVUA 1B3WA 2PPGA 4BWLC 3OVRA 1R9YA 3H4GA 4LCQA 2YDQA 3SCRA 1Z48A 2PZ0A 5FF3A 2PCQA 1XIJA 4EAMA 1KFCA 3NSMA 3OGRA 3G0SA 2PTWA 2AKMA 4YWIA 3SFWA 3RM4A 3W7EA 4X9SA 5FEXA 4LUSB 4DM2A 2QNEA 4UCGA 1GVYA 2NV9A 3ZJ6A 3IVTA 3PNUA 4LFYA 2EPHA 1GJPA 3QPZA 2QCCA 1TCDA 1S2UA 2GDQA 3I7QA 1FWIC 2PU1A 2VQUA 4L61A 2PDYA 2QJMA 1V02A 3BJFA 2W91A 4F0KA 4MLRA 4MYAA 2I14A 3H6OA 1GTEA 3NDOA 3PZVA 1JI1A 5FEZA 3E12A 4I90A 3N2OA 4MNKA 3G1RA 3CQIA 2DEPA 1W37A 3PPGA 5CLWA 1K8ZA 4FR1A 1P7TA 4FX7A 1DIKA 1Q6EA 3WENA 3W75A 3VIMA 4Q4RA 4IX0A 3L2IA 5IFPA 1BTCA 2VQTA 2Y5EA 5M1TA 2O9OA 4FNUA 5D4YA 4QDMA 4E38A 4KEVA 3S1XA 3MO7A 2Z1WA 2VFFA 3GO2A 3RITA 2QAFA 3WQEA 5A6JA 1QNRA 5FJIA 3MSDA 4LVGA 4IOTA 4HB7A 1JDFA 2O9TA 1TO3A 5DX7A 1KV5A 1LWJA 4C6DA 4W4QA 3GIQA 3S46A 3BLEA 1QJWA 3SUVA 3BXWA 2XFRA 3PJXA 1DOSA 4JL1A 2A3EA 3WQDA 2IPGA 4QLLA 3FKRA 1Q65A 1EP2A 1EOMA 3UP8A 4AYSA 5KZDA 2YDAA 2G4FA 2D22A 4WHBA 2WB5A 5LA0A 4L56A 3ARSA 3WQWA 1H7XA 1C7TA 3WFZA 3IGHX 2ISWA 1E56A 3C2RA 3L4TA 1K6AA 4G2DA 2B7OA 3L65A 4B9YA 2WKLA 3GTXA 3PNZA 1E1EA 2YJQA 4ZOCA 3HGOA 3E0LA 1ENUA 2WAGA 2FDMA 4DAFA 3SJNA 1H63A 3M0JA 3STGA 1D7FA 2QHAA 4OUEA 5AVHA 3QM3A 3F2DA 1QASA 3C0JA 5HJLA 4PRWA 4DJDA 4OTKA 4F2BA 3R1ZA 4UZSA 5C2XA 5C2CA 4LAMA 1Z44A 1E4NA 5A8NA 3N9SA 4A8RA 1UQYA 1OCNA 3WQ8A 1V7AA 2P76A 5F2MA 1QOPA 3IJQA 4BHYA 1NTHA 3V1PA 3FA5A 1XS2A 3AYSA 3CH0A 3L4VA 2EGZA 2DFAA 4DXKA 3B0VC 4LB4A 3CQ0A 4HN8A 1O12A 4AZ5A 3CPRA 1IIHA 2INFA 3R12A 3SRFA 1S3TC 4S3FA 2IUZA 3MTWA 4QQ3A 3EWDA 5FSEC 5DRCA 1JYNA 4LU0A 2F7FA 1DWAM 4E5TA 5A69A 4HU0A 1W1ZA 1JAKA 1YX1A 2OO6A 2XTKA 3EKLA 1KXHA 1QR7A 4ORMA 1US3A 4OIFA 3OB8A 1KXVA 2DV0A 3APTA 1QXLA 3NURA 3POCA 3F4CA 1DL3A 5ABHA 2EG7A 5FESA 3VX1A 1GWJA 1T5AA 3QSRA 2CC0A 2WCGA 3EMQA 2V0TA 1DJNA 2PEVA 2A3LA 2ZICA 4GQ0A 3QJAA 4W5ZA 3H7RA 3T08A 3KBVA 4B3ZA 4GC4A 4C6MA 5LNVA 3VC6A 4HNTA 2QCFA 4P7LA 2DW6A 4UTUA 3DEQA 4WR3A 1PKYA 4Z1AA 3ZWSA 2RAGA 3ZR4A 2BY3A 3SFKA 5AC5A 2YW3A 3W29A 4Z2HA 5HMSA 1Q6DA 2Z00A 9XIAA 1TYGA 1XIMA 4LAOA 2BGNE 1TWWA 3QZ6A 3MC5A 4X9YA 1KFJA 4YNGA 2F38A 4G6CA 1N8FA 4ACZB 2INZA 4LCSA 1XSKA 1I75A 3M5XA 2Y8VA 2FZ9A 1E72M 1EB3A 2WMJA 3G8EA 1DORA 2W3ZA 2YXXA 1E9ZB 3S1GA 1B2YA 4FP1A 3QXBA 1QK2A 3RU8X 3DHPA 2FPVA 2XIOA 5CZTA 1JYXA 1NDWA 4ECLA 3SADA 3APYA 1EUNA 2WPBA 2R82A 1K8XA 3BLLA 1PIIA 3U8GA 4GKTA 5F4SA 3GFYA 1KCLA 4OOZA 6PTDA 1WKEA 2I5GA 1WZLA 1GHRA 5BWAA 2R6OA 3ZT5A 4MB3A 4TQTA 1RJPA 1V6WA 3GR4A 4JHMA 3VNMA 1AQFA 1F4HA 1R46A 3FYYA 3FK4A 3SM0A 3W7KA 1XW8A 4LB3A 5C54A 2BGSA 3W23A 1VFTA 3FJNA 5G5IA 3B9NA 2Z7GA 3A5FA 3SIMA 1HFBA 2CZ5A 4ZTYA 3TCEA 3HQNA 4IIEA 2QV5A 3TW7A 1S39A 1V6XA 3CUGA 1H5VA 3RO6A 1QW7A 1VEOA 3V0SA 1OX6A 1ZAHA 2P50A 4O54A 2ZA2A 4Y9PA 2F2KA 2QUNA 5FSDC 5I06A 3UJ2A 3WDHA 2GDUA 1R3QA 1IXNA 4XZ9A 5D9OA 2BASA 3MKCA 3XIMA 3LBOA 3UYIA 2QDDA 4AZCA 2OCZA 3PWGA 3VMNA 4HZ7A 4XAGA 3S2LA 4LRTA 4B4HA 2W27A 1RJRA 1OY0A 3NQCA 3V75A 3TAOA 5KINA 2OYMA 3CMJA 3A9BA 1BFNA 1L9WA 4K6AA 1RPXA 3GG7A 2FTPA 3UXLA 2YR1A 3QYQA 9CGTA 3KVKA 3PZ9A 3Q45A 3W7NA 4JEJA 1H41A 4U28A 2VEFA 1PCKA 2G3JA 3MW7A 3W7MA 3FJ6A 3NJ3A 3URBA 2VUNA 4XAFA 1R85A 3WD0A 3MVIA 2HQAA 4H3DA 1JPHA 4NXKA 2WVSA 2TYSA 4BI6A 1XIHA 2HK1A 2YZ5A 4AVOA 3H7UA 1QOQA 1TPVA 3NIYA 1KM4A 3KWSA 5HNRA 4LJ3A 1R38A 2C0AA 1DYSA 3GHTA 3GDBA 3ANYA 3CYVA 3W7JA 1AH3A 1GVEA 1FVPA 1MUWA 1UD4A 1UR2A 2YL9A 4HMNA 3W84A 4FB7A 2VURA 1LQ0A 1XLBA 2CYGA 2DQXA 1B54A 4JFTA 2FZNA 3P82A 2HVNA 1GG1A 2DQWA 2YCLB 3LCIA 2NUYA 2YYTA 2H8XA 1SZNA 3TH6A 2JIEA 3A64A 3M0YA 3EWBX 4IPNB 4Q8MA 4BWLA 2BHZA 3M6YA 5F7UA 4JIQA 1VFLA 2UY3A 4LVAA 3ZVIA 2YIHA 1NVMA 5I77A 1CNVA 4LYKA 2GVEA 6CGTA 2PP3A 1B31A 2D24A 2VR5A 3ABXA 3VK5A 2Y1HA 5CC6A 4GNJA 2IPWA 3PR2A 3TYDA 4PH6A 3MSGA 1YPXA 1WUFA 2YB1A 1FWSA 2POTA 3JU2A 1GQJA 4QNEA 4D1IA 1QO2A 2HCVA 1GT8A 4IFRA 5HMDA 1BGGA 1ZTVA 4B9ZA 1Y5VA 2PZNA 4JQ1A 3EWZA 1AUSL 2PC8A 2PWUA 4NG3A 1B3OA 3WLIA 1V77A 3LCHA 1EO5A 3SY5A 2PLMA 2OWWA 1TUFA 3GIYA 3W1QA 3LM7A 3M0KA 1V6VA 3BSHA 4MZ1A 3RK8A 1Q6CA 1POJA 3N18A 1P43A 1BVZA 1VLWA 4RNFA 3G5EA 2XZ7A 2R9RA 3LG3A 5A8OA 3B97A 4LSBA 3NWRA 3M0MA 5A2CA 1VZWA 1NWRA 3WEMA 4G7EB 1GGOA 4ADTA 1OHLA 1ONRA 1AMYA 1M1BA 5I23A 4C6OA 3KOZA 1DXFA 1OCQA 2FTWA 3B8IA 4MWAB 1M5WA 1E6RA 2C79A 4L5ZA 4ZCWA 2ALDA 3DERA 2DIEA 3WLLA 4BQ3A 5LA1A 4L80A 2B4GA 2QVNA 3CWOX 4N02A 2CNCA 2P3EA 2F9RA 1UG6A 3VUSA 1RH9A 4C1LA 1JJKA 4QG6A 3AFBA 4QAIA 4JR5A 3NQAA 4WGXA 3OLGA 4MDOA 2PDHA 3L2MA 5E70A 2QDEA 4S2CA 2V5KA 3FVDA 4NAEA 2H3DA 3ATZA 5MKGB 2WANA 2NQ9A 1UROA 1BVWA 1H5YA 1IT8A 4RPPA 1TE1A 1I60A 5FAGA 4JX4A 4H9ZA 1X96A 5IM51 1DE5A 2ISDA 2VNCA 3IGSA 3S8HA 1HJUA 3BG9A 4Z1DA 2VGGA 3U3HA 2ZUVA 1IEWA 4RW5A 2PDKA 2Q8ZA 4GC3A 3N4FA 3LSCA 2ABBA 4GQQA 5CGQA 1QVBA 1EGVA 1MNZA 4A3HA 1W1PA 2FIQA 1AQHA 3TEVA 4LALA 5LHEA 4WLCA 1ZAIA 3AU2A 5I07A 2YL5A 3O6DA 1BRLA 2Y24A 3S83A 1W1IE 2EHHA 3SUSA 1KFBA 4FMVA 5K2ZA 3S9YA 1CCWB 3SECA 1R9XA 4UFJA 4LC6A 2VFHA 6TAAA 3H2CA 5HULA 3MZ2A 5FIPA 2PFHA 1QPRA 3R0UA 3W2UA 3A47A 4PRTA 3M0IA 1A3XA 2J13A 3LNPA 4OWGA 2DSVA 2VEMA 5AC7A 3PZOA 5KETA 5A6KA 3RNDA 3TA6A 3NXFA 3AWNA 1X7IA 1PHWA 3N25A 1VPQA 4YLWA 1Q13A 2V9DA 1K6WA 4NP7A 3SN4A 5E09A 3RO8A 5JH2A 3IWPA 3L4ZA 3PF3A 1OG0A 2XH4A 4E0CA 5HWJA 4Z1CA 1UWIA 3G2GA 4DJDD 1VFSA 1EP3A 4PUMA 4C6PA 3HGJA 1VHCA 2V3FA 2DH3A 4NZ4A 4GBDA 2PD5A 2OT0A 2PDWA 4JCLA 4H9UA 4H7CA 2PCEA 3C3UA 3T44A 3NQBA 4WEVX 4O19A 2GDVA 2GLKA 3OZMA 4HCHA 3QC0A 3M5YA 2GJPA 4RDVA 3QGVA 3OU8A 3EB2A 3LZ3A 3M46A 1KRCC 3KBSA 4CNSA 4AWUA 3RJYA 1XD0A 3HG4A 3DH7A 4CQBA 3GE7A 4QCFA 4MYXA 1EXBA 1A80A 3TMLA 5KZ6A 3WDPP 1W9DM 2ZA1A 3IUIA 3F03K 3C61A 5DN1A 4DPQA 4AY8A 2CBJA 2TAAA 5IHSA 2H3BA 4MF4A 3ARUA 3O06A 1RBLA 4NT0A 1HO4A 2WC3A 3QV6A 2C19A 4GPNA 2YDSA 3BVJA 1V03A 4C65A 2E6YA 2E77A 4JAWA 4LWWA 3RLHA 2XVLA 2XIJA 3EAUA 3AISA 3MI6A 3WLTA 1A5NC 2QW5A 4DWDA 4UFHA 3VC5A 4AVFA 3W6LA 5TQLA 5E9AA 2HISA 4PTWA 1EJWC 2TMDA 3DFPA 4GNVA 4XD3A 3MY9A 5FF4A 4ASTA 4Q7BA 1DWGM 3VKJA 1AZ1A 1YTEA 4NKCA 4BK9A 4HPNA 2F6XA 4EPDC 1JL8A 1GW1A 4V1YA 3MS8A 3W85A 2DSUA 3TNOA 5GPRA 2WQPA 1I2NA 3OA3A 1JPMA 2VGBA 3QOKA 4DLFA 3JS3A 4DUWA 1A0DA 3PC0A 1EZ2A 2EBNA 2WHKA 1D7KA 3VM5A 3ABOA 3WLKX 1FDYA 2XSBA 1CXKA 2NSOA 2E9BA 2X0SA 1GZGA 3V5CA 3LGDA 2VYOA 2WK2A 3IJIA 4GWEA 2BBFA 3II1A 3W88A 3ITGA 4EWND 3V0UA 2QCHA 3AS2A 3SCWA 2FKPA 3P0WA 1LCOA 3XINA 3I7SA 4FNRA 1H51A 3H70A 4GFIA 1KO0A 5TIMA 1MRQA 2AOSA 3IGUA 4L6DA 4FLQA 3TQPA 2PRHA 2PRLA 5DMLA 4RZ4A 4HZ6A 2VO5A 4J9JA 3GNXA 5HNNA 2VT0A 1LG1A 4L4OA 3VIFA 2PGRA 4JL2A 5LNRA 3S9ZA 3SBFA 5FJRA 5T91A 3GWQA 1XI3A 2F8QA 3DKLA 1HIZA 2VENA 1IEXA 3F5LA 2I56A 2YCIX 3TN4A 5BU9A 3WDJA 1GQKA 1ODZA 1K7XA 1YE4A 1OCJA 1BWVA 3P93A 1FH9A 1HZYA 2VFDA 3KZSA 1NQ6A 2JGQA 1OF8A 1PVNA 3WNOA 4HYRA 4JTHA 1UKPA 4C5YA 4PCFA 1OGSA 4E3TA 1CX9A 3RX4A 2EJAA 1ZCOA 2ZRZA 1UB3A 3AIWA 4Y8EA 4P8UA 5I03A 3SUUA 3N2BA 3KXQA 4DELA 1TX0A 3I10A 4C7FA 4CQ8A 4I7WA 2GUYA 4R9OA 1L6GA 3GC2A 2WNZA 4KBXA 3SCSA 3OTRA 5HPOA 3URQA 3H12A 3VNYA 2QEZA 3D47A 1IZKA 2GVLA 2J8GA 4HCDA 3OA5A 3VIHA 2CZVA 1UWRA 4NIRA 1NOUA 1XLGA 4GUIA 3EX6A 3WK3A 5B7YA 5D38A 5EKYA 3WLJA 3OG2A 1ZU8A 4YWSA 4ATDA 3JZUA 3AZTA 3QTPA 5D04C 5HMFA 1VBJA 7TIMA 1W5QA 3GTFA 1D2KA 5D9PA 3T4CA 4Q8VA 1F3EA 1ZBKA 4PCNA 5A8GA 2ATSA 3UPMA 1JGIA 3CO4A 2V2HA 4CNOA 4AD1A 3JZEA 3L0KA 3PG9A 4V27A 1A5MC 1OFEA 4I8YA 4KCVA 1DQWA 4LXFA 4JQAA 3PK7A 3MP4A 3WNMA 1UZ1A 1PEZA 3OO2A 4L4MA 3IIZA 4AFYA 1JCYA 1W8GA 2QV4A 1DJIA 3T0BA 4HGXA 1E4MM 1FHDA 5HATA 5CSYA 3LI1A 1JVNA 3EX3A 3ZR5A 5HQMA 3F7JA 4LYRA 3LS9A 2ZA3A 3QLDA 4WSKA 4DUOA 4F2TA 3PBGA 1TUXA 1MUCA 4HNNA 1RK5A 3N9KA 1NY1A 3TJ4A 4JNMA 4FNQA 5KEZA 4S39A 3ISIX 1TSIA 1X8CA 4P7OA 2QT3A 3P84A 1J2WA 3ONCA 1B0IA 4IL0A 4GZ7A 3CT7A 4IIBA 2GVYA 1V08A 2PTXA 4ZB2A 3FS2A 1EBHA 4Q22A 3BWWA 2ZFAA 3C0LA 4YHGA 3LHZA 4KS0A 4HSHA 1W5OA 4LW7A 1R3TA 4XTDA 3S2JA 4DHGA 1U33A 2QKFA 2GGJA 2PDNA 1CYGA 2YYUA 4O1DA 3WUBA 2DZVA 5D2XA 1TPDA 3LK6A 1YNPA 4A3RA 2LLEA 3U48A 3CU2A 1Q85A 3KTSA 2AL2B 3W07A 2PGWA 3AYVA 1XM3A 4Y9NA 2OX1A 1LLWA 3S0CA 4ZO7A 4NYYA 2CLKA 2QCDB 4REQA 3MCOA 5D8WA 5A2BA 5H91A 3VXGA 3STCA 2UY4A 4PCTA 2QIIA 1CTNA 1K8YA 3MJMA 1Q6RA 3ONBA 3VGGA 1EJSC 4EVZA 1MXGA 1H7WA 2GWGA 4GVGA 1DHPA 3W3OA 1VEMA 2RGMA 5F2LA 3WF4A 4C7GA 4PCPA 1QI2A 4LQ1A 2FVMA 2ZRYA 4I9MA 2BS9A 4KKXA 4FI4A 1DJGA 4DRSA 4HA3A 3IIOA 1KB3A 4MWAE 3PZMA 3V16A 1W1YA 5EL1A 1F07A 1ODUA 1NAL1 4IMFA 3PTMA 1VB9A 3GUWA 1FWAC 4IQJA 3WJXA 4HPJA 3T2QA 3N04A 3RMEA 1I2OA 4XBSA 2OWCA 2ZXAA 5H6HA 3E3HA 2OTDA 2C1IA 4XZNX 2OPJA 1EEXA 3VUPA 2E6FA 5D03A 3FGCA 1WAWA 4PB3A 4XD4A 1BLIA 2QDGA 4KESA 3RFAA 4XVDA 3THQA 4F66A 2DJXA 2DIKA 1XUZA 1W6TA 1Q8AA 4JIRA 2RH9A 5F1UA 2Y7FA 4B90A 4WJXA 2DZXA 2PDUA 1W9UA 2PU0A 3H53A 1GYNA 1H1NA 5FCZA 2ZXQA 2Y62A 4RK8A 3IIXA 1GOOA 4GX8A 4O14A 1M03A 1WKDA 1X1NA 5M2FX 1WAUA 3IJ6A 2BHUA 1XCWA 2HVOA 4AWTA 1SJCA 2G8ZA 2I16A 5U4NA 4CKQA 3AQUA 2FGBA 4AC1X 4EE9A 3W25A 3QMRA 1TPEA 3PVFA 4L9XA 1XYCA 2QCLA 4W9TA 3VMPA 3W53A 4K39A 1KCXA 1UZDA 3TTYA 1QNVA 2YA1A 4WZHA 1C8QA 3FVMA 4UQ9A 3WN6A 3ZLFA 2GJXB 2NXIA 3PPFA 3FAWA 1T41A 3P7YA 1NQKA 1W32A 4JIPA 4LVBA 3EX1A 3VIIA 1O5KA 3D46A 1OCBA 1HL9A 2YZRA 3PUGA 4AD2A 2J24A 5BU6A 1YYAA 1W5NA 3BG5A 4A21A 2BP1A 1EIBA 4US6A 3UBPC 3VAVA 4Y9OA 1KWKA 2CHOA 1CXIA 1UUMA 5CPSA 4WY0F 3SSZA 1RA0A 3PUOA 2AAAA 4HBKA 3AMDA 1BQCA 4JTSA 2PRMA 3UCDA 2JQXA 3QR3A 3P0XA 2E1WA 3TW9A 3ANUA 3GFXA 3AS3A 4US5A 2IQDA 1C90A 2FJUB 3NZRA 1Y0EA 3Q65A 1TE6A 2FFCA 3M5ZA 5K9CA 2I17A 2QAPA 1V79A 1ZGDA 2C7FA 4IICA 1NP0A 1UC5A 2XVKA 4AZGA 4D6GA 4OECA 1KTBA 2ZX8A 3GXPA 2H9AB 3NNTA 5RUBA 2PTZA 3G1AA 1UR4A 4ENLA