1DQWA

Crystal structure of orotidine 5'-phosphate decarboxylase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
MHKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 92
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1dqwA00
1QCWA 1XDLA 2E5BA 1I4NA 2LLEA 1OABA 1TPVA 3LCGA 3MP5A 1G7VA 4HN4A 3WJWA 1XKYA 4BWLC 1TPDA 1TRDA 2C14A 5I3IA 1VR6A 3T7VA 3MW7A 3PBUA 1AW2A 1JUKA 3I6RA 3LXCA 1LDCA 1ML1A 3TW6A 5D2WA 4ICNA 4L4MA 3KRZA 5BMXA 1UUMA 2AQWA 3USBA 4LU0A 3BW4A 3PULA 1OFDA 1WQ5A 2DJXA 4LT9A 5HQEA 3DFTA 3W7IA 1VS1A 3GB6A 1AK5A 3MHFA 5EMUA 3UXDA 3N2MA 1RQHA 1LOQA 1ZENA 5AHFA 3AJXA 3L2IA 3P80A 4JICA 1W5PA 2NV2A 1FWRA 2NX9A 4ZQRA 3LCWA 2CZ5A 1R30A 1FUYA 3A23A 5D33A 3EKZA 1K8ZA 3OA3A 2CLEA 5LNUA 3BPWA 4JTGA 4PFMA 5AHIA 2H90A 3HMJG 5HULA 3DFSA 2GVLA 5E1QA 4I7UA 4ZMGA 1QOQA 1VYSX 3KRUA 1P0KA 1PE1A 2NXHA 4L4LA 2QCCA 1VCVA 1M7OA 5FEPA 3T78A 1OFOA 3GXPA 2VKZG 1OFPA 2E6DA 5EBUA 2J9YA 1OYAA 4O14A 3W7NA 3BG5A 5DCEA 4H3DA 4K8HA 4LVGA 3NZRA 4Y90A 5K9CA 2YDAA 3AO0A 3S42A 3GDTA 4O11A 5E93A 3PBWA 4TMCA 1GTEA 1B4KA 4IXXA 3WK2A 2E1DA 4H6KA 2RH9A 1J4EA 2E68A 4E2BA 3G1AA 1VHCA 4O10A 4OV9A 3HGSA 4Z08A 4UMBA 4U4MA 1SZGA 5G5IA 3LERA 1DOSA 1DJNA 3LTYA 4UTHA 1QO2A 1OFRA 1XUZA 2ABAA 2F84A 2DZWA 4LVFA 4PCFA 3S1WA 1XL9A 1B57A 3L5LA 1SU5A 3A21A 3T55A 1H61A 1B3OA 5HWJA 3RK8A 2BWGA 4WD0A 3F4WA 1AMKA 3LCLA 3E9AA 1KV8A 4DPPA 5HUPA 3C61A 5D02A 4KWVA 2A21A 3NQVA 3F1QA 4UFJA 5LSMA 2G95A 3KAOA 4ZQMA 2ZZ2A 1DORA 3NXFA 2A6NA 2A4AA 1OK6A 4MJZA 1Z41A 3G0UA 4JXCA 5AHNA 3JR2A 2VFGA 3EWBX 3B0PA 2DP3A 4JTKA 1G4EA 1JCXA 1D9EA 1FQ0A 2CZEA 3W3OA 4GXMA 1K03A 3WK0A 3B0UX 4P61A 3I7RA 4N9EA 3UXAA 4XBSA 2V2DA 2OT1A 4PEKA 1KFJA 4RLIA 4FX8A 3V75A 3H54A 2WNNA 1L6WA 3UWYA 5DY3A 5LHEA 1I2RA 1PS9A 4XKYB 2I1OA 1Q6LA 3TQKA 5D30A 4IXHA 1W5QA 1EB3A 3EXRA 4FF7A 3BV4A 1RQBA 2B0MA 4O19A 4OU1A 5MHBA 4O1CA 1NSJA 3RFAA 4IX2A 1DQWA 1R2TA 5F2LA 3TFCA 5EYWA 2ISWA 5F2MA 1TV7A 4JDYA 4UFKA 3L0GA 3CLMA 2E5DA 3S9YA 4CLMA 1YXDA 3W1PA 1ME7A 4MYXA 1PVNA 4NUWA 1JUBA 3P61A 1QOPA 1OK4A 2DZSA 3LOTA 3W83A 4YCPA 5H2ZA 3IVSA 3RLUA 3GZ3A 2HSAA 3EWYA 4LV9A 3THQA 3M44A 2VEMA 2VENA 3KVMA 4N6FA 4HKPA 3DHFA 3DENA 4DF0A 2QUVA 2HTMA 3DXIA 1AL8A 4JNMA 3BG9A 4TO8A 4RR4A 1W3TA 5D2XA 4AVFA 2NX1A 5G4EA 4LRSA 4I7VA 3S5ZA 3WJZA 2R91A 4LOCA 2VELA 1ZAIA 5D03A 4ML9A 1FWWA 2J24A 5CZTA 1LBMA 2E09A 1UJPA 1TPC1 5C54A 2NUWA 2Q3OA 2V5LA 4POCA 4ADUA 3MI2A 2J6XA 4HNVA 1L2UA 3W70A 5LNWA 2JKPA 4K7VA 4O17A 1O94A 3NG3A 1A53A 3MBFA 2Y7DA 2R14A 2TYSA 4GRSA 4AWTA 2DZPA 3TX9A 2C1HA 2DORA 3A24A 4JTEA 2ZRUA 2DZTA 4FNPA 4MJMA 3EWXA 4IWWA 3STCA 4DO4A 4FNRA 1TTPA 4CNOA 1XC4A 3PBVA 2J9ZA 4Y9AA 4RKAA 1OHLA 2YR1A 1VCFA 4Q4KA 5A5WA 3NPUA 1O5XA 4MZYA 4RXFA 5G2WA 3SGUA 3G8RA 3PS7A 3H53A 4D2JA 4EOUA 4AHOA 5BRBA 4JX4A 1WYIA 2YCEA 5KSWA 2CZFA 1HL2A 3LGEA 2GQ8A 5D37A 1HFBA 4UTTA 3BLEA 1HUVA 4UXDA 1D3HA 5KMYA 1C9DA 3LBCA 4MVAA 1K3UA 2E6YA 3L5MA 1R46A 3QPZA 4S2BA 3NQCA 5CPNA 4X2RA 2NXGA 2QCHA 1EUNA 2C13A 1H7WA 4CCEA 1T96A 4O13A 1PCKA 2H3DA 1TREA 4N2YA 4QQ3A 4JS3A 3E02A 4NVTA 1VLIA 2QF7A 2VEIA 1UBSA 4G1KA 5F4WA 3W22A 4NJGA 4J9JA 3HPXA 1K7EA 3VFLA 4BFAA 3NQGA 1G4PA 4ZQOA 5BOOA 3OHIA 4QIUA 1PIIA 3TCEA 3LHZA 1IGSA 4LV4A 4WXZA 3TR2A 4JX5A 1SO4A 4CCDA 5L6UA 4LTSA 2B7QA 2EF9A 4W9TA 2BLEA 3DU0A 4JGDA 1JQXA 4TX9A 1YTKA 3TKFA 3M7WA 3LHYA 2P0OA 3TQ0A 2WSRA 3NA8A 3C4UA 2J9XA 3QQ1A 2HMCA 3UNDA 4UUIA 4JY8A 3UD6A 3FOKA 2FDSA 1DHPA 3L5AA 3M5ZA 3MYPA 1GJPA 2C15A 5D05A 4DPQA 3DHDA 3A22A 4FNQA 3DGRA 3NQ7A 3W2KA 3W1NA 4ZL1A 5D32A 3WJXA 3EB2A 4OV4A 4MZ1A 1SPQA 3LDVA 3NPVA 4GFSA 3QJAA 5SWUA 1FBAA 2Z0IA 5FEWA 2G5WA 3DFPA 4UR8A 3NQMA 5HUOA 3EX6A 4LVDA 3K30A 4MFDA 3QRHA 2FFCA 1WBHA 4FHAA 3O07A 1A50A 3NYZA 1SSGA 3HGRA 3NVTA 1AG1O 1K02A 3PUOA 1ONRA 5D2YA 1GTHA 2Y6ZA 4N9CA 1GT8A 3Q2DA 1O95A 2RKXA 3B8DA 2ZRZA 2V82A 3B4UA 4BWLA 3QF0A 3GXTA 5HNRA 3L0KA 1VYPX 2D73A 4ZQPA 4LY8A 5FESA 5U7SA 3PM6A 4K39A 3TSDA 1X1OA 3M16A 1A5BA 1QFEA 3PY2A 1T0OA 2QCEA 3SIZA 3S0CA 1TPB1 1Q6OA 2YW3A 3W1UA 3TSMA 1LTDA 1SW3A 4WOZA 3KOFA 4AHPA 1YPIA 2EHHA 3GKFA 4N6EA 1DBTA 1F6KA 2CLHA 4N4QA 3MP3A 1OX6A 1F73A 1W3NA 3ATYA 3QZEA 1QDSA 2BSLA 3P5YA 3DI0A 3W7EA 4AMAA 5FF3A 1QO5A 3F03K 5BNKA 5AHMA 4OT7A 3GAYA 3MO7A 5AN7A 2QKFA 3FLUA 1YYAA 2FPTA 4QJ1A 3FJLA 2I9EA 1S5WA 3ABOA 5AC6A 1TJPA 3W7LA 1IIGA 5K3VA 3GXNA 3LV6A 3ZFHA 4NQ1A 3DI1A 4JTSA 4S2CA 2YX0A 1ALDA 4UIOA 4JTTA 2CU0A 3EWUA 1O60A 3QPYA 4WQ6A 3NR0A 3PUDA 4CNPA 1PHQA 4FXSA 5EPDA 2WSQA 1Z44A 3STEA 3FS2A 1FWTA 3W2JA 3V1PA 3P74A 3W2UA 3UPBA 2OZ0A 4FNUA 1J5TA 4AXKA 4RZ4A 3N3MA 4FX7A 2TRSA 1EP1A 4A2RA 3QW4B 1CX9A 1FCBA 1TPUA 5K9XA 2ZRVA 3UPWA 2RHGA 3G1HA 1JCYA 1A5CA 3BK0A 3NQ6A 5EY5A 4O8RA 3E96A 3BW3A 2ZQ0A 3W7GA 3PUEA 4BF9A 1EUAA 1VCGA 3LTSA 3PC0A 4Q33A 3DFOA 1MSSA 3N2XA 1H7RA 4XTDA 4XBKA 1NVMA 3W9ZA 1TPH1 2YZRA 3TUUA 4LVBA 1P5BA 3LHVA 3EXTA 1TPFA 4M7SA 3W7OA 4UCGA 4FX6M 3PVFA 4NNBA 3FKRA 4DELA 3UZ5A 1KA9F 1OFAA 4WUIA 3NQEA 4MOZA 5DCDA 4O18A 1DQXA 4LS1A 1IXOA 1XBVA 3BW2A 1H7XA 4E38A 1NF7A 2Y63A 3P67A 1JCLA 1W37A 3ZS4A 2PCQA 4ONVA 3D0CA 1OF6A 3HG4A 4MYAA 3CU2A 1GEQA 3L68A 5CPMA 3W7RA 2JK2A 4OQVA 3LCIA 3LLDA 5F2IA 1FXPA 1ME9A 1SUXA 3I7QA 1QPRA 5FI8A 2ZZ7A 3CIXA 4NJJA 4LNYA 4NXSA 3M1ZA 2CLLA 2RFGA 4A29A 3LX9A 4O53A 1TMHA 3LXAA 3M5YA 1H7NA 1W54A 1YXCA 4ZQCA 1VQTA 2NLIA 4M7TA 4CQ9A 5IBXC 1P1XA 3M47A 1QPOA 4NJIA 3GIYA 3KX6A 4R7JA 3GAKA 4TIMA 5KZMA 2WNZA 4YL2A 2Y61A 1JUEA 2Z6IA 4N02A 3GNNA 4NJKA 3C2EA 1OX5A 4IQLA 4ZZ9A 1WOAA 3KVJA 4DBDA 5K7JA 4B5NA 4DXVA 1O5KA 2ZZ6A 3GDLA 3BGJA 3TMQA 1N7KA 4QSHA 5I3FA 1U83A 3GKAA 5F4XA 1YPFA 1RR2A 5D04C 1VHNA 1H7OA 1VGAA 4QAIA 2AAMA 1VJIA 3G24A 2YW4A 3C8FA 3O6DA 1FDJA 1KW1A 3UQNA 1W8SA 5FEXA 3SW6A 5C5YA 2YYUA 2XFWA 4FIRA 3PAJA 1W3IA 1YDNA 1LP6A 2VEKA 3W75A 4MFEA 3PSVA 1F5ZA 1ICSA 2QUUA 2ZA2A 4ADTA 1JQVA 2VOMA 3CHVA 3LI0A 3LRKA 4DBEA 1LYXA 1LROA 3C2OA 4KKXA 1GVSA 3C56A 4GUJA 4EWND 3CWNA 3DZ1A 2Y7GA 5KINA 2QCMA 5HR6A 1Y0EA 1YADA 2FPVA 1O4UA 1UCWA 2P10A 2QCGA 3LB0A 4E0CA 4I9AA 3GDKA 3P81A 1NAL1 1LBLA 3SJ3A 5CZJA 4E2DA 5EKYA 5LZLA 2E6AA 3NPWA 2G97A 4OBTA 2XN1A 3G1YA 3O6YX 1RV8A 4OGZA 5DBTA 4Z1AA 1KM6A 4RCXA 1AL7A 1XDMA 3O05A 5CKSA 2JGQA 2EAWA 4Z0JA 2X1TA 3G1VA 2WNQA 5T26A 1SO6A 4UTLA 5K2ZA 1I2QA 1PL9A 3L21A 3LTPA 4HNNA 4O0KA 1KFKA 5LGXA 2V30A 2ZDRA 4UFIA 4ORIA 4MY1A 4O28A 1XFBA 1KM2A 3GDRA 4GBUA 4MUZA 2B7PA 1KFBA 1KLYA 3FYOA 4HSOA 1B4EA 1UUOA 3HG5A 2W79A 1SO3A 4JR5A 1V7YA 1I2NA 4O1AA 1CW2A 4AF0A 3GVGA 1ZAJA 4KWWA 4UMCA 4PL2A 4JYDA 4X9SA 3TMLA 2ZBTA 2OT0A 5GVJA 3M6YA 4M6VA 2GQ9A 1H7PA 3R8RA 3ABSA 1L9WA 3W07A 1G4SA 4JIPA 4YWIA 1ICQA 3KFTA 1Q45A 5H91A 1SW0A 5I3HA 3I68A 1ZNNA 1G7UA 3E49A 3NL5A 1WOBA 3P5ZA 3HF3A 5I3KA 1H51A 2QEZA 4LWWA 1EA0A 3W6YA 2NUXA 3TSBA 5CZ0A 3CT7A 4MZ8A 3T4CA 1FWSA 3JRKA 3IIZA 2PE4A 5TIMA 3HPZA 1KBJA 3ELFA 2CFFA 5K4ZA 5J5DA 1FCUA 2A1YA 1ZFJA 3M5VA 3O6CA 5CSSA 3A5FA 4BI5A 1LRTA 2XN2A 3IGSA 4XWUA 2VFEA 2QR6A 1TQXA 1FWNA 2QAPA 5FF2A 4AH7A 4OHQA 3S1UA 5C6MA 1GVQA 3TJLA 4ADSA 5DXXA 5AC7A 4RZ5A 2Y7EA 1XBXA 2B4GA 2C18A 1XM3A 1SFJA 3RU6A 1EX5A 4HNTA 4ZQNA 2EKCA 3ABRA 1R2SA 3PB2A 2W0UA 2EPHA 3HQ1A 5LGZA 2V81A 1X1ZA 4CCCA 4IJBA 4A3UA 4BI6A 5F1UA 1FCQA 2WKJA 1FX6A 1N55A 1XBZA 1TV8A 1LLWA 1DVJA 1D3GA 1KM4A 3PB0A 1MEIA 1W56A 1Q3NA 1OFBA 4FO4A 4O50A 1TRIA 4DF2A 3B06A 3EX3A 1F2JA 4BR1A 3FIGA 5CSRA 2QJIA 2H8XA 4NJHA 4M6PA 3GR8A 4TR9A 1JRCA 3EX2A 4Y8FA 1TPEA 3C3NA 3M5XA 3DAQA 2VXNA 3F4NA 2WSYA 4JX6A 1EWDA 3UWWA 4JTJA 1PV8A 2NUYA 1T99A 3NPXA 2IQTA 4U28A 2V5BA 1OG0A 3TC7A 4MY8A 2FQIA 3TAKA 1JCJA 5C55A 3W74A 1FDYA 2H6RA 3INPA 4RX0A 3HGOA 4WX2A 1YTEA 2OJPA 4FNTA 3W87A 2VFDA 2YSWA 1RPXA 4JTHA 3CTLA 5HR7A 2C16A 2V9DA 3HBLA 5AOUA 2Y89A 4MPQA 1XBYA 2CLKA 2ZYFA 4EF9A 4HSNA 4UMAA 4AB4A 1ICPA 1KTBA 5E0KA 2OMAA 4RZ6A 1TSIA 3P82A 1V5XA 3HG3A 2GJNA 3GK0A 2A0NA 1MXSA 3L9CA 5AHLA 1KTCA 2BX7A 3OVPA 1SR9A 4TMBA 3HB9A 4A22A 4JN6A 2OCZA 3LBMA 4JTUA 1F6PA 4XZ9A 2B7NA 4HNUA 1KM0A 3E0IA 4NX0A 2PRHA 1AW5A 3PBYA 1KFEA 2V2CA 3OVQA 4UNLA 3OEXA 5G2IA 1VLWA 3MWAA 1ZCOA 3NQAA 3T40A 3WJSA 2ZA3A 1RQEA 3G0XA 3NM3A 1YDVA 4Z1BA 3C0JA 3RNDA 5BMWA 1K7FA 1WBJA 3L0NA 2NWRA 2VEPA 3OBKA 3W2NA 3LXBA 2JGYA 3TFXA 3QMSA 2DZVA 3QMTA 2W6RA 4NX5A 2J88A 5A8GA 3W1QA 1TB3A 2NXIA 4UTMA 3RF9A 4NZFA 1GVOA 5J5RA 1I45A 4RJEA 2QJGA 2UV8G 3R13A 3MI6A 4LW7A 3NQFA 3R89A 4EIVA 4K6AA 3WK3A 3TAOA 4IMDA 2WQPA 3MI3A 1OX4A 3SECA 5LNSA 5TBOA 2ZRYA 2NV1A 5AC8A 1LOLA 3BARA 3G1DA 3GYEA 8TIMA 2ZZ4A 1DL3A 3HJZA 3P62A 3S5NA 2OX1A 2WV8A 3W7MA 3QQ0A 3NGJA 4FNSA 4FEZA 3SZ8A 3W7HA 1M7PA 3OVRA 1GVRA 2CW6A 3NAVA 3IV3A 3S6DA 2GVJA 1MO0A 4LUJA 3QC3A 4JD4A 2ISSA 1KFCA 4NU7A 3KHJA 5IBXA 2Y85A 3G0SA 1M6JA 1IXPA 1QWGA 3M43A 1TIMA 4HT3A 3NQDA 4O52A 1GVFA 3W86A 4AAJA 2C0AA 4IUOA 2E6FA 3W23A 4GE8A 3P8IA 2R8WA 4KFNA 4R34A 3QSRA 4AHQA 4EF8A 1L6YA 2FB2A 3DBPA 2QCFA 1G6CA 3CIWA 4M6QA 1LRNA 3VNDA 2ZRXA 3TJXA 1XUUA 1T8XA 5DELA 5EL1A 3FKKA 3SFKA 2Y70A 2VC6A 1UASA 5CGQA 1QPQA 1SFLA 1EWEA 4DQWA 1LRQA 3UZJA 1MEHA 4XQ6A 1LOSA 3IVUA 2H3BA 2FIQA 1ZY9A 2V2HA 4PC8A 4GUFA 2NZLA 3N14A 3TK7A 1A5SA 2GUUA 2RDWA 2X30A 3NL2A 1F7BA 3BVJA 3U8GA 4O15A 2QCLA 3CPRA 1VYRA 4TU1A 4GJ1A 3UY7A 5G1YA 3STGA 4X3ZA 2YGYA 3STFA 2DU2A 1TCDA 2VFFA 3NZ1A 4NT0A 5EA9A 1H5YA 1W31A 1HO4A 3CC1A 3VKJA 3WJYA 1VRDA 1I2OA 4GUIA 2RDTA 4IOTA 4O57A 3QMRA 3IEBA 2GOUA 3C52A 2WPBA 5ABTA 1W5MA 3U2OA 4IMEA 3R12A 4LS0A 5FF4A 2DZXA 3L65A 3LI1A 3LCFA 3JS3A 3O1NA 4Y6GA 3G8EA 3TH6A 3W1AA 1XCFA 4AEOA 3TDFA 4YLWA 4FB7A 3SI9A 3G1SA 2VFHA 4AF0B 5LHFA 4WY0A 3W71A 3TQVA 3L66A 3QSTA 3KRSA 1L6SA 1VZWA 2CWNA 3NL3A 5LKYA 2Z6JA 1DJQA 3LHWA 3NL6A 4X22A 2JBMA 5U4NA 1LM1A 1WA3A 3PG8A 3TC6A 3LV5A 3W85A 6ALDA 3CEPA 4MIMA 6TIMA 3UWVA 1GYNA 4FIQA 2GJLA 3MMTA 1ME8A 3S5YA 1K8YA 1TO3A 3G3MA 5FF7A 1BKSA 1PHWA 3NO5A 3W2LA 1SZFA 3W76A 1ZAHA 3TW7A 4PTNA 1UB3A 2B7OA 1X8FA 3ZWSA 2QCDA 1ZJIA 2CLMA 3B04A 3RMJA 4HIBA 3ABQA 4OWGA 4QNWA 4QNEA 3S8HA 4QITA 1TYGA 1F76A 4Y96A 4NXKA 5KITA 3MHUA 4PL1A 1BWKA 3EKLA 4IMGA 2RDUA 3W1TA 3B03A 3TROA 4WY0F 3DH7A 3FJ6A 5CPLA 4WOQA 3I65A 3ANYA 1BWLA 5LNVA 2AGKA 3W7QA 4UTJA 1SZNA 3LHTA 4K7YA 1IXNA 4MKNA 3B0VC 1EP3A 1IXQA 1GYLA 4DF1A 5AHEA 1GG0A 3O16A 5HWNA 2C19A 4UTWC 4AWSA 2TMDA 3CWOX 5G1TA 4UFHA 2NX3A 4AWUA 2Z1BA 1G67A 3HG2A 4RXGA 5DY2A 4A2SA 1P4CA 3I7SA 4NZJA 5D09A 1TTJA 1LORA 3CQ0A 5I3JA 1NFBA 1MEWA 3UWUA 1GOXA 2DZUA 4LVAA 2KZHA 2HS6A 1NEYA 3FEMA 4JIQA 3TXVA 2Y88A 4O16A 5CG7A 3CB8A 4M19A 5F2GA 2ZTKA 3TXZA 1THFD 3TE9A 1G69A 2Q8LA 4LC8A 3E12A 4UC5A 3IIOA 4ALDA 4JYEA 3P8JA 3QYQA 2V0TA 2JKEA 3N9RA 3ZR4A 5K9DA 4N4PA 3W7JA 5FEZA 2ZTJA 1N8FA 1FDZA 1RVGA 3YPIA 1KFLA 3DKLA 4MLRA 2A6LA 4XTIA 2X2GA 2ALDA 4HPXA 4A21A 3G22A 3NEVA 3TNOA 1DV7A 2E5CA 4O4VA 3NQ2A 3GR7A 2ZZ5A 1KM5A 4O1DA 3PR2A 3O8AA 2ZCGA 4GNJA 4K36A 3HIJA 1TTQA 4NNCA 4LUIA 1WXJA 4QISA 2I14A 2YYTA 1XXXA 1HG3A 4S1FA 2TSYA 5D38A 3EX4A 4KFOA 1SQ7A 4UNKA 1QR7A 5K4XA 3VE7A 4EVZA 3GLCA 5G4WA 1JRBA 4IMCA 2GPTA 3IGUA 3LLFA 2Q8ZA 4Z1DA 2ATSA 2A85A 3PG9A 2ZFAA 5AYZA 1CI1A 1RD5A 5C2XA 1YTDA 3WFAA 3SSJA 1TQJA 3MBDA 3IRDA 2PRLA 4R33A 5F4SA 2FB3A 5CPOA 4WJEA 2A5HA 1W5NA 3HOJA 2H8ZA 3ZWTA 5BW6A 3SY5A 1C29A 1LCOA 1W1ZA 2EGZA 7TIMA 2BZNA 4K38A 1GWJA 3W84A 3RLVA 2PURA 1GQNA 3W1MA 3C2FA 3W7DA 4O1BA 3BLIA 3IIXA 5HWMA 4OE7A 2FPYA 2QDGA 1I2PA 2YFOA 1H62A 5D2TA 4Z0SA 2GVGA 1TJRA 5FF0A 2QDHA 2Y62A 1QNVA 3LHUA 3MHGA 4JY9A 4Q32A 1SO5A 1Q6RA 1NF0A 5AB3A 3L67A 4BI7A 4IPIA 2O7QA 4DEFA 4PA8A 1WDWA 3IIVA 1GZGA 1SW7A 3Q37A 3TV8A 1IF2A 3B05A 1IIHA 1OFEA 1TV5A 1WV2A 5L9FA 1RZMA 1G4TA 3ATZA 3H55A 2ZZ1A 1OX4B 3NQ8A 3VE9A 2WOQA 5LNRA 2CZDA 2YFNA 1JCNA 3G1FA 2ISVA 2PRMA 2ZRWA 2ATMA 3SR7A 3TU9A 1KBIA 3MYOA 3S1XA 2A7RA 4JDBA 3QH2A 3EEGA 2ZA1A 3KVLA 1FY6A 4HHPA 3M41A 1W5OA 1X6UA 3M0ZA 4PODA 4JTLA 1QAPA 5G2HA 3NNTA 3O63A 4JTIA 5DN1A 1OFQA 2XN0A 3EX1A 5D2VA 3T44A 2O7SA 3A9IA 1ADOA 4N9DA 4XKYA 5AYYA 3VCRA 3DKJA 2YPIA 4LRTA 4ORMA 3DFNA 1WX0A 5I3GA 4MY9A 1OVDA 3EXSA 4R53A 1W0MA 5CZSA 4UTKA 2V8ZA 1YDOA 1KLZA 1F05A 4KFPA 3W73A 1MZHA 5KTLA 4RV8A 3LCXA 3QW3A 3W1LA 1YXYA 3O15A 4WZHA 3PWAA 3UY8A 2TPSA 3KVKA 3C2RA 3FFSA 1JVNA 2G96A 2CLOA 2WJZA 1LLZA 3SGZA 1KV5A 4DO6A 1JJKA 4O4WA 5KZEA 1XI3A 3PF3A 3UWQA 1H50A 4JEQA 4IPJA 1R47A 5KZDA 1P0NA 3LM7A 2F7FA 2QUTA 4M5PA 3N34A 3NDOA 3W72A 3W7KA 3S1VA 4CQ8A 4Z1CA 1B9BA 2J27A 1WAUA 4GWEA 4FXRA 5DCBA 2FLIA 3FA5A 3W1XA 2X1UA 3W7PA 2P1FA 1EP2A 3EWWA 3WK1A 4P2VA 1QMLA 2C3ZA 2HS8A 4H4IA 1VC4A 5IM51 4NNAA 3QEZA 1S5VA 1VH7A 2CLFA 1Z42A 2NWSA 3MUXA 3OIXA 2X16A 3BGGA 3N73A 4I7WA 2BTMA 4CQAA 1HTIA 2BXVA 3GDMA 2C6QA 5AFDA 3DFQA 3IGXA 1X7FA 3BLFA 3O06A 3N9SA 2A2IA 4C1LA 4UFMA 1ZALA 5HJLA 4UTUA 4LS2A 4WXYA 4O54A 4GC4A 1KTNA 2GQAA 1EPXA 1SSDA 5TQLA 4UTTC 2WO5A 3A5VA 1R2RA 2YXGA 4IGHA 3MJYA 1TTIA 4UFLA 3W1RA 4WY0B 2E77A 2PC4A 3FYPA 1OF8A 3NOEA 1JULA 1C8VA 4PH6A 2X1RA 2FTPA 3CM4A 4HPJA 3HPSA 3QFEA 1JR1A 4UTIA 5DLCA 5HINA 1EEPA 2JKAA 1Q6QA 1J2WA 1M5WA 3EWZA 5AYXA 1QPNA 4CNNA 3BO9A 3GNDA 4N9BA 3CEUA 1K7XA 3C6CA 4O0ZA 2Y7FA 3OG3A 4IMFA 3G3DA 2A7PA 3P60A 1FXQA 2QCNA 4O12A 4YXGA 4ZVJA 2QCDB 3IVTA 3TIMA 3S5OA 4JTFA 3BG3A 1K8XA 4LC6A 1H60A 3W7CA 4XUGA 4IX0A 1U5JA 3VI2A 1KM1A 2CLIA 2ZZ3A 4JYFA 4K37A 3M9YA 3GX9A 1YLVA 1JCMP 3W88A 1OYBA 5DBUA 5HMSA 2DJLA 3THAA 1BTMA 4YCOA 1E51A 3C2VA 3G1XA 4MLJA 2X1SA 4GUGA 1ZHAA 3LRMA 3W2MA 2A7NA 3R5EA 1LBFA 3Q58A 3P7YA 1VPXA 4BK9A 4K8EA 4GUHA 4QM1A 3N19B 1AW1A 3U6WA 3MP4A 1OJXA 1LZOA 1H1YA 3R2GA 1S3HA 4C1KA 1FCVA 1H63A 3Q94A 3HO8A 5F1VA 1KM3A 3HGJA 1I8JA 2QJHA 1Z48A 2VFIA 2Q3RA 4DO5A 3LRLA 1BEUA 3PSWA 4RK8A 2Z2UA 4UR7A 3UWZA 1TPWA 1OYCA 1H1ZA 3KXQA 1F74A 1A5AA 1PCWA 3NM1A 3G18A 2FJKA 2QAFA 3QM3A 4YMZA 1DKWA 2ABBA 4UTWA 1SZEA 1GG1A 1HO1A 1S5TA 1GPWA 1EIXA 3TA6A 5DXYA 3LCHA 3IIPA 2R94A 3P84A 3UYCA
chains in the Genus database with same CATH superfamily
1HX0A 1JXJA 5JBDA 1OABA 3KBMA 4LF2A 1LQAA 3VNLA 3KDNA 3NURA 3U48A 4DNMA 1JUKA 3LUTA 1ML1A 3GTIA 2NQ9A 3KRZA 5BMXA 3CZKA 1QU4A 3P0XA 3LBOA 2UY5A 3TQPA 5HOSA 2XINA 4GQBA 4DO7A 3GS6A 3AJXA 5JBEA 2GJPA 1FWRA 2NX9A 3LCWA 2J77A 3CV2A 4RW5A 5LIWX 1BYCA 3HMCA 3BPWA 4BQ3A 1SVDA 3HMJG 2BHZA 5CEWA 4PN2A 1ZPTA 2GVLA 1R3VA 1P0KA 1PE1A 2NXHA 3RDKA 2QCCA 1M7OA 3A6OA 3T78A 2ALRA 4TQTA 2E6DA 3VX1A 3FAWA 4TX8A 1BFNA 2OEMA 1HVXA 1V3JA 2OTDA 4H3DA 3CZGA 4LSBA 3SN0A 3ES7A 5A8MA 1A80A 1D7FA 2BB0A 3AO0A 5E93A 2GOKA 4GGBA 4V28A 4YYCA 4WJXA 1HJVA 4H6KA 2RH9A 3WD3A 2D1ZA 2E68A 4PMYA 1VHCA 4O10A 3HGSA 1TVLA 4W5ZA 2ANUA 4Z08A 2PBOA 2Z1VA 1BYBA 3DGBA 5G5IA 4ZB2A 2QJJA 3LERA 4QS6A 1DJNA 1C9WA 1HGYA 1ZBKA 4NAFB 1QO2A 1VFSA 2ABAA 4YVXA 3ZYZA 2FHFA 3S5SA 3E38A 3XISA 3B8WA 2Y8KA 3UVIA 2G4FA 2C91A 1B3OA 2BWGA 1KQZA 1J9YA 2PP1A 3A9BA 3LCLA 1FH7A 4Z2GA 3E9AA 4DPPA 2WAGA 1LG2A 1WZAA 5RUBA 3L12A 4LF1A 2GSEA 3F1QA 3TOPA 3KAOA 3CV6A 2A4AA 4MJZA 3G0UA 4MTVA 1CT5A 3BTNA 3HTWA 3EKGA 3EWBX 2J13A 3WUBA 1JCXA 1XSIA 1K03A 3K4DA 2UBPC 1KR0A 1AMYA 1CDGA 1ONXA 5FJIA 3PZNA 4HHHA 4PEKA 1KFJA 2BOGX 3UGRA 1KXVA 1WAWA 3H6OA 3XIMA 3UWYA 1V3LA 5DY3A 1JPHA 1Q6FA 3TQKA 1G94A 4D6EA 1OZMA 1RQBA 4UZSA 4IIHA 1CGUA 5DRIA 4B3KA 1R2TA 3K1DA 5EYWA 1XJBA 1RLCL 3V3WA 3L0GA 1CIUA 3UU0A 1CTNA 1EJTC 1XRVA 5LIXX 1YXDA 3W1PA 1EF2A 4R9OA 1W1PA 1PVNA 4NUWA 1M65A 3MSRA 4AD4A 3A4AA 4YCPA 5H2ZA 4GCXA 3VMNA 2SFPA 4JKMA 3LU2A 1XC6A 3I3BA 1K6WA 3M44A 2VEMA 3WCZA 3KVMA 4HKPA 2JE8A 1AL8A 2C8NA 1DXEA 4RE2A 1XIJA 4LAMA 3N3TA 2WVSA 4B9YA 5G4EA 4LRSA 3S4TA 3W37A 4JN8A 1ONWA 1RJRA 4P5UA 1X97A 4ZSTA 2VELA 1ZAIA 1FWWA 2E09A 2VX6A 4ICMA 4DRSA 3UCDA 3MI2A 3IANA 5LNWA 3PZIA 2JKPA 4HMDA 4K7VA 1O94A 3NG3A 3BWWA 1Y5XA 2Y7DA 4AWTA 2DZPA 3T09A 1CGYA 2DORA 3A24A 1UIOA 2PODA 3V18A 3STCA 2RDXA 3PBVA 1IE7C 3CHFA 1OHLA 2GYIA 1UKPA 5A5WA 1FVPA 3S1GA 4MZYA 4QJ4B 3G8RA 2J47A 3H53A 4IG2B 1FWGC 4W8AA 3RITA 4AHOA 5BRBA 4JX4A 1WYIA 2YCEA 5C7HA 3EBVA 1WKDA 4A3RA 1HL2A 3NZGA 1R6WA 3FN9A 4L9XA 4OZOA 5A2BA 5KMYA 4MVAA 3LBCA 2GGHA 3QPZA 4AIOA 1WCGA 4X2RA 3CV1A 1V77A 3KS6A 5I2UA 2GK1B 1T96A 4I9TA 1ISXA 1KRMA 1VEMA 2HBXA 4JS3A 1ZUAX 4YTUA 2PCEA 2CERA 2PGWA 2QF7A 4GHRA 1GQLA 1NH6A 3FJ4A 3W22A 2DDXA 2G3MA 1MUCA 4NJGA 3VFLA 2FHBA 2CCRA 4PB4A 5I0DA 1VFOA 1WUEA 3LHZA 4IQEA 4JX5A 1AQMA 3WF3A 1SO4A 2PDJA 1Y7VA 1FP8A 4DY1A 2CNCA 4WEVX 5CJ5A 4Z2HA 1C93A 4ACYA 3G77A 3TQ0A 1UH4A 3C4UA 3VGEA 3QQ1A 4QLKA 4UUIA 3UD6A 1BGAA 1BRLA 2OOFA 4GMEA 1DHPA 4Z2LA 3L5AA 1HJWA 3E2VA 5CC5A 5HATA 4CNUA 4FNQA 4JCLA 3NQ7A 4KCVA 3W1NA 3WJXA 1DHKA 1SPQA 4CUCA 1AA1B 2I56A 2ASHA 4F48A 2Z0IA 1E4LA 3GWQA 3RX2A 3K30A 4MFDA 4XD6A 2B31A 1JL8A 4HSHA 1A50A 3AIUA 1GORA 5D2YA 2Y6ZA 4J5NA 1Y5VA 1GT8A 3GG7A 2RKXA 3WQEA 3B4UA 1EZ2A 4ZOEA 1R3QA 2D73A 4ZQPA 3VU2A 3WUEA 1NDVA 1O1ZA 3TSDA 3PPCA 3MKVA 1U2YA 4H9UA 1A5BA 1QI4A 4XB3A 2YW3A 3W1UA 1EF3A 4WOZA 4PUKA 1YPIA 2WMJA 1EZWA 4TX6A 1VFFA 2EHHA 3AS2A 3GKFA 4N6EA 4N4QA 3MCOA 1WZKA 3MP3A 1OX6A 4F0MA 3ATYA 4JNYA 1QDSA 3P5YA 3DI0A 3W7EA 2FHCA 2O4QA 3WQ6A 5A6TC 5FAGA 3BAXA 1J18A 1FHDA 2QKFA 3FLUA 1V6YA 3H7UA 1S5WA 5AC6A 1Q4WA 1TJPA 4LYRA 3LGDA 3I4EA 3CMGA 4JTSA 3GRIA 2YX0A 2A3BA 3KWSA 4JTTA 3EWUA 2EPMX 4OFCA 4IGSA 3I6EA 4CNPA 3CZ8A 3DERA 1TWIA 3W2JA 1M7XA 3W2UA 4FNUA 4RZ4A 3PTKA 1W17A 1XQLA 3UPWA 4S3EA 4BQ2A 2RHGA 1A5CA 2D2HA 3NQ6A 5EY5A 4CN4A 2PDKA 1Y8BA 4BF9A 5C2GA 1EUAA 3GHSA 4GO9A 3PC0A 1MMFA 1E3ZA 3N2XA 3ZO9A 4INFA 1JG9A 4XTDA 3UZWA 4XBKA 1MYRA 1RPKA 3W9ZA 1ITUA 1UWTA 1TPH1 2DUXA 2E28A 1P5BA 4A8LA 3W7OA 4UCGA 1OFAA 3VD3A 1D8CA 4NILA 1VRXA 3UCQA 1ADSA 1IXOA 3VD9A 3R25A 3H2EA 4MWAC 1NF7A 3VKKA 4U33A 3TYEA 3NZQA 3HG4A 2VEFA 5CPMA 3W7RA 2VX5A 3SADA 3LLDA 4HVXA 3I7QA 5FI8A 3CIXA 4NJJA 3FHQA 4KH2A 4PYSA 2WHJA 4NXSA 2R1LA 2XIQA 4GFIA 4X63A 1UR1A 3LX9A 1TMHA 3M5YA 3FVMA 2VZVA 3EWDA 1XS2A 3I4KA 1W54A 4M24A 3C8NA 3M47A 3GIYA 3KX6A 2BOFX 1B54A 2GSJA 1EGVA 2WNZA 4YL2A 2CESA 3N29A 3GNNA 4B5NA 1N7KA 3DFYA 3W4RA 2NVDA 3GKAA 5F4XA 5D04C 1H7OA 1VGAA 2X7VA 1TR9A 2YW4A 4EANA 1O68A 3GUGA 3C8FA 3GG0A 3UQNA 5BYWA 1W8SA 5FEXA 1QW8A 4K1WA 2QVHA 2XGZA 3R8HA 4EK7A 5B80A 1W3IA 5GNYA 1LP6A 4M3PA 2JF7A 2DVUA 2J4GA 2ZA2A 3ISIX 2CC0A 3CHCA 1LYXA 3WQDA 2NQ5A 1DIKA 2BMBA 2D0GA 4D6CA 3VCNA 4Q7BA 3T0BA 3GE7A 1PKNA 2O55A 4Q8PA 3GDKA 3TYUA 1LBLA 3AUJA 4W8BA 2PWDA 5CZJA 3TYZA 2E4TA 2PSNA 2XN1A 5DBTA 1AL7A 5CKSA 4MJ4A 2FMOA 3ME3A 2EAWA 1EL3A 2X1TA 1TV3A 3GXIA 1UD6A 4P8VA 1J8VA 4H83A 4P7LA 3LTPA 3RPDA 1I60A 3GM8A 2OLSA 1KFKA 1RY0A 2QQ6A 1LF1A 5LGXA 4UFIA 4ORIA 1EO7A 1KM2A 4GBUA 1VJSA 2B7PA 1KLYA 3FYOA 4FLQA 1P48A 2W79A 1DE5A 4JR5A 4GINA 3ARTA 4AF0A 4KWWA 4AYSA 4N7QA 3H8AA 5CAHA 3CQKA 4XAPA 3SCOA 4X9SA 5GVJA 2V3GA 3FDKA 3UNTA 3M6YA 2GQ9A 2ZUMA 3NWRA 3W07A 3S2JA 1YE6A 1ICQA 2OR2A 1Q45A 3AMGA 1SW0A 3KUMA 5A3HA 2G3FA 5I3HA 1UWUA 3APGA 3E49A 1M04A 1WOBA 4O1EA 1P6BA 1GW1A 2QEZA 2W92A 4LB4A 1XRSA 4TUFA 4JKKA 3CT7A 3WNLA 5FCZA 1FP9A 3IIZA 2PE4A 1XR2A 3K46A 5TIMA 2GSHA 5J5DA 2OSWA 1ZFJA 1N82A 1W91A 3O6CA 3WH7A 1U5VA 2NVAA 4XWUA 5HNTA 1QHOA 4QJ5B 1RBAA 2VFEA 5LA1A 5FF2A 4AH7A 4OHQA 4ZA0A 3R1ZA 3RCMA 3VKDA 4Z2KA 3LQLA 1RBLA 4JN7A 3OLGA 3QPEA 1PKMA 5DF0A 1AJZA 1YEYA 4U3AA 5MF5A 5LGZA 1A4LA 3HQ1A 4J3WA 3T2OA 3ITXA 4WDTA 1X1ZA 2YDQA 3GIPA 4QLLA 1NOWA 3P93A 5F1UA 4AZCB 3MA8A 3ARVA 4GZJA 1DVJA 3WF0A 4O50A 1Q3NA 1OFBA 2Z1SA 4B5TA 2CBUA 2PTDA 4PEEA 2DH2A 2DY3A 4A6GA 4BR1A 1A0DA 2H8XA 4TR9A 4Y8FA 3M5XA 2VXNA 3GH7A 2IUZA 2D22A 2VDIA 3H23A 4Q8NA 2WCAA 2HE8A 5A6BD 1OG0A 3M0HA 3TAKA 1KD0A 2FMNA 3W74A 1FDYA 4RX0A 4WX2A 5LIKX 5DEZA 4C65A 3F7JA 4KEUA 1RPXA 3IUHA 4KS0A 5MKGA 3WLTA 3E6EA 4OBSA 2I16A 2DIKA 2Z29A 3HBLA 1R38A 4JL1A 1X8CA 3E0LA 1EQPA 1XBYA 2HDJA 4HYRA 2R1KA 4CD6A 4AD1A 4RPQA 1PSCA 2QIWA 4UMAA 1PZ0A 2PS2A 1VBJA 5I02A 5E0KA 4RDWA 4LNCA 2FGZA 1MXSA 1Q13A 4H9XA 3QLDA 1SR9A 1E6XM 3VNYA 4TMBA 3HB9A 4Q8MA 3DOPA 4W5UA 2OCZA 3BJFA 3LBMA 2YDSA 4JTUA 1F6PA 3IJ7A 3CZEA 3R4IA 4XK2A 3WLJA 2AL2A 1P0DA 3RR1A 1AW5A 2R82A 4L1WA 3VNMA 2V2CA 4RDZA 1VLWA 3RG6A 3CHEA 1GK8A 3WJSA 1RQEA 4RDVA 2PP3A 3L0NA 2YA0A 2VEPA 3KDOA 3T05A 2Z7GA 3MCNA 3OBKA 1HGWA 3W2NA 1QPKA 3EEZA 1U30A 1Q65A 4JBRA 1ISVA 3KL3A 3MUY1 4FLOA 2J88A 3W1QA 5BXRA 4D6GA 1P6WA 1GVOA 3OIHA 1XH0A 4H8HA 1J0IA 2UV8G 3R13A 4F79A 4FK9A 4MWAA 1ZL1A 5FSDC 1R3YA 2QLYA 3CQHA 2WZEA 4HA4A 5TBOA 3EA2A 1PKLA 1UZDA 5AC8A 4WKFA 3EOSA 1ZSXA 3PZMA 1W9BM 2G3NA 2ZC8A 3W7MA 5CPTA 2VRKA 3GD6A 1PPIA 3OZPA 1J5SA 3SZ8A 3OVRA 3SY1A 3S6DA 1A4MA 4JD4A 1GKQA 3ITLA 1KFCA 3WMSA 3PBMA 3KHJA 3QR3A 2QGYA 3NQDA 4O52A 4LUTA 1Z7AA 3OBEA 4LANA 4GNVA 1JYXA 4ZFMA 3W23A 3P8IA 1E6ZA 3ITGA 4XSMA 4Y7EA 1XSJA 2G0WA 1BAGA 4EF8A 2OFJA 1FKWA 2QCFA 1QNQA 3VNDA 4LALA 2ZRXA 4H04A 3GTFA 4L7ZA 2FZDA 3TJXA 3TCSA 3FXYA 2VC6A 4ENLA 1QPQA 4AZ5A 2J6VA 4XAYA 3M0LA 3TYBA 2DSKA 4W88A 3V5OA 4GA8A 3BOLA 4PC8A 4CNTA 1UR8A 3N14A 2X30A 2XYLA 1F7BA 4AZHA 2QCLA 4WDXA 2IPJA 5FJJA 1JPKA 1E1CB 5CCZA 4TU1A 3SUSA 2WHLA 3BCJA 4KCUA 4OOZA 2XIJA 4DZAA 3STFA 5EA9A 1H5YA 1BYDA 4C7DA 4XIMA 5A8PA 3VIOA 3UG8A 1MFVA 3M0YA 3IJ9A 2WVTA 2CWXA 3U2OA 3UZYA 3R12A 1FFRA 1O66A 3NIYA 3AS3A 3LCFA 4QAWA 3G8EA 3TH6A 4JFWA 5JBFA 4LAZA 4AEOA 2REQB 4YLWA 1OG6A 2WLZA 4FB7A 2PDMA 5D9OA 3QSTA 3KRSA 5LKYA 2Z6JA 1DJQA 3LHWA 1G5AA 4HN8A 3GIQA 4KCWA 4M80A 3W85A 1VP5A 6TIMA 2I9UA 4W84A 1I6NA 4P7OA 3L4WA 4DJED 1UR0A 1A0CA 4NKCA 5FF7A 4XD5A 1S2VA 1PHWA 6XIAA 2GDQA 2X0YA 3UJRA 4D72A 1ZU8A 5I5RA 4PTDA 3TW7A 3BZJA 1NP2A 2AL1A 4WHBA 2B7OA 2W91A 3RCYA 1GW9A 2ZXBA 4MB1A 2QCDA 3GNXA 3DCPA 2QS8A 1ZJIA 1YNQA 2CXGA 2QXWA 4QNWA 1TYGA 1F76A 2ZUUA 4NXKA 2ESCA 3SCWA 1E4IA 2VL4A 4D6JA 3GO2A 3EKLA 1V6TA 4EWJA 1TV4A 5A8NA 3B03A 4WY0F 3GBEA 4QBXA 5C9UA 3ZJ7A 2XSAA 4LYPA 5XIAA 3BAJA 3R79A 4WOQA 1W9VA 2VTFA 1BWLA 2HXUA 3CUJA 3LQGA 3AC0A 4K7YA 1E5JA 4HNCA 1KBKA 1IXQA 1GYLA 1VFMA 4LPCA 1AFSA 4GO8A 5AHEA 3LENA 3O16A 4FXFA 1W2VA 3JZEA 2C19A 4UTWC 2Q8XA 1AQFA 3NUKA 4UFHA 2NX3A 2V69A 2Z1BA 4EX4A 3HG2A 4FF5A 2J7HA 3I7SA 4NZJA 5D09A 5I3JA 1NFBA 1MEWA 1PZ3A 2DZUA 4JIQA 4HOWA 2WPGA 1XWYA 3UWEA 4HZ6A 5DFAA 3SDOA 5F2GA 2DSWA 2ZTKA 2E3ZA 1THFD 1KGXA 3UVAA 3IIOA 1YQ2A 4R85A 1RUSA 4S23A 3P8JA 2VNCA 4XZMX 4G1NA 3N2CA 2JKEA 2QIIA 5XIMA 5C9ZA 2R1PA 3VZXA 4CU7A 3AZSA 3DKLA 4M6UA 2D69A 3PBGA 4E4PA 1F4AA 1BF6A 4GYJA 4B5XA 4HPXA 4WKHA 4C91A 4M29A 3WF1A 3ARYA 1FWEC 1KM5A 3PR2A 3HA1A 2Y1HA 2ZCGA 3PN8A 2W27A 3HIJA 4LUIA 1ZQ5A 4H9TA 2ZE0A 4QISA 3V4BA 1XKJA 3U7BA 4H1ZA 4FS9A 1TWSA 5D9NA 2ICSA 2WLYA 4YNGA 3AYSA 1B0IA 3R0DA 3AOFA 1JRBA 1F61A 1XV8A 4QDWA 2Q8ZA 4Z1DA 2ATSA 1CI1A 2EG6A 3MUZ1 3WFAA 4JIIX 3UZXA 3LSCA 4TOQA 2FB3A 1XW8A 4IIEA 2A5HA 4WJEA 2BVTA 1W5NA 5BW6A 3WQWA 1C29A 2V68A 4ERAA 4XSLA 2OODA 4K38A 1HZYA 3KLKA 4U5KA 1OD8A 2QV5A 1QASA 3C2FA 4WGHA 7REQB 2INZA 1XGZA 2WCSA 5HWMA 5AC5A 3T0CA 2FPYA 2PGEA 1OEPA 3UG3A 5E6YA 3RIKA 2PDUA 1TX2A 2VYOA 3ZLHA 2YFOA 1E5NA 1H62A 4Q4PA 4Z0SA 2GVGA 1TJRA 1PX3A 2Y62A 3RR4A 2PDLA 4KIEA 1V6XA 3LHUA 3VABA 1NF0A 5AB3A 4IPIA 5C0QA 4PA8A 1SW7A 3TV8A 1C91A 3GVVA 3N6HA 1IIHA 4JTAA 1VBHA 1YE4A 4ACZB 3WD2A 1GGOA 3VDBA 3ATZA 4Z42C 1OX4B 1W3LA 3VE9A 1FWCC 3SM0A 2VZTA 1JCNA 3G1FA 3GH4A 2ISVA 1XYMA 2CBJA 3SR7A 3TU9A 3EPMA 3S1XA 4EXBA 1BSIA 1RY8A 3EB3A 1EJSC 4XZHA 5LXXA 1FY6A 1W5OA 4PODA 3E5BA 4JTLA 3WY1A 3NNTA 1JDFA 4FR6A 1OFQA 2XN0A 4PFHA 3EX1A 3T44A 2YCLA 3A9IA 2GVYA 2IXVA 4ORMA 3M07A 4HU0A 5I3GA 3EXSA 4R53A 1E9YB 5CZSA 2V8ZA 1YDOA 1KLZA 3MMWA 1VBGA 4PUNA 2PF8A 1MZHA 1WDSA 3SO7A 3T8QA 3QW3A 3W1LA 3O15A 4WZHA 2QMJA 1LUCB 4MPKA 2G96A 3LZ3A 2C0HA 4IPNB 1OT2A 4IPJA 5KZDA 5HNUA 4BA0A 3SEPA 4M5PA 3N34A 3QR0A 1JF5A 2J27A 4FXRA 5DCBA 3TONA 3FA5A 3TEVA 4P2VA 1CWYA 4H4IA 3QEZA 1DJZA 1VH7A 4IPLA 1T6MA 4W93A 1MI3A 3GTNA 1Q5MA 4MNLA 1OGBA 4I7WA 2BTMA 3FA3A 4CQAA 3O7UA 5AFDA 3K4WA 2ONEA 4F0HA 4HA3A 2Y5SA 5JIWA 2IS7A 2QULA 2PU1A 4DWSC 1XSKA 2O56A 4UTUA 5E9XA 3SN4A 1U5HA 2GDVA 4LS2A 2FGBA 5I23A 4GJIA 4QE5A 1SSDA 4AG0A 3PZUA 3KLLA 3VK5A 2PC4A 3FYPA 1RBOB 1YBQA 4GOAA 3FVDA 4HHMA 3NOEA 5C70A 1JULA 1QHPA 2X1RA 4DBSA 3DYPA 4AY1A 5DLCA 3ECQA 2X0HA 1EEPA 3QKEA 1J2WA 1XLEA 3EWZA 4CD8A 3W6LA 4XAGA 3GNDA 2MANA 3CEUA 1OCJA 2Y7FA 4AFYA 2A7PA 4ZOBA 1DWJM 1FXQA 5EMMA 4MNKA 4UOZA 4D71A 3KOWA 3IVTA 3TIMA 4XD3A 3UJEA 2HZGA 1M68A 1H60A 3W7CA 1B1YA 4F40A 2ZZ3A 4JYFA 4GXWA 4LAUA 3W88A 1OYBA 1AZ1A 2DJLA 5TD4A 2OLHA 3THAA 3G1XA 1XIEA 3DIPA 4GUGA 3LRMA 1BF2A 1VPXA 2Z28A 4QM1A 1AW1A 3MP4A 3R2GA 3ZJKA 4ATWA 3LPGA 3L2MA 1S2CA 4W85A 1H63A 1FWIC 3Q94A 3UG5A 5F1VA 1C7TA 3HGJA 2VFIA 1B90A 4IH3A 3OBAA 3C86A 1FTXA 1TPWA 1OYCA 4HCLA 1H1ZA 3NM1A 3G18A 4YMZA 3NDYA 1DKWA 4UTWA 1EGZA 2VR2A 1J0HA 5DXYA 2X1IA 4GNKB 3P84A 1JXKA 3UYCA 1CLXA 2E5BA 3CMJA 3SY8A 3TOYA 4KMQA 3LCGA 3BMXA 3WG6A 3ITTA 3CPGA 4N42A 1Q7MA 1TPDA 2GZXA 3AALA 4B92A 5I3IA 3T7VA 3PBUA 4R5EA 1AW2A 3LXCA 3TW6A 5D2WA 1R8LA 1UUMA 2P3EA 2AQWA 3USBA 3W01A 3PULA 1OFDA 4M51A 1WQ5A 5HQEA 3DFTA 3W7IA 2GDUA 1J0KA 3KZSA 3MHFA 3UXDA 1OADA 3N2MA 2BVWA 1XLMA 3ABZA 3S2NA 4JICA 3UEQA 3POHA 1MQPA 3NDZA 4AC1X 4Y9MA 2IKJA 5C9XA 2CLEA 4WVXA 3QC0A 5AHIA 1ZJHA 4MKSA 2BY3A 3BICA 3KS5A 4H8VA 2PWUA 5FEPA 1V3MA 3CGTA 3RLHA 4C6OA 2CHRA 3TLLA 2J9YA 1R3SA 3BG5A 2CETA 4GYFA 3K1GA 4I5UA 1K1DA 4K8HA 4KEMA 2EQDA 5K9CA 3GW3A 2YDAA 1PWMA 3HV8A 3GDTA 4W86A 4O11A 5FSEC 4RUBA 2YJQA 4TMCA 1W32A 4PMRA 1YRRA 2E1DA 1V0MA 3LMZA 1YPXA 4Q6XA 1UOKA 1KBBA 4UMBA 4F2BA 3KOYA 1DOSA 1GONA 5ECVA 3OYZA 2Y0FA 3REQB 4IF2A 3E0VA 2F84A 4LVFA 3R7MA 4PCFA 3S1WA 3CUHA 1XL9A 1B57A 3L5LA 5REQB 1SU5A 4D1JA 3GNRA 4ZCWA 1H61A 4V2XA 3FGCA 4C6EA 2OWCA 1KV8A 1CCWB 2WVVA 3Q67A 3W81A 1KWKA 5D02A 3PZVA 4OUIA 4B2DA 3GSMA 2WJEA 5LSMA 1ZBVA 1DORA 2JIWA 5ABEA 4HCDA 3N2OA 3QGVA 4G7FA 4F0LA 3VOHA 4W7WA 2PDWA 1D9EA 2NT1A 2ZE3A 4CQBA 1L6GA 3W3OA 1EJVC 4DN1A 3I7RA 4QFUA 3AS0A 1EXBA 4Q4RA 3BMWA 4RLIA 4D6FA 3PP7A 2OYLA 4IXHA 3ZVIA 3EXRA 2B0MA 4PMOA 4LEFA 4OU1A 2PWFA 3RFAA 2E67A 5AECA 4D1IA 1AZ2A 5F2MA 3BZGA 3E2QA 1V0KA 4JDYA 3KTCA 1E9ZB 3CLMA 4E5TA 2JQXA 4FOJA 2WC7A 4HNLA 4Q8VA 3B0YA 4Z17A 4IIFA 2DZSA 3LOTA 1QBAA 1VIWA 3IVSA 1UH2A 2BFGA 1TFVA 1VFTA 4MADA 1Q2SA 3EWYA 4X60A 4BKNA 4Z1YA 4ROPA 1DTNA 1H1NA 4N6FA 5I79A 4DF0A 2I5QA 1BVWA 1HJQA 3TJIA 3AS1A 3KRBA 1NWUA 1CLKA 1A5OC 4I7VA 4KEVA 3S5ZA 4F3HA 2R91A 1WXZA 1IR2A 4NHVA 3VA8A 3WF2A 1J79A 5EMLA 5LIUX 2F6UA 1VIZA 1LBMA 3BJTA 2ZUWA 1UJPA 1TPC1 5CBIA 2NUWA 4XUYA 4ADUA 1X39A 1L2UA 3W70A 1BXNA 1A53A 1GJWA 1U1UA 1F8MA 3FHAA 2R14A 2CHOA 2P88A 4JTEA 5FACA 1XLFA 1GYMA 2VZSA 1VD6A 4FNRA 1TTPA 4DO4A 3H70A 2BASA 1F07A 2YR1A 4DX3A 1J10A 1RK6A 3RYSA 2PDNA 4ZE4A 3TVAA 4RXFA 3SGUA 2X8RA 3LGGA 3CLWA 2ZWZA 4DWSA 4Q4MA 4QQUA 4GH3A 4UQ9A 3HN3A 1QWKA 2CZFA 3A3HA 3LGEA 2GQ8A 2ZXDA 1HFBA 1SZRA 3BLEA 1HUVA 4UXDA 5CG0A 2BVYA 1C9DA 1IZJA 1K3UA 2QW5A 1R46A 3SUTA 2PTYA 3G6LA 3NQCA 3VMOA 1RALA 1M03A 1H7WA 3A4XA 8XIMA 3TZNA 2C7FA 1TREA 4N2YA 1XX1A 1KRAC 1UBSA 1VF8A 3HPXA 1K7EA 4BFAA 4C1NB 3OHIA 1PIIA 4Q8TA 3VNKA 3TCEA 5J8LA 4LV4A 2PTWA 4HOXA 1Q66A 4V33A 3MZ2A 1OBAA 5L6UA 2B7QA 1S2AA 2JF6A 3LN3A 2BLEA 1JQXA 1YKWA 3M7WA 3PJUA 3ZR6A 3ARZA 3ARRA 3NA8A 4GZIA 1UPPA 2J9XA 2P3ZA 2IKGA 3VDCA 4WF7A 2G37A 2A3LA 2VDHA 2PMQA 3FOKA 1VBUA 2WC3A 4LCSA 2YDRA 1GJPA 1J6PA 2P8BA 3DHDA 1ISYA 4OV4A 4QCFA 4MDPA 3BSGA 1FBAA 3RAOA 4HBKA 3DFPA 4UR8A 3BCDA 1ONEA 1RH9A 1O5RA 2FFCA 1UW9A 1WBHA 3O07A 4D8ZA 3NVTA 1XLCA 4C6PA 1GTHA 2XSBA 2QT3A 3AXIA 1O95A 3PJXA 5CH9A 1OC6A 4WK9A 3WDJA 2V82A 3AXXA 3L0KA 4J40A 3W28A 4LY8A 1OB0A 2DQXA 3USZA 1EOMA 5DQPA 2QVNA 2PLJA 1AVAA 3M16A 3PY2A 1T0OA 5EFDA 2QCEA 3S0CA 1LTDA 3MKKA 1UG6A 2J79A 1F6KA 3LNMA 2CLHA 2PUZA 3THDA 4ZODA 1F73A 1LL6A 3QZEA 4F9JA 4GQQA 2OVLA 4RNJA 2IPFA 5BNKA 4IPPA 2D3NA 3K8MA 1E4NA 2OYKA 4GD0A 3V16A 1IGWA 2ZOXA 3WD4A 1BWVA 4M82A 1YYAA 1QNPA 1MDRA 3GXNA 3KTXA 2YB4A 4GIEA 7ENLA 2CKRA 5A2AA 4DI9A 3DI1A 4HA0A 1TA3A 5I09A 4UIOA 3OG2A 1DXFA 4ZENA 3QPYA 3C0QA 1PHQA 4L6DA 5EGRA 3FY1A 1FWTA 3V1PA 4AXKA 3V36A 2E25A 1FCBA 1TPUA 2VI0A 5K9XA 3TTSA 3G1HA 1HJUA 3MJMA 4GQRA 1MZRA 4HJWA 1LUCA 1TJ0A 4AZ6A 1KKOA 3OQEA 3BW3A 1QT1A 2R1MA 3QLLA 2CBVA 4ATDA 5HMFA 1MSSA 1PX4A 1VFLA 1EJXC 4HCHA 2DSUA 3M0IA 3CUGA 4LVBA 1JD9A 4Y9OA 3WMBA 4NZ5A 3E5PA 3PVFA 4HZ8A 3FKRA 4I5XA 1U22A 1MNSA 1GQIA 1KA9F 2D0FA 3VNZA 4C6IA 5DCDA 1G01A 3GC2A 3BW2A 3KE0A 3P67A 2TODA 3UPMA 4GC3A 3ZS4A 1H0GA 2PCQA 4ONVA 2PLCA 3LSBA 3LK6A 3CU2A 3EAUA 3N17A 4XISA 2JK2A 4OQVA 4DUXA 5F2IA 3AHTA 2YBTA 3QR1A 5AZ0A 4LNYA 1UOZA 2INFA 3M1ZA 2ZVIA 2IMRA 4LB3A 5BU9A 3EDEA 4EPEC 3UJSA 1IWPA 1GVIA 5HJXA 4CQ9A 3VAVA 4NJIA 4R7JA 1XQKA 3L4ZA 1E1FA 5EBAA 4BQ5A 4D6IA 4N02A 3H21A 3C2EA 4YVVA 4ZZ9A 5FIPA 4DBDA 4OECA 1O5KA 2YCIX 4ZSUA 2ZZ6A 3VKBA 4HA1A 3LA4A 4RZBA 3BGJA 5I7GA 4PSPA 1SYTA 1UQYA 4QSHA 1U83A 2AAMA 3GDBA 3VUPA 1GOMA 1VJIA 3G24A 2Q6ZA 1GOQA 4DWDA 3EDJA 4XZIA 1MUWA 2F6XA 4C7FA 2YL8A 2J62A 1SJCA 1IYXA 1J93A 3TA9A 2XFWA 1XYBA 4FIRA 1VFUA 3WEMA 4GCAA 1ICSA 1QNRA 2QUUA 3VKAA 1G1YA 3AWNA 4DBEA 4KKXA 3ZQ9A 1GVSA 3C56A 4GUJA 3IJLA 1B2YA 2FZMA 1UD5A 5HR6A 1ZJBA 4PSRA 3QGKC 2XVKA 2W66A 1UCWA 5AKQA 2QCGA 4OVXA 4E0CA 3I3EA 4I9AA 1JPMA 2BY2A 2PFHA 1H4PA 1NAL1 3S2LA 2R24A 4E2DA 1XLBA 1Z32X 2G97A 4OBTA 4Z1AA 1RV8A 3CWHA 2I7GA 1KM6A 1KKRA 2PD5A 3HFYA 4RCXA 3O05A 2WNQA 1XIFA 5K2ZA 2PLMA 3L21A 4HNNA 1TR1A 2PU0A 3BSHA 2V30A 1DWFM 2ZDRA 3PJTA 1AH0A 1UD3A 2VJXA 3GDRA 4L64A 1SR0A 1B3YA 1K8CA 4PBEA 1XCWA 3C0SA 4HSOA 1Q7ZA 3EOLA 4QP0A 1P6CA 2ZX8A 2XDFA 2ZUNA 2QPSA 1CW2A 5A6AA 3GVGA 1ZAJA 1AH3A 4Q7IA 4UMCA 4BY3A 3BAIA 2QJMA 4E4UA 2HE5A 1H7PA 1ZB5A 4H8NA 3R8RA 3ABSA 4JIPA 2GJRA 2WANA 5H91A 4Q22A 3PZQA 3I68A 3JVAA 1I9CB 1ZNNA 5CBJA 3PPGA 1IR1A 3NL5A 5M03A 5GNZA 4Q8UA 1EJWC 2Y2WA 1BRLB 3GR4A 3W6YA 4XVDA 5A95A 5DT5A 3VOJA 3KCOA 3T4CA 3M6DA 3WMCA 3DHUA 4WSJA 3ELFA 4MGGA 2CFFA 2WVUA 1UP0A 3JZUA 1S2WA 3TW9A 3WN6A 4BI5A 4I6VA 3J7HA 3KBWA 4F2TA 2QR6A 4X0VA 2QAPA 3IRSA 3D3FA 2VGIA 3TJLA 4ADSA 5DXXA 3E1F1 4RZ5A 2Y7EA 2C18A 5GQBA 2XFRA 2MUCA 3VZZA 4M81A 3UP8A 2WC4A 2W0UA 1JZ3A 1DIDA 3CAQA 2DGAA 3QOKA 4IICA 3EYPA 4RPPA 3ZMRA 4BI6A 1R9XA 4GKLA 3WBAA 1TV8A 1D3GA 1KM4A 3PB0A 1G9HA 2NT0A 3NOYA 1F2JA 3ZOAA 1ITQA 2HROA 1IV8A 2QUNA 1F3XA 1TPEA 1EWDA 3UWWA 3A4JA 4A3QA 1R87A 4LGXA 4JHZA 2V5BA 3DECA 3UT0A 4ERIA 4MY8A 2FQIA 4EAYA 3AIEA 1XYZA 4NI8A 1YTEA 2OJPA 4FNTA 4PMZA 4JTHA 4JHOA 3CTLA 5E9AA 4ZXOA 2FKPA 3JW7A 2V9DA 3SUUA 1A5LC 2Y89A 4MPQA 1JPIA 5I00A 1E0XA 2CLKA 3FW6A 5CPQA 2EEXA 4PMQA 1TVNA 5FJTA 1ICPA 4AMCA 5HMEA 3N25A 2GJNA 3QFWA 2A0NA 3COTA 1IWAA 3H2FA 1TV2A 3VO0A 2BX7A 2OB3A 3OVPA 1HKVA 3V0TA 4HQVA 2HWGA 2J66A 1V02A 1MRAA 1B9ZA 4XZ9A 4AISA 3CQIA 1NFPA 4Q4QA 4DYKA 1RD6A 3E0IA 1YW1A 3I10A 2XJ7A 2PRHA 4Q8WA 3PBYA 4KBXA 1EYEA 2XWEA 4UNLA 5G2IA 3MWAA 1ZCOA 5IFTA 1GKPA 3T40A 2J8GA 1UC5A 2ZA3A 5AYIA 1YDVA 4Z1BA 3C0JA 3RNDA 2P50A 5IHSA 2WKGA 2ACSA 5EMYA 4ZB0A 5KEZA 4CVUA 3RO6A 3S9IA 4LYQA 4P7RA 1TB3A 9XIAA 2NXIA 3PJWA 1R7AA 3QQWA 4IFKA 4NZFA 4JTDA 1Q6DA 1WDRA 4EKJA 4EPBC 2POZA 4JFVA 3H26A 3CIVA 4EIVA 1B3XA 3TAOA 2FJUB 2YL6A 1CGXA 1C8XA 2ZX6A 2GWGA 3IK4A 8TIMA 4BEUA 2ZZ4A 1DL3A 4Q7NA 4UR9A 3P62A 2OX1A 3OA5A 4KEZA 5C9WA 4FNSA 4FEZA 2CW6A 3WNOA 2BGNE 3IV3A 3PFRA 4JIEA 1RK5A 1V3KA 3DG7A 4NU7A 1YMYA 2YA2A 1M6JA 3GHUA 3M43A 3WNKA 4DM1A 4FXJA 2DQWA 3XINA 4ZO6A 3H2AA 3AHYA 4HYVA 4GE8A 2R8WA 3NSMA 3GTHA 3QSRA 4AHQA 1QI0A 4IIDA 1FHVA 4C1NA 2GGIA 1HL9A 3U7VA 3MUIA 4RNFA 2EG7A 5CQ1A 5DELA 3PNZA 5EL1A 3FKKA 3SFKA 2Y70A 2V63A 4A3YA 1UASA 1VJZA 4MNMA 4DAFA 4DQWA 3KHDA 3WO8A 3ZJ6A 3OYXA 1LRQA 5C9RA 1LQ2A 3AIQA 4XQ6A 1LOSA 5CAKA 3IVUA 2H3BA 2FIQA 3E0WA 1ZY9A 1KCXA 1WZMA 2D23A 2XU2A 1XYAA 3AMDA 1UA3A 3NL2A 3OZOA 4NZ3A 2OPJA 3CPRA 1VYRA 2X40A 2E9LA 4GJ1A 5G1YA 3DEQA 2YGYA 4MM1A 1R9ZA 1QJWA 4NT0A 1US0A 4LCRA 1HO4A 5JVLA 1CNVA 1VRDA 2H9AB 4GUIA 2VZOA 4IOTA 2OQLA 3NO1A 3DC0A 5LA0A 5ABTA 3VMPA 4PB3A 1CEOA 1UMYA 4P7QA 5G1MA 4HTBA 2DZXA 3CH9A 3L65A 1IT7A 2OWXA 3FNDA 2WCGA 3GNOA 3JS3A 3H4WA 3MPGA 2DSVA 1XCFA 2ZXAA 3SI9A 4AF0B 5LHFA 4WY0A 3W71A 3L66A 3PWIA 1TUXA 2PDBA 4KRZA 4H8UA 1KGUA 4X22A 2IXUA 2JBMA 3MQTA 5E70A 1NDYA 3TC6A 3LG3A 1BQCA 5A1AA 6ALDA 3N6JA 4MIMA 3UWVA 5HNNA 4GYPC 3RN6A 2DUZA 2XVLA 3QZAA 1TO3A 3G3MA 3T2PA 2XH4A 3NO5A 1JYNA 4MNJA 4PTMA 1VENA 1ZAHA 3B3DA 4IFOA 3RO8A 3VM7A 3ZR5A 1UB3A 5AZ1A 1JYWA 3SN1A 1L8PA 4A35A 2CLMA 4HIBA 5HMDA 2J75A 1L8NA 3VDHA 5I03A 2VCAA 3BURA 4QITA 2V5DA 3FCPA 3H7RA 3B97A 1PWLA 1TWZA 1WDQA 3IJ8A 3MHUA 4L80A 4IMGA 4YIWA 1EC9A 2V5CA 1PEZA 3I65A 4Y9NA 2X2YA 3ANYA 4BF5A 3CO8A 2PZ0A 4UTJA 3M7SA 1QI2A 3LHTA 3BAYA 1PB0A 4AEEA 4DIAA 1E9LA 2OKTA 4AW7A 2Z27A 4B5VA 3LM3A 3W0KA 4AWUA 2GL5A 4A2SA 1KR1A 4LBSA 4JIHA 1UWRA 3CQ0A 3TLQA 4AX7A 3UWUA 3R94A 2KZHA 1NEYA 4DUVA 2Y88A 4O16A 3IJQA 1S1PA 5IHRA 2RJHA 3CB8A 4M19A 4IFRA 2C71A 3TXZA 3DG3A 4QEEA 4QLJA 1WKFA 3CO4A 2FH8A 1FRBA 4LC8A 4UC5A 4ALDA 1MNZA 3MO4A 1W1TA 2V0TA 3ZJ8A 1JDEA 3AXHA 1E40A 5K9DA 2DW6A 3YPIA 1VEOA 5CXPA 1ZTVA 2A6LA 4KWOA 3IARA 2X2GA 1E43A 5MKGB 2XH2A 2EPLX 4MSSA 5FA5A 3NEVA 1DV7A 1M9HA 1WNOA 5CBBA 4UQBA 3IACA 1DXIA 4GNJA 2ZVRA 4NNCA 4NI3A 4QGCA 3HPAA 1T5AA 3CUXA 4S1FA 2TSYA 4UQDA 5D38A 2AKMA 5ABFA 4X9YA 1NU5A 3OJGA 5B7YA 4KFOA 2RGMA 1SQ7A 4UNKA 1ZJAA 1RHCA 4GG9A 3VE7A 5CC3A 1DQUA 3GLCA 4F66A 1QATA 3LLFA 3PG9A 1JCTA 5C2XA 2ZUTA 1YTDA 2AL2B 3E3HA 4ZOAA 1GNXA 3L4YA 3ALGA 4ZFCA 3SY5A 1EH9A 1LCOA 7TIMA 2BNJA 2BZNA 3DDMA 4ZB5A 3W84A 3RLVA 2PURA 3TWBA 3IIXA 4GZ7A 1J0ZA 4OE7A 3BOXA 1I2PA 3MDWA 5H1WA 2O9RA 3WNPA 1B5TA 2IPGA 4C5ZA 4D8LA 2HPIA 3B8UA 3PWGA 4BI7A 3ZSTA 4DEFA 1WDWA 1R3TA 3IIVA 5HQLA 3AYRA 4ZGYA 1IF2A 3B05A 2BODX 2UWFA 3C0LA 5L9FA 4MWAB 4H01A 3H55A 2ZZ1A 3SUVA 5LNRA 5HPCA 4CNSA 1ITCA 1R7OA 5ABGA 4FALA 2ZRWA 3N1AA 2ATMA 4WDWA 3AXMA 3SCNA 1W1A1 3ZZ1A 3SCRA 4FSAA 3SCVA 4NZCA 4HHPA 1DEDA 4R7OA 1K9FA 2IQDA 1T7LA 3LPOA 1QAPA 3O63A 1DWGM 2ZKMX 4AD2A 4NIRA 5BOFA 1MW1A 1P1MA 4B16A 3T08A 2O7SA 4LUTB 4XKYA 2GGEA 3B4YA 4AUBA 1P7TA 4YTSA 3GBDA 2X41A 1H11A 3WLLA 3VD5A 1WX0A 1IEQA 3B9NA 1V6VA 3WLIA 1O7AA 3BSMA 5ABHA 1W0MA 7A3HA 3OZMA 1JDAA 4YU1A 2W9MA 4JOMA 3H22A 1PTGA 3CQJA 3EPOA 4RV8A 2PDFA 1YXYA 1NIUA 3MB9A 3QKZA 4NYUA 3UY8A 1UJQA 2TPSA 3KVKA 1E70M 3H12A 3C2RA 4PMNA 2F2HA 3VNIA 1UPMB 4MJ2A 3BQ6A 2EJAA 1LLZA 1KV5A 3MVTA 8A3HA 1XI3A 3K4AA 4J28A 4JEQA 1HT6A 3BOFA 1YDYA 2Q01A 1P0NA 3LM7A 2F7FA 2ACQA 3W7KA 1E1EA 4Z1CA 2FLIA 2FZBA 4PZVA 4A4AA 1KNWA 1PIGA 2P1FA 2OO0A 3EWWA 1EA9C 1QMLA 1VC4A 5IM51 1HKIA 2Y5EA 1Z42A 3MUXA 5FAJA 3BGGA 1XD1A 3N73A 4TXEA 2AOSA 3GFZA 2C6QA 3FYYA 1F4HA 5I78A 3O06A 4KESA 1WP6A 4C1LA 1QOXA 4UFMA 2D2OA 1ZALA 5HJLA 1UP3A 4WXYA 1UROA 2GGJA 2XIMA 1KTNA 4G7EA 1EPXA 3H2OA 4UTTC 5LXEA 2WO5A 1F8IA 3MJYA 1TTIA 3BLDA 1OF8A 1AH4A 1GOWA 1TJ2A 1C8VA 1W3KA 2CYGA 4MUPA 5IDZA 2FTPA 5BRPA 2ACRA 1D8WA 1Y65A 4PUDA 3HPSA 3OGSA 4YHEA 1A49A 1JFXA 4D6DA 2YLLA 1VBRA 2BG5A 1M5WA 4CNNA 3BO9A 4U2ZA 1K7XA 3C6CA 3OG3A 2G4JA 3MC5A 2PDGA 1R3WA 5JIPA 1PUDA 2WMIA 4GYPA 4ZVJA 2QCDB 1B3ZA 2IPWA 4MB3A 3BMVA 2UY3A 3VI2A 3QBUA 3UXIA 2CLIA 4K37A 4HMEA 3GX9A 1YLVA 1JCMP 3KCJA 3VIKA 5DBUA 5HMSA 4EACA 3C2VA 2X1SA 3AMLA 6PTDA 3GUWA 2E0PA 1C8QA 5DO8A 1H1YA 1S3HA 1CXLA 4F4RA 1JF6A 3HO8A 4XD4A 4QJ3B 4I9MA 1K4HA 1JPDX 4QR6A 4DO5A 2YLAA 1BEUA 3UWZA 3QV9A 3ANUA 4E8DA 1ZLPA 1F74A 2G3IA 2XVNA 3MMDA 3P14A 2OELA 2PLKA 2DZAA 4UQAA 2Z2AA 1W3JA 4NG3A 4REQA 3FEQA 2ABBA 1KCLA 2EXOA 1GG1A 1HO1A 5BXTA 4XAZA 1K9TA 3LCHA 4K68A 1XIHA 3VINA 1OZQA 1QCWA 1XDLA 1EYWA 5J04A 3B9EA 5A6MA 1I4NA 2LLEA 1EKOA 1TPVA 1N8IA 1PO9A 3MP5A 2PTXA 3AIWA 3UW6A 4BWLC 3MW7A 3I6RA 1EC7A 1LDCA 3ICJA 3K8LA 1DP0A 4ICNA 4L4MA 4J35A 4LU0A 3WENA 3HV9A 3IS4A 1VS1A 1OCQA 3GB6A 1AK5A 5EMUA 4IP7A 2F38A 1ZENA 3KTSA 3WH9A 3P80A 5KETA 1W5PA 2NV2A 4MWAD 4ZQRA 2CZ5A 1O12A 3A23A 5D33A 3WKZA 1K8ZA 9XIMA 5LNUA 4OOUA 4R7WA 2H90A 3H2MA 4CU6A 3WUFA 5HULA 2HK0A 4ZMGA 1QOQA 4L4LA 1VCVA 1RCQA 2VKZG 3VVGA 1IHIA 1WDDA 4H9YA 1LQ0A 4E3VA 2BGQA 1UP2A 1V8EA 4URIA 4O14A 1FWHC 3W7NA 4PMVA 3NYDA 1WO2A 4LVGA 1JI1A 1OSEA 4G5DA 1AQHA 1HKJA 4H41A 3ALFA 2EKGA 3LD5A 3CUFA 3PBWA 2XIOA 5EB8A 1AJ2A 1GTEA 1Z69A 3WK2A 4ROQA 3VM5A 3SAZA 4E2BA 2FZNA 1HNYA 3G1AA 3URAA 4OV9A 5GJMA 1UKOA 4L65A 4U4MA 2F6KA 4L6HA 4H9VA 2PP0A 3ITOA 3GXFA 3P0WA 3K2GA 1GZJA 1XGDA 2DZWA 2XVPA 3CNYA 3T55A 1MRQA 1NP0A 2VWSA 1S5NA 2VVNA 1BKHA 5HWJA 3RK8A 3BE7A 4WD0A 3F4WA 1ODUA 1AMKA 3ENLA 3FX4A 5HUPA 2J25A 2OKOA 3GW0A 1V03A 2G8ZA 3VX0A 4KWVA 3VNJA 3ZXWA 5H8MA 2A21A 3NQVA 1JZ7A 2XFYA 4UFJA 5DMLA 4ZQMA 3P6LA 3B8IA 1Z41A 4JXCA 3KM8A 4J3UA 3JR2A 3VILA 3B0PA 4MF4A 3VTRA 1W1YA 2RUSA 2PGRA 2OSYA 3WNMA 2CZEA 1R86A 4GXMA 3B0UX 2QYGA 4K2SA 4N9EA 4RNIA 1K77A 4L56A 1TIWA 4QXIA 4ILSA 4B3ZA 4XBSA 2V2DA 2C1IA 2OT1A 2QZRA 2H9AA 4GZEA 4KGLA 4OTKA 4FX8A 2PA6A 1QNSA 1POKA 5M17A 3V75A 1FKXA 2PEVA 1C8YA 3V5CA 5LHEA 1I2RA 2YCLB 2I1OA 1TZ9A 3GYCA 1EB3A 3BV4A 4FOKA 5MHBA 4TV5A 1KBLA 1BSLA 5F2LA 4WSHA 3URQA 1AJ0A 3ORWA 4HNOA 1TV7A 1REQA 1TZ7A 5IDIA 1OINA 1SFSA 3S9YA 4FAMA 4GQ0A 3AIBA 4M0XA 4XVEA 1ME7A 4JZ5A 1X96A 4MYXA 4N0RA 1JUBA 2MNRA 3P61A 1VFHA 1OK4A 3W83A 1TZZA 1DJWA 3F2DA 4PMUA 1US3A 3RLUA 3GZ3A 2HSAA 3THQA 2BVDA 2XVGA 4FLSA 4CVWA 2QUVA 5JUVA 4JNMA 1X38A 1EBHA 4TO8A 2X0SA 1W3TA 5D2XA 2P76A 4LUSA 4AVFA 2NX1A 3WJZA 3UR5A 4LOCA 3KZPA 1IZKA 5I24A 5D03A 4GXPA 3AICA 5CZTA 2WM1A 4H6QA 3AZTA 2V5KA 5C54A 4NZ4A 2Q3OA 3SUWA 2V5LA 2J6XA 4NZ1A 3WIJA 1M01A 4I5RA 1HW6A 2WZIA 4BS0A 2TYSA 4Q4OA 1GUVA 3ZM8A 2C1HA 2VM8A 4PRTA 2VZUA 4PB5A 3W02A 4AZIA 2ZRUA 4MJMA 3EWXA 4IWWA 4TVUA 1XC4A 2W5FA 2J9ZA 3TTYA 4Y9AA 4RKAA 2DZBA 1VCFA 3NPUA 1LWIA 1O5XA 5G2WA 2PDCA 2HRWA 4XV0A 1N8WA 1YBQB 4IP4A 1OGGA 1BQGA 1KXQA 1J11A 5KSWA 4JNZA 3BCFA 4UTTA 4LAOA 1D3HA 4XKMA 1XICA 4PTWA 3N04A 3L5MA 4DJDC 2OZ8A 3VOCA 5AVHA 2WMHA 1EUNA 4QG9A 5CC6A 4CCEA 4HTYA 1PCKA 4JFUA 3THUA 1HIZA 1H41A 3E02A 1ISZA 3TP4A 4NVTA 3A47A 2Z2BA 2DPEA 2VEIA 3DUGA 4G1KA 1Q6CA 4J9JA 6CGTA 4D8AA 1G4PA 3MUCA 2YXOA 2D24A 5BOOA 8RUCA 1BGGA 4QIUA 3AHXA 1IGSA 2GJXA 2Y4SA 3TR2A 1KFWA 4C60A 1EPVA 4CCDA 3AYVA 1JAEA 4LTSA 1R9YA 4W9TA 4E6MA 1QI5A 1YTKA 1XINA 3TKFA 2P0OA 1H3GA 2J7BA 3G5EA 2HMCA 3UNDA 3OHMB 2FDSA 3G2GA 2WW5A 3ARXA 3S6OA 3MYPA 2C15A 4L6OA 4DPQA 4CU8A 2QDEA 3DGRA 3W2KA 4ZL1A 5D32A 4TVCA 3LDVA 4GFSA 3NPVA 4C5YA 2QUMA 3SJNA 5SWUA 1XIGA 4AD0A 1W9PA 1E3XA 2PI6A 5HUOA 3EX6A 4UOQA 3HURA 3MTWA 4FHAA 1SSGA 3HFTA 3NYZA 4XAFA 1YX1A 4KGJA 1NTHA 2QPUA 4N9CA 3M0VA 3Q2DA 3QV6A 4NRSA 3B8DA 2ZRZA 3NCOA 3HU7A 3MSDA 2WBKA 4BWLA 3GXTA 5HNRA 3KBNA 2VR4A 5FESA 3PM6A 4IP5A 3KEHA 4R27A 5HPOA 4C6JA 3VGGA 1QFEA 4C90A 1H0IA 3ANVA 4GI6A 3SIZA 1TPB1 3WDHA 4E2VA 1SW3A 3ABXA 3KOFA 2VHLA 1FWBC 1DBTA 1PZ2A 2VP8A 1TWDA 1XH2A 3O9NA 1MXGA 4GVIA 1DJXA 2F61A 2BSLA 2CITA 3WQCA 1TX0A 2EPKX 4HOZA 1KWGA 3PZOA 1YIXA 1V7AA 2QJNA 3AISA 3IV8A 4GI8A 2GFTA 3NEHA 5BROA 3WQGA 1OY0A 1OCBA 1NY1A 5AN7A 2VGGA 1DE6A 5A8QA 3WDIA 3VDGA 2XG9A 3DX5A 4JFTA 3W7LA 1IIGA 3LV6A 3TNBA 3ZFHA 4PCNA 3G1RA 3DFHA 3VUSA 1WB0A 3A3WA 4S2CA 1M7JA 3CJPA 3ID7A 3NSNA 2PC8A 4H7CA 1O60A 4H6EA 4W89A 4WQ6A 3NR0A 2ISFA 3IUDA 3PUDA 2W63A 2WSQA 1Z44A 3TN4A 3STEA 3FS2A 4GYKA 1Z8AA 1MW0A 4PUEA 3V35A 3UPBA 2DEPA 1J5TA 4AU0A 1QXLA 5GJNA 3B9AA 3A3XA 1JZ5A 4LY4A 4A2RA 3QW4B 1CX9A 3FGCB 4GX8A 3T81A 3BK0A 1HP4A 1OD0A 2Z1XA 2WVVB 1ZZMA 5G4HC 1FWFC 2ZQ0A 3PUEA 3OODA 4I6KA 3LTSA 3SRKA 5JQ9A 4Q33A 2XH0A 1H7RA 1NVMA 2ZWYA 3RJYA 3RUBL 1TMQA 3LHVA 1TPFA 1E6NA 4W4QA 4JTQA 4NNBA 2Z24A 3UZ5A 1CGVA 4WUIA 1OGSA 3HZ3A 3NFUA 4O18A 1DQXA 1XBVA 1H7XA 4E38A 5E5CA 2Y63A 6A3HA 1BG4A 1OF6A 4MYAA 1GEQA 3L68A 1QBBA 1WUFA 3RM4A 3F2BA 1FXPA 1ME9A 1POJA 1SUXA 1QPRA 1RJPA 3KOZA 5TF0A 4C6NA 2WK2A 2CLLA 2Z7KA 4DAIA 2RFGA 4A29A 3MVIA 4NAEA 1UWAA 1H7NA 2DT1A 3W6MA 1YXCA 4ZQCA 1VQTA 3U57A 1E9IA 1FA2A 3RMEA 4M7TA 4LUYA 1QPOA 3ZLGA 3GAKA 3MZNA 1Q7QA 3ARSA 2PWEA 3EDKA 5KZMA 4CQCA 4BHYA 2Y61A 1JUEA 2Z6IA 1Q6EA 4GACA 3SGGA 3A4WA 1EHAA 1OX5A 4B9ZA 2INEA 3L2LA 4QX4A 3GDLA 3VGBA 5I3FA 1YPFA 3AYTA 4A3HA 3ONBA 1RR2A 1VHNA 2X05A 2GQ3A 4KRTA 2YB1A 2WZMA 3EZ4A 2BY1A 2UY4A 5M2FX 4S3AA 3GVQA 1FDJA 1KW1A 1LLOA 2D0HA 2J8FA 2UY2A 2ACUA 4IL0A 2YYUA 2HQAA 3AMKA 3WLSA 3QY7A 3W75A 2ON3A 2OLAA 3HQPA 1XIIA 2VUNA 1R3RA 2DV0A 3RRXA 3MANA 1JQVA 1F3WA 3CHVA 3ES8A 2XSXA 2YBUA 1UZ4A 2PDPA 3U4FA 4EWND 3CWNA 1ELSA 3DZ1A 3PANA 1T41A 2Y7GA 1YNYA 2QCMA 1U1JA 1YADA 2FPVA 4NASA 1O4UA 1LWHA 2P10A 4I3GA 4DWSB 4GI4A 3P81A 4WKAA 2JALA 5EKYA 4JTCA 1NOUA 3NPWA 4J3XA 3VD7A 4OGZA 3CAKA 1XDMA 5KZ6A 2JGQA 3FSUA 5GPRA 4Z0JA 1E6SM 3PHAA 1PL9A 1XYLA 4FZIA 4KIRA 1SJAA 2OG9A 4MY1A 4O28A 1XFBA 1KO0A 4MUZA 4DJDA 3T6CA 2OXNA 1UR9A 2YL5A 4LXFA 1B4EA 5FJUA 3B0XA 1QW7A 2J7EA 1V6UA 3HG5A 3RILA 1OWQA 1S39A 1PAMA 4US5A 1I2NA 4O1AA 4JYDA 4LCQA 2HVOA 2OT0A 1J0YA 2OGYA 4M6VA 3F4DA 2J7CA 3ARPA 1OT1A 2VEGA 2FZ8A 1X7IA 1L9WA 4YWIA 1LL4A 3NGFA 3CYVA 2OQYA 4YTRA 4AD5A 2RGLA 3AIVA 1DWIM 2UZ9A 3QXBA 3H4GA 4ZTYA 3U4AA 3HF3A 5I3KA 1H51A 4U2YA 2NUXA 3TSBA 3GU2A 1PX8A 5HJYA 3N2BA 1V08A 4MZ8A 3STPA 4HMNA 3O3RA <