1DQZA

Crystal structure of antigen 85c from mycobacterium tuberculosis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
280
structure length
280
Chain Sequence
RPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ANTIGEN 85-C)
publication title Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines.
pubmed doi rcsb
molecule tags Immune system
total genus 102
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dqzA00
3L1IA 2XUDA 5LYYA 2I78A 3WYNA 2BKLA 3AZOA 1YSCA 2G4LA 3HACA 5LLSA 5D7BA 4CIBA 5D3ZA 4UHDA 2JGEA 1CUCA 1U4NA 3AZPA 4J0HA 2EDCA 1UOPA 5JAHA 1QJ4A 2GZRA 1XZGA 4BYMA 2BAGA 3DD5A 1YAJA 2X8BA 1QIMA 4BP9A 2ZVDA 5ALWA 3C87A 2WIKA 4KE7A 3WWOA 1CR6A 3VJLA 3WZMA 5DLPA 4CG3A 2XMZA 5EIEA 3VISA 1H23A 1VKHA 1XZBA 2PVSA 2GYVA 1D07A 1EVQA 3M3DA 1R50A 3WMRA 2O2HA 4QDOA 2XQIA 3FLBA 4DSAA 5K5EA 2WTMA 3LIPA 1P0QA 1XQVA 1VZ3A 3C8HA 1EK2A 4EHBA 4NZZA 5JZSA 1DWPA 2XMCA 4DYHA 1AQLA 1A8QA 1NU8A 3WWCA 4L9AA 5HFNA 3S2ZA 1F8UA 4LXGA 4DMKA 2HIHA 5HQ3A 2Z3ZA 2ACEA 1K4YA 3W2TA 2J3QA 1UZAA 3ICVA 2OCIA 4FOLA 5AK4A 1GKLA 3WLAA 1UKBA 4TGLA 1GPLA 4H7KA 4UFNA 1Q0RA 3ED1A 5CH3A 3HXKA 4B7ZA 5LZ7A 3STTA 3BDIA 1QIIA 2WU3A 5IH7A 1R3DA 5AI5A 3FOBA 4IO0A 2D0DA 2WJ3A 5DNWA 1DX4A 3I28A 4X94A 5C8VA 1MNAA 3VJKA 3WKBA 4UUQA 1JJIA 4KAFA 1ORWA 1UK7A 1AURA 1OCEA 2OQVA 1GPKA 3WI7A 3DKKA 4PNZA 5FDFA 1CUEA 5LZ5A 1KU0A 4C4ZA 2QXTA 1XLVA 1L7AA 3SWWA 1WPRA 1TCAA 3F67A 1CUVA 4UBOA 1QFSA 4M0EA 1Q83A 2EEPA 2D5LA 5K3EA 4FMPA 3WL5A 4CCYB 2WUFA 2VEOA 5LIPA 5AK3A 2Z3WA 5HFAA 3HRHA 1ZJ5A 4OSEA 3VJMA 4M0MA 5CT5A 1C4XA 3O4JA 4W63A 3D2CA 5ALGA 2XMSA 2UZ0A 5CURA 3WIBA 1M33A 4A5SA 5HK8A 2OAEA 4BDSA 4AXBA 3K6KA 3HZOA 4DSZA 1KU6A 5A62A 3PF8A 5DJ5A 3R3ZA 4BC0A 2XUHA 3A70A 5AI8A 1ZI6A 3STWA 5H3HA 4B81A 1SCKA 4BAZA 3PFCA 3EIOA 3BIXA 1E8NA 1Z68A 5AI9A 2QXUA 2RHTA 4GBGA 4C4YA 4J3JA 1MNQA 2C4HA 4JH0A 2Y2VA 1XQYA 4G4JA 3E1GA 5LZ4A 1CUGA 5A7GA 5EFZA 5DNUA 1WPXA 4BBZA 3WKAA 1QE3A 1SCIA 1QGED 2CBGA 1LPBB 1BCSA 2CB9A 3ZLUA 4EUSA 1CV2A 4U2FA 3WA6A 4UFOA 5AM5A 2IIVA 1WHSA 3QZUA 2K2QB 3CN7A 4CCYA 4BVKA 4UBJA 4INZA 5AO9A 2AJDA 2PUJA 2WIFA 2RONA 1UKAA 4QEKA 2ROQA 4P92A 5ISMA 2BCEA 1QFMA 2O2IA 1CUZA 6YASA 4QDTA 1JT2A 2G5PA 3F98A 3PDCA 1AX9A 3E3AA 2XB6A 3OTQA 5DWDA 1IUPA 1FFCA 2QZPA 3GZJA 5FV4A 1MTZA 4G4GA 2Z8ZA 4LKOA 1UOOA 4G5XA 2DSNA 5ALRA 2JGIA 4J7AA 3QMWA 3C43A 1UFOA 5ALXA 1LPAB 4Q82A 5ALLA 2PSHA 4GI1A 4MEAA 1ODTC 1IZ7A 3G7NA 5FKJA 3WZLA 4Y2TA 2G5TA 4H0CA 3H2GA 4XJVA 3ESBA 3BIWA 4KJXA 3FWHA 5EI5A 1VXRA 4G8BA 3WL7A 2DHCA 3TJMA 4UFPA 3G8YA 1J06A 1NU6A 5ALMA 3B12A 1YR2A 4OPMA 5FLKA 4RE5A 2WG2A 2Z5GA 3QMMA 1IVYA 5JAUA 1O6FA 3FCXA 3O4IA 1AGYA 3QBJA 2DCMA 1MU0A 1YASA 1CUDA 2Y2UA 2C5GA 5CMLA 5JASA 2XMBA 1LPNA 2RHWA 3OG9A 4HXEB 3WL8A 3GROA 3H18A 3I2HA 4EY5A 3QPAA 3M83A 1P0IA 2HA2A 3QYJA 5AI4A 4P9NA 3IURA 4KRXA 2WKWA 5E2IA 3SK0A 4YK7A 5AKEA 4Q3KA 3WA7A 1XLUA 3O4HA 4RGYA 4X6UA 4OB6A 5AKHA 1W4LA 4BZWA 3STVA 2CJPA 4AN0A 1R88A 5JARA 5ALZA 5JAOA 5JANA 2XQGA 5C7YA 1VOTA 1E8DA 2HADA 2BFNA 1ZI8A 1K63A 4FNGA 4WCVA 1LGYA 3W06A 2WUGA 4Y2XA 5CT4A 4X97A 3UUEA 2I03A 2WFMA 2W6CX 1XZJA 1JU3A 5K3AA 2QJRA 2LIPA 3HEAA 3BL8A 3GUUA 1LPPA 1G66A 1YA4A 4ZXFA 5ALPA 2H7CA 4BC1A 2XQKA 3DLTA 1U2EA 2C7BA 2XDWA 3EQ9A 4B9AA 4G1FA 1THGA 1ACLA 4BCBA 4MYSA 2WLSA 1VZ2A 4J0GA 2WIGA 2XLCA 2VJBA 1CPYA 1MX5A 4Z49A 5A6VA 5AI0A 3WKDA 3M82A 4N8EA 1GT6A 3U0VA 2WFZA 3JWEA 2H9YA 4CI9A 1O6GA 5JADA 1DQZA 1UOQA 1EHYA 4Y2JA 1S8OA 1A7UA 4IH1A 5AOBA 1JJFA 1BS9A 3U1TA 1YA8A 2XUIA 3STXA 4UBMA 4C88A 1ZIXA 4W1SA 3C70A 4XIIA 3KWJA 2DQYA 3O9MA 5C81A 1R9NA 4DMHA 2QJWA 2V97A 3F8SA 2AJBA 2JGJA 4QA9A 5FPQA 4G8CA 4PSCA 1MO2A 2PM8A 4AMYA 5JAPA 3F96A 3V9AA 4HZGA 3BF8A 4H35A 4XWGA 4TVKA 2HU7A 4BB0A 2HRQA 3UUFA 1LBTA 4BAUA 4B85A 2XQJA 3ZPXA 3GBSA 3HI4A 5ALDA 2QOEA 4E11A 1VA4A 3WL6A 1GXSA 1JMKC 1CQZA 2GYWA 5HK9A 4RPCA 4QLAA 1XZLA 5DYTA 4OD0A 5EIAA 4D9JA 4FNMA 3KWFA 4WFJA 1DX6A 4Q3LA 2HA0A 3DS8A 2C58A 4WDRA 2XUAA 5CRIA 5HF6A 3TRDA 4GWLA 3HLKA 3KDAA 1SOMA 5ALFA 3RARA 4Q34A 1WM1A 2CKMA 3WJ2A 4ZRDA 4H7JA 2YXPX 2JEZA 1H2XA 2V9ZA 4KEAA 1MN6A 2ES4A 2OGSA 3FLEA 1MPXA 1T2NA 1TKRA 4PO3X 1ACJA 3BJMA 4I19A 1HBJA 3D2BA 2ZSHA 4BRZA 3GFFA 5FPPA 5IKXA 4WDQA 1XZKA 4C01A 4P93A 2Q0XA 5AH0A 4H7EA 5YASA 3RKSA 4ZWNA 3BF7A 3DOIA 1BN6A 4J0IA 5K3FB 3H17A 3A2NA 2R8BA 4GW3A 1DINA 1QOZA 2FJ0A 5HZGA 2QMQA 5D6OA 4FWBA 1ZGCA 1YAHA 2PL5A 1GQSA 3FYUC 4BDTA 1UWCA 4U2BA 1EB9A 1OILA 4DGQA 3IB3A 1XZFA 2OQIA 1YS2X 4EY6A 3SX4A 1AUOA 5IVKA 4K6GA 1FFDA 1U65A 4H77A 2OXEA 2VJDA 4NS4A 3WK8A 2WUDA 2XMDA 4PSDA 1ZD3A 2CUTA 1FFEA 4L3WA 5KBYA 3TGLA 3DL7A 5HKBA 1B6GA 3WK5A 5EHZA 1YB7A 2ACKA 4EBBA 4XX1A 2R11A 4FFWA 5JD5A 2QM0A 1UK6A 4BTLA 1YB6A 4CFSA 2WHRA 4WY5A 5BV7A 2P8SA 3KD2A 2GZSA 1CUFA 5LZ2A 1C7JA 3R3WA 1XQXA 4WJLA 1E66A 2Y6VA 4FHZA 2Y1KA 5AJHA 5I9IA 1GZ7A 3KXPA 1U8EA 1PV1A 3H1AA 2BUAA 1W75A 5K3FA 1IUOA 4DNFA 1CEXA 5KREA 4FLEA 4UHHA 5BWCA 5AKJA 2XUQA 3EBLA 4BCCA 1QO7A 4ARAA 1AZWA 2BGNA 3CXUA 4X95A 3IUQA 4Y2RA 1Y7HA 4QWMA 1XRMA 3I2IA 5HF9A 3V1KA 2BUBA 4MJ3A 3IUJA 1CFJA 1EH5A 4X93A 5DTIA 1QIKA 3ZV7A 3FCYA 5AKZA 1QZ3A 1EA5A 4QLOA 5LZ8A 3R3XA 4B0OA 5CT8A 1QIDA 4ZGBA 2ORYA 4PV7A 2XMRA 4NMWA 4UBIA 3QH4A 3IDAA 5ALJA 1J2EA 3HJUA 5ALNA 4QE3A 4ARBA 1J07A 4LXIA 5AM0A 1MAHA 1XQWA 4B82A 3G0BA 2JBWA 1W52X 2WIDA 4F0JA 1LPMA 3PUIA 1TK3A 4PSUA 2YASA 3I2KA 1QTRA 3STYA 1ODCA 4HRXA 4X92A 2PU7A 4HRYA 2HM7A 3FVTA 4EB0A 3BJRA 1OXMA 2ZJFA 3QPDA 1LBSA 1K8QA 4K6KA 1LPOA 1LZLA 2HA3A 1H22A 4OU4A 1EINA 5BOVA 3ESDA 1RP1A 1EXWA 1N5MA 3AUKA 3T4UA 1AKNA 1MT3A 1JFRA 4DNPA 4X90A 4K5QA 2RGUA 4K2AA 5ALUA 1L7RA 4KRYA 3DEAA 3H2JA 3AILA 4AB1A 4OB8A 3LP5A 5KWIA 1XRPA 2H7XA 3LS2A 3IBTA 4J0JA 4HVTA 2X5XA 2OPHA 4WFKA 4RE6A 1W1IA 3G9XA 2VTVA 3RM3A 5AM2A 2FJPA 4MQMA 4KAAA 5AKLA 4OB7A 4X6YA 4B84A 1CQWA 4FLMA 2PU5A 3UMJA 2C5FA 2ZSIA 1N1MA 2DFPA 4HS9A 1PFQA 4Q3OA 3ICWA 1RYYA 4N8DA 3PI6A 4CG2A 2O2GA 2WUEA 4X00A 2XUJA 4G9GA 1R1DA 4L72A 5AKKA 4FBMA 4ZI5A 1BN7A 5HCUA 1WB4A 4KE8A 3QVMA 3L1HA 3M81A 4UBKA 3L1JA 4JUIA 1HLGA 1MJ5A 1QIEA 1QIJA 5SYMA 5E4JA 2ZJ6A 2WJ4A 4AX4A 5LP1A 2PBLA 4FLFA 3FVRA 3DYVA 3EF3A 4AMZA 4WFIA 5CTAA 3ZI7A 1PJAA 1TQHA 5EHNA 2VQ6A 4FTWA 2PUHA 2FX5A 2V98A 3WK9A 5CW2A 1BEEA 1AMNA 2XUGA 3DNMA 2HRRA 3FYUB 1G5FA 5FP0A 1A88A 2QS9A 2VATA 4IH4A 1XKTA 1EVEA 1EI9A 5A7FA 3H2IA 3O4GA 4KR0A 4ITVA 5HF8A 3S8YA 3IIIA 4UBLA 1VE7A 4YPVA 1CUJA 4DTCA 2HA6A 3QMVA 1CUHA 4BE9A 4CIAA 3P2MA 5BWBA 2JEYA 5T4BA 3WWEA 1G4HA 1JKMA 3GELA 1IMJA 4H18A 3BDVA 1BRTA 1H2WA 2PPLA 2E3JA 5IVIA 4Y2QA 2ONCA 5AM1A 4MWSA 4KE9A 3K2IA 2VJAA 1VE6A 2HA4A 4J0CA 1USWA 2H1IA 2HHAA 1QO9A 5AI6A 1BU8A 1KEZA 5AOAA 3G9ZA 4O08A 3FAKA 4F5ZA 4EY8A 5IVHA 5ALQA 1FJ2A 2J3DA 1LZKA 4B83A 4JYMA 2JGMA 1QIFA 5ALSA 2DHEA 2GBIA 4Y7DA 4Q1VA 4N8SA 5IVDA 2JF0A 3WK4A 1FSSA 2C0PA 3I6YA 4H7DA 3R0VA 1XZCA 1R9MA 4PW0A 2XE4A 3NWOA 2I3ZA 1F0PA 3T52A 3WK6A 2VA9A 4LXHA 3C6YA 3ILSA 5F4ZA 3FYUA 1VLQA 2XI4A 2HL6A 1TCCA 3OURA 5T4EA 2IITA 3D2AA 4W1RA 1TRHA 3AFIA 5AKXA 2PX6A 5EIHA 3I2FA 1K6EA 4U2CA 2I3DA 3PICA 1WCYA 4E15A 3IA2A 2HA7A 3WKCA 1JU4A 2PSJA 5I8PA 3WQHA 2OGZA 1E3QA 4CG1A 4CCWA 3G0DA 4EY4A 1XZMA 3B5EA 2RIPA 4HAIA 1F6WA 3A6ZA 5LKAA 1HPLA 5ALVA 1RWQA 3Q8WA 4P08A 5EHXA 3VXKA 4G4IA 4N5IX 2XUPA 3FSGA 1IZ8A 2JIDA 2OLEA 2NW6A 1EK1A 5ESRA 2O7RA 2QVBA 2OCKA 4FFVA 3E0XA 5HKAA 3V1NA 5ALYA 2Y6UA 5AK5A 1XZHA 1JJBA 5AM3A 2VSQA 1DWOA 1FFAA 3BE8A 4Y2YA 1DWQA 1BROA 3HSSA 5EGNA 1CIJA 3C6XA 1LPSA 1GGVA 1AC5A 5EHQA 3MUNA 3V48A 5KWJA 1E8MA 2HU5A 2RAUA 4XVCA 1EDEA 4X6XA 2VT6A 4MYDA 1DQYA 1IUNA 3SC2A 3NGMA 4OYLA 3MUOA 4BATA 1SFRA 2WIJA 4FDMA 4ZV9A 2OGTA 1P0MA 2AXEA 1TIBA 4W1PA 3C45A 4HTAA 1ZI9A 1DT5A 1W76A 4L0CA 1ETHA 2XUFA 1DU4A 3F97A 4B6GA 1E5TA 3PE6A 4Y2VA 3VVLA 5K3CA 4A16A 1HQDA 1QIHA 1UXOA 2W22A 4DMCA 3FYTA 2QT9A 3NUZA 3O95A 1CUAA 2XUOA 3I2JA 3I1IA 1Q0ZA 5ALHA 1ZD2P 1CUBA 2FUKA 3G9TA 4BE4A 1X2EA 3EQ8A 3DDUA 4W1QA 2WJ6A 2OCGA 3ZLVA 3NOXA 4QDUA 4N5HX 3D3NA 5DTJA 4AO7A 1H2ZA 4X91A 1XLWA 4WY8A 4B0PA 5CT6A 4AO8A 3C6ZA 3X3HA 3C5VA 3O0DA 2H7YA 1SC9A 2HDWA 4E46A 4DNOA 3H1BA 3ESAA 3G02A 4DM7A 2RI6A 2B20A 3IVMA 2AJCA 3FSGD 3D5EA 3IULA 1W6RA 2WHQA 5AKIA 2ZJ7A 1UK9A 4F60A 4H7FA 2BJHA 2ZYHA 3AJAA 5A71A 3WKEA 2WTNA 2DHDA 1Y37A 3QM1A 4UPDA 1CLEA 1WOMA 3D0KA 3HC7A 4H7IA 5FXMA 1WB5A 3RK4A 4BZZA 1QIGA 2XUKA 4LIPD 4C89A 4S0XA 3VDXA 4ZREA 4K6HA 2YYSA 2CZQA 1BEZA 4J0DA 4EY7A 4MQLA 2WSLA 2AJ8A 3AIKA 1EDDA 3MGAA 4UHEA 3KOOA 5DYWA 5FOQA 1X2BA 3FLAA 1JI3A 1XRQA 5JZBA 5ALKA 1EDBA 1CUWA 3ANSA 4BP8A 4OYYA 3PF9A 1G42A 3DKRA 4BVLA 1SCQA 5CBKA 2JGFA 4DMFA 5LZ9A 3YASA 4QZVA 2WHPB 2CEKA 1BCRA 1ZGBA 3OC0A 3WK7A 1FFBA 1BE0A 3D4LA 5E4YA 1Q84A 5AKYA 1CUUA 1NX9A 5ALIA 3K9BA 1ZD5A 3STUA 3G0GA 1I6WA 3ESCA 4I4CA 2J4CA 3LLCA 1L7QA 3V1LA 3RLIA 2EDAA 1CVLA 4YASA 2PSEA 3C6BA 3W04A 5E4TA 3PFBA 3ANTA 4ETWA 2WQZA 3DCNA 2J4FA 3D59A 1XZAA 4U2EA 5AKGA 4I3FA 3D7RA 4BVJA 1CRLA 4B9EA 4MWTA 1VXOA 5ALOA 4U2DA 3WIOA 1XKLA 4FKBA 2C0QA 2CMFA 1HKHA 3FBWA 4BAGA 1ZD4A 2B9VA 4KYVA 2WILA 1P0PA 3R3UA 3W9UA 3DOHA 4LYDA 4HXGA 3ZWQA 1EB8A 4X3CA 4UHCA 1ORVA 1VJ5A 5K3BA 2VT7A 4UHFA 3MVEA 1XZDA 4DIUA 2QUAA 1UKCA 1QLWA 1GPNA 3OOSA 2AJLI 3W9BA 3OPMA 1WB6A 3H19A 1C7IA 4YX9A 4GXNA 4OCZA 1XROA 1J1IA 2PKYX 3G9UA 3A2MA 2IX9A 1QONA 2WHPA 3I1YA 3N0TA 4AQDA 1WHTA 1UT6A 2WFLB 5ALTA 2QTBA 5HF5A 3F9CA 4QDZA 4Q05A 2PSFA 3BWXA 1MAAA 3IUNA 2DR0A 4IH9A 4JNCA 2ZYIA 2XMQA 1CUYA 3HYSA 4NVRA 4C4XA 3I6ZA 2WM2A 3VVMA 5A2GA 2JGKA 2BUCA 5CXXA 4BCDA 2V96A 4QDXA 5JD6A 4GECA 4KE6A 3R41A 5C8XA 5JZ9A 2QR5A 1UK8A 2XLBA 3LCRA 2VJCA 2HU8A 5T4FA 5DNVA 4X7BA 4MEBA 2VAXA 5J3JA 5D3KA 3IUMA 2GYUA 3CCBA 1TAHA 1LLFA 5CT9A 2BGRA 2PSDA 4Y9SA 4RNCA 4GLBA 1ZOIA 1ZIYA 1A8SA 3AINA 4W9RA 2QRUA 4E14A 4IQ4A 2HA5A 5DYYA 1ISPA 5K3DA 4GHWA 3R40A 5LKRA 4Y2PA 4JEIA 4M0FA 1E89A 2YH2A 1YCDA 3C8DA 4AN1A 2WFLA 4EA6A 3Q0TA 1CUIA 4IHAA 4KAJA 4QNNA 3DL4A 3FNBA 5JIBA 1QTIA 4X85A 4TPKA 3TEJA 3GA7A 5AM4A 5AP9A 4MXDA 2WG1A 5AK6A 3DYIA 4G9EA 4UBNA 1K5PA 4PF1A 3H04A 2WG0A 4GDMA 1DT3A 3H0CA 1XZIA 2GBGA 1JMYA 3W05A 3QITA 3H2HA 1B41A 3JW8A 3VKFA 2DQZA 1ZJ4A 2ECFA 1HDEA 2B4KA 1N8SA 2G63A 4F21A 1R4ZA 2OCLA 3CN9A 4AZ0A 5FRDA 5AOCA 5T4HA 4ROTA 4HXFB 1N5RA 3WWDA 1XRRA 2QUBA 3CCCA 1XRNA 2VAVA 1T4MA 4BTVA 4BRSA 3AIMA 4X71A 4EZIA 2B61A 3WYDA 1CUSA 2JGLA 1VA5A 2OAGA 1MX1A 4PQEA 3G0IA 4LHEA 3AIOA 3I2GA 4FBLA 4KACA 4LYEA 3WWPA 3WJ1A 1ODSA 3OM8A 2OG1A 3C5WP 4V2IA 4J0KA 2GBCA 1XRLA 4DNQA 5AIBA 5I7UA 2GBFA 3DQZA 5FUMA 2XT0A 1LNSA 5SYNA 3AZQA 2QKYA 3R3VA 3B3QA 2Z8XA 1XFDA 3V1MA 1DTEA 3QPCA 1GKKA 1XZEA 1ZICA 3R3YA 4H7HA 4OUKX 5CH8A 7YASA 4J03A 3LIIA 4AZ3A 5JYCA 3N2ZB 3KSRA 1MX9A 5CH5A 3DJYA 2VF2A 5C8ZA 4G8DA 5ALEA 3HABA 1H2YA 2WU4A 4UHBA 4QWWA 2HFJA 4C87A 3I6MA 4U2GA 2ZYSA 1X70A 5JATA 4ZV7A 2ZYRA 3PUHA 3H2KA 5JD4A 3JYHA 2X76A 5AHXA 4B80A 3A2LA 1YS1X 4GEGA 4A23A 1F0NA 4C6HA 5AIAA 4Y2UA 1Y7IA 1CUXA 1THTA 5JALA 2XQFA 2O7VA 4DLNA 4JYPA 5CXUA 4Y2SA 3O9VA 5AICA 1HL7A 2HFKA 1A8UA 3BXPA 3ZLTA 4AO6A 3E4DA 2XMGA 4OU5A 3EQ7A 3G0CA 1TCBA 1EX9A 5A7HA 1GQRA 5HQ3B
chains in the Genus database with same CATH superfamily
2XUDA 1SMKA 3PQDA 1Y0BA 2L0XA 2FFBA 3BX1A 4MW5A 1E9VA 4HI0E 4RAOA 4DMGA 1YSCA 1FRNA 3AERB 3L82B 5LLSA 1I2MA 3M5CA 3T95A 3BRQA 4GVXA 1K6XA 1RXSA 3L77A 3U44B 1E2JA 1L3CA 4HV4A 5D3ZA 3QA9A 1DKLA 5HZHA 1EPUA 1H8ED 3LKVA 5BSRA 4CTNA 1PKEA 2X1VA 3FOEC 4TM8A 1QYIA 3RS8A 3QF4A 1M1ZA 3PYLA 4OFZA 1BHO1 2EDCA 1G7RA 5HGJA 4AJKA 1M83A 4W5TA 2VPIA 1UOPA 1N34B 3BRWD 4FGZA 3LQ2A 1MC8A 2TRSB 1GUYA 2UVQA 1KSJA 3ILHA 2BAGA 4GZ5A 4XVHA 3M7IA 1YAJA 1NFFA 4RPHA 5EYPB 4MIEA 1WBBA 2BM9A 3UWOA 3HCDA 5DHFA 5JAMA 1Z82A 3GCWA 3PGVA 4NCJA 4DZRA 3BB3A 1IAVA 4BP9A 3JASA 1PUJA 1NFQA 2YDXA 3HYCA 2UVPB 1PR9A 2WIKA 4KE7A 1N6IA 3TLMA 1CR6A 4ZMRA 3D4BA 5HUQA 3IX7A 4DB2A 4EKEA 4MR7B 4XIGS 3RHSA 5H68A 4CL0A 2CFIA 2HMWA 2GCPA 2X13A 3A7EA 3QIAA 4A0QA 2XITA 5ES4B 2HDHA 4PZ9A 2QJTA 4ALIA 4E6EA 4IX1A 1M67A 4NJEA 3ER8A 3AP3A 2HJ9A 2AS0A 2G82A 4EA8A 1K06A 1TEHA 4PONA 4DEXA 2RHBA 4EVRA 2Q28A 1NBHA 5F1OA 3L6OO 2JJ1D 2VDQB 3M3DA 1EVQA 3W3AH 5LXTA 3VRHA 4R1TA 1QO0A 2X42A 1P7PA 2EWVA 2IKQA 3C4QA 1MHTA 5DHAA 1SVMA 2XA9A 1MO6A 1BXRA 3HJAA 4M22A 1JHPA 1FNNA 3N2NA 1PJZA 2ZB8A 1G19A 4Z8XA 2OHGA 1JHAA 3L0DA 4DSAA 1V3TA 1ZW1A 2XKBA 4HNSA 3ETGA 1E61A 2WTMA 1NJ2A 1FPMA 1GVHA 1V7QA 2FOIA 2H4FA 2VH2A 2O50A 3DGEC 3LIPA 4KQCA 3SC4A 1XQVA 5EESA 2CUZA 2OAP1 2KB0A 3C8HA 3QU5A 4XCXA 4IEFB 5EKDA 1NN5A 4EHBA 3UPTA 1IN8A 1L3IA 1W85A 1EFAA 4BU1A 2BR4A 1Q3HA 2D3TA 2D2IA 4NZZA 3RVQA 5JZSA 3G2KA 5JS8A 2ZAYA 2H1HA 3UA3A 3H2YA 1ZR4A 1V0JA 2O4UX 1EGAA 2JFXA 4P5PA 5H3CA 1U0OC 2DBQA 3K0KA 4PO1A 1EFRD 1AQLA 1R6DA 1E0KA 1ZK3A 2O0MA 3FNQA 1P6XA 2W6ID 4MAFA 3EXHB 5EE9A 4H1WA 3GCZA 1R0RE 4BQFA 1Z74A 4NR0A 4JVSB 1M34A 4XB2A 3TRFA 3S2ZA 1XCJA 1XMJA 3VR3A 3UAVA 1AH2A 1QZTA 1F8UA 4LXGA 1GKIA 3NBUA 1T4BA 2FEKA 2CLLB 3CX7A 2DE0X 4QVKA 5B1SA 2ATIA 2ZRIA 2HO4A 1EFVA 1HYEA 5KOHB 3PT9A 1I7QB 2JJ2D 4QGHA 3GRUA 5BR4A 3LP8A 1K4YA 2ZAIA 4RIFA 1REQB 1XEFA 4JITA 3FXAA 3V7UA 3O0TA 3GIWA 4UNPA 1UZAA 2CJFA 3BMXA 2DLNA 3WDKA 1AUVA 5DKFA 1N0WA 1RJ9A 3ECCA 4YRCA 5B12A 1N6KA 3JQFA 3GRPA 4J4TA 4K9SA 4TGLA 4UHKA 3D81A 2RJNA 1O7JA 4UFNA 2XE8A 4XVRA 4WACA 3RUPA 1JPVA 3ZXSA 3BKWA 2EF1A 2FPKA 3ZR4B 1C0EA 4CWAA 5E3HA 4D6PA 3REFA 4D9IA 1ZJJA 2VDWA 4L78A 4Z9FA 5DCUA 4FFOA 4AMUA 3STTA 4RLQA 1S4QA 4WWHA 4WZZA 2GTHA 3LBYA 5AI5A 4EO7A 1UBNA 4AS1A 1QYVA 4TWAA 3UB4A 5AW4A 1ZK1A 3AK4A 3OVMA 2ST1A 1NBWB 3DKPA 3FOBA 1J39A 4RD3A 3OPNA 3WQQA 3BSSA 2D0DA 3ZG6A 5DNWA 4D9HA 2VP2A 4UE6A 3C3KA 3KQWA 1FNMA 2C84A 1YDGA 2IKSA 4DG5A 2O0HA 1BDBA 3KQQA 3GA0A 5IHPA 2R60A 3KB8A 4QYWA 5CYPA 4L57A 3AH8A 1UEXC 1MNAA 1UXIA 3AUTA 1BS2A 3VJKA 4EUEA 4IZOA 3WKBA 2PZFA 2EL9A 4LSZA 2AR0A 2FZ4A 1DC8A 1T6XA 1VSBA 3CLTC 4JP8A 1XL1A 2JVJA 1OWOA 4MIOA 1AURA 2EBWA 2RB5A 4OKNA 3IPYA 1GYQA 1GPKA 3DKKA 1F20A 3EDRA 4HEA6 5LZ5A 1EVZA 1G2IA 2A5GA 3H2ZA 4R2XA 1YDMA 1PU2A 3PNLA 4MRPA 2CHUA 5EL0A 1JMVA 4E1BA 1DG9A 1U2SA 3ET4A 4EEKA 1DNPA 1UDWA 2F48A 2Y9MB 4KH1A 5ECDA 5CA0F 3OMXA 2DFVA 5G4KA 3OIUA 1P73A 1TCAA 1FCJA 1EP2B 1RRMA 2GN2A 3F67A 2OXTA 1CUVA 5A5FA 4EJ2A 1W5TA 2NP6A 2C2KA 4QFBA 1L8LA 3NJ8A 2E1PA 1L7OA 1TZKA 1RVV1 2RHGB 3ANLA 3I01M 4V0LA 5ESDA 1Q83A 3HVRA 4C0HA 1KPGA 2CHFA 3KVNA 3H83A 4IZHA 1ZVKA 5CDUA 1J21A 2F8LA 1WHSB 2X8LA 4MJXA 1C4KA 3INTA 2PGJA 4QO8A 4BY9E 4BJ1A 1X8LA 5E1MA 3GVPA 3Q15C 2QX9A 3ZGNA 1ZJ5A 3QV1A 3GRAA 4PO9A 2ZK7A 4BGDA 3EGEA 2XCIA 2CNLA 3MYYA 4FCWA 5CNMA 3VJMA 1ONNA 1UWLA 1MJGA 2MU1A 3SFVA 1CEYA 5GZ1A 5H1YA 1WF3A 4RC9A 2IF2A 5CT5A 3U49A 2WICA 1C4XA 3F6EX 1EUYA 2ZRHA 1NE7A 3ZYZA 4CV0A 3I0MA 2WU0A 1N2HA 1V6AA 2LDXA 3EZ2A 4XZ3A 3DE1X 3R76A 5B7PA 1U7XA 4Q4JB 5KAPA 3RR2A 1T3HA 2UZ0A 1JHOA 3RD5A 1G1MA 3PJDA 3ILVA 5HRCA 3MW8A 1V1JA 1V7ZA 2F1JA 2NTEA 4I5IA 4XCQA 1M1NA 4ZZ1A 4GI3A 1NW3A 5EWLB 1Z5ZA 3ORRA 5FUBA 2XRMA 3OPQA 1D9ZA 2XT9A 1ZIOA 4KXMA 1Z5NA 4NIMA 4LRQA 1TZCA 4BFZA 4RENA 4CLRA 2C57A 2DETA 4XVQA 4IY1A 4UARA 4YEDA 4BC0A 2BT4A 1YI1A 4D8WA 1QYCA 4ZVTA 3FGOA 5IJXA 2FDCA 2ODEA 2GK6A 1A72A 2ZSFA 1X19A 5FL7D 4L74A 3QK7A 2EXXA 5KU1A 3DV2A 3HN2A 3UHPA 5E7JA 4E5PA 3CX6A 4BNYA 3BK7A 4ND2A 2PH3A 1CJCA 1L9KA 4B73A 3REOA 4YV7A 1KWKA 2XXAA 3SCZA 3BIXA 3IOEA 2IZ6A 1KNXA 4H4EA 1JDZA 3VR3D 3KAPA 4FILA 3O8LA 1UMKA 3VNBA 5AI9A 3N28A 2J9GA 2AN1A 2YOHA 2UZ3A 2BC9A 2QXUA 3CZ5A 2RHTA 3EXFA 3KVVA 3ZWPA 4DTIA 4MKIA 1L1EA 2OY0A 4ALMA 3RVSA 2IOFA 2O05A 3GLIE 1LI5A 3DEZA 3GLKA 4OBEA 3UTCA 1CJVC 1C41A 2ZI9A 1GNPA 1RE0A 2C4HA 1A82A 2WAYA 3C1TA 4Z7NB 3K9NA 3RWBA 4R7ZA 5TJ9A 1XDUA 2F1KA 4DV0B 2VYFA 3ONWA 5AJTA 3Q41A 4Q6WA 1CERA 2VYCA 3BAFA 3PA8A 2BZ1A 3GX1A 5EZ6B 4PIVA 5CA0A 4JLBA 1FF9A 2YWXA 1CUGA 2AOUA 2Z5VA 3E1GA 3JQGB 3SDSA 4D5GA 5LZ4A 1TO2E 5BNFA 1CF9A 1IXKA 1R0SA 1KO5A 1WPXA 3CNLA 3R23A 4JBGA 2IGBA 4JUFA 2QXYA 4ND6A 3S28A 1H4QA 5K8UA 5A0TA 1QE3A 3LXXA 4XGIA 4O33A 2JCYA 5SICE 1QGED 5TPWA 3THOA 4KXXA 2CBGA 4WINA 3UQZA 2XWBF 5KWVA 3CR7A 4CXMA 1V48A 1UZUA 1J8DA 2NM0A 1NUHA 1CV2A 2KHZA 1KS2A 4MJLA 4N18A 4M0KA 3WA6A 2J4DA 4FDTA 4HLDA 2P9HA 1GLGA 3T9DA 4BVAA 4F5WA 3MS2A 4KSYA 3FNIA 2WTEA 3OE1A 3PLRA 3QZUA 1RNLA 3CN7A 5U4QA 5ADHA 3L4JA 1U7DA 2B35A 1S02A 1J0DA 3LPDA 2WB2A 3OZSA 3NAQA 4KXWA 5ELMA 2VK8A 2JATA 2FSHA 1IBCA 2F3UA 2QZSA 3D6JA 3FCUB 4I1SA 3COYA 3LT1A 3ZV3A 1CF4A 4MQ6A 4LZJA 2Z2IA 4PSVA 3FNGA 3FF4A 4ND7A 4KQHA 4LSGA 5HM8A 3FHLA 4QEKA 4A2QA 1QGZA 1ZM3A 5JXJA 4BMYA 4I6GA 3OF5A 4P92A 5BW5A 2HK9A 2HIGA 3ENZA 3O91A 1S01A 3DTYA 1Y80A 4RVDA 3ZZNA 2BCEA 4L22A 3ZHYA 2QW1A 3V3KA 2ZUCA 2OO5C 1E79D 4FQ8A 4XDZA 4EJ6A 1D1TA 3C4JA 4W5WA 3LY7A 6YASA 3PK0A 1RWPA 1XF1A 1Z39A 1V16B 2YQ5A 1IXSB 4L4UA 2Q0SA 4YP7A 3LVQE 3PTLA 3FMGA 3F98A 3GAMA 5CDTA 3EPLA 3PYMA 2Y71A 3EC1A 4WOKA 3PDCA 1EWKA 1VHJA 4I5FA 1YRHA 2E37A 3SBOA 3OTQA 1K2VN 2PE5A 1YV9A 1VRWA 1E59A 3GZJA 3VDQA 1AHNA 4QATA 3SEAA 4ZZ2A 1MTZA 1JECA 3L6BA 5DI3A 4EYKA 2VTBB 1PR2A 1PEYA 1UOOA 5CDFA 1YB5A 2C9ZA 1FU4A 1ULAA 3GP3A 4RELA 5DGTA 2POQX 3VUFA 2FZKA 4ZVLA 3WQRA 2C94A 3NDPA 4JBLA 3UAGA 3D8BA 4YAIA 3BG5A 3N59A 1T25A 2GA9A 3DSRA 3RT1A 4HFRA 4M6WA 1VI5A 3FOZA 1HNXB 4O2LA 5L3RA 2QZ4A 3DCIA 5ALLA 1CRZA 3D8SA 4N5MA 2GUGA 1B6SA 3FPKA 4NZNA 1JHVA 1ZH6A 3SFZA 1GWNA 4G3XA 2A57A 4HZUB 1NW7A 1ODTC 1XXLA 1IZ7A 2QMEA 1TVCA 2RHRA 3FZQA 3QQ5A 1FIUA 3ZGYA 3GJ0A 4MP3A 4OUDA 4TKMA 2O8DA 2G9UA 2O7NA 2B1IA 1A4XA 3ORSA 4Y2TA 3DB1A 3CNEA 4L4YA 3KUXA 4DMMA 4TTAA 5FV7A 2Z5FA 5EE1A 1YE3A 1KJ8A 2E49A 3QKUA 2ZRQA 2OG2A 4JXJA 4OQ4A 4H0CA 1Z06A 3AL2A 3OQ1A 2QMUA 4NE7A 3H2GA 1E77A 4II3A 4WHMA 2FSGA 3FOFC 3TZBA 1BH2A 3FWHA 2IC5A 1NXWA 2P3QA 1SWWA 3DOOA 4KLCA 1XWWA 2C99A 3ZWNA 4BJ3A 1VXRA 1WZUA 1L5FA 3O74A 4Z8YA 3RT9A 1S2IA 1U98A 1TZJA 2DHCA 1PR4A 3K72B 4U1RA 5DU2A 3WIEA 4CM7A 1ISJA 1M9NA 3LA8A 1M0EA 1D2NA 4UFPA 3DMYA 4CLXA 1RXVA 1J06A 4LFAB 2PL3A 4UPEA 4HAOA 2CFCA 5ALMA 2FAXA 3LDHA 5IJ9B 3KJQA 3B12A 3PPWA 2W00A 4J94A 1GQOA 5HTKA 3AF2A 1FFWA 4WAUA 1E92A 4V0RA 1P9WA 4WXRA 3MS7A 1O6FA 1ULSA 2WM3A 4A6DA 4JJKA 3O4IA 1LVHA 1XE3A 3SQXA 3Q3CA 3EPJA 1B8NA 4YMGA 5I4KA 3VYSB 1XVVA 3KUKA 3IKVA 4BJ6A 4K86A 4NU6A 2IY7A 5ILQA 1OVMA 2QP4A 3QWBA 4HYYA 4KN9S 7GPBA 4KPFC 1QLJA 3Q10A 1MU0A 1YASA 4GMXA 4I2NA 5H16A 2JLCA 4GR9A 3KQTA 3QG5A 3W1WA 2IYXA 1PTJA 2LWIA 4WKCA 2C5GA 1QG6A 1UPBA 5CCBA 2XMBA 1QH9A 4MKXA 2O5CA 2RHWA 3OG9A 5EZYB 3GGGA 3GROA 1WDMA 4HGQA 1OBVA 3FD8A 3T5PA 3BXOA 4WOPA 1TC1A 1IJKA 1P8AA 5G1NA 4Z6KA 4W5QA 4ZT2A 2HA2A 2NU9A 5TJHA 1KVSA 4DR3B 3ZNOA 3KKQA 5AI4A 1NT2A 3AEQB 1AZTA 2O5VA 3JR3A 3Q1KA 4MTLA 4KRXA 4BVBA 2PEYA 3Q5GA 4WLFA 1IMOA 4GZMA 3WJAA 4AMGA 5FADA 2GMWA 3AEKA 1OB5A 4RPKA 4E5UA 2IPOA 4FYJA 1QHGA 1Q16A 2ZPUA 4JXKA 1E7YA 4M8IA 4B5KA 2Q2NA 4ZFNA 4ZI3A 5JUWA 2UU9B 3AHGA 3WA7A 1DJNA 4QG3A 5LYJA 4H3SA 3NHYA 2APJA 4LX8A 1MR3F 2ZYWX 3V5NA 4OB6A 1QV7A 3STVA 1RWVA 3GXBA 3N3BC 4B8ZA 2VAWA 4M9SA 3HGMA 3FPSA 3IGFA 1E6WA 2O3TA 3NIGB 4ZDWA 3WZ2A 4ZZ3A 3NMUF 3RSZA 3AVOA 1ELOA 2P8JA 1CZLA 2PT7A 4GE3A 4LJ7A 4Y1EA 4AICA 4CKYA 2D7DA 3AONB 2GSDA 2QW0X 1NKTA 1ISGA 2MMCA 4CR7A 1TU0A 5CAEA 3FGZA 2XW6A 5C7YA 1PK7A 2FWNA 1L1RA 1R37A 1OYYA 3T99A 2V7XA 1Y82A 2Q1TA 1L4UA 3H8WA 4R8KA 4BLOA 2CXNA 4Z4EA 2Q8PA 5H02A 3KE9A 1JR3A 1YIOA 2NO0A 2XF2A 1VOTA 1E9SA 1E8DA 1M6HA 1D2GA 4F6RB 2QGNA 3P2JA 5J23A 2J0QA 2A86A 1IOLA 4K0KB 2EIXA 2BFFA 2P0EA 4TXNA 3ZHOA 4IDDA 2BKVA 3DEYX 1K63A 1XP5A 3ABQB 4FNGA 1QP7A 2IP4A 1G55A 2GLXA 3JAKA 4UAGA 1FW6A 5PGMA 4X65B 4MPJA 4YJGB 3UAZA 3G2LA 4P98A 3B60A 4PYRA 521PA 3OECA 3P9XA 4RTKA 1EXDA 3HUFA 3B89A 4Y2XA 1A2KC 1FJHA 4X97A 3SZOA 3UUEA 3W4KA 1VL1A 2A94A 1IRIA 4HDNA 1PCXA 1WXHA 3EGDA 2F17A 3H7IA 5F73A 4DLKA 6ADHA 2WQ6A 3X2SA 1Z4LA 3OHPA 1VYTA 2MSCB 2PO5A 3B5JA 1C8VB 1K0FA 2W6CX 4FNAA 5EUBA 4FYVA 4RY8A 4R6XA 4PEVA 2IK8A 2IQIA 2QVCA 3DAGA 5BT8A 5LQRA 1TF2A 3ZQKA 1RKBA 1WQ3A 3O1LA 4HQKA 1SG6A 1GXSB 1ZEMA 4GXQA 5GINE 1N25A 4BV8A 2NQ8A 4KI7A 4RTMA 1IEXA 1SCDA 2FGKA 1Y98A 4ZO9A 5EXXA 1GCGA 1LPPA 1RP7A 4A0HA 1WX1A 1Y1TA 4ANFA 1T6BY 3E9CA 1ZNWA 1UDXA 5JSZA 4L73A 3K6JA 3NH9A 2VH1A 3JQ9C 1P1KA 2C7BA 1U7ZA 2XDWA 3CLSC 4LXXA 4AJNA 4H3KB 4EM6A 3DO6A 2AVNA 1E1NA 4AURA 3OOYA 2B1GA 4YTEA 4Z4HA 5IC4A 1GFIA 2ARKA 5JC8A 3WL3A 5M04A 3SC3A 4MYSA 1QFJA 3P27A 3FDZA 4IXTA 4DWJA 3AHCA 1V8DA 2BEWA 2WLSA 4OHFA 1ZNXA 2VKTA 3OP1A 4GOXA 4EPWA 4BS9A 4IUYA 2WVAA 1RHJA 1JDSA 1GCOA 1X1AA 2I33A 2NO4A 5E6RB 1RBQA 1T5BA 3LT0A 3RJ5A 1O4VA 3TW6A 4Z49A 1IBLB 3TFWA 1GT6A 3SJ7A 1CVIA 2VIIA 1Z8FA 4IDOA 2AFHE 4C2UA 4M87A 4D44A 2XNKA 2H4JA 3QX3A 3DBVO 2Z43A 3NATA 1RM0A 3DAHA 3J81A 1WKBA 4CV1A 1UOQA 1WABA 4KDRA 1KAGA 3VR5H 2O54A 4LJ9A 1S8OA 1PHPA 3ETHA 2YBEA 1M7BA 1Z5GA 3MCAA 1YS9A 5CEEA 2OFPA 2VT2A 2W71A 3PQ2A 5AVSA 3P26A 3RTCA 2QN6A 3T7SA 2R6CA 4LDNA 3EXG1 3QRWA 2P2GA 1H4TA 4JGBA 1J8QA 1Z0UA 4NS1A 4DDKA 1ZNZA 2VYVA 2WIBA 1M1YB 1N6LA 3NHWA 4JVLA 1M5UA 4D3XA 5ICGA 1E1MA 3D4OA 1ZIXA 1F12A 3GF4A 1O6BA 5A3VA 4DPKA 2C5HA 2DQYA 1QHSA 4BNXA 1FDSA 4G63A 1R9NA 4BTEA 1ZEJA 5B4TA 1L5ZA 3PFGA 1LW6E 3F8SA 1THMA 1G20B 2OO3A 3K8ZA 4RFSB 4E5KA 1KJJA 1ZCAA 2W8BB 4OJKA 5H81A 2JGJA 3T3HA 2XTJA 1UL1X 4QA9A 2E1RA 4ER5A 4F45A 1NPYA 3DHWC 1YBHA 3OZAA 2AQKA 2PM8A 4PXYA 4TTIA 4AMYA 5JAPA 2BFCA 4HATA 4JC8A 3M6IA 3TRKA 1ZLXA 4ILEA 5HJEA 1RJFA 2H2DA 3JPYA 3LX6A 3N75A 4BFWA 3KSUA 4MICA 1QVVA 3S5UA 1CY1A 4AP9A 4C08A 4MS4A 3UUFA 1DQPA 3K6SA 3L7BA 3PGMA 2CLDX 2ZSEA 2VRBA 2V8BA 4M1KA 3TLCA 4CQMA 4S1WA 5DGHA 4KIUA 4QDJA 5FOVA 3AJRA 1LU9A 1N3BA 1UBTS 4AROA 2I65A 4P4LA 5BY2A 1DMRA 5ILGA 3E3NA 1WUJS 3R7WB 1DZIA 3RS5A 2QOEA 3MS4A 4KWCA 5FOTA 5BVHB 1V9SA 2K5UA 1QKIA 3UHFA 2PWPA 2PZJA 2I8LA 3ZUGA 4FFBA 3QVGA 3UFBA 3RYHB 2O0JA 1CIVA 3JYOA 1R0KA 2OESA 4RPCA 1RBMA 4YJ3B 4D26A 3OIYA 1JR3D 4HSGA 3PRHA 4ND5A 3A1NA 1Z5WA 2QLNA 4DJFC 1N2BA 4OD0A 1IN4A 3EC7A 2V65A 3L7OA 2QUHA 2ORED 1GRNA 3GEEA 3RBXA 4WFJA 5CRIA 3ZJVA 2C58A 1LVGA 4YP5A 5ELLA 1EEXB 4MR9A 4GPIB 1TYBE 2H2GA 3KQHA 4R6WA 5K0LA 1MZVA 1OJLA 1RYZA 2E4ZA 2V0NA 4PNEA 5HUHA 1L4KA 1X8XA 2RJ3A 4JQSA 1QF9A 4Q34A 5ALFA 4QUIA 4MYRA 4XWTA 4RU1A 1CZUA 3O94A 2V5AA 1W5AA 5T41A 7MHTA 1AKWA 4OTZA 4R1LA 2BJWA 2KQUA 4YCMA 1Z16A 6AT1A 3O93A 3GCGA 4C7BA 4R3UC 4KN6A 3TMAA 2YXPX 1X1EA 2WY2D 5JRDS 3HTXA 4DA9A 1JKJB 1TUBA 1MN6A 4D8YA 1K68A 3CNNA 5JSQA 3NZEA 3MWYW 3N0VA 1V9CA 3FUUA 4N82A 3GFSA 2ES4A 1HG1A 1KI2A 5TMDA 1I24A 1YJAA 3DFKA 3WOVA 1N36B 1KJYA 4RF4A 5H59A 5JISA 1JIUA 4CTJA 4O1IA 4WN9A 5ADVA 1VIAA 2WF6A 2G8LA 1TQ6A 4O2BF 5JVDF 3SP1A 4XFJA 4D3SA 3CNQS 3KT8A 2R85A 3R24A 4N7MA 2ZSHA 4Z4IA 2GVZC 4CIVA 4QECA 3MK31 5FPPA 4AJPA 3I5YA 2PX4A 4C01A 4P93A 1FX1A 2Q0XA 1K92A 2X2OA 4OLBA 2ZKLA 4RY2A 4AKIA 4HWKA 4HCJA 4BMOB 1OH5A 1NMQA 3OIWA 4HAWA 4BLTA 4HDAA 4G84A 1PZMA 4U7GA 1MOPA 3D0QA 4EYGA 2P9ZA 3PFWO 2EZ9A 3INRA 4LI0A 2XE6A 3TLEA 4Z9XA 1QE0A 3TLAA 1DCFA 3CJQA 5I4IA 1Q0TA 5KOIA 4OQQA 1CZOA 3F5QA 2JA1A 2KYRA 3HQ4O 2EFEB 1MHPA 4J0IA 4RANA 2C92A 5JSUA 5LSAA 5M34A 1I13A 5HHTA 3FIJA 1UZMA 4L3VA 4ARZB 1EIWA 2R8BA 3F47A 3I0ZA 4FKMA 2L17A 1NAIA 2W83A 1V39A 1YJXA 2X1HA 4XYGA 1QOZA 2QNRA 2HHJA 3RTBA 4EHNA 2G70A 4HWRA 1N5OX 5JZMA 5K51A 1JGTA 2VYVD 1JIQA 2AN9A 1WETA 4RM3A 3U3KA 3DD1A 5JSKA 4FWBA 3P9PA 1RJEA 4EL5A 1ZGCA 4ENVA 3CLTD 2A9PA 1UWCA 4BDTA 4RYLA 1WVMA 4LE2A 3RW9A 2ZBQA 1EB9A 3TNJA 2ZRDA 3KR2A 1U2RA 1AQIA 3UC5A 4EYOA 3P45A 1XZFA 1YZLA 3SFTA 4EY6A 3PXUA 4OAOA 2AI1A 2NO1A 5A6VA 4L4ZA 3RNOA 2OVBA 4X1IA 3QWIA 4MROA 5LP6C 1ESDA 3EZNA 4HAZA 3V42A 3WIUA 2OO5A 4H77A 1YCHA 1FP7A 3AJ8A 2ECKA 3G17A 2E7ZA 4LCBA 2ZS7A 1UAYA 3L9WA 3M1AA 3ZS9A 1E2KA 3OKFA 2OXEA 4X0EA 2JJQA 3IHTA 2WUDA 4CDRA 5ARBA 2IELA 5GZ6A 1G21B 3MYRA 5BYJA 3T0IA 2FE4A 1B15A 4YAOA 1KDYA 4L0MA 3DTNA 2RC6A 3PC8C 1UKZA 2NO7A 2Q3JA 4KOEC 1ZD3A 4YUZA 5JY6A 2O19A 2ZRKA 1YNOA 2ZU0C 3A6PC 3HDQA 1TYDE 5AHKA 1MJFA 1HXHA 4LDAA 3H84A 1ADCA 1NVXQ 4G1VA 2I1VB 2FEXA 1UANA 1AB6A 3UAYA 3TGLA 4H6XA 2JH3A 1U02A 1OC2A 2X86A 3JRWA 4O2BA 2DBYA 1KAEA 3JPWA 2VNIA 2YFKA 2C7PA 1PZEA 1NVKA 5A2QA 3WK5A 1DIHA 4V1CI 3G59A 4E08A 3W1VA 4L8WB 5TT0A 2IW3A 2HPVA 1YB7A 1YBMA 2XT6A 2OZLA 4U63A 1H0RA 4E2FA 4Z0NA 2X5NA 3ADCA 4MITA 3L01A 3MELA 2ZIWB 1FW8A 4JVOA 1I2BA 1TVEA 5JD5A 3LYHA 1UK6A 2I7XA 4G23A 9ABPA 2GHQA 5EJ5A 4BTLA 4CFSA 2VDPB 2WHRA 4FQ7A 4OM8A 2P8SA 2VCEA 4ND1A 4AP5A 3KD2A 3EEYA 5DCLA 4ZEXA 2P30A 3VM6A 4TZTA 3U4CA 5LZ2A 3HP1A 5CM2Z 4HDMA 3EVFA 4ZYZA 1KYXA 3MTEA 2W2MA 1TAQA 4MV3A 5K2OA 3L6DA 3FRJA 4U3JB 4XGKA 3BXZA 5E7IA 3K16A 4ERNA 4A26A 3T9EA 1TM1E 3QLVC 5E3JA 2VH5R 1GZ7A 3N2KB 2VQ3A 1ZOLA 4WI1A 4EJFA 3IOCA 4LYJA 1PV1A 4AJ2A 1KXZA 2Y1LA 1W75A 1HV8A 1X9GA 2A0XA 3NTQA 3ONVA 1QS0A 4YJ2F 2I2FA 3WNDA 4ENTA 5CEFA 5FX2A 4WA7A 1ILWA 3K05A 3N7TA 4FLEA 4WLVA 3ZE8A 3ZI0A 2XYHA 3LMKA 2OMKA 2ZWMA 3RIHA 5BRJA 5JFTA 1I33A 1XD8A 3EBLA 3QP9A 1DTWA 1LBIA 1PUXA 2QA5A 1T3SA 4C0KA 2WA2A 1GRRA 2QRPA 3PE3A 1BXGB 3GRYA 3KNZA 3IUYA 4Y2RA 3R6TA 5HKOA 5CFZA 3I37X 3I2IA 2EW8A 3NFRA 5KYWA 5HF9A 3V1KA 3H99A 2BUBA 4BNTA 3U16A 1WVIA 2C00A 1BDHA 3GV0A 1Z0SA 4X93A 5IBRA 2OR3A 3KJGA 5JO0A 4C22A 1TM5E 1Z35A 3ZV7A 5HBGA 1E2BA 1TKBA 1QZ3A 3OZBA 4Q5IA 3ZD6A 1W34A 2QV0A 2RGGA 1X92A 2D0PB 3IJ5A 3HY4A 3P9RA 4ZVUA 3JVDA 1E58A 4KQJA 4J2TA 3UANA 2WZCA 2FPGA 3V2IA 1TJ5A 5CT8A 4ZGBA 4QEZA 2E5FA 4AU1A 2ORYA 2XVAA 3O26A 4YO8A 3JXEA 3CF0A 2XMRA 2X8WA 3AETA 2V7QA 4FOTA 1RAAA 5KYVA 3GLIA 4M7RA 4PYIA 3I72A 2OA0A 4DJJA 1QPBA 4N65A 4XKJA 3TL3A 5JWOA 3ANXA 3C3JA 3CU5A 4MINA 5DBGA 3NI2A 3VYVA 5FWYA 3D7NA 4JJEA 4QQFA 4HQ6A 4M60A 1S9HA 5IF3A 4AKGA 4PTYA 3GJYA 2AI2A 1TUGA 1XYVA 3EDQA 4UUOA 3TZHA 3U31A 3K1TA 2ZB3A 3HRIA 5FBKA 5CG2A 3DBHA 3BE6A 1SB9A 2R96A 4BMNA 1WA5A 3TLGA 5CP8A 3T61A 2IX3A 1OTHA 1QANA 3Q12A 4IMJB 4LXIA 1ML3A 4LZZA 5CK5A 3OZWA 3D3JA 2HKIA 4TWIA 3ZGXA 5BN4A 4MUYA 4UTNA 1JEEA 2CLEB 2VJMB 2WF7A 3VYTB 3NBKA 4DV4B 2JBWA 2OOSA 1W52X 4WW0A 3WISA 2IS1A 4QSMA 4EMBA 2VSNA 3IDSA 4NZYA 4R2HA 3CIFA 4ZK2A 1A96A 4C2TA 4F0JA 4JLSA 3A9VA 2PR2A 1N9KA 5DM4A 5B1HA 1KFKB 4MPDA 2CLKB 3RFVA 4E70A 3FMFA 3BXGA 5F4BA 5A9SA 1K7YA 3Q9LA 4LF7B 1TECE 3BMCA 1G6HA 4MUNA 3UYKA 3KU1A 4LECA 2DKOA 5G0TA 3N8DA 3CVJA 2IU6A 1TYAE 1JIJA 2HM7A 2DBZA 4G86A 2Q2WA 4GFDA 2G40A 1NXOA 1P1IA 2W6MA 3GJ4A 1ECPA 4LQ4A 2VXBA 2DUWA 1YC5A 1W73A 2D8MA 4P3YA 2ZGVA 3MHTA 1AQYA 2BGUA 5M2QA 1BU5A 5A6SA 4UHJA 3QXSA 1A9YA 4X7MA 1K8QA 16PKA 1Z13A 1RJDA 4RTNA 2ZG6A 3MIZA 4DA4A 3DDHA 3ICOA 4OQMA 1TYZA 4RSGA 2HPZA 1EFCA 2PX8A 1YJ5A 3SYKA 1DHTA 5JNWA 5EERA 3V97A 1N2CB 1I0LA 4DARA 5KB3A 4XLLA 1V8PA 3CRQA 2A67A 3ESDA 1RP1A 3OEED 2DUNA 1N5MA 1KMCA 2H3HA 4B43A 3O8OB 3T4UA 1PK8A 2HYIC 1AKNA 1SVIA 3MB8A 3EGVA 1MT3A 5CX4A 4ALKA 5IJ0B 4YMSA 3TD6A 2Q8QA 3BHJA 4GWKA 2J0SA 1DC6A 4YRFA 1DKRA 4ETIA 4K5QA 3ABZA 4K2AA 5ALUA 2D13A 3JD1A 1GSOA 4RA9B 1GTJ1 2XYGA 2X15A 4AB1A 2IYFA 1JRLA 4OB8A 4JBXA 3RRJA 2H7XA 3CR8A 4AJ9A 1O54A 1A77A 3JQ9A 4NECA 5CNIA 4Z9YA 1FDTA 1DAKA 2XRZA 2WJYA 3VPHA 2V0CA 1M10A 2JFOA 5B5SA 3FM9A 3THYB 1CYEA 2O8VA 3NWJA 1Z63A 5ILOA 2AEEA 4DIBA 4HBZA 1JIXA 4UAVA 4RE6A 1U1DA 1DL5A 2Q5LA 2QROA 4PLFA 1J90A 4TLDA 3UJPA 2VTVA 5JMPA 821PA 3A0RB 2FPIA 4PLCA 3OH8A 4Q01A 3ESQA 3THSA 1S96A 1LCIA 2NT4A 1CQWA 5T6BA 3WBKA 4AJJA 4EITA 2PU5A 4WNAA 4CGYA 1VCOA 2J31A 1E4VA 1SVWA 3M3PA 2ZSIA 1DAEA 1WW2A 1E2QA 4LMBA 4ZQBA 2A1TR 2HJSA 1CZRA 1YRQA 1RYYA 4I3GA 3VI3B 3IBSA 1ZQ1A 3K0EA 1JA1A 2Q9BA 3NLLA 4Q4HA 4X41A 3V7NA 4CG2A 3PJRA 5IP5A 2Z08A 3C3DA 2XUJA 1VE5A 1A50B 2WHEA 1O8CA 2B2NA 3ZE1B 4DM3A 3FBGA 4IG4A 3BSWA 3V8VA 1GZ3A 3CLUC 2RGCA 3AG5A 1TQ8A 5AW8A 3BAZA 1Y8QB 4ZQHA 4NFSA 1Y3DE 3KYIB 1NJ5A 2XYRA 2GZAA 1WQ1R 3MLEA 3V4SA 2RSLA 1Q7EA 2QL6A 4KE8A 4LVNA 4BO0A 3MJCA 5I48A 3KSBC 1GEEA 1EQ2A 1HKUA 3E8SA 1JG6A 3GC6A 4EVIA 3GYGA 1RI4A 3FUCA 2G1AA 5ICCA 4OKIA 4EHKA 2DUMA 6PFKA 4DSUA 2J07A 3QFTA 2V7QD 4IUDS 1FFXB 1MQ8B 1HLGA 2BCJQ 2Q3CA 2WAMA 4YCAA 3VOAA 1C50A 1O57A 1MP0A 1DVRA 4JJ6A 4P34A 5E4JA 5SYMA 3BOSA 1HT3A 2HSEA 2ZJ6A 3WIDA 4AX4A 5AW3A 5HIKA 3X1XA 4PYMA 1YO6A 4IM7A 3Q7SA 2XX3A 1JG7A 3FVRA 3IC5A 4HN4B 2HBRA 4NLLA 2FPOA 1UINA 2PMEA 3COPA 3G13A 4US0R 3T41A 4AMZA 3L6EA 3NWPA 4IIFA 3MILA 2B37A 3KPYA 3B48A 4ZYTA 4G6ZA 2JAHA 1GTZA 4JI4B 2ZT8A 4WXEA 2FTKE 5FUVA 2B4YA 1M2OA 2VQ6A 1P7WA 2PUHA 4E14A 3S2YA 4PWYA 2C2ZA 3CZAA 5H82A 2QRZA 4COKA 3JCZA 3WK9A 1GLVA 3I58A 2QLJA 4O4IF 4CMBA 4E4RA 4LF8B 4W99A 3EY4A 1AMNA 5BNIA 1Y8CA 2H48A 1JQLB 2ADFA 3EW9A 3H1EA 3DONA 1DXYA 2M6KA 3WLJA 1ZUNB 4MMXB 2OLKA 2XNJA 4ITRC 5IT4A 1A88A 1N1EA 5C7IO 3NT5A 4LOHA 1FMCA 2R2AA 3PNVA 5D01A 1E1QA 1RDFA 2AG5A 1YB2A 2VATA 1QPZA 1ZVVA 3UK2A 1XYGA 5TY0A 1JXOA 3IHLA 4LXQA 3OD1A 3LUGA 4BP1A 2ILTA 2V7TA 4GNKA 2P40A 2HX1A 3N3AC 4UBLA 2HRZA 1X7GA 3LSYA 4YPVA 4I66A 4JP3A 4ER7A 1PEDA 5JBQA 1L7DA 1RQLA 1HR0B 1KI7A 4UM5A 1BW9A 4JLAA 2WT4A 4GX2A 4IMIB 3K8YA 3REQA 2DYKA 5LP6F 4PR3A 4XQEA 1HFEL 1T0PA 4BE9A 1F14A 4CEJA 2RH8A 2R8PA 3ETNA 4UM9D 4URYR 3VAAA 2I2WA 3ZQ4A 1W36B 3C16C 4WCFC 4C0JA 2YV3A 2JCVA 3A6KA 4OQFA 1G4HA 3RU3A 3GLGE 1X80B 5JT1A 3F5MA 3GELA 3MNFA 1T29A 1OREA 1PWZA 2WV7A 2YX1A 3OFKA 4NXMB 2F4VB 1VHTA 3CUUA 4OGKA 3HI6A 4K1LA 2NYRA 1W49A 1SQGA 1I51A 2GSWA 2NVBA 3ZCRA 2PMCA 4LE1A 4LNUA 4ODIA 4TWBA 3ZWMA 1ST3A 3GUVA 1ZNYA 4CQNA 1NXSA 2AFRA 2ONCA 2OHJA 2YJ4A 5AM1A 3UWSA 3MGGA 1RFGE 2HWWA 3WGYA 1GPJA 2BN4A 1AO0A 3K2IA 3CLSD 1KSGA 1EGVB 4CI0B 3CUTA 3V4RA 1NQTA 1SD2A 2H1IA 1QO9A 5DNAA 3KTOA 1NASA 3GFPA 3S2GA 4BOYA 3AU8A 1YZVA 4Y6LA 5AOAA 1A1VA 4GKKB 3HU1A 2RBEA 4B48A 3G9ZA 4YH1A 3RC7A 3KYCA 4OSOA 1U9IC 2VFAA 5HS6A 1C1YA 4FYHA 1RWOA 3LKZA 5IVHA 2GERA 1NMEA 2BM0A 4LWZA 4WE3A 4TTVA 1LZKA 4DWOA 4KFCA 3K1AA 4RUKA 1D1SA 1JV2B 1C0KA 3JQ8B 3DT8A 4M8SA 5HQJA 1SXPA 3L1KA 5IBQA 3Q98A 1BGVA 4LTNA 3L0ZA 1KKLA 2G1JA 1GL9B 1Z5VA 1KDZA 2NZVG 4KIFA 2JZCA 2OCBA 3MPUA 4PZAA 2OUIA 1FP6A 1V5GA 1HWYA 2G80A 4I55B 4Q1VA 2PA3A 1L5HA 4WVLA 3F6CA 2X8JB 2FYTA 4NPAA 3T1QA 1BE8A 4EUKA 5JQGB 4UDXX 3IDOA 3ILXA 2Q2QA 5TF0A 1PNRA 3U7QB 4HDSB 2XGGA 2XE4A 1AB5A 1YUBA 2XWQA 3CG0A 1DAPA 5GP1A 3VZSA 5B6IA 3EARA 2O8FB 1BVRA 3IP3A 3BXXA 4F97A 3CUEF 4LXHA 2ZJYA 3C6YA 4MGZR 3UOGA 1Z75A 2B25A 3ILSA 1I2CA 4GUDA 3RUHA 3W6PA 4ZVRA 3WYBA 4TLAA 2AFHA 2QTWB 1CZKA 2Y4NA 1YBVA 3QBDA 3OPXA 1R74A 4KQWA 4HG2A 4FDUA 4NNOA 3WBBA 1IVSA 4G0XA 3KZ1E 3A6FA 1VDMA 1R5OA 3HKBA 4NCHA 4OAQA 4IMPA 1CY2A 4XQGA 5LP6A 1TEZA 3R6WA 1IY0A 2GCEA 1TRHA 2C4UA 3LQQA 3TKYA 4N01A 3AFIA 1F9EA 1YMQA 1YJ8A 2VEDA 3I2FA 1UPAA 2HWYA 5CGQB 4YRSA 1K6EA 3ZE0B 3Q8LA 2GPTA 2IOFK 1WSDA 2I3GA 1R4MA 2AOTA 1RPJA 4RV9A 4E15A 1O95C 2HA7A 1E63A 1JU4A 2OM6A 3IIEA 4QGGA 1WKVA 3WV4A 5I8PA 1WXXA 3LC2O 2ZJZA 3OAAA 2I4TA 3D4PA 2QE7D 3G0DA 4LZAA 5EG5A 1C9DB 2J5RA 3I76A 3EULA 3R3SA 4N7RA 4TS9A 4YIHA 4HAIA 3GGDA 1DBRA 4EP1A 5LKAA 5IXSA 3ROXA 4G1UC 4MVJI 1G8YA 3TEFA 4HQOA 1QH8B 3UMRA 2ACWA 3A36A 1HPLA 5CNKA 3CLKA 4BKRA 3Q8WA 5ALVA 5L51A 2WNIA 1HMYA 2KBEA 3BL5A 3WTBA 2JAXA 2Q45A 5SZJA 3NO4A 4M8NE 4N5IX 3N2GA 5SZHB 3VXKA 4Q1CA 1WBJB 2QMHA 3KZNA 1N8NA 4V0OA 4J9VA 3T5BA 4B45A 2H31A 4JQOA 5IZCA 1WV1A 1GUBA 2Q9CA 4TLLB 4ZP1A 2NWQA 5DX8A 3TLJA 3KTAA 4C1BA 2C7GA 4GQIA 3DUFA 3NTUA 3N8IA 4YACA 4QUEA 4Q18A 3MT0A 3WQBA 1G7CA 4G09A 3BH7A 3CC8A 4NYIQ 4Q37A 3FR7A 5AVYA 1T3TA 2Y0CA 4URWR 3WGLA 5EC8A 3ZDYB 3DR5A 4L8LA 3ZW7A 5HKAA 1NJ8A 2PX0A 2VDNB 3IQFA 1GSHA 3E7PA 3GLRA 2WYOA 2O8EA 5ALYA 2VYQA 3CX8A 5U4XA 5A0FA 5AK5A 3QLVA 3VAYA 2KWIA 1F2TA 3F1KA 4KC0A 2VSQA 4JBIA 1MC4A 4C4AA 3D8RA 4R69A 1PT8A 2W2XA 1YQQA 2AKAB 5DGXA 2NPIA 3E9QA 4B2YA 3SHOA 5I7OA 4ZIRA 1BROA 3HA5A 4ZOEA 1AKUA 3OF3A 1TFRA 1GNQA 3TE7A 1U0GA 5KSYA 3C6XA 1PWHA 4KXFB 1GGVA 1D09A 1GDDA 1RHUA 4X7PA 3T7AA 3BIFA 1P2DA 4JBHA 1OV6A 3EUEA 2ZSBA 4BO6A 2G7ZA 2W2QA 1SY7A 4YROA 2JASA 5JR3A 2RAUA 3PNYA 3K0AB 1CNFA 3TJZA 3VHXA 2NYAA 3VOTA 2G88A 2F55A 3MJSA 1HDCA 4FQ5A 2IBTA 3ERCA 2Y92A 2ANBA 4RHEA 4NMLA 3IEIA 4C7KA 5CLJA 2JIQA 2G77B 4KUEA 3RU9A 3MUOA 2JGDA 4MW1A 3Q6IA 1Z4MA 3DDNA 4IDBA 2OFWA 3HUEA 1SCBA 1HI9A 1V1RB 2VZEA 1DXHA 1E32A 4UAJA 1X7XA 3JWHA 3ZS8A 1ZRSA 1B73A 4WIAA 1KAOA 2I87A 1P9RA 1AUQA 1SO8A 4RORA 2R6R1 2Q9AA 4W1PA 1P2UA 2JKYA 2OK7A 4TKLA 5EGSA 2FZVA 4N0PA 3EDOA 3EMKA 5DX0A 5KUTA 4RMIA 4YUYA 2K4MA 5K8CA 4G56A 2PFGA 4Y2VA 2YYYA 1QUFA 2H1CA 4A16A 4D9EA 2H2HA 1A8PA 3CLRC 1GPH1 4YMTA 5JI3E 4R31A 3EWSA 3FYTA 1NRWA 3B38A 3LV8A 3BFPA 1JJ7A 2QT9A 4I0WB 5DLDA 4XWOA 4UZSA 4I4TF 4JUBA 1ACMA 3PWZA 5IYZA 4PG4A 4MA0A 3H6KA 3O03A 5KNBA 2YUTA 3CV3A 2XUOA 4L6IA 3I1IA 1XBTA 2G17A 4PBSA 5BUZA 4X54A 4FU0A 4EGSA 3N8NA 1KRHA 3AR3A 5ALHA 4XTRA 3SM9A 1FJGB 3R9IA 2FUKA 3G9TA 3EASA 4Q1AA 3FZGA 2I6QA 2DY1A 1R6AA 4H1VA 4P38A 1KOLA 1Z0JA 4Z7JA 3Q7IA 4NENA 2AKYA 2CXUA 2ZJBA 4LKRA 3EFBA 3PXAA 3VTFA 3NOXA 2RAFA 1ABBA 1SKMA 1T36B 2IH2A 4D99A 1SAYA 2QSZA 4GR4A 3CX4A 1QHHB 1WULS 2PAFA 4IOLA 4GOOD 2E87A 2YJZA 4I1UA 4B0PA 4IIVA 2BMFA 2IIBA 2AVDA 2ZYVX 1ZAYA 4A7PA 3JQCA 2AFVA 2MSDB 4B3BA 4B17A 1TM2A 3BD7A 4F2WA 3KR1A 3KPUA 3DV0A 3X3HA 1KEEA 1NVMB 3C5VA 4GYYA 4LJ4A 5TF4A 3LY8A 2VF7A 1JFVA 3RRNA 4B3HA 4L51A 1M2WA 2GK3A 4TROA 4E5NA 1DPGA 1RYEA 4JEHA 3SXUA 3L7CA 4HP8A 5INTA 1AE1A 1JSZA 2QRGA 3DWGA 2QL9A 3G02A 5TC4A 4LOJA 2VAMA 4ND8B 3ZVLA 4EKIA 2K7ZA 2Y0PA 1LF0A 2IZ1A 2QMOA 2AJCA 3D8TA 2ERYA 3IIKA 3EBPA 1WPQA 2I4OA 2OHOA 3W4IA 1LTHR 1V41E 3U3RA 3C5HA 2FOXA 3X44A 4EI9A 1GPWB 3B8HA 4O8ZA 1I6KA 3T7DA 2WHQA 1DEAA 3ZWVA 4AYXA 1N2EA 1G8MA 4N40A 1UWVA 5ECYA 1NMYA 3WGNA 4AY6A 1PBNA 1XWFA 1CY8A 5IK2A 2CJWB 4JJIA 3HP7A 2OHFA 5TRTA 4F6LA 1PSDA 3H0EA 4GP9A 1B16A 2BJHA 3H4VA 3DXYA 3OMWA 3RU7A 1GTRA 2ZYHA 5GIOE 1W581 3H1PA 5L3VA 2IVZA 5ULLA 1DUIA 4MW4A 4UM7A 2HLHA 1DOAA 2VBGA 4LXTA 4HXYA 3W7VA 4X1YA 1G16A 3C0KA 1SNYA 5HRUA 5A9TA 4UPDA 1I4EB 1CLEA 2OYSA 2V6GA 4ZCSA 2PL9A 2PTGA 3FCAA 2IWRA 1U8TA 4LBVA 2BFDB 4ERXA 3VSBA 1GUDA 3TPCA 2PT6A 1Y3HA 1SOUA 4I4TA 2D2VA 5CVEA 4C07A 2IS4A 1OYOA 1GUZA 2JFUA 4CKCB 3RUEA 1N2ZA 4DCNA 2Z6VA 2LRHA 3KXDA 5GJWC 4RTRA 2XUKA 3R5SA 3TAUA 10MHA 2P68A 4S0XA 3VDXA 1NN1A 4O02B 3ITEA 1U9YA 2NZ2A 4NBNA 4GPTA 4R9UC 5CFOA 3A4MA 1KQGA 2YYSA 3M8KA 4ZVOA 1BEZA 3CZPA 1KMQA 1J0EA 5L3QB 3T3MB 4ZCRA 2WSLA 2DAPA 3X2EA 1EDDA 3AEYA 3MGAA 3OTOB 3FBTA 4ZVKA 3UW1A 2A5YB 3D3QA 2GK4A 2GAJA 3KOOA 5C18A 2HEGA 3EODA 3GEIA 2C7QA 1U9JA 2EJBA 1Q19A 2P11A 3H1GA 4FFLA 1N8KA 4HT3B 2QTVA 3SS8A 3DE7X 1THZA 3UBMA 3OUUA 4LYGA 1K9SA 3HDHA 1RRKA 5JZBA 4ZEVA 3DC2A 3OFJA 3ASVA 3QOYA 1EDBA 1OXXK 4Q9AA 3D1JA 3UHOA 3BS4A 1BX0A 2AHOA 3OJFA 2MJLA 4KRFA 2ZYTX 4KWEA 4Q1DA 5BVGA 1Q3TA 3DKRA 3JRXA 4HVLA 1DC3A 3DH0A 2R47A 5JZVA 3UJHA 4EB8A 1NYRA 2YXBA 1D0SA 2XVZA 3MINB 5JWHA 8ATCA 5JW6A 3F4BA 2H3EA 5KYXA 2CDRA 1RJWA 4QZVA 3FTPA 4LUCA 1DC5A 2O3JA 4MCAA 1MAVA 2BDEA 3G2PA 2XE7A 4DSOA 4ZOBA 1Z15A 4RPIA 4R9RA 5AXDA 3WK7A 2VSOA 3K2BA 3UA4A 3KC2A 3TSCA 3TQTA 3ROEA 3D4LA 5E4YA 1E2PA 4XPIB 1V2HE 3JQPA 1D7AA 1Q84A 1CR2A 3W5CA 1Z2DA 3K9BA 4FZ5A 4MW7A 1TJ4A 2LZ0A 1I6WA 1IM2A 1DS6A 3AY0A 2ZBUA 4WBSA 2I7CA 2JIZA 1U6KA 3SN6A 4BO3A 2J4CA 1V5EA 4WVFA 3HCNA 5JAIA 1JHMA 3RLIA 5KJ1A 1ZGZA 1EM8B 1E69A 3GQVA 3ORYA 1YB4A 2J45A 1YI8A 1AZSC 2ZBDA 3OZ7A 4YASA 1U28A 2WDPA 3W04A 2EAUA 3QJ5A 3ZU6A 4ZXPA 3ANTA 3IVXA 3KK0A 4TV8F 2CHEA 1ADGA 3WRYC 2V7UA 4ILKA 5AUQA 4UASA 3FUWA 3L5OA 1J1UA 1T4GA 4MVJG 4NMXB 4YRRA 3D59A 2X2PA 3B7WA 1ZM4A 2VF8A 1N1GA 2JFZA 1YL7A 5KTMA 3A6DA 4QNMA 2LIVA 4GOMD 5T6MA 3IXMA 4BVJA 1VXOA 3JRNA 3E9YA 5EE5B 5DIZA 3T1OA 4QU8A 1I3OA 1HKHA 3FBWA 5HE8A 2C88A 4UUAA 3CEHA 4MV7A 2Q7DA 4BFTA 1ZD4A 3AR4A 5JJKA 1SJ9A 2Z2JA 4MOWA 5DTRA 1DEKA 3BA6A 4KYVA 1XA3A 4WCFA 3FRIA 1XMVA 2YCLA 1OFUA 2Y0DA 4RNDB 4GSKA 1FBNA 4DJTA 4JJZA 3L4BC 4QTXA 3LC7O 3SLKA 1LC3A 1NUSA 1U1GA 4HNTA 1RZRA 4V0ME 5C52B 4PLHA 1YWGO 1O58A 2H5IA 5DW0A 4FONA 1R5NA 1W8IA 1ZHHA 1LA2A 3CJRA 1CDEA 1TUEA 2YWJA 4XE5A 5IDVA 3TBHA 4DIUA 2CVHA 3UGTA 2IS2A 2UYGA 1QP0A 5EE3A 1A9TA 1Y5IA 1DOHA 2QIOA 5DTMA 3UGKA 1P62B 3AR9A 1QLWA 3GLQA 3U4QB 3K53A 1GPUA 1DFHA 4FP9A 1PZGA 2H00A 4LBZA 2SBTA 5EPUA 1SBZA 3ZEIA 1VECA 1FDVA 4YXFA 3OICA 4H6WA 3FHTA 3OPMA 5KVCA 2ET6A 3H19A 5L6LB 1PD1A 3U3DA 1C7IA 2YFHA 3NEAA 4EFNA 1KMHB 2WPNA 1RPAA 2VHVA 3NNSA 2W6NA 1U9IA 3I5AA 1GG2A 1ZWLA 4IRUB 3TX2A 2MINA 4Q3NA 1ISHA 4YQZA 3CH7A 3UXHA 3V7YA 4OHUA 4CQJA 4OI4A 2YR0A 4IOMA 1I94B 1NY6A 2W48A 2RHOA 3S1AB 2F3PA 1ADBA 1VLJA 3G9UA 5DBIA 4FSDA 3KZCA 1RQ7A 3W6ZA 4Q47A 1MVNA 3VDMA 5IPFA 2WHPA 3N2LA 2CVQA 1WUHS 2RJOA 1ECLA 1LRJA 2WFLB 3O8QB 5B53A 2WPDA 1AKQA 2BMAA 2XTZA 3KQPA 5ALTA 2QTBA 3VMMA 5KO2A 4YV2A 4YA6A 1FRFS 2HXGA 1F7UA 4H4DA 3CLUD 2FEMA 1QHYA 3B1JA 4OIFA 4EW6A 1UT8A 4YQEA 2JK1A 1MX3A 2QVLA 3TW8B 3UV6A 1PJBA 3WMFA 5I3ZA 2VQEB 2I4RA 4XR9A 4NYIR 2DR0A 4IH9A 1RXIA 2BGMA 2ECQA 2JLRA 3GFBA 5GM1A 4JNCA 1Y6GA 2XMQA 4TV8A 2W93A 4QGBA 4KPUA 1CUYA 3BA1A 1SD1A 2UVDA 5EMMA 1UT5A 2Y1XA 1ZINA 3HA3A 3JQRA 2WD9A 4P7BA 4EZEA 3SKXA 1C0IA 3PNOA 1L5YA 1XD2A 2GWRA 3I6ZA 4KIGA 3USES 3JVEA 2PNFA 1DRVA 5LOVB 3IT3A 2XVXA 4QGAA 3MXOA 1CQXA 2HHHB 2YJ5A 1HLDA 1TF7A 5DH9A 1UFQA 1JE0A 3TNFA 2MYTA 1E6CA 4QDXA 4F2PA 4GECA 3ZE2B 4UEKA 4QULA 1SZDA 1AY0A 3RV4A 4KE6A 2BR5A 4HVCA 3HPQA 1CS0B 2IS6A 5FD8A 2QQEA 3GP5A 4CEHA 5EJGA 4KUGA 4ZKEA 2BP7B 2I76A 1VG8A 4E2XA 1X39A 1O95A 1PIWA 2HH9A 2XLBA 4EARA 1F4PA 3SDZA 4X3PA 2HU8A 1A9XA 3HZRA 4J7CA 3KB1A 4JLOA 4RVCA 4AZ0B 2G0NA 3RIMA 5JYDA 2JIZD 1P1RA 1NULA 4GLJA 4RQBA 4Y30A 1E1KA 2BFBA 2OL4A 2RBGA 4FHGA 4Q7MB 4QQRA 4KXYA 5FTMA 3TCNA 4ZHQB 1H42A 2F8SA 1NATA 3X0DA 3NXKA 1G8PA 1OFVA 3NORA 3HCWA 1VJRA 3HCCA 2A9JA 2W6JA 1DELA 3AT1A 3ZZ0A 3VHQA 3BPSA 3MN1A 2Q3MA 1T1IA 1P61B 1N6HA 1VLZA 3D5QA 3GG9A 3KVYA 4IIUA 1C0LA 1SEPA 3L1VA 3B3AA 5CT9A 4DQXA 2Q6KA 2BGWA 1RAHA 3ZJTA 1ZXXA 4GP6A 1G0OA 1H6DA 1OJ7A 2RGYA 5FWAA 4Y9SA 4RNCA 4IPTA 1WMDA 4RMNA 4NULA 5F1PA 3RYCA 1N7HA 1DBVO 3MD9A 5KHAA 1A8SA 3T0FA 2ZR8A 4W9RA 4ENPA 5KJFA 1F8FA 2GF9A 4ZAVA 1SKBA 4OQEA 2G6BA 1IZZA 1T9KA 1I10A 2HA5A 3JQQA 3H9UA 5LBIA 1G8JA 2DWOA 3AP2A 5CFPA 4PU0A 5LKRA 2QZJA 2RDMA 4YHHB 4Y2PA 4JEIA 4M0FA 4QLBA 2AQ8A 3WP0A 1JKIA 1RADA 4ZU6X 3V4FA 3T7JA 2HHLA 1NMZA 2P75A 2PKQO 3L0SA 3K1YA 1NQVA 3KEMA 2ISCA 1RZRD 4G5SA 1XN4A 2QQ5A 3BM5A 4EA6A 5CDSA 1N9ZA 1KEKA 1FSPA 1SC3A 1YDEA 3C7TA 4EPVA 4X8LA 2XY4A 3PD1A 4KAJA 4N7JA 1R2QA 2R7NA 3NJ4A 2HN9A 2X0IA 3QSYA 3E70C 4A15A 1S3FA 2O06A 4TSKA 1GPMA 2OQRA 1QTIA 3BGOS 3GQBB 1KHTA 3PDWA 3QLTA 4YMHA 2AT1A 3CRRA 3TEJA 4LJ8A 4ABYA 3OT1A 1R4NB 3U60B 2H2IA 1U2PA 1KRWA 2GDJA 5P21A 1OZFA 3UF0A 3V4ZA 3CZ4A 1GO2A 4JLKA 1G3MA 5AK6A 3GDGA 3DYIA 3GMSA 3HKDB 3SQLA 3MGCA 4LOKA 4H08A 5FHQA 2AOXA 4CLOA 3GLGA 2J3HA 2FMIA 3D3EA 4GG1A 2R5FA 2O2XA 3DXXA 3PKIA 1RZVA 1R6UA 2WSIA 4L5YA 3I6QA 3H0CA 4WESA 5JJLA 3E9NA 2ZUVA 2GBGA 2ZWIA 2JD2A 2WJVA 4LYYA 1OZ0A 4QOSA 2A6PA 3QITA 1YQTA 1B41A 3JW8A 3AVUA 3HR7A 1QF7A 3COSA 1MEOA 2Q99A 4FGLA 1MFPA 1E1RA 4QU0A 4F4DA 1P4JA 4AZ3B 2DQZA 5LDDC 3OLQA 1UUFA 5FPKA 3SSNA 1ZJ4A 2D0IA 3O4RA 1LLQA 2ECFA 3GFTA 3PJFA 4W6ZA 3CGGA 1RD4A 4PZ0A 1BMFD 3IPRA 1QK3A 3PNPA 4PBRA 4HUTA 3T7CA 2RK6A 1UEJA 4HGOA 3K9CA 4FX2A 4J8PA 2OCLA 4B3XA 2IUFA 2CCKA 3CN9A 3OIFA 4REOA 4ARIA 5FRDA 1XALA 2DBVO 2Z2ZA 4IW3B 3W2EA 4L8GA 1V4NA 1IG0A 2GZHA 3RT7A 3WMWA 3E5RA 1G3IA 4G1CA 1I3CA 4QASA 2BMDA 3A4NA 2NXEA 4TT8A 5FNVA 5K0SA 1VLLA 1VQ1A 2FSUA 4LRUA 3GMTA 2DFLA 4J0FA 2QSYA 4P82A 4BB9A 2IBMA 4WXPA 2MCFA 1Z08A 3ELBA 5BRNA 5JSYA 1O8BA 1GU1A 1LJLA 2I67A 4MKGA 3LOQA 1SZCA 4IIJA 4N3BA 2YFQA 1SN7A 3GDOA 1GPAA 5HDQA 3WWDA 3GLSA 5C5EA 3BKXA 1HNNA 1VDZA 1QMPA 1JQ3A 1G7TA 3CPSA 4G0NA 4ZCIA 5FUWA 1F51E 5GOTA 4FMCF 4EKDA 1ZR2A 1SOWA 1ZH4A 4OQZA 2ZZMA 1SIOA 2ZJ5A 3FWPA 5TR9A 2Q4EA 1C5KA 5B55A 2HXYA 4X71A 1O95D 4KCGA 1Y4SA 4M98A 1ZK2A 3LQYA 5AJUA 1VIYA 1ODFA 2OMEA 5CLIA 4IKEA 3RUDA 1MX1A 2WUWE 1K6JA 4ZAZA 2V58A 3MCVA 4PQEA 1JSRA 2G3YA 2P6PA 1DARA 5EZSA 4H4CA 4US2R 1UBMS 3I2GA 3V34A 4II7A 4OX9B 1C0PA 3EY9A 4QGSA 1JDNA 2HDNB 2W6JD 2P0YA 2PCJA 4MHTA 3R09A 4FHFA 5AO9A 4BUZA 4MRRA 3KXLA 3DDWA 1JG1A 1U2GC 3DYBA 2WYHA 2ZIZA 4HX9A 3OD5A 4LHZA 1APBA 3DQQA 3BDAA 1PGPA 1VL0A 4NC9A 4DR6B 4J0KA 2GBCA 3VZRA 4ZI7F 3NNDA 2YC4C 4KFUA 3ROPA 1V71A 5BO5A 2A14A 4CLRB 3WTCA 2CFRA 4JI0B 3IR7A 4KMMA 5SZIA 2QK4A 3CXRA 4C0AC 4D56A 4LBWA 4U0JA 3BXEA 3FI9A 3R9WA 5BR7A 2VDOB 3R3VA 1XIVA 3B3QA 1CBUA 2O1WA 4EHIA 2JHAA 1ABFA 5T3YA 1J9ZA 1GZDA 2XDYA 4HK4A 3EIFA 5KHLB 1LY1A 1U0BB 5L9AA 4CTMA 4JLWA 3K2EA 1AKEA 1ZUWA 3JQAA 1GILA 4LNAA 3QF4B 5EJFA 2J48A 4Z0HO 2O14A 4YAKA 3KV1A 5FI0B 1Y1SA 4H7HA 1ISRA 4HDCA 4OUKX 5CFMA 1GG9A 2XZTA 1U04A 3DT9A 3ZIUA 3NV9A 4RYDA 1RKVA 3DOFA 3GARA 2L2QA 3RIYA 7YASA 4J03A 5DEOA 3U3OA 2ZAOA 4MW2A 2OFFA 4TMKA 2FSPA 3VZQA 1MX9A 1J9EA 2IHZA 2IUEA 3RAGA 3B82A 3E1KA 3E3LA 3FPLA 5CH5A 4C7JA 4EGQA 4F5EA 2VSYA 1XC7A 3CRMA 4ZO8A 5F5NA 1Q3KA 5JECA 3JASB 4CF5A 3LSTA 4F72A 1IHUA 5B1EA 3OQNA 3A6JA 3Q3HA 3ONNA 3VNSA 4G8DA 4PY2A 3SOPA 3B7PA 1YVPA 1F0KA 1ZUHA 1D4ZA 1ORTA 2C78A 1E6LA 4MQUA 1JF8A 1UC9A 2W4MA 2HMSA 2FN4A 1GRQA 2HFJA 1PSZA 4QBKA 4IIDA 1WAMA 2CZCA 4NJEB 1IY2A 2GOYA 2NLOA 1JR2A 2Y8EA 5KHOC 4C29A 4IX9A 4EAAA 1T5LA 3M4YA 3AI7A 5JLAA 2HPAA 4EKYA 3LQ4A 2ZYRA 5ECGC 2PX2A 3PUHA 4ZV7A 4RVGA 1GSAA 2XOXA 5LXTB 1FMJA