1DQYA

Crystal structure of antigen 85c from mycobacterium tuberculosis with diethyl phosphate inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (ANTIGEN 85-C)
total genus 105
structure length 283
sequence length 283
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dqyA00
3MUOA 3IUJA 5AKLA 4QDTA 1N5MA 4GLBA 4Y2PA 2RGUA 2HA7A 1UWCA 2WG2A 5ALPA 1K63A 2C0QA 2ZSHA 1LBTA 1XQWA 1ETHA 4EY7A 4A23A 4KEAA 1AKNA 2XUAA 3C8HA 1SCKA 4DSZA 2XUKA 2FJPA 3I1IA 4P08A 5ALEA 4QNNA 4Q3KA 1CUHA 3EQ9A 5E2IA 5ALYA 5JADA 4IO0A 4S0XA 4LKOA 2G5TA 2V97A 2XQIA 3WZLA 5HFAA 2CUTA 2XMZA 4W1QA 2YYSA 2XUOA 1XZIA 3C6ZA 3R3ZA 4X93A 3C5VA 2ZVDA 1DWPA 1CUYA 5F4ZA 4J3JA 5ALOA 5A71A 4Y2UA 4PF1A 3K9BA 2WKWA 3AJAA 4G4GA 4G8CA 4AMZA 5AI4A 1BCSA 4FFWA 3PDCA 2QOEA 3DNMA 1Y7HA 2OCGA 4BE9A 4X3CA 1VA4A 4KE8A 1JJBA 5AKXA 5IVHA 4BVKA 3I2JA 3JWEA 5LLSA 5AM4A 1CUFA 3DEAA 4KAJA 1EK2A 1E3QA 3C70A 3STWA 2WIGA 2XUPA 5AJHA 2HFJA 4H18A 5FOQA 2R11A 1J1IA 2GBCA 2XUGA 2QR5A 2ONCA 5CURA 4QWMA 1QIIA 5FDFA 2HA6A 1MAAA 1G4HA 3WJ1A 1DX6A 3UUFA 4ZXFA 4UBOA 1T2NA 1MTZA 3QM1A 4AQDA 2RONA 3ZV7A 4MYDA 4DNQA 3WJ2A 4BCCA 1F0PA 3EQ7A 4IH9A 2DHDA 4AO8A 2FUKA 2C0PA 3QPCA 3WWCA 4B80A 1XZAA 2WU4A 5JD6A 1FSSA 4HXGA 3WIBA 2Z8XA 1SCIA 3N2ZB 2HRRA 4QLOA 1CEXA 1FFCA 3WLAA 3Q0TA 4IH1A 3I6ZA 4PO3X 2OGZA 4UPDA 5ALMA 3ANTA 2JF0A 5AOAA 2G63A 3HABA 1QIEA 1AZWA 1ZJ5A 5AP9A 4BVJA 1MO2A 3H2KA 4AN1A 1CUUA 5EIHA 3VJKA 4IQ4A 5HQ3B 4UBNA 3WK8A 5HF6A 4HTAA 2WSLA 3O4JA 4B85A 2IITA 1K5PA 5K3FA 5JZ9A 2OGSA 2B9VA 3GZJA 3R41A 1J07A 1CUDA 4ZV9A 3SC2A 5KREA 2PSFA 3IULA 4YK7A 3G0GA 4Y2YA 3T4UA 1C7JA 2OPHA 3W05A 4B7ZA 5K3FB 1LLFA 1AGYA 3FYUB 1WM1A 2JGKA 5AM1A 3FVTA 3WWEA 1LPMA 2BAGA 2NW6A 3GFFA 1FJ2A 1XRLA 1Q0RA 4HXEB 1YCDA 5JAUA 2XMGA 5EIEA 2CBGA 2RAUA 3FSGA 4WFJA 5K3DA 3OG9A 4YPVA 4UHFA 3HEAA 4FOLA 4UHDA 2XI4A 4CIBA 1ZD5A 1BN7A 1TK3A 4B81A 4RE5A 2I78A 3ESBA 2HFKA 1WHSA 3O4IA 4MEAA 3UUEA 4M0EA 1QIMA 4B82A 3V1LA 2BKLA 2PU5A 3DOHA 3FLEA 4JYMA 2VAXA 1GPKA 4QEKA 5CT4A 3SX4A 5T4FA 4X85A 1XZGA 2B61A 1UK7A 5JALA 4BZWA 2ROQA 3STUA 4LXGA 5I8PA 5HF9A 1GGVA 1WHTA 2H1IA 4ZWNA 4GWLA 4BBZA 3WA6A 4C88A 4HRXA 2VT7A 5JZBA 3A2NA 4GHWA 5HCUA 5AM2A 4OUKX 2I3DA 4MXDA 5CXUA 3A70A 3EF3A 3VKFA 1XZMA 4AO7A 4X97A 4ITVA 1YAHA 1QIFA 4KRXA 1YS2X 5AI0A 5LZ5A 5ALJA 4X6UA 4PSDA 4DLNA 1ZIXA 1PFQA 2HL6A 4C4XA 1MX5A 4J7AA 3H19A 2P8SA 4DIUA 1EDDA 4G9EA 2K2QB 3CN9A 2VTVA 4B83A 1AQLA 3AILA 5JZSA 3OOSA 1ORWA 2J3DA 2JBWA 3FBWA 1ODTC 1VJ5A 3KWFA 5ALLA 1E5TA 1RYYA 2EDCA 3VJLA 4OB7A 2GZSA 4HS9A 5FKJA 1QIJA 4WFKA 4Q1VA 5BOVA 5AKZA 2WFLA 5T4EA 3RLIA 4CG2A 2QXTA 4H7DA 3A2LA 1E8NA 1XZJA 1IUPA 3V48A 2JEZA 2G4LA 2XQKA 4C4YA 1G66A 2O2HA 4UBMA 1LNSA 4M0MA 5A62A 3ICVA 1XFDA 4FMPA 2PKYX 4E14A 4UFPA 1MPXA 4OYLA 5EHQA 2EEPA 4EY5A 4DM7A 3KXPA 1CV2A 2ZYSA 3R3UA 1XZEA 5AHXA 3F67A 3DKRA 1HQDA 4GXNA 4RE6A 3EBLA 1TKRA 5DYTA 4G4IA 3C6XA 3LP5A 3O0DA 2OXEA 3HYSA 3STYA 3D5EA 1EXWA 2BUCA 4EZIA 2VEOA 3PF8A 4L9AA 4DMFA 4BCDA 1QGED 5DNVA 5C8XA 1GPNA 1WCYA 5FP0A 1TCCA 5FRDA 1F0NA 4XIIA 2IIVA 2Y6UA 2X5XA 3KOOA 1HBJA 1L7QA 1FFAA 4X90A 2WUGA 4KRYA 4Y2QA 4HXFB 2QJWA 3WA7A 3WIOA 3QZUA 2YASA 3A6ZA 1QIHA 2HA3A 5CRIA 3CCBA 5FPQA 5JYCA 2AXEA 4LIPD 5EFZA 3ICWA 1YA8A 1H2WA 4DSAA 3WKCA 3G0CA 1JU3A 2XMSA 2DSNA 3O4HA 1JU4A 5JASA 4X6XA 1CUXA 1X70A 3WL5A 3DLTA 3G8YA 3JW8A 4EA6A 3R0VA 3K2IA 3O95A 3TGLA 1U8EA 4H35A 1BROA 2B4KA 3WL6A 5A7FA 1R88A 3MUNA 2PBLA 4A5SA 4Y7DA 5AK3A 3QMWA 1QLWA 3H2IA 4QDOA 1OCEA 3HXKA 1XZCA 3JYHA 1DQZA 5I7UA 1LPOA 4U2FA 3BF7A 4BCBA 1XZDA 2ES4A 4Y2VA 1EA5A 1Q84A 3HZOA 2XMDA 3VJMA 4C01A 5ALDA 2HU5A 3C5WP 2GBGA 4BTVA 1W75A 1NU8A 1E66A 2XUHA 5A7GA 3R40A 1IUOA 2OQIA 5A2GA 4G5XA 2OCLA 1BEEA 1CUGA 1ZD4A 3PUIA 2ZJ6A 4J0KA 4ZRDA 5LZ7A 2H7XA 1BN6A 1TIBA 4FHZA 4G8DA 5CH5A 1LZLA 3C45A 1YR2A 1CUIA 2GZRA 2JGJA 3ILSA 3H1AA 1VA5A 4UBLA 3OURA 1E89A 4DNPA 3CN7A 4C89A 1HLGA 4PNZA 3IURA 2H9YA 3IB3A 3ZLUA 4PQEA 4FNMA 4HZGA 2JGIA 5AM5A 1EHYA 1JI3A 4W1RA 3WWDA 4LYEA 5C8VA 4X94A 4UBKA 4NMWA 2CJPA 3F96A 4DMHA 3HI4A 4KAFA 5CH3A 3IDAA 2VSQA 4Y9SA 4OD0A 1B41A 2X76A 3M81A 5IH7A 2XT0A 3PI6A 5D7BA 3I6YA 4X71A 1CRLA 2DHCA 5HZGA 4KYVA 5LZ2A 4H7EA 4MYSA 3O4GA 1QFMA 1XRMA 1J2EA 1PV1A 5FUMA 3H2GA 1ZJ4A 3I1YA 1A88A 3DJYA 1IUNA 2XE4A 4OU5A 5EHXA 3QYJA 1MU0A 1FFEA 2JGMA 2HU8A 4QDUA 1DQYA 1VXOA 3V1MA 3OM8A 5AI8A 4QE3A 1U65A 1WPRA 4Z49A 4OYYA 1QE3A 1CQWA 3WWPA 3E3AA 4F5ZA 3F97A 4UHCA 1Q83A 5JD4A 5ISMA 5ALRA 1J06A 4GBGA 4P9NA 4K5QA 2ZJFA 3WI7A 2Y2UA 3U1TA 1ZGCA 2CZQA 5D3ZA 1XZFA 3TEJA 4MWTA 2D5LA 3S2ZA 4LHEA 1GXSA 1CR6A 1OILA 4G8BA 2DCMA 4MQMA 1ZGBA 4XJVA 2QZPA 2O2IA 4GDMA 1SFRA 1H2ZA 1IZ7A 3WKDA 2ZYHA 1L7RA 4UBIA 4J0JA 3MVEA 3M82A 2BUAA 2XQGA 3QPAA 2WIFA 3ED1A 1FFBA 2XLBA 4HAIA 4EBBA 4H0CA 4FTWA 1GKKA 3STXA 4RPCA 2WFZA 2EDAA 3WQHA 2ACKA 5DNUA 3ANSA 1AUOA 3P2MA 5K5EA 4ZGBA 2PUJA 4BAZA 3BIXA 2WQZA 5DNWA 3AZPA 4DNFA 2D0DA 1CUVA 1MT3A 4J0HA 2QM0A 1EDBA 1LZKA 4I3FA 1R3DA 5K3AA 5D3KA 1WPXA 3DL4A 4WY5A 4ZREA 5LZ9A 3W04A 3D2CA 4AZ0A 1ZIYA 1VZ2A 2QKYA 3FOBA 1MAHA 1W6RA 5AOCA 3AZQA 1K6EA 2WHRA 3H1BA 4H7KA 5AO9A 1HDEA 3EQ8A 4KJXA 2ZJ7A 4ROTA 1VXRA 4L72A 1LPSA 3BWXA 3LS2A 3M3DA 3KDAA 1ZD3A 3IBTA 3VISA 3F98A 4FKBA 5JAOA 1A8QA 5HKBA 2Y2VA 4RNCA 3HJUA 4PSUA 4BP8A 4JNCA 4WCVA 5LZ8A 3OPMA 3W9BA 4BAUA 3B5EA 4TGLA 3I6MA 1XROA 2XB6A 3IA2A 2BCEA 2XMRA 3G7NA 1X2BA 3VXKA 4BYMA 2PX6A 5AKHA 2XQJA 4W9RA 1CIJA 3IUNA 5LZ4A 3W9UA 5DYWA 2ZYIA 4B9EA 4BRZA 1UKCA 2I03A 1DX4A 2PL5A 3W2TA 1O6GA 3C6BA 4WJLA 1AURA 3C43A 2OCKA 2O7RA 5AM0A 4EUSA 1CVLA 3PE6A 2QUBA 4P93A 3QBJA 1H2YA 3FSGD 4IHAA 1PJAA 3BF8A 2QT9A 4FLFA 4H7HA 2Y1KA 2UZ0A 2XDWA 5E4TA 3FWHA 3G9ZA 4KAAA 1DTEA 2PVSA 4L3WA 4H7JA 1THGA 4G9GA 4CG3A 2XQFA 2H7CA 1VKHA 2Q0XA 2J3QA 4UFNA 5CBKA 2JIDA 1R9MA 1RWQA 1CQZA 5EIAA 3V9AA 1XRNA 3ZWQA 2JGEA 3WMRA 1H23A 2JGFA 4UBJA 4K6GA 4XX1A 5AIBA 2W6CX 3GBSA 4QDZA 5CT8A 3QVMA 3AIKA 2WG1A 3F8SA 4BC0A 2VATA 3WZMA 1JMYA 2YXPX 4A16A 4UHEA 1C7IA 2WHPB 3FYUA 2OAGA 1BCRA 2XLCA 3D0KA 2OCIA 4ETWA 2B20A 4K6KA 4BP9A 4W1SA 4KE9A 2ORYA 5ALGA 2BGRA 1AC5A 1VE6A 1ACLA 1CUCA 2HA4A 2ACEA 1W76A 5CW2A 3H0CA 5HKAA 5JAPA 3FNBA 1U4NA 2OG1A 3LIIA 3VVMA 2CEKA 4B6GA 4J0IA 4WDQA 1DU4A 3ESCA 2QRUA 1SOMA 5SYMA 5AI6A 5ALSA 3QMMA 1SCQA 5ALVA 1CUEA 4N8EA 5ALUA 2GYVA 5J3JA 1YA4A 1YSCA 3SK0A 1XQXA 1LPBB 1N8SA 3G02A 5AKYA 1MNQA 4W1PA 4PSCA 1W52X 1UK9A 3E0XA 3LIPA 4H77A 2WU3A 4OCZA 3TRDA 4EY8A 3SWWA 2R8BA 3QITA 4D9JA 2DR0A 4EB0A 3C8DA 4BE4A 3FLAA 1XRRA 3PF9A 1EVEA 3N0TA 2LIPA 3D3NA 1JMKC 3ZLVA 1MX1A 1GT6A 2ZSIA 1CUZA 1GQRA 2G5PA 4I4CA 2C4HA 3BDVA 4J0CA 1JKMA 1QZ3A 3WK6A 2QUAA 5ALHA 2XUIA 3NOXA 1CPYA 4Y2SA 4YASA 4J03A 2I3ZA 3E1GA 2HRQA 1ACJA 2VAVA 5EGNA 1CUAA 2HIHA 2HHAA 3W06A 2VF2A 5ALTA 1G5FA 1UOOA 4E11A 4U2EA 4XWGA 3AIOA 4DMKA 5AKJA 4QDXA 5DTIA 5A7HA 2WFMA 4NVRA 1KU0A 2QMQA 4INZA 4BZZA 3A2MA 4B0PA 3GA7A 2PU7A 2AJBA 3QH4A 5ALQA 3I2HA 4UHHA 1R1DA 4WFIA 5C81A 1Y7IA 4BRSA 3OC0A 2HADA 3V1KA 3I2IA 2V98A 3WL8A 4OB8A 2GYWA 2WFLB 4M0FA 1WB6A 4Q34A 4JYPA 2H7YA 1LPNA 1A8UA 3I2KA 2OAEA 3UMJA 4FFVA 2JGLA 4OB6A 1EVQA 4ZI5A 3HRHA 4N5HX 2WHPA 5CMLA 5ALNA 2Z5GA 1S8OA 5HK8A 5CT9A 1A7UA 4N8DA 1ORVA 2VJAA 1BS9A 4CCWA 3D2AA 1XQYA 3BIWA 5DWDA 1ZOIA 4JH0A 2QVBA 5AOBA 1Z68A 3O9VA 3D4LA 3VDXA 2WG0A 1UZAA 2WUFA 4PV7A 3IUQA 2HU7A 4Q3LA 4U2CA 1KU6A 1Q0ZA 5ALZA 2GYUA 4KACA 4IH4A 4Q05A 5BWBA 3DDUA 3BXPA 2Z8ZA 4H7IA 5AK4A 4J0DA 1H2XA 1VOTA 1BE0A 3DS8A 2XUQA 4JEIA 3G0BA 3NUZA 4HRYA 5EHNA 3CXUA 2OGTA 2WTMA 2W22A 3EIOA 4CCYA 4K6HA 1QIKA 1TQHA 2WHQA 4UHBA 1A8SA 3BL8A 4N5IX 3RARA 1YS1X 5IKXA 1K8QA 2PSJA 2DFPA 4X6YA 5EI5A 5AH0A 4E46A 3FYUC 5ALXA 4BAGA 1XRQA 4C4ZA 3NWOA 4JUIA 4TPKA 5DTJA 2WIKA 3WL7A 2HA2A 5IVIA 2DQZA 4EY4A 3DYVA 5D6OA 3WKAA 1F6WA 4N8SA 3HC7A 3STVA 5FV4A 4XVCA 4CG1A 1RP1A 1P0IA 3M83A 3WYDA 2WJ4A 4F60A 1HKHA 4BB0A 5FXMA 3WWOA 3CCCA 4LXHA 4MJ3A 4X95A 1EI9A 4LXIA 1P0PA 2WUEA 1N1MA 1UK6A 1YB6A 2CKMA 2XUDA 5AKEA 1JT2A 1LPAB 2PPLA 1GQSA 5H3HA 3DOIA 1CUSA 3D59A 3BJMA 5AK6A 3H17A 3D2BA 4G4JA 1DT3A 2WUDA 2WIDA 1ZD2P 4Y2JA 4X7BA 1UXOA 2FJ0A 1CUBA 1MNAA 5SYNA 5C8ZA 3PICA 1XZBA 1WB5A 4PW0A 3AIMA 3L1JA 1USWA 3WKEA 1QO9A 1ZICA 4TVKA 5CT5A 4F21A 5JATA 2HDWA 1UKAA 4CI9A 3R3YA 4FNGA 1XZLA 2OQVA 2WM2A 1JFRA 5HF8A 2DHEA 4B0OA 4V2IA 5DYYA 3PFBA 1P0MA 1L7AA 7YASA 2WILA 1E8MA 3RKSA 5AKGA 3KWJA 4NZZA 3BDIA 3NGMA 5ALWA 2WJ6A 5LIPA 1R50A 5K3CA 1XZKA 2PUHA 1EK1A 1GZ7A 5JARA 1CUJA 5KWJA 5AK5A 2VT6A 1QOZA 4GI1A 1UKBA 2XMBA 3B3QA 3QMVA 5ALFA 2J4FA 2O2GA 1UFOA 5JD5A 1QO7A 2BUBA 4C87A 1YASA 1LBSA 1XLUA 1IZ8A 3G0DA 1AMNA 2FX5A 2VJCA 5LYYA 5T4BA 5AI5A 1HPLA 4F0JA 3B12A 4AB1A 5HQ3A 3G9UA 4LYDA 4WDRA 1DWQA 4AZ3A 4HVTA 1ZI9A 2BGNA 5CH8A 2WJ3A 4Q3OA 2ZYRA 2ECFA 3GROA 4QA9A 3U0VA 2QJRA 3HACA 4AX4A 1EX9A 1U2EA 1YB7A 3DYIA 1GPLA 1ODCA 1GKLA 1ODSA 1C4XA 4DYHA 3FYTA 1SC9A 1QIGA 3G9TA 1T4MA 4QLAA 1MN6A 4AO6A 2AJ8A 3WYNA 5IVKA 3DQZA 3HLKA 2AJDA 3C87A 1P0QA 1W1IA 4CFSA 4K2AA 5AI9A 5CXXA 5FPPA 2Z3WA 3R3XA 4ZV7A 3ESDA 3TJMA 3S8YA 4BTLA 5LKRA 2E3JA 3WKBA 4OPMA 2AJLI 4MEBA 2RHWA 3DCNA 5I9IA 4L0CA 3K6KA 4CIAA 4DNOA 1BEZA 3ESAA 5AKKA 3FCYA 1DT5A 3R3WA 4AXBA 3FAKA 2GBFA 4I19A 3PFCA 4W63A 1QIDA 1FFDA 3L1HA 4GECA 1CFJA 3IIIA 3BJRA 1D07A 3WK9A 3PUHA 4Y2XA 3YASA 1UT6A 2C5GA 5E4JA 4GW3A 1XZHA 4BATA 1KEZA 3O9MA 1EB8A 1O6FA 3VVLA 1R9NA 1EB9A 5JAHA 4X92A 3ZPXA 3I2FA 2OLEA 1Y37A 3I28A 3FVRA 1VLQA 3G0IA 3DKKA 1WOMA 3AFIA 2WLSA 4FBLA 4Y2RA 2QXUA 1WB4A 3R3VA 5LP1A 5JIBA 2HA0A 3ZLTA 3WK5A 3FLBA 4J0GA 3ZI7A 1B6GA 2PSEA 3LCRA 4H7FA 3AUKA 5T4HA 1ZI6A 4RGYA 6YASA 1XRPA 1XLWA 1W4LA 1CUWA 4NS4A 4U2BA 1UK8A 4QZVA 4Q82A 1ISPA 4AN0A 1BU8A 4X00A 3H2HA 1IMJA 4BDTA 2BFNA 2X8BA 1TCAA 3KSRA 2DQYA 5YASA 3AINA 1HL7A 4KR0A 2Z3ZA 4BDSA 2WTNA 3HSSA 5AIAA 1MX9A 3LLCA 1VE7A 2V9ZA 5LKAA 2HM7A 1QJ4A 4B84A 4ARAA 4DMCA 5DJ5A 3V1NA 2XMQA 3X3HA 2J4CA 3DL7A 5AKIA 1X2EA 2BJHA 3BE8A 1F8UA 5ALIA 1QTIA 4KE6A 4U2DA 2O7VA 1THTA 3L1IA 5IVDA 5C7YA 5BWCA 4X91A 5HK9A 4FBMA 4YX9A 1LGYA 4DTCA 4WY8A 1H22A 2C58A 3H04A 4O08A 1VZ3A 4EY6A 2VQ6A 2RI6A 2AJCA 4FWBA 2QS9A 4UFOA 2PM8A 5HF5A 4BC1A 3GUUA 2HA5A 2JEYA 1JJFA 4ARBA 1M33A 5ESRA 1XLVA 4KE7A 3KD2A 2IX9A 1NX9A 3WK7A 3RK4A 3AZOA 4FLEA 4GEGA 1JJIA 1XKTA 1QTRA 1UOQA 1DWOA 5EHZA 5AM3A 3IUMA 2VA9A 5K3EA 1QONA 1TCBA 3FCXA 2CB9A 5A6VA 1K4YA 4P92A 5AICA 2RIPA 1QFSA 1N5RA 5DLPA 4C6HA 1BRTA 1TAHA 1AX9A 2VJBA 4MQLA 1ZI8A 1G42A 2XMCA 3QPDA 3H18A 4EHBA 3RM3A 1E8DA 1IVYA 2PSHA 1TRHA 5CT6A 3E4DA 4QWWA 1NU6A 4OSEA 4FDMA 1UOPA 5KWIA 3D7RA 3IVMA 4AMYA 3DD5A 3GELA 3G9XA 1DINA 4DGQA 1XQVA 4B9AA 3MGAA 3STTA 3OTQA 2QTBA 4FLMA 3T52A 4UUQA 4U2GA 5FLKA 3WK4A 2V96A 3F9CA 5K3BA 3H2JA 5BV7A 4Y2TA 1YAJA 3I2GA 1MJ5A 1EDEA 2XUFA 2CMFA 1OXMA 2PSDA 2XUJA 1R4ZA 5ALKA 2YH2A 1LPPA 1XKLA 4G1FA 4BVLA 1CLEA 4MWSA 2WIJA 2Y6VA 2GBIA 2C7BA 5KBYA 2VJDA 4E15A 3C6YA 2RHTA 1EINA 4CCYB 3Q8WA 5E4YA 5JANA 4OU4A 5HFNA 1I6WA 1EH5A 5CTAA 2C5FA
chains in the Genus database with same CATH superfamily
3MUOA 3N2NA 4OHOA 2ZRGA 1Z6QA 4KMRA 3GU3A 5AKLA 4QDTA 1M34B 3IEXA 3H2SA 4KC0A 4OQQA 4BGEA 3CUEF 1N5MA 1ARZA 3HBLA 1ZU4A 3KHTA 3SYMA 3ZE7A 3PPXA 2ISCA 4FJ2A 3ZD8A 3GP3A 4ZRNA 4BQIA 2IELA 3NYIA 1TUIA 4EF5A 4R7GA 1K63A 5C53B 4MR9A 3HCDA 3OZTA 2C0QA 3EEIA 2ZDQA 5KNDH 4GI3A 2QEQA 2I99A 3RB8A 3K8OE 1TQ2A 4JITA 4XJTA 2ZSHA 2R6ZA 4PYQA 7REQA 1XQWA 2P2NA 4UNNA 1YVPA 3EEYA 4AY2A 1OA1A 1RU3A 1ETHA 5KYGA 4RCVA 5LB4A 1GYRA 4JAVC 5CEFA 3TOXA 4AS3A 5I8ZA 1PCXA 5DXFA 5FUVA 1G9SA 3BFVA 5COQA 1OQAA 4KEAA 1Q14A 4RVCA 1AKNA 4OM8A 2IXDA 2G0AA 2R8PA 4WLVA 1YBAA 3D4IA 1PDOA 4YJ3F 1YBHA 2XUKA 3BJEA 2A3RA 3I1IA 3MMSA 2C9MA 4P08A 3IEVA 3DEZA 1JQ3A 1T8YA 1JXAA 2WJVA 2BEVA 4NR0A 4QNNA 4Q3KA 5ENVA 4QT4A 2P30A 3KLBA 4FS3A 2OBLA 4BUJA 3KT8A 2EC5A 4ILEA 4LDRA 2ZSKA 2HO4A 2HRDA 1LQUA 3BH6A 3C3JA 2Q8PA 2QJOA 1OGIA 4O4JF 3SJBA 4EOGA 3PD7A 4IW3B 3IVXA 4Q4JA 4MUBA 4IDEA 1Y3FE 4HWSA 5HFAA 1KI6A 3KP1A 4FKMA 2I7TA 3N7TA 3W34A 4CT4B 3KDSE 4DA0A 4KXQA 1OLUA 1ESZA 3C5VA 5IMSA 4PHGA 1WQ4A 1SKQA 3EIHA 5A71A 1NW6A 2I54A 3CJQA 5TEWA 2Y1FA 1W30A 2G25A 3E18A 3GJ6A 3FROA 2WKWA 2D7DA 3AJAA 121PA 1J8FA 4I3GA 4QDJA 4WY2A 1F5SA 3TNJA 3V3KA 5TQ0A 5LD2B 4PHCA 4CQNA 4ARCA 3ZU3A 1JIXA 4M0UA 2EJBA 3DONA 2VBCA 1BCSA 1FYDA 2QNIA 2G4VA 2D2VA 3GDHA 3IAEA 4X3CA 3NTXA 3RGGA 5D5PA 4TWJA 1N9ZA 2X2PA 4H16A 5AKXA 5DHTA 5IVHA 3BQNB 3EF1A 4BVKA 1J9GA 1WUYA 2Y4OA 3JWEA 4EJFA 4XVUA 5AM4A 3QEMA 1G3UA 2A0FA 1CUFA 3H1GA 3ABIA 4DADA 5E7IA 3AWDA 3RUPA 3L8FA 3L05A 3QKWA 2J08A 4L3VA 3UK0A 2F1JA 2ONJA 3STWA 2C9BA 1WPQA 2WIGA 3IO3A 4F9EA 5IRCD 2HFJA 4H18A 4PZAA 4GD3Q 4DLRA 2CLOB 3QXHA 1U3VA 4BEWA 3LZ6A 3RU7A 3WS7A 3AW8A 1W5BA 1CR0A 3EXEB 5HE8A 4GQIA 2GBCA 2XUGA 5EN4A 2A1UB 1U11A 3TXAA 5I4KA 4OMDA 2F90A 3HKEA 4UM8B 3AG6A 3K72B 3TI9A 2X8AA 4KLAA 2ONCA 1AUXA 4PHTA 5A02A 3CR7A 2BI4A 5EZ5A 3M5DA 4OHFA 5FDFA 4M38A 1BZYA 2Q3MA 1DX6A 2Z4TA 4QUJA 3UUFA 5GZ3A 1HDXA 1BO6A 3EPRA 4EO7A 2P65A 3ORYA 5A4JA 2VHQA 1Q0SA 2RONA 4JC0A 4NE9A 4JA2A 4UAVA 1UDRA 2IX3A 4ZPJA 3SZOA 3EVFA 3WJ2A 5IFKA 1XTJA 2V7VA 1Z63A 1GGMA 3EQ7A 2DHDA 4RSGA 5EJEA 2IBSA 3MHTA 2HLDA 4AO8A 3ZIUA 2OBXA 3IS3A 3PNSA 3CEJA 3GX1A 2R6HA 4M9SA 1TM3E 3WYGA 2NTNA 1FDWA 5JNSA 4ZQCB 1T2AA 2B3DA 5AVRA 4CI0B 5F2NA 4KO4S 1U4SA 1UBNA 1PS8A 3GEMA 2W4MA 4FEGA 4ZOLB 2WZDA 1GU0A 3HJNA 4BV8A 1N92A 4UXJA 1XVIA 3GD5A 4MVXA 2UZ3A 2HRRA 1KXZA 4AX8A 4IMPA 2P7HA 2R87A 4G41A 5D8DA 3SE0A 3PQCA 2C7RA 1CJSA 4IH1A 3I6ZA 4PO3X 3EDCA 4NBKA 1V9CA 3V97A 1GPYA 2J67A 4HNHA 4BO8A 1PQUA 3ITEA 4DJ5X 4DG9A 4YY3B 3EIQA 5GVSA 5ALMA 5JCJA 3ANTA 5CD1A 1IE3A 1VL1A 3TQHA 3KPVA 4LSZA 1QIEA 5BWMA 1ZJ5A 2AB0A 3SCZA 4WESA 1T0BA 4YT8A 4Q5IA 3L4JA 2O8NA 5EIHA 2VHWA 5DMHA 5L4LA 4JR0A 3VJKA 5AW3A 1KDRA 1KBOA 4JJZA 1UOEA 3W4JA 1IEQA 1OBVA 3WMEA 4C07A 1C4OA 3ENZA 3GLRA 3JASB 1E7SA 1MIHA 1VSUA 4HTAA 3LY5A 3QTBA 4O4HA 5KS2A 4LXUA 5FQNA 3BKWA 4BLVA 5MGNA 3ROZA 4MLPA 4GM1A 4GXQA 5BNZA 3LUDA 2FHSA 5I4IA 1F4PA 1X42A 3K9CA 4NV0A 1I4WA 1XV5A 4B85A 1AF4A 1WUKS 2DY1A 2IITA 2SCUA 1DRJA 3KJFA 4MW4A 3QFRA 3USZA 4LRWA 1UJCA 4N7JA 3EXFA 5JZ9A 4YXWA 1BDMA 4Q3NA 4CGYA 1YONA 2BI8A 1RXIA 1UJ2A 2QLFA 1F8FA 2VNAA 3EZXA 3LC2O 1QGUA 4K7JA 3FHCB 3KK0A 3M1LA 2PNJA 1JHXA 4NP6A 1XJ5A 4EUEA 2AK3A 2C3YA 2PSFA 4YI5A 3IULA 4UAJA 2XJ9A 4GL2A 1NBHA 3IPAA 1MJGA 3M70A 4WZAE 2IF2A 4ZO9A 4DQ0A 3W05A 4WXRA 2WWFA 5DNAA 4B7ZA 3U44B 5K3FB 3IDOA 2ADFA 1AGYA 2H5IA 2AQHA 1K4MA 2JGKA 4CRWB 2HDNB 3FETA 3FVTA 4OM7A 3D3QA 3INYA 3EDYA 3T7AA 3HDHA 4EG5A 5B55A 4CEHB 4AFNA 5ADVA 2O6LA 1BD4A 4LTDA 1SHLA 4KN6A 5LWQA 3AUSA 3AV3A 4R1SA 1G6HA 3GEIA 5KPDA 1FYFA 1ULTA 4YGXB 1E2NA 2GFIA 2QM7A 2QT0A 4FFSA 4XZ3A 5JAUA 1WTCA 1RLUA 1P9NA 3P94A 1FFXA 3ZNPA 3ZVKA 5SYAA 2CC2A 2VQEB 2GNAA 2WF7A 4Z0HO 1ZNWA 1IB6A 3CCFA 4JYCA 2RAUA 2W70A 1QRSA 3CWZA 4OQDA 3U4QB 5K3DA 5KTPA 1E2LA 4ZEVA 4BNTA 4YPVA 3SSOA 3NDRA 2AFIE 1T8SA 4L1KA 4B3SB 1POWA 5ER9A 2X1MA 2GAJA 3UAVA 3CPEA 4DRXA 1QHEA 2PPVA 4LJ7A 2PCJA 4QXAA 4YV0A 2I2CA 4E08A 2V7GA 1E3EA 3DH0A 1YMQA 1AMOA 5GJVC 1VBFA 1SXJD 1H2FA 2WTAA 5F5XA 4J43A 3WMWA 2RFLA 1TK3A 3T9EA 2O7NA 2YV3A 3SQLA 3ESBA 2HFKA 3QI2A 1U81A 1YIDA 2QSJA 1E69A 4TTJA 1E98A 4DN6A 1O96A 1P29A 3B53X 1QFJA 4KX5A 3V1LA 3IPRA 1ICIA 4KBGA 3W6ZA 4IVPA 2VP9A 2D0PB 2BBOA 2XNKA 2ANBA 5TVGA 1C9KA 5LP6F 3TPCA 2FWIA 2WE7A 3LX5A 3KQHA 2FZCA 3E53A 1XEWY 4TL6A 1GPKA 1D6MA 3D3WB 2OUIA 3NR2A 1EPUA 1TK9A 3DBVO 4Q9KA 4C76A 1A76A 1HDZA 4ND8B 4I50B 2QTLA 5A5GA 5K6AA 3F49S 3ZBQA 2JHAA 3DQPA 3OT1A 2D7CA 5D3QA 5KSWB 1XZGA 1R5OA 3DAHA 1MABB 3CFYA 5CB6A 4YUAA 1T29A 2ZB7A 1V9LA 2CHGA 1E5QA 3NVDA 5E0OA 3NBMA 1XTZA 5A3JA 5EVJA 2F9LA 4JGBA 5CHEA 1L4GA 1N6RA 1CQXA 2D1RA 4LWZA 3LP8A 3D31A 3UJPA 2JARA 1GVHA 4LXGA 2A35A 4P5PA 5LD2C 4WLFA 5I8PA 3NT4A 1HE8B 2ZETA 4NENA 4KQIA 4ZU3A 3IAS6 3BXGA 3QMPA 3CF4G 3FJOA 5DCUA 1OU0A 2H1IA 4ND7A 3IVRA 4O59O 2OP1A 4ZWNA 1X9IA 5DX1A 4BBZA 5J4YA 3ZJTA 1DJPA 2IUEA 1UCFA 4MS1B 1A7AA 1I32A 1NV9A 2GAIA 3WA6A 1VBNA 1R0SA 5HGJA 2FN8A 3CIFA 3FCCA 3VSBA 2VT7A 3ORFA 4RTRA 1X0XA 1V39A 5D3MA 4AZSA 5JZBA 4ZYXA 4L95C 2RHLA 3G5AA 1U9ZA 3LWBA 4FKZA 4LYGA 4M1TA 1ZOOA 5LL6P 1Y8QA 3NIFB 1Y5MA 1Z6AA 2NN3C 2PWZA 1FTQA 4MKFA 3LFUA 5JMTA 1JHDA 2AMLA 5IKEA 1CRQA 1T34A 1BS2A 4NICA 2FSHA 1T15A 2NPOA 3EF3A 3GLIA 1C1XA 1XTUA 3DOJA 3OMWA 4MR8A 4OKSA 1BW9B 5JSQA 4X97A 2FPPA 5MFPA 1O94A 4J7CA 4WACA 4BN4A 4YJHA 2IDKA 2EBHX 2XKBA 3OJEA 1QIFA 2B92A 2CE7A 3PFFA 4KRXA 4PX2A 3TQQA 3W2IA 1HUQA 3G1WA 2O3RA 4KB5A 3ZHQA 1FYVA 4MKZA 3UXEA 5A4IS 1S3FA 4HUQA 1OREA 1EWRA 3BEOA 4FOOA 5FPKA 5BT8A 4YREA 3TQOA 1L6IA 4FDAA 1X9GA 3UPDA 4N41A 3V8VA 5EE9A 4LCJA 4IMRA 3RODA 4DLNA 4C21A 5BN5A 2JI7A 1PR2A 2XZTA 2W8BB 1XO1A 2VZLA 1GRVA 4J7AA 5B1DA 3FTDA 4CHGA 2RMKA 1YKSA 1TZMA 1BA2A 2P8SA 2C9CA 1V3VA 2VT2A 1YB1A 1PT8A 5EQJB 1EDDA 1XALA 3TLGB 4BB5A 2FEKA 4CF7A 1K6MA 2R97A 4JC8A 1E6KA 1RM3A 2Q7DA 2IYWA 4HQ0A 5CIQA 3W2EA 1LB1B 1DS6A 4JFRA 5FAXA 2FPXA 1E92A 1N2CB 2OV4A 3MA0A 4ZU6X 1GLGA 3UJBA 4DWVA 2R5FA 2P3QA 1YL7A 4IIBA 4QODA 5G0VA 3RVRA 5DN6D 7ADHA 2Q41A 5FAKA 1WMSA 3L7NA 3D4OA 2VDQB 4IUBS 1IJFA 3TZQA 2I4OA 4NL4H 2JBWA 3AF4A 3DKIA 1P45A 1W5EA 3THOA 1GPMA 1S7CA 2DFLA 2FLWA 1KA9H 2WSSD 2GUWA 2GPBA 2WF6A 5B2FA 3B5IA 4K0RA 4KQGA 2I29A 5FBHA 3TB4A 3T5DA 1IXKA 3L0DA 2XTMA 2NZJA 5KNBD 4PY2A 2Q2NA 4HT3B 3PDJA 1Y3IA 4R81A 5BSGA 2R48A 1Z7EA 1E5LA 1GL6A 3E81A 5EY5B 1P1BA 4QD3A 2EDCA 4Z3OA 2QMYA 2Q07A 1JTEA 3HBFA 1Z18A 2GLTA 5JMWA 1ZK4A 3LFTA 3HL4A 3PXXA 3ZWYA 4N49A 2BZGA 2X0KA 3EODA 3OJOA 4HS9A 1PZMA 2XMPA 2Y66A 3FZEA 4U5XA 1CQPA 1QIJA 3JQ9C 3LGXA 1XEAA 3P0HA 4R01A 4IV0A 4Q1VA 3Q2KA 1YZYA 2FEWB 4MW6A 5BOVA 3ZYCA 5C46F 2FR8A 2F1KA 1RLIA 4QPCA 3CO0S 3L4BC 5T4EA 1KR5A 4CG2A 3MJFA 2IBTA 1A4IA 2R1TB 1Y1LA 1J7KA 1JBEA 2AOTA 3FSRA 1ODJA 2QU8A 3FPFA 3FTNA 1E8NA 4HLCA 3IILA 4DQUA 1SQ5A 3WMXA 2R8YA 2WW8A 1XA0A 2A9OA 1UAYA 3U9SA 4GP9A 5BW6B 4C7OB 1QV7A 3Q7TA 4TWZA 4KMOA 2O2HA 4OLFA 1CS0A 1RJEA 4QASA 4RIHA 3SM9A 3TQCA 4W8OA 3BFXA 4QYMA 4DBLE 4ZI7F 5A62A 3RAEC 3T3EA 1MX3A 1P7WA 4UFPA 4AJHA 1YGPA 2WWHA 4P58A 4U6SA 2FW7A 4XDGA 2C77A 2QE6A 4Y7CA 5A4AA 4L27A 2FWNA 1KQNA 5IANA 3O94A 3R3UA 1XZEA 4PO8A 5JC1A 5AHXA 1R0KA 3ABRB 3ELWA 5ITZB 1P4AA 2EXXA 4BP1A 4BNDB 1DAEA 4RBNA 4EENA 1B14A 2RGBA 1W96A 2YHSA 1GSHA 3IQXA 4K1XA 2QYHA 4OKNA 4XQCA 5GONF 4CUJA 1ECCA 1UWLA 2YJ5A 2NXNA 4JVLA 3E4CA 4L4YA 5K4GA 4KLCA 2F8LA 2BTQA 2ZDHA 4KPGA 2PLNA 4FYHA 1VI5A 2YW2A 4Z7JA 1PJCA 4R3UC 1LSUA 3EIFA 2OFPA 3IALA 3TNDA 3PDWA 3C6XA 1ZM2A 3F46A 4L02A 4D4IA 1WD5A 1Y4DE 3P5BA 1P9RA 3DVQX 3RPEA 4O4IA 1PI3A 1DRVA 3HYSA 3NPAA 4GZ3A 3D5EA 4NPAA 2R2GA 4G0YA 5C1DA 1Y3DE 1YOVA 3RC1A 5BUZA 1PR9A 3LKVA 5HMMA 4EZIA 6YASA 1DUVG 3PF8A 2J3LA 2F3RA 3TPFA 3EZLA 4YQYA 4DR7B 1QGED 1Y82A 2QLTA 5DNVA 1J2JA 1NURA 4BKRA 4DKXA 4UTNA 4GDFA 5C8XA 2X58A 1XVTA 3D5QA 5KKCA 3WGUA 3QYFA 1GPNA 3I01M 4R68A 3PQFA 1WCYA 3HDGA 3WL4A 4NYIR 4KQ2A 3AKYA 2JBAB 4MUNA 3W78A 5CK4A 4ZA2A 3RH0A 1V95A 2CNLA 1QQ7A 3NHBA 3MUFA 2HIGA 1GGEA 2EU8A 2PD4A 3LDUA 4MMXB 2ZLBA 1SU6A 3BK1A 1ZCZA 2HBYA 2IIVA 1HEYA 2QX9A 5E95A 4GE0A 3IMGA 5FNVF 5C5IA 3TL3A 5H8WA 4YACA 2AJTA 1DNPA 2R6AA 4IZHA 3ZHOA 4YLGA 3B51X 1BSVA 2D59A 2N9UA 3DF9A 5KJ6A 2R7LA 4RIEA 2IYTA 3LO5A 3A28A 3H16A 1I3NA 1UBRS 2O05A 5DISB 1IL0A 4Y2QA 3E22B 4D43A 1B73A 1MGOA 2QJWA 3U19A 3WA7A 2ZI6A 1U2TA 1VE5A 1HDRA 4J0FA 5EERA 3KAQA 1E2EA 4C3VA 4O33A 3A6ZA 4Y2HA 2FR1A 4NMXB 4LV5B 1BHJA 3MJTA 5DN6A 4ZVRA 4EGCB 1MH1A 4K0KB 1X6VA 1SO8A 1XI2A 2OZVA 1X38A 2A0WA 3ES9A 1UQTA 1UDBA 3KC2A 3RF6A 2FR0A 1QSGA 1N78A 4DMGA 4YBRA 5JYCA 5EFZA 4EKYA 1MOQA 3E61A 1Z6TA 4LEIA 4D3ZA 4HDRA 1KTVA 4LJAA 3GRPA 2GN8A 1NFFA 2A8YA 1BC5A 3QV2A 4R1UA 1YA8A 4UW9A 2R68A 2I6QA 4EF4A 4XVRA 1ZK1A 4Z9BA 3FYDA 1WDTA 3EJWA 3WKCA 4DSAA 6LDHA 2Q5EA 3FTQA 3DE6X 1SXHA 1GRQA 1U3DA 5A6SB 2CEAA 1YTUA 2ID9A 3N2KA 3O4HA 4TV8B 4BO9A 4FWTA 4AKHA 1II9A 3E5HA 5A03A 2V3CC 1Z29A 3KQNA 3FF4A 3G2MA 1FYXA 4NEQA 3L0YA 5GM2A 5C8YB 2UXCB 1X70A 3WL5A 2EKLA 2CXRA 3NCHA 1NQUA 4Q0MA 1Z7GA 1KAQA 2YUTA 3DE5X 3R0VA 3O95A 3GT4A 4G07A 4HD8A 4MKIA 4AUNA 4W5JA 1Z08A 2E48A 4H35A 2Z5VA 3GNQA 3OX4A 4R1PA 1BE6A 4M1YA 4ZYUA 3T38A 3OX1A 2EKBA 5CVVA 1C3OB 2FZWA 2IU0A 5KQPA 3O93A 5K0NA 1LSSA 5L9AA 3HCOA 2AEMA 3COZA 3FWKA 5FWXA 3H2ZA 2I2XB 2ZIVB 2Y1LA 1RLMA 2Q27A 1RQXA 1MLDA 1M0WA 1VHTA 3CMMA 3K9HA 4HDMA 5DYNA 5TPZA 4G01B 2PGXA 4O4JB 3SN6A 2DQKA 4GM4A 2EJWA 1F38A 4XLTA 3JYHA 1E9FA 4OHYA 3V2HA 3F47A 1CFZA 2RCNA 3DKPA 3DOFA 5KHAA 3VNAA 2G1UA 3BF7A 4IXNA 2AOVA 1H6AA 4R8SA 5FIUA 4DQDA 4F97A 1B93A 1XZDA 3CY6A 4MO9A 2AF3C 3SXPA 3ID6C 3AR4A 1W19A 1ZN9A 4I4TF 1NXSA 4FUTA 1SHZA 3MS2A 2F62A 1YACA 1Z39A 2VT3A 3EYAA 1IN5A 4ZCTA 5D01A 1MPTA 4KL8S 1ZNQO 4DEYA 1RYNA 5AVJA 3WNCA 1WW2A 2I1QA 5LP6A 5KOIA 4D4LA 2V8OA 2RH5A 3TSYA 1BIFA 2XUHA 5DM1A 5F64A 5A7GA 2ARKA 3L6RA 2MHCA 1JDBC 3OI7A 1IHYA 3RIEA 5A2GA 3RTCA 2OCLA 1DL5A 5GONB 1SXJE 1ZD4A 3Q41A 2XTNA 5BY2A 2RGEA 4XCXA 5LZ7A 2PAFA 4TT8A 4X3PA 3CO5A 3OLVA 4DM4A 1BN6A 2AOXA 1NVXQ 1D5WA 5IN4A 3VZRA 4NZ9A 2M6RA 2X4IA 3IHWA 2GD0A 3KYDA 3THXA 3AVVA 1FJXA 1FUUA 4I4TA 4LCBA 1EFCA 3TTWA 5LYJA 2JGJA 1U0FA 3ILSA 3N2IA 4R7TA 4G25A 4R1TA 2NM0A 4NMLA 1BMDA 2DJ5A 4OKIA 1I0ZA 2ORVA 4RHUA 4A6PA 5J2TB 3UEOA 3NHWA 4AJ4A 1KK3A 3FH0A 1P2VA 1I2AA 2YR0A 2VHEA 2JCXA 2BFEA 2BEUA 3D81A 3PYLA 1D2CA 4HTFA 3SNHA 2H2HA 1AUPA 1SHJA 3QVOA 1GRNA 3EHDA 3NFYA 4OQFA 2AXNA 3MCVA 3ADCA 3T15A 3QOWA 4Q4LA 1HSZA 2XKJE 3IB3A 1RHUA 4X61A 4M49A 2OHOA 4TZ6A 1NG9A 5E4FA 3ZY4A 5CVDA 1B1AA 4EW1A 5K0EA 3L4SO 1RYBA 2GRAA 2VPQA 3P2KA 3ZKWA 3L6EA 4BPRA 1JI3A 1QWOA 3GCDA 3Q0EA 1VHDA 3DOCA 4F46A 2W93A 2CXSA 2BM8A 3LZDA 2YVQA 3H9BA 4MARA 5C8VA 3T3PB 4L6IA 2ZYAA 5KNCD 4Z3KA 3UB3A 4HXYA 2R6CA 4OXQA 5EZYB 2UUCB 4AVYA 3ROGA 3IEMA 4D9IA 1SWWA 4DYVA 2G77B 4RD1A 3T9CA 3RUFA 4E21A 3NC1C 1FXSA 3OIWA 4UM5A 1AUQA 4ZQIA 3GDGA 3VO9A 3P26A 3DDWA 3JQFC 1IHDA 1ZITA 4UTXA 1GZ5A 4X1YB 4Y9SA 4B6OA 5KYNA 3AYZB 4EGQA 1KFEB 4BEVA 1XKQA 1E0KA 3O2NA 4NS1A 3U3OA 5J4VA 3NHZA 2XT0A 4H6VA 4D9GA 3FX2A 2CJFA 5D86A 2JAPA 3SSMA 3L79A 3FZGA 1T5TA 4NX2A 4ECAA 1WV0A 2IXEA 3KXLA 5JU6A 3MRVA 1CRLA 2O3SA 5HZGA 3DE3X 5ESWA 2OMEA 3EUEA 6Q21A 1UKVY 3HWX1 1MA0A 4MYSA 3V42A 3ZI0A 3N70A 2FW1A 2QIPA 1ZL0A 5FTMA 4MPDA 3CRVA 3VR6A 1JDZA 5FUMA 1XEXA 5DKFA 4EYOA 4RF5A 2H00A 4U6QA 3CF2A 5JXJA 3DFZA 1DXHA 3I1YA 4B73A 2WYWA 4R3NA 3CUSA 3IEKA 4ZV4A 3PQ6A 3AEZA 3EGCA 1C1YA 3GNTA 1D8TA 1SIBE 3DJYA 1IAVA 3EUAA 2QAGB 1NXWA 2OR3A 2I6UA 4I9FA 1MAWA 4H1UA 3REQA 4OU5A 2R84A 2YWJA 1D9XA 2I22A 3M1AA 4C14A 4CDNA 4KXWA 4V3CA 3TQSA 2JGMA 2ZRLA 2REOA 4EW3A 1NW8A 4KN5A 5E8RA 4F3KA 2ZRPA 1FX1A 3V1MA 4CR6A 4GU5A 4S1TA 1M8PA 3LPLA 2IEBA 4JLUA 4PLTA 5LOVF 5CDFA 3QKSA 4RZ2A 4S3MA 3INRA 4XPZA 2GCPA 4OYYA 5M7EA 2JFVA 3ZTYA 1Y1QA 4IF4A 2ZRNA 2AWOA 3GJ0A 5JS8A 3UJCA 5ECDA 3TL2A 4ARIA 2DGDA 1GCAA 4M1MA 5HRAA 4XOIA 4WVLA 4BQPA 2HPZA 1Z0FA 2JG3A 4BO2A 1ST2A 2W98A 2Y3IA 3JAWA 3C5HA 1JG7A 2WZBA 2PMWB 4ZP1A 1Q0TA 1MO3A 1ZVMA 3B1WA 3F97A 3NBFA 4MOWA 1DBSA 4UHCA 4XUDA 3X2SA 4EX6A 4L5IA 1L6RA 1K3TA 2HF8A 5EE3A 1HV8A 3EGXA 1RC1A 4WNAA 5EZSA 5H1YA 4X1KA 3S5JA 2M6SA 3SEZA 1GXSB 2FK8A 4P0TA 3LL4A 4B5KA 5ALRA 4I8XA 4BQEA 1MB3A 4IMIB 4ZHQF 3BIFA 1W1WA 2Q3DA 1L7EA 2HT6A 4Q3DA 3B78A 3SZMA 3AI3A 4ZOBA 3KTFA 3O91A 3DM9B 5E2BA 3U1TA 2FETA 1ZGCA 5DCWA 5K8UA 2CZQA 4UDXX 1I2ZA 1AF7A 1RYEA 2V7PA 3Q1LA 4V02A 1UDXA 1O58A 4Y9TA 1YFZA 2LBPA 1CDDA 4RC9A 3TEJA 3PQ3A 4WQMA 4B2IA 3S0JA 2D5LA 3U3ZA 2I7CA 4H2DA 1STOA 2PJDA 4S1VA 2AFIA 2VXOA 4QU0A 5D87A 4RZQA 3DR3A 4DIFA 1BFDA 2X8JA 4RHTA 3GEBA 2FEAA 4US0R 3V4PB 4GDMA 2VDMB 1YRYE 5J63A 3GAFA 3LT2A 5CA0A 1W1UA 3W7VA 4G2TA 4PQYA 1L7RA 1J0EA 4D8UA 1GJRA 1L5MA 2X9LA 3MVEA 3RS8A 1YDWA 3F8WA 1S2DA 4G5OA 1NVTA 2O2YA 1DAPA 2ZULA 5HZKA 1FFBA 2XLBA 4R3WA 3PUVA 2PYDA 4EBBA 1F4LA 3FIUA 2ZCUA 4DIEA 3A1NA 1B6RA 1GKKA 1W59A 1X1BA 1XL1A 3Q7IA 1WP4A 5HIMA 3ICEA 4QPZA 2JAHA 3DEFA 5KTRA 3OU7A 4Y67A 3DBHA 3BMQA 5AVVA 3EMBA 3FRJA 4EX7A 3DPUA 3IOMA 3B38A 3O4RA 4G97A 3CRW1 2CHUA 5H81A 4QOSA 4G6ZA 1AUOA 1BG6A 1FTGA 1EGHA 1KOGA 4I55F 1E2IA 3R9WA 2Y1WA 3A6FA 5EZYF 3EUFA 3L0SA 5JSYA 4UUMA 3GGOA 4CR8A 1EZZA 3C97A 1N7IA 3IMEA 3PCRB 4HEA1 4DNFA 2PS0A 4LSMA 2BELA 1I1OA 3EPKA 3G5LA 3HFRA 4Q4JB 5J1TB 2D6FA 3V8PA 1A9YA 1E61A 2J5BA 4AT1A 2QM0A 3HUTA 3SSAA 1CQJA 3DNPA 3HXQA 1LZKA 4RH1A 3ZIDA 3AKDA 1DIOB 3HV2A 3RD5A 5KB3A 3AM1A 2ZI9A 3EY9A 5IS2A 4IHJA 2F59A 4NFLA 2Q4EA 5DM2A 3DL4A 5B3JC 2HPVA 2HY7A 2Z1NA 3R4VA 4M54A 3FXAA 1R5NA 4DMUB 1IJEA 1C7QA 4MVJF 4XIFA 4ZT3A 3QU5A 1SOAA 4KGXA 5LZ9A 5CFQA 3W04A 1CNEA 1ZIPA 2FUEA 4Q6WA 4BNVA 3KLMX 3KR0A 2PZAA 1VCIA 1SU4A 4B3MB 4O3MA 5AT1A 2EFEB 3KB8A 4JYBA 2I76A 2BH9A 4AIRA 3EQ8A 3WXMA 4ZZIA 2ZJ7A 1HC7A 1JWLA 1A7KA 4H1VA 2V6MA 3E0QA 3FSJX 4RLQA 4UNQA 1D2RA 3N8IA 4XQEA 5DF1A 4EUKA 1TF5A 2Q1XA 5EJ8A 2WD7A 2GN4A 3VISA 2FSGA 3NVMB 1P9OA 4LS3A 4OO3A 1J22A 3OIDA 3D1VA 1CHNA 2JIOA 5HRUA 1UBTS 4Y9DA 2CGEA 1U1EA 4JFAA 4N5NA 5KSOA 2XHEA 3TOCA 2UZ1B 2Y2VA 4RCZA 1U9IC 1Z0ZA 5JS7A 1EBFA 1XUOA 4PSUA 4QPPA 5MN6A 5IAAA 1U1IA 1Q1AA 3BAFA 3N0RA 5ENZA 3FOCA 1NKTA 1OYVA 2PEZA 5LZ8A 2UXBB 1YFKA 3ZQ6A 1N33B 4Z86A 1NWHA 2Q6LA 3OPMA 3OAAD 2YDXA 4R8MA 4BMDA 4ALMA 3B5EA 4DMLA 2XB6A 3CZ5A 4V3BA 3WMFA 5JY6A 1DKNA 3IA2A 3HUFA 3G7NA 1QG0A 2JLQA 1QPBA 4UM9B 2HR1A 3VGPA 1P6QA 4LHYA 3U7QA 4F5WA 4TRNA 2BLNA 4HVCA 2AG1A 1KI7A 3TZHA 2Z1MA 4GLLA 3WLHA 1P8AA 3O47A 3FPGA 4UD6A 2ADMA 4XR9A 3M3PA 5BSKA 1JHZA 2I2DA 3DO6A 3EDRA 3RSLA 3V1YA 5C1OA 4FFNA 1EP1B 3PX2A 4L8YA 3B20A 1G21A 1UP4A 4NBLA 1JU9A 2B5VA 4YAFA 3V2GA 1CP2A 3ULKA 4C78A 4CVNA 4N47A 3K1ZA 3ZD9A 3W2TA 1AIPA 2ZRKA 4C0SA 4XGNA 1YJQA 4MWDA 1O6GA 2E89A 3Q6NA 4R9RA 1N2HA 5B36A 2ZYDA 4AROA 5MN4A 1B16A 3TW4A 1C7RA 3ACCA 3WBJA 1KIAA 1XTTA 2Q2WA 2ECPA 1XXHB 4DCUA 1U8TA 4M0PA 5AM0A 3O8QB 2IV7A 4IQFA 2ZKIA 2VKQA 4ND5A 1XP8A 4HFNA 4URWR 2C7OA 4P93A 2ZAGA 3CLHA 1RAHA 3HUDA 4U7WA 3GQBA 1H2YA 2BFOA 3FSGD 4EFDA 1DXOA 4IHAA 4D92A 1K0UA 4ZEWA 3DBIA 4FLFA 1ISHA 1T1RA 2Y1KA 3D7LA 4RDHA 4RMGA 1JVBA 3IVGA 2ACVA 3ZOZA 4JI5B 3P4XA 3IVCA 1VIAA 1IIBA 1IONA 3DTVD 1I6KA 1KYWA 1UIRA 1TCVA 3FWHA 3G9ZA 3OOEA 4O2AA 4EB3A 2P9ZA 3VX4A 3ZHXA 3I8SA 4Y1GA 5H9VA 4QM6A 2YVAA 4H7JA 4L3WA 4S1NA 4AD8A 2K87A 4UPVA 2GTPA 3FPHA 1T3SA 4UFNA 2XBMA 1Q1EA 1FQJA 2JJ2A 3G7UA 3ZCUA 3I9FA 4P3OA 2MSWA 3HXMA 3HRKA 2SCUB 4YHHB 3IIKA 3PI7A 2Q1YA 2WM9B 4LQDA 1JALA 1YK1A 3A4MA 3EIEA 4JHLA 3EXFB 3V9AA 4DCCA 3K20A 1JSZA 2JGEA 4MRSA 3L82B 5DYGA 3P4UA 4DSTA 4DV2B 4N3NA 4E70A 4KTTE 2O0KA 3FGPA 4RO0A 2YKGA 4LJSA 3W5CA 4AKEA 3TWOA 5LVAA 4QDZA 1AG9A 4DV1B 4MTLA 1DEHA 2A1TS 1V5GA 1QO0D 3O21A 4IRXA 2BJWA 3WB1A 4O2AF 1GTSA 2RAFA 1JQAA 2PN1A 3W5AA 5G40A 3ZV5A 1JMYA 2YXPX 2V5AA 1SNYA 3SBDA 4A16A 1OWLA 3JPYA 3O9ZA 3SOZA 3IV7A 3SLRA 4R84A 4CLEA 1VIDA 2OC9A 3NW9A 3PZBA 2QJFA 3D0KA 3SI7A 3UJ8A 5FO0A 1AY0A 1Q3KA 4DPLA 1WZIA 1NN0A 2OCIA 3H87A 1M5TA 1ZOPA 3VVBA 3C3KA 2XADA 2ET6A 4LV6A 5TMEA 2HV9A 4K6KA 2W48A 4BP9A 2E4ZA 5AJTA 1KDPA 2JKVA 3ITNA 2ORYA 5ALGA 4KYTA 2YJNA 1AC5A 4U0JA 3S28A 3PNYA 4RENA 1LBHA 3DZBA 5PNTA 4FB4A 4MUJA 4B3FX 3K1JA 3RSHA 4F9FA 1JR6A 1HWYA 1UEXC 2C7PA 3F74A 3O8LA 3OCWA 1PKXA 1JVNA 3QLVA 3LTNC 2DFTA 3WO1A 1GGKA 2JAUA 2OG1A 3CLTC 2JLWA 2YJTD 1SOWA 2FQWA 1U8UA 1C8VB 1EFPA 2MWMA 3LIIA 4OOFA 3HVJA 2PZFA 3KEMA 4LRXA 2CF5A 2CEKA 2JGDA 1GTRA 3UHJA 1FVHA 1TM1E 1FRFS 3PFKA 4OJNA 5CX1A 5HS6A 1LS6A 4O4HF 1MHPA 5CLIA 5CFNA 2ZAOA 3PGMA 3VR5H 1ONNA 4WDQA 5LDHA 1DU4A 1IJBA 4CIWA 3COSA 4N76A 2QV7A 2KSQA 4D46A 3D6VA 1FW8A 3EFBA 5KYYB 4KU4A 4X0EA 1R7RA 3D6FA 4WBXC 1IN4A 5DGDA 1TA9A 1R0YA 2GAAA 3GUCA 4FFMA 4G4SO 1FFHA 3VZPA 1E2MA 5JAZA 1TUEA 1UINA 3KTOA 1NJ6A 3FTEA 1G21E 1V48A 4N8EA 1WF6A 4KYUA 2ID8A 3C3AA 4UEWA 1U2ZA 4BFVA 2I2BA 2H4YA 3B13B 3D3WA 1YSCA 4FOTA 4E94A 1YQ9A 3HSKA 2O23A 2EBUA 2DFDA 1DRKA 4HATA 4MPJA 4R0VA 1N7GA 3OT1B 2QU7A 2I7XA 1YD7A 2I0FA 3UJNA 3IE1A 1J5PA 5HBGA 3PCTA 3GBVA 1NXOA 3WJ7A 3BILA 4BNGA 1N36B 4LJ6A 4W1PA 1U0SY 1QYDA 2HPHA 2LIVA 3PNQA 3LIPA 3U7JA 4CODB 4GQBA 4UAUA 3EC7A 1SPXA 5FBKA 4OCZA 3TRDA 2BFDA 2JFYA 3IP1A 1J00A 2R8BA 1T0JB 1T8RA 4PC3A 4RCYA 3TTXA 4NBWA 2ADOA 3HBNA 3AKZA 1YRHA 3QITA 2G1PA 3R5FA 4PHHA 4C3OB 2AF4C 1P7CA 3RBXA 3RYIA 1IJKA 3DLBA 1YL6A 4HB0A 3ZW8A 3GZNA 4JLJA 3EWSA 3P9ZA 1YQXA 4RZXA 3C8DA 3SXJA 4DWOA 2DRIA 2XCUA 3W90A 4RWZA 5ELXA 2PZEA 1XRRA 3G2IA 1ZCJA 3K6JA 1A82A 2GWHA 3LVRE 3N05A 1F2UA 4RULA 4A8PA 4X1IB 3ZS9A 5A4KA 2ZSIA 4F6CA 2FPUA 4IEFB 1OMOA 2VNJA 3M4ZA 4GSLA 4QICA 4OHCA 1GQRA 1N2OA 2H1SA 4OGWA 1CTQA 1TZCA 3MOSA 2C9ZA 1R5BA 4ZJZA 4H15A 4A73A 4PTYA 5CNMA 3WVNA 4CF6A 2JFGA 4J0CA 1EESA 1YR1A 1BW9A 5TV2A 1QZ3A 1Z0AA 2FPPB 1T5LA 2C2OA 2QUAA 2WJIA 3T7JA 4Q1BA 3O2QB 4IOMA 4Y2SA 2FRDA 4OH7A 5KYXB 2VCYA 1EVLA 1YJCA 4G1CA 4NBSA 2I3ZA 3Q3VA 4N1AA 4WLOA 3T35A 3PR3A 2JHCA 2I8CA 3TD9A 1A71A 1K1EA 4L51A 3G17A 1ADGA 1Z4QA 2LZ0A 3E1GA 4EI8A 1NZDA 1PZNA 2HRQA 1R4NB 3U4HA 1B6SA 3LFHA 1ACJA 3JWPA 1CUAA 4L50A 3ZE8A 4G5GA 4GOLD 3HNRA 4BLOA 3DEYX 2XGMA 4HDSB 3HZHA 1I0LA 3NM6B 4NAUA 4O25A 3F7NA 1QH1B 3OT4A 5FULA 1UOOA 3R7DA 2QSYA 4OAOA 1J8DA 2EV9A 2PGJA 3ACDA 3GYBA 4A0FA 5JR3A 2BGGA 2PZKA 1H1DA 4JBIA 5KYUB 5LNK6 5T67A 4IJUA 5CDSA 1KU0A 3OEWA 4OHPA 4DLPA 5KUTA 2FUNB 2B4AA 3DVLA 1RXVA 2PKXA 1R0BA 2K5UA 4BNHA 1EXNA 4HPWA 2ETXA 1UXGA 1UWKA 3A2MA 3MWLA 1L7MA 2KPOA 3GA7A 3KOWA 1Z2PX 4UDOA 1O7JA 2ZT6A 2ZBFA 2K7ZA 2Q2VA 2IV3A 3S6JA 1SOUA 2AOWA 1SKAA 1P1KA 1SVUA 5GV7A 2CXNA 3UJDA 4GMGA 1XTQA 2PGOA 1R16A 1Y7IA 2QSZA 2OT3B 2QW8A 4GG1A 4BRSA 2ZITA 4GKJB 2PZJA 4FGZA 3N5CA 3V2IA 3V1KA 4BXOB 2YXEA 5LNK1 3UCEA 3OZIA 2V98A 3QBVA 3EVGA 1Y8RB 2GYWA 3HSYA 1W581 4M0FA 2DR2A 5J9FA 4EYEA 3UJ6A 1IC6A 3Q12A 3EXIB 3H8JA 4J2HA 1FSFA 1T4BA 4ASUA 3D8NA 5LOVB 4NCBA 3DMYA 1GPH1 4AG3A 4HQKA 2O59A 2OAEA 1AKMA 3AHCA 4M9UA 4LOAA 4P3XA 3CVWA 4JQCA 1F17A 4RW0A 5CA1B 1JN0A 1KFBB 1YS4A 2A84A 2VDPB 5TXGA 1YR3A 3SJ7A 1DEXA 1NQVA 2CZCA 4JL8A 3FVVA 1NVMB 1G41A 4MR7A 2WHPA 5F7OA 4MA0A 1G19A 4MV9A 2EHJA 4TLCA 1S8OA 4ALKA 1JXOA 2EW2A 3D6TB 4N8DA 4C03A 3LI2A 1MP0A 1YZUA 1FX0B 3PENA 2VJAA 3SGLA 3QBDA 1Z37A 4X41A 3IMCA 1I7DA 4ZOEA 2NVUB 3QPBA 5I9NA 4LE0A 3IQIX 1M1YE 2B0JA 2H4HA 3PXAA 4HYTA 4CMEC 5C52B 1S3GA 2Q0QA 3AETB 4C0BA 1U2GA 3TZKA 5B6IA 3OO0A 4HGYA 4D8TA 2LW7A 1PGNA 1L9XA 2XD9A 4OQNA 2QTAA 3G23A 1V41E 2RIRA 4P7GA 3O9VA 4MYTA 1PJSA 1AXGA 3D4LA 2Q1UA 3GCXA 1CULC 2WWXA 1V7PC 2AR0A 1K5HA 4DA4A 3PWZA 1ULBA 2GCIA 3SMQA 1WZNA 2WUFA 2FYTA 3HCBA 4FBGA 1XE3A 3GN2A 2A9KA 1JKJB 4Q3LA 1KU6A 1Q0ZA 1LTQA 2J31A 1V8OA 3F7MA 3KOYA 4TKVB 2FQXA 4JQOA 2PVCA 4HWPA 1I7NA 5DK6A 4TYQA 4CHTA 5CJPA 5T6MA 3CPHA 2ZIFA 2CVPA 4NG5A 1E1QA 3RJ5A 2GYUA 1PZHA 4IH4A 2O4CA 3RUCA 3KFLA 4IKOA 3DDUA 1UFQA 2FSFA 1T6XA 1TKBA 1JH9A 5DWQA 3ESQA 1LVGA 2V3WA 4BEJA 5ILOA 3BXPA 1O5IA 1N5KA 4CQLB 2JFXA 2UUOA 2WAXA 3AERB 4J0DA 1AKYA 1F9AA 2GAOA 4RK7A 1Z7WA 2DF8A 3R0XA 5I4BA 4OX9B 4RPKA 1GA6A 1GG9A 3O3OB 2R00A 3DZ8A 4D4GA 3NUZA 2GN1A 2B37A 2B21A 3N8DA 2X4LA 3PA8A 4I55B 4IRMA 4KFUA 4AF8A 3CXUA 5MGBA 2OGTA 3CUUA 3KUXA 1ZSVA 4KJZA 4Q4HA 2CFCA 4RM3A 1EUYA 1PHRA 2B5WA 2HJHA 2EFHB 3K6RA 2WKQA 5CB4B 3UWSA 4WLNA 5CXSA 3EIOA 3RS0A 1J0DA 1D0SA 1QK3A 4LMRA 1EFTA 1PL0A 2H2IA 1WCWA 3P2EA 3HO6A 1LCIA 3I6BA 4D26A 4KWIA 1NNSA 2HJGA 3AL0C 4KOAA 3BL8A 3MTEA 1V3TA 1EKXA 3WO0A 3ANLA 3F2IA 3BG5A 4XYLA 2AFHB 5AESA 4N5IX 3PKJA 5CPBA 2FAXA 3R44A 3RARA 1HXHA 2DLCX 2JKZA 1K8QA 1RWVA 1Z2EA 1ACMA 2QL6A 2R1ZA 3PFWO 3Q10A 4BP3A 1WTAA 1GNVA 2PSJA 1P6XA 1NNEA 2J5XA 2QPTA 4ZMBA 4QTZA 1PYOA 1KVQA 3K9WA 5BYBA 2P4QA 3QUSA 5HIIA 2ZCJA 2CDAA 1JZQA 1HG1A 1TYDE 2V8BA 3OJLA 3RC9A 4BAGA 1PSDA 1Y9ZA 1XRQA 4F6LA 5H02A 1O1YA 1K0FA 1TYEB 4R1QA 1SH7A 3UH1A 3AYXB 3Q4GA 5BW8A 1YQQA 1SCNE 3Q1KA 3MB5A 3ZVRA 3T1YB 4DV3B 5FNVB 4CLXA 2GILA 5FPYA 4BU1A 1OYOA 3ADKA 3NWOA 3O3CA 1E9VA 2Q9CA 4QOGA 4ZCRA 2JW5A 2RC6A 3OQJA 4HF7A 4DLAA 2X3FA 3KB2A 3KJHA 4ODIA 4OI0A 1LU9A 3P5SA 5C8YA 1GU1A 3BHIA 3TW8B 1M6NA 4J75A 5AW7A 1U6JA 1UJMA 3HXPA 1QQTA 3A6EA 1IIRA 1ICEA 1ZZEA 4KXVA 4LYAA 2A0XA 2QD3A 3PEFA 3E9CA 1UBCA 4DAEA 2AV6A 2B4YA 5TARA 2JA2A 2KS6A 3F6EX 3BCHA 1QGDA 3GCZA 4XYEA 5FV4A 5IHPA 1M9NA 4WZAB 2WYHA 3GXOA 5FOSA 3PQ4A 5JSKA 1F7UA 1SBCA 1LI5A 3JU3A 3NO4A 3A1SA 2EQ5A 4CDGA 4JP1A 3AY0A 1X7GA 2XKKA 4OSPA 2NZ2A 3O92A 2XRMA 1X1TA 5ILGA 5FXMA 1NBWB 4OK5A 1L5LA 5EPEA 4WIAA 4E7OA 4F2GA 4LFAB 4IHKA 4WAUA 3SZ3A 5JQGA 4AZTA 1R8JA 1P80A 2VH1A 3KL4A 2EJVA 3LCMA 4IIJB 1BDIA 2OFXA 2AX3A 2QMOA 4RQUA 1DI0A 2GSDA 2HREA 2WUEA 4J0QA 5DP1A 5T57A 1L8OA 3RFUA 2HO5A 3IERA 1YB6A 4GMHA 1VSVA 3HVRA 2DHQA 1ECLA 1L4EA 2CKMA 1YDHA 3CX7A 4NSNA 3AHHA 1MEOA 3NNDA 5AKEA 1JT2A 1LPAB 1Q12A 5DPMA 3ZWWA 3PX7A 3QVGB 2AXPA 3MWKA 3L7AA 4XB1A 3TNLA 5K09A 1GQSA 5LDGA 1RS0A 1CUSA 1WW3A 5CJ2A 4A1OA 2YRWA 1ZR2A 5IZCA 2GM5A 3DBRA 1Q0HA 3IXLA 1VI6A 2BOVA 1AHHA 1SM4A 2H07A 4EJMA 4TWIA 4G4JA 1V16A 5JWRA 1A2BA 3PB3A 5KNDD 4ZTUB 2FMKA 1UKYA 1W36D 4PLYA 2WUDA 1Q95A 1JQKA 1GFSA 4WX2B 1ZD2P 5CM9C 3W7BA 1T35A 4GYYA 2WB2A 1N5JA 4D6YA 2QB5A 4MITA 1KBZA 5F9MA 1H6CA 1PEKE 1Y1SA 3WHIA 2XYPA 5L3SA 2WF5A 2DUWA 2FJ0A 1I7PA 1WZEA 2HPAA 4YAUA 3AR3A 1P9LA 1CEYA 3F4BA 4U7PB 2QUKA 2XTAA 3DOEA 4PW0A 2GJSA 3L9XA 1FOEB 2FZEA 5IUNC 3NH6A 1HMYA 5JATA 1U80A 3WLRA 5JDCC 4I4TB 1FW6A 5ERYA 3CNLA 3EGWA 5DZSA 1M1UA 2XOXA 3U1VA 1XZLA 2BI7A 3ILYA 4B44A 3QY9A 2WM2A 4EG3A 3ZJUA 3ONVA 3TYXA 3NBUA 4MP6A 4YRFA 1JR3A 1VGRA 2DHEA 3L7YA 5B2EA 5DGIA 1S8NA 1DRUA 4BNZA 3ZE0B 1J0CA 3R1IA 4BX2A 1Y4AE 5DYYA 1CDOA 3EAQA 2BFEB 3PFBA 4G86A 4J9VA 1XCOA 1VDMA 1ZJJA 1RVV1 5F5NA 3K1AB 3VZCA 4AC9A 4A0GA 4A4DA 1TM7E 7YASA 5IKMA 3LQ1A 4J1SA 4MJLA 3M6MD 5AKGA 4C5CA 1B26A 4XIJA 1A1SA 4B31A 1NBMA 4EO4A 3KWJA 5CFPA 3FKJA 2PFGA 4A6EA 4EWLA 2J0EA 4W99A 2M98A 3NT5A 3BDIA 3UQZA 5L3QB 3NGMA 4G5RA 2J0SA 3SEFA 4ICIA 3LHKA 2NLOA 4P33A 5ALWA 5BN1A 2CLFB 1O0SA 2PGAA 3HR7A 3OJCA 1G8SA 2RI0A 4PO1A 5DV9A 5K3CA 1MT0A 1ULZA 1XZKA 3ZV3A 2WJYA 2QRLA 4G89A 3PU6A 4MJXA 4U2KA 3LUFA 2RK6A 1LQTA 1PIWA 1FZTA 4ZDJA 3RC7A 1CUJA 3IV9A 2GX6A 2E55A 2NU7A 3RVBA 2Z9BA 3W2FA 3WGLA 4C0KA 4V1CA 1Z7BA 3SD7A 2ZS7A 3JQAA 4RAQA 4P0PB 1VE9A 3IJEB 1SD1A 2RJNA 2VT6A 1QOZA 4TX1A 2QT1A 4OHZA 5IEJA 4TMXA 2C96A 4GM0A 4XM2A 4ENPA 1J9ZA 2Z8YM 4FEYA 3G0HA 5JG7A 3EZ9A 3L7LA 3LMKA 5ALFA 3UIEA 1QOPB 2GXAA 2Z1DA 1P74A 1XL0A 1H05A 2C2WA 2O2GA 2VA8A 3ODPA 4LGYA 4AZ0B 4CTKA 3HA5A 1UFOA 4EH1A 1TAGA 1DKQA 2JDID 1JG3A 3AI1A 5KVVA 4TYWA 1NNI1 3M3HA 4L5JA 2VTBB 2BC9A 1SN7A 2PKQP 3BJZA 3H9UA 4JX8A 2BUBA 4KQJA 4LAFA 4K9SA 5ECGC 4F85A 1D1TA 1XLUA 2O1XA 2OYSA 3FDZA 3G0DA 4ECEA 2VJCA 2E82A 3OHPA 1TGVA 2RGXA 4BMVA 5HIJA 1ZS9A 3ETNA 2UYYA 5MFZA 3JTMA 1HH4A 2UVPB 2GMWA 2IEZA 1C30A 3E7WA 4P2GA 3AP1A 2JAWA 4LY9A 3UHOA 2BR3A 4WH0A 5GJWC 1G8GA 5T8KA 5J58A 4QDKA 2YUIA 4QJIA 1Y6ZA 1MUUA 4XCQA 2W9XA 4MWBA 3AJDA 4LYDA 4P36A 1DWQA 3EDOA 2R8OA 1ZI9A 2G04A 1VMIA 3DGEC 1SZDA 2X1VA 1L4KA 1QS0A 1TOAA 3U4GA 2WJ3A 4BHTA 5IJ0A 2ZYRA 3C3XA 3MK31 4XB2A 2C03A 3GROA 4PYNA 3G3EA 4V0LA 5AJWA 3OZVA 4NNPA 3RREA 2I7VA 1WXGA 2Z30A 2JBHA 2FPKA 4A2WA 4BQRA 3G2JA 1PL6A 1W8DA 3HACA 3N86A 4JKYA 3QWIA 2A1IA 1ZK3A 1C4XA 3GDOA 3PL1A 1T0UA 2HF9A 3HYCA 1LLQA 2YBEA 2PUCA 2QYTA 2RHJA 3L7DA 4OIFA 3H8VA 5GJCA 3OTHA 2YC2C 1UDCA 3WDKA 3ZS8A 4DARA 4AO6A 2G06A 1ZC4A 1CT9A 1JRLA 2G1JA 4CTOA 4F3RA 4BX3A 3CSDA 3NS7A 3PE3A 2AJDA 4QOEA 3T0FA 1N4AA 3I8OA 1IHUA 4HKTA 2YV4A 3HCRA 2TYSB 3LHSA 5JNVA 2Q4TA 2WAMA 4XPIA 1MOSA 2DULA 2ZB4A 3LLMA 3CLRC 4K2AA 4M6WA 3JAWB 4BWFB 4EKDA 5EJ9A 3HTXA 1SCUB 4G8JA 1UM9B 4MVJD 2XPCA 3FBGA 4OQXA 5DGHA 3RT9A 1DCKA 3IA7A 1ZD9A 5B53A 3GFSA 1R8YA 3S2EA 1ADYA 3FF1A 3WLKX 1CYEA 3TJMA 3CF6R 3NIGB 4DIDA 4E5UA 3ITDA 3QUBA 3S8YA 4OBBA 3GF4A 4IJ5A 3IKLA 2XQVA 5FI1B 4KRFA 1QGZA 5F77A 4JLOA 3MJ4A 3FMIA 1C1HA 3TTSA 4I99A 3WYEA 1RYMA 3F4KA 2C5LA 5CVEA 5JCZA 2RHWA 1E3WB 2AX4A 2HMYB 4RVSA 4GX2A 2PMBA 4CW7A 3K9NA 3FIJA 1EM8B 5CVTA 3K6KA 4BNMA 3W8RA 4PNEA 4MROA 3GGCA 5G2OA 4CIAA 4BFYA 2LCIA 3I0NA 4DBLC 3ABZA 2PZMA 4C9BA 4E4TA 1MQ8B 2E4WA 3QLEA 1UODA 2O8VA 3QHPA 5IXSA 4IKPA 3LU1A 2OAP1 4A5OA 3GNLA 4A15A 4PE5B 4QHTA 3VA7A 2SKEA 2PQ6A 1JLSA 4AP6A 4NXNB 4XW2A 4I19A 2AD5A 2ORWA 3OIFA 2QM8A 1F0YA 3BJIC 1QIDA 1RRKA 1FFDA 1ZH8A 3M2PA 3CX6A 4C6TB 4W5HA 2VP5A 1OSNA 2HRZA 1MH9A 4ERNA 5F7JA 4D3SA 1PVVA 3ZXUB 3MWGA 3WQSB 2OENG 2XYQA 4HNQA 2FP4A 3TRHA 1H3FA 2NOAA 4AJJA 2F4VB 3Q11A 1U31A 2XAAA 4S24A 3BJRA 4ZVTA 1D4OA 1FXWF 3OQIB 2C1XA 1SXPA 3BMQB 1D07A 2QZ4A 5I8WA 3YASA 3L46A 1HO3A 4CLRA 1DC7A 4MV4A 4M9RA 4MCAA 3EVEA 4EGFA 1T91A 2C5GA 4M1SA 5IXYA 3W5IA 2DOKA 4OSOA 3ROKA 1KSFX 2Z6UA 1HE3A 4PONA 3FNFA 4WA8A 1RC8A 1PEAA 3F3YA 1E5XA 3FAZA 3O0TA 3O9MA 5IC6A 2C78A 4IJMA 4UCQA 2VXYA 3UK6A 1KMNA 4PYLA 2V55B 5U4QA 4BPBA 4MCJA 4NTZA 3RFCA 1UPUA 1TEVA 1IK4A 2C3UA 2V9CA 4GC5A 4U02A 1H4TA 3HEBA 2QMHA 3K15A 4DDHA 2J33A 1KEPA 1X19A 2II6A 1KI2A 1QDLB 1VIMA 3MQ4A 3SDSA 1QORA 3M49A 1JTFA 3OCCA 3OT5A 1O9GA 1QRDA 2OLEA 4JJ8A 3JYOA 4F3CA 2E6UX 2JGNA 5KHLB 3T1VA 1Y37A 3I28A 1JHRA 2H4ZA 4Q1FA 4FP9A 2WSBA 3KXDA 3M33A 1SELA 2JDIA 4X7RA 3OOHA 1J70A 2IUUA 2NXEA 4ZO6A 2ZBPA 4FBLA 1RHRA 1P8JA 4MVCA 4Y2RA 1IM5A 2ZBRA 3MTGA 1RM5A 1EFRA 2ZFUA 2JJQA 2AIRA 4PIVA 4AJIA 1H2RS 3NRJA 3TSWA 3GC6A 1I6MA 4TN5A 5T6BA 4Q1CA 1S8FA 3JQAD 3SXUA 4DS3A 2G80A 3FFBA 1UBSB 3EZYA 5LP1A 5U4XA 2XCOA 1TFRA 4F2WA 2ZQ5A 3ZLTA 1PUJA 3ZD7A 2IOHA 2FN7A 3GN1A 1OTXA 4FI3F 2ATXA 4FDVA 2DX7A 1CJMA 3U48A 3LCRA 1NR1A 1U2SA 1Q22A 4S05A 3ADDA 1XNGA 5AYVA 3WHKA 4A7PA 2VLBA 5DTQA 3LV8A 1BKDR 1DHRA 1E58A 2JJMA 4IM7A 4MI1A 3S1AB 4E6PA 2Y68A 4A6XA 4YCCA 5HVNA 5HNKA 3HV0A 3THYB 4GRDA 5FOWA 5JSZB 4GVPA 4ESHA 1G0NA 1W4LA 1TO1E 3PE4A 4U2BA 5FOTA 1Y3BE 2IYVA 4KGDA 1RI4A 1YRQA 3EQ2A 4Q82A 2EQAA 5E1MA 3TGWA 3PTLA 3IDSA 5E9QA 3S29A 3X1XA 1XJQA 2CFOA 1LV8A 3ZZNA 4BDTA 1ZGAA 5H83A 5B7PA 4HAWA 2G4CA 1TCAA 3NP9A 5YASA 4B34A 2YZ7A 5FB3A 3I9V6 2FZLA 3HMQA 5C7LO 1K86A 1D4FA 1RZ3A 2ONKA 4KQ6A 1HE5A 3KFXA 4MMZB 4XB6B 4F5DA 2JC3A 3F73A 2Z3ZA 4HCJA 2HF7A 4NRDA 3T1QA 5AIAA 1MX9A 2KJQA 1BFKA 5JW6A 5LKAA 1V47A 5B4UA 3QXGA 4IIFA 3VDMA 3VKUA 4Q1EA 3WIEA 3WNZA 2FZGA 2VPPA 3QKIA 2CKDA 1XJCA 2HIMA 2V03A 4JBYA 5DJ5A 3KQUA 3ZDAA 3CZQA 1B8UA 4QTYA 2J48A 3PTZA 3K0FB 1VPWA 1RKXA 1UBUS 1M76A 2PX2A 2QTZA 3TLMA 4RVGA 4D56A 5AKIA 1EWQA 2P2SA 3NKLA 2BJHA 3BE8A 1R6VA 3O82A 4BBPA 1T10A 4U2DA 2H0RA 2QQFA 5E3IA 1ZUNB 2Q6VA 2VF4X 1OPXA 1THTA 2ZW9A 5CG1A 2VPIA 2EKQA 2FFBA 1L5WA 2A86A 1YC5A 3LWNA 1G9XA 1A9PA 3L7IA 4KXUA 4HNVA 3MINA 4Y9RA 3S2SA 1G2OA 3R7LA 1SPBS 4HWOA 1WO8A 1GRRA 1ULAA 2G83A 3A6GA 3UXYA 4WOKA 2CL0X 3C5CA 1LGYA 1KI9A 1ZRMA 3JY6A 5J4LA 3DE4X 1RFLA 4IDGA 1H22A 1JGTA 2IDJA 2P68A 3H04A 3JATB 4WY8A 5FLXA 2XODA 3QENA 5CIWA 2Y67A 1FFYA 1XU7A 3O03A 4WK0B 2DH5A 1TW3A 4UFOA 3C14C 1QH8B 2PM8A 2ZUSA 3ZE6A 1PBNA 1G7RA 1NTRA 4KIUA 1PKEA 4E51A 3NAZA 4BC1A 3MUEA 4M1EA 4S12A 2AUTA 3VPDA 1PX2A 3HXOA 1GZDA 1YKFA 2HA5A 1FP6A 4EIWA 3KEQA 2J59A 2HK6A 5LBUA 4RHCA 3U3MA 4C4PA 3TTUA 3ITKA 4E5SA 1P1IA 3I04M 4ARBA 4BVFA 1HDIA 3HUEA 2I62A 3M6XA 1RI2A 4FK8A 2AEFA 4P7JA 4U1RA 3RC2A 3ZTTA 3LVBA 3EXHA 5LC1A 3UBTA 4MRMA 4IIDA 1JAXA 5I01A 3EG9B 2WHEA 4LZJA 4RK4A 3AH8A 3FJ1A 2FZVA 2PL1A 3RAGA 1PS9A 4C4SA 3WK7A 1KZ9A 4BQOA 1FP7A 2IYAA 3C7TA 1G5HA 4JASB 4FLEA 3COWA 3IT1A 2BP7B 2PUWA 4YJGA 2GJ4A 3KETA 4LZLA 5EIOA 2PS9A 2BWJA 3M6VA 3LUGA 2XDQB 4MAAA 8GPBA 1OGJA 1WCV1 1DWOA 5AM3A 2WY2D 2ZBUA 3DGFC 3ZHCA 5LA6F 1ML4A 2C4NA 3QK7A 1V0JA 1DC4A 1XWFA 2VDLB 5DTRA 2DH6A 4N01A 5K3EA 3W6OA 3NTVA 4BNIA 1QHHB 1KWGA 4ZT7A 1S4MA 2CB9A 2OTCA 3LAWA 2J46A 2GK3A 1DJLA 3WLIA 4QO7A 5BSVA 2XF2A 2YHUA 4DDVA 1GPBA 3MAAC 3ZV6A 4KVAA 1QFSA 1JR3D 2C7VA 1WVGA 3CZ4A 4C6HA 3ZU4A 4F3YA 4RM2A 4H17A 1QB7A 3DZKA 4BGUA 1WSBA 1OD6A 2MR5A 4FHFA 1VRCA 1RKVA 1U99A 3L06A 1G42A 5LN1A 3HU1A 4ZDIA 1QVAA 3PC8C 5E1DA 2JFHA 1RXWA 1IULA 3VR6H 2R7MA 1YR7A 4H7PA 4BO6A 3K35A 4ZODA 3TN7A 4D44A 2JASA 2WR8A 3UB2A 2D5BA 1TRHA 4BLRA 3A1WA 4TWRA 5AVQA 2NAFA 4QFCA 2GZ2A 4G0WA 1II8A 3FUUA 2PNFA 5ESXA 3ZEIA 5JJLA 4II2A 4OSEA 2R66A 4ND6A 4M9ZA 3CX4A 4WE3A 2CF6A 3ZZ1A 3EA4A 5KWIA 3D7RA 5A9SA 3M4NA 3UV7A 1I7QB 4Y1RB 3DD5A 4ILKA 2WSIA 4D5EA 4G9BA 3B1KA 4D0RA 5TEVA 1K75A 3LM8A 1RZUA 3IHLA 1GGNA 5HCIA 2IUTA 4MGIR 3RSGA 2IF0A 4RLFA 5BURA 2I7DA 1KS2A 3T52A 3ND7A 1PJBA 3R7AA 4B6PA 5I7SA 1H94A 5I5GA 2AEJA 3NLLA 2WPDA 3O2SB 3ZCTA 8AT1A 8MHTA 2G1KA 2Q2QA 4JJFA 4DNXA 3MBKA 3OKAA 3F4LA 3HB9A 3T5AA 3BHJA 1V37A 2BGTA 1L7PA 4PYRA 4CMCA 3OHSX 2O19A 1Z7YA 5DB4A 3I2GA 5LM3A 3HB0A 5CLQA 1COZA 2Z83A 3AL2A 3IVAA 4WNYA 2RGRA 3MTJA 1ESDA 3BX1A 1PNOA 4LMAA 1OXMA 3T5GA 4J7XA 2SKDA 3BK7A 1KYYA 3IQDB 4FT4A 4MHOA 1E6EA 3SM3A 4X7MA 4QGFA 5GGYA 1OH5A 4MDFA 1XP5A 3QVKA 3DG9A 1ADBA 1Z4NA 2ZJ2A 2H4XA 1QBKC 1COWA 2JIMA 1OWMA 1USVA 4JLBA 3ZW9A 1T36A 1T5DX 4M0KA 5EYPA 1N2BA 5BRAA 2IU3A 4KX3A 2VUSA 1E64A 3W3AD 3UMMA 1H1LA 4MWSA 4AL4A 5KYTA 1YNSA 1N6OA 3OJFA 4K9RA 5COBA 4M60A 3JCZA 1Q1NA 3CRRA 4K9MA 4WKNA 2C7BA 1NI5A 3WLFA