1DQZA

Crystal structure of antigen 85c from mycobacterium tuberculosis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
280
structure length
280
Chain Sequence
RPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (ANTIGEN 85-C)
total genus 102
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dqzA00
4E15A 5EHZA 4KEAA 5K3DA 4UFPA 1D07A 4HZGA 2QT9A 4B0PA 4HXFB 5JIBA 3IUNA 3WYNA 4RE5A 3MUOA 1Y37A 4UBJA 5LKRA 5DYYA 3OTQA 3EBLA 1MX5A 1W4LA 4FTWA 4MJ3A 5ALEA 3M3DA 5AKLA 3TRDA 5A7GA 4PV7A 2BKLA 3GUUA 5ALNA 4BRZA 2WG0A 2BUAA 4J0HA 2XUDA 3HJUA 2VTVA 2H7XA 4CCYA 3FBWA 4WFIA 1QO9A 2Y2VA 5CT4A 2OGSA 2CJPA 1XROA 1PJAA 4BBZA 4XWGA 4AO6A 5ISMA 1VLQA 3BE8A 2Q0XA 1ISPA 2BAGA 3FLAA 1KU6A 1QONA 1WB6A 4OU5A 3V1LA 4DMHA 1CIJA 3O9MA 3O0DA 3A2NA 2H9YA 2QR5A 3RLIA 1QFMA 4OUKX 4Q34A 4CG2A 1ZI6A 2V96A 3ZLUA 2HHAA 4LXGA 3WK8A 2C0PA 2X8BA 5ALPA 5CURA 5LZ9A 2O2IA 4Q1VA 2IITA 1H22A 4JUIA 1ZD4A 1HLGA 1EDBA 3WKBA 2CEKA 3ANTA 4H77A 2J3QA 3JW8A 4WY5A 4CIAA 5A71A 2QTBA 3FYUA 1EDEA 3FLEA 4UHBA 4W1QA 2ACEA 2VEOA 3STVA 2OLEA 1LBTA 2Y6UA 5LZ2A 2VA9A 4FWBA 3B12A 5ALOA 2AXEA 3GBSA 1SFRA 4C4XA 5AK3A 3BIWA 5ALUA 5C7YA 4HTAA 1QIHA 1QTIA 1E89A 4LXIA 5J3JA 4B84A 5CT9A 1XRNA 2RONA 1R4ZA 3CN7A 5T4BA 2D0DA 2XQIA 4U2EA 3OPMA 4OCZA 4X97A 2NW6A 2WFLA 4LYEA 3D2AA 3H2IA 4ZREA 2RHTA 5AM4A 3IURA 1GZ7A 3RM3A 2HA6A 1MJ5A 5JYCA 1DU4A 1ZD3A 3GROA 4MQLA 2GYUA 2AJBA 4EZIA 1J2EA 1P0IA 1R3DA 3OG9A 3ICVA 1YA8A 1YB7A 3UMJA 2J3DA 4P9NA 1QIKA 2HU8A 1EXWA 1AUOA 4QDZA 4B85A 5D3KA 5HF5A 5K3AA 1ODCA 5E4YA 1UOPA 5T4EA 2QMQA 3E4DA 4QNNA 5K3FA 2WUFA 4CCYB 3DYVA 2C4HA 4N5HX 4W1PA 5AP9A 3EQ7A 3H17A 3HABA 5SYMA 2ES4A 1KU0A 4DIUA 4BP9A 2DHEA 2GBCA 2J4CA 4BVJA 1XZMA 3TGLA 4DSZA 1SCKA 1LBSA 3R3WA 1EH5A 2VT7A 4EHBA 1ZD2P 5LZ4A 3H2KA 3H1AA 5IVIA 3JWEA 2QUAA 4X90A 4HS9A 5JAPA 5I7UA 1EB8A 1Q0ZA 4Y2YA 1EDDA 3D2BA 4P92A 3VVLA 2B4KA 2OAEA 3WA6A 1VOTA 4MWTA 3C8HA 5AKXA 1YB6A 4GW3A 4B6GA 4DLNA 5E4TA 5CTAA 4AMZA 4L9AA 1VKHA 3HSSA 1CUJA 4DSAA 2VJDA 3FSGD 2QKYA 5HKBA 4H7JA 2DQZA 2BGNA 5DTJA 2CB9A 4YPVA 2HU7A 2BUCA 3I28A 3NGMA 1IMJA 3W9BA 2XQJA 3IA2A 5ALZA 1THGA 4BRSA 4NVRA 4MWSA 1VE6A 1ZJ4A 4QDXA 4DMFA 2HA3A 5FXMA 3WK4A 4C4YA 4LXHA 1G66A 2C5GA 2DFPA 3AJAA 1FJ2A 1IUPA 2H1IA 2WHPB 1RWQA 2CMFA 1XLWA 3E1GA 2ECFA 3QYJA 4WCVA 3C87A 1UK7A 5EIHA 4J0KA 3OC0A 4QEKA 4Q82A 3O4HA 1P0QA 4W1SA 4KE6A 4FFVA 2I78A 4AMYA 1UXOA 4FFWA 4KRYA 3AUKA 2PU5A 2PKYX 1BU8A 1MT3A 4K6KA 2Z8ZA 1XZEA 5AIBA 3YASA 3D7RA 3WK6A 4PF1A 2WKWA 5AOCA 1XQVA 5E2IA 4JNCA 3Q0TA 1A7UA 2V9ZA 4YX9A 4H35A 1H2WA 2GZRA 4NS4A 1GGVA 4FLFA 3WWCA 3WMRA 2V98A 4I3FA 1DT5A 2XUOA 4MYDA 5BWBA 3D0KA 3M82A 3STYA 3WJ1A 2XMCA 1SOMA 4G4JA 1QOZA 1YSCA 3O4GA 5AO9A 4B81A 4GECA 2WFLB 4OYLA 4EY5A 4PNZA 5C8VA 3Q8WA 2OCKA 2OQIA 2YXPX 5JALA 4N8DA 2HDWA 4X6UA 3KWFA 3QVMA 3WL7A 4FLMA 3W9UA 1C7IA 1X70A 1B6GA 1E66A 4X94A 4IH9A 4UHCA 1BROA 1VZ3A 4KE9A 3QPCA 7YASA 3E0XA 1XZJA 5EHXA 2P8SA 4AO7A 3KWJA 3DS8A 1EHYA 1CUGA 4OU4A 5CT6A 3FOBA 2RAUA 5AI5A 2BUBA 3OOSA 5EHQA 3QPAA 3AIOA 3DOHA 4OB8A 1XRRA 2G4LA 2QJRA 4GHWA 1A8SA 1LZKA 4WDQA 1F0NA 2HIHA 2VAVA 3B3QA 2VT6A 5KBYA 1PFQA 1CUXA 4GLBA 3C8DA 2ORYA 4UBKA 4EBBA 4N5IX 3R3ZA 1CUZA 1E8NA 1LPOA 2EDCA 5ALKA 3A2MA 5CH5A 2H7YA 5FDFA 1JJBA 1G42A 4U2FA 5JAHA 3C70A 5AKHA 1A8UA 2O7VA 4ZRDA 3TEJA 2C5FA 5ALXA 4B82A 5CH8A 3QITA 1EA5A 4BTLA 1JT2A 5AKGA 4ZGBA 2ZSIA 2XQGA 2W6CX 3D4LA 4QA9A 1QFSA 1WOMA 5D6OA 4E46A 1GPKA 3A2LA 3WIOA 1JU4A 3IUQA 3FNBA 3WK9A 1XZKA 4B0OA 1O6GA 1R9NA 5JAOA 5IKXA 4FBLA 2G63A 3AFIA 2WJ4A 2D5LA 2DR0A 5EIAA 4J0JA 5T4HA 3L1IA 1QIDA 2ZYRA 4ARAA 3DJYA 5HQ3B 1O6FA 4UUQA 4J03A 1H2ZA 4XIIA 5FKJA 3BF7A 5AICA 3STWA 2WIKA 5YASA 3R0VA 1WB5A 4GI1A 1KEZA 5AM0A 4L0CA 1QIIA 3LIPA 1XZIA 1L7RA 1EVEA 3PF8A 2HA7A 5AHXA 3N2ZB 1Z68A 3OURA 4K2AA 5AI0A 4H7KA 4XX1A 2CKMA 2PBLA 1RYYA 1UK6A 4EY8A 4G8DA 5AOBA 1N1MA 4LIPD 4GWLA 4WFKA 2HFKA 3RK4A 3PDCA 1TAHA 2PU7A 4Q3LA 4MXDA 2OQVA 1QTRA 2Z3ZA 3I6ZA 2WFZA 1E8DA 1W6RA 4NZZA 2I03A 2FJ0A 1J06A 1XZHA 1ZGCA 2Z8XA 4X71A 1JJFA 6YASA 4PQEA 3H04A 1DQZA 1VZ2A 4BCBA 5T4FA 3D59A 4CIBA 3O4JA 2WUEA 2DHCA 5IH7A 3F8SA 2HA2A 3I1YA 1CR6A 3C6BA 3UUEA 4F5ZA 4ARBA 4TPKA 5EI5A 3V48A 2PPLA 1DT3A 1HBJA 1K6EA 1R9MA 3F9CA 3P2MA 1OCEA 1XZFA 4ZI5A 4V2IA 5D3ZA 1H2YA 5DNUA 3KDAA 5JZ9A 3LLCA 4H7IA 4G1FA 3BXPA 1Y7HA 2QVBA 2HADA 4I19A 3DLTA 1XQWA 2VATA 2BCEA 2HRQA 3U1TA 3LIIA 3NUZA 4Y2TA 3WIBA 2GBGA 3K9BA 3I6MA 3W06A 2AJCA 1GXSA 5AM2A 1TK3A 2JBWA 2O2GA 5FRDA 3PICA 3NOXA 4KAAA 5IVKA 1XZDA 5KREA 2ZYSA 3WL8A 3VKFA 4CCWA 3WKAA 4ITVA 1CUEA 4FMPA 2EEPA 1EINA 1W1IA 5A2GA 4PSDA 5CMLA 3G0BA 3MUNA 2R8BA 1K5PA 3FVRA 4KJXA 5AM1A 1Y7IA 3G7NA 4KACA 3HZOA 3PE6A 1XZGA 2GYVA 4P08A 5HK8A 4CG1A 4ZWNA 2R11A 2WUDA 1MNAA 1QGED 2XMQA 4W9RA 1E3QA 4HRXA 2HM7A 5LLSA 1W52X 5ALJA 2DCMA 2CZQA 4TGLA 3HC7A 4GDMA 3W04A 2WIGA 1WPXA 4UHFA 1U4NA 4AN1A 5A7FA 2OCLA 3ZV7A 1VA4A 1BEZA 4JYMA 1MX1A 1C7JA 1UKBA 4H7DA 5AK5A 1G5FA 2XUHA 3WL6A 1UK8A 2WLSA 3G0DA 4WJLA 1NU6A 3AIKA 4BDSA 3WI7A 4X3CA 4RNCA 4Y7DA 3G0GA 3HI4A 4H18A 5HCUA 1BRTA 2JF0A 2UZ0A 3WLAA 5JANA 3C5WP 2RHWA 1XKLA 3PFBA 2G5TA 4BC1A 2VJBA 4QLOA 3WJ2A 4Y2PA 3H19A 2JGLA 1M33A 1F8UA 3MVEA 4HAIA 1PV1A 1QO7A 2PUJA 2JGMA 2QS9A 5DYWA 5AKIA 4BB0A 2XI4A 3NWOA 4X6XA 4F21A 3G0IA 1AURA 1XQYA 1K4YA 1DINA 3W2TA 1CLEA 4F0JA 3JYHA 2J4FA 5LZ7A 1GQRA 4YASA 3R40A 2PSFA 2XT0A 3AILA 1FSSA 4Q05A 1U65A 2JGKA 5AK6A 4Y2UA 2XLBA 2XQKA 5EGNA 5FPPA 5DLPA 1UWCA 2JGFA 3FAKA 1K63A 1H23A 2XMSA 3DOIA 1T2NA 4H0CA 3VDXA 2Z5GA 4KAJA 4QDTA 1LLFA 1XRLA 2PX6A 3STUA 3IUMA 4J0CA 3H2JA 2VJCA 3IB3A 3ZLTA 2ROQA 1BCRA 3V1NA 4BAUA 4U2GA 2OAGA 5K3CA 5ALDA 3G8YA 3VISA 3M81A 5C8XA 5AKKA 2XUIA 5IVDA 4H7HA 4L72A 1CUVA 5JASA 3AIMA 1IVYA 2X5XA 3H2HA 4FOLA 4A23A 5DTIA 4J0IA 3LP5A 4G4IA 4DNFA 1YAHA 4U2DA 2C7BA 4PSCA 1THTA 4P93A 4A5SA 5EFZA 3F98A 3WQHA 3KOOA 1QZ3A 1WHSA 3FSGA 4DGQA 2XMBA 4OSEA 1CUIA 5ALWA 5JD5A 1CUUA 5H3HA 2WUGA 4X00A 3HEAA 1DX6A 1JU3A 3QPDA 1AGYA 2OGTA 4ETWA 3EF3A 3RKSA 4PSUA 2BGRA 2XUGA 4HVTA 4Y9SA 4L3WA 3WZLA 5DJ5A 2HL6A 2GZSA 3DNMA 1N5MA 1ETHA 3VJKA 1LPMA 1YS2X 3G0CA 4W1RA 3BF8A 3SX4A 4CG3A 4AXBA 2LIPA 4FDMA 4UBMA 4B9EA 2ZSHA 1FFBA 4WFJA 1XRMA 4LHEA 3O4IA 2EDAA 3VVMA 1ZJ5A 5SYNA 3R3YA 4LKOA 4ROTA 1CFJA 2XQFA 2WU4A 1IZ8A 1I6WA 5HFAA 3W05A 1TRHA 3BDIA 4X85A 2Y1KA 2OG1A 5A7HA 2RIPA 1UKAA 5JD6A 1NX9A 4J7AA 1ZD5A 1HL7A 4Y2RA 4WY8A 4B83A 4Q3OA 1XZAA 3FYTA 3QM1A 3B5EA 5BOVA 3AINA 2HA0A 4GEGA 1ACLA 4H7EA 3F67A 5A6VA 4XVCA 1LNSA 3GFFA 2I3ZA 4U2CA 4CFSA 3PFCA 1EB9A 4H7FA 3H2GA 4YK7A 1OILA 1MN6A 1EK2A 5E4JA 4IH4A 2ONCA 1GT6A 3QBJA 1UOQA 1BEEA 2ZYIA 1BN7A 4DNPA 4AB1A 5ALSA 4M0MA 5BWCA 2HU5A 4AZ0A 1UZAA 2IX9A 4G4GA 5DYTA 4Y2XA 4EA6A 3WK7A 1CUYA 3R3XA 2WQZA 1ORVA 4BVLA 2YH2A 3SC2A 4RE6A 1JKMA 2WJ3A 1TCBA 4PO3X 3HRHA 1T4MA 1QIJA 3VXKA 4BE9A 4RGYA 3I2KA 1ODTC 1HPLA 4NMWA 3G9XA 1CV2A 3GZJA 1YA4A 3IBTA 1W75A 5C8ZA 5AM3A 1LPBB 2XDWA 3DYIA 1DWOA 4XJVA 4X95A 4X7BA 3IIIA 3WWDA 2JGEA 3AZOA 4C4ZA 4X93A 5HF8A 1LGYA 4G9EA 2CUTA 3I1IA 4WDRA 2GBIA 3ZWQA 1MAHA 1MTZA 5ALTA 3C43A 1USWA 5EHNA 4JH0A 1EK1A 5HFNA 4HRYA 1EI9A 3E3AA 3DQZA 1VE7A 4OB6A 3R3UA 4K6HA 3S8YA 1F0PA 1S8OA 1U2EA 1YCDA 4BVKA 1XZLA 3G02A 4S0XA 3SK0A 1CRLA 3PUIA 1JJIA 4ZXFA 3I2GA 5LKAA 1BE0A 3STXA 3V9AA 4FBMA 2JGIA 1N8SA 1ACJA 1IUOA 3N0TA 2QZPA 5I9IA 1R50A 5K3BA 5ALQA 1XZCA 1SC9A 2IIVA 4GXNA 1ZIYA 3O9VA 2WTMA 2PSEA 1BN6A 5HQ3A 3LS2A 5CW2A 3A70A 4IO0A 1GQSA 5D7BA 1CVLA 1UFOA 2AJDA 2O2HA 2GYWA 1P0MA 5CXUA 4K6GA 1CUDA 4UBNA 5AK4A 5AOAA 4KAFA 2X76A 3FCYA 5JZSA 3G9UA 1LPPA 3R41A 2WSLA 5LIPA 2W22A 3CCCA 1RP1A 4FLEA 3K2IA 5FP0A 2AJLI 1W76A 4ZV9A 4BE4A 2WHQA 5HF9A 1ZICA 1MPXA 3TJMA 4C01A 4UFNA 2WG1A 3WWPA 4UPDA 3DL4A 3BDVA 1XLVA 3VJLA 2XMGA 4X6YA 1MU0A 1XQXA 4BC0A 3I6YA 4MEAA 5HK9A 1FFAA 1NU8A 2H7CA 1XKTA 1P0PA 3L1JA 5AM5A 3F97A 2ZJ7A 2BJHA 1SCQA 5AH0A 2OXEA 1XRPA 1FFEA 5ALLA 2DHDA 4KE8A 2XMZA 1Q0RA 4EY4A 1HQDA 5AKZA 2E3JA 1XRQA 1WB4A 3EIOA 4G9GA 4E14A 2YASA 2HRRA 3K6KA 4EY6A 3DKKA 2VQ6A 2DQYA 3FWHA 2XUJA 3C45A 3I2HA 4BTVA 3C6ZA 2OPHA 3WKEA 1AMNA 2HA4A 1ZIXA 4BAZA 1QIFA 2XUQA 3F96A 4KYVA 4EB0A 1YR2A 2QM0A 2YYSA 5FOQA 2ZVDA 3STTA 5CXXA 2JEYA 4QLAA 4Y2JA 3R3VA 1R1DA 3FVTA 1HKHA 2ZJFA 4Y2QA 3OM8A 1FFCA 1TCAA 5CT5A 2HFJA 2PL5A 4BCCA 3UUFA 4DTCA 5K3EA 3FLBA 5CBKA 4JYPA 2XUKA 5JADA 5LP1A 4DNQA 3DDUA 1LPSA 4OD0A 2Y2UA 4KE7A 3PI6A 4U2BA 3BIXA 1Q83A 3DKRA 3I2JA 3EQ9A 5LZ5A 5JATA 2C58A 2WHPA 4UFOA 1HDEA 4FNMA 3BJMA 1X2EA 3FYUB 4M0FA 3D2CA 1J07A 4BAGA 1WHTA 3VJMA 4DM7A 4QWWA 2O7RA 2WU3A 3QMVA 1DX4A 3WKDA 4IQ4A 3WZMA 3IULA 4HXEB 1QJ4A 4B7ZA 4BYMA 2WIDA 5DNWA 1H2XA 5ALMA 4N8SA 4DMKA 2QXTA 1CUBA 2WILA 2XUAA 3ED1A 4G8BA 1WM1A 3WL5A 4I4CA 3LCRA 1DWPA 4J3JA 1ORWA 4UBIA 4B9AA 3C5VA 2AJ8A 2B20A 3CN9A 3FYUC 4HXGA 4UBOA 5DWDA 5AI8A 2Y6VA 3ICWA 2V97A 3C6XA 3DEAA 5KWIA 5LZ8A 2RI6A 1J1IA 4K5QA 5ALHA 1CEXA 4QDUA 3FCXA 3KXPA 1A8QA 2XMRA 3GELA 4QZVA 2FJPA 4PW0A 2RGUA 5AIAA 1LPAB 4FHZA 2PUHA 2VAXA 2WJ6A 2VJAA 2XUPA 5AKEA 1GKLA 3V1KA 5I8PA 1CQZA 4BZWA 1JMKC 3WYDA 1AC5A 3PF9A 1U8EA 4QE3A 4KRXA 1JFRA 1DQYA 3I2FA 4GBGA 5AJHA 1CUAA 3C6YA 1UKCA 2ACKA 3M83A 3BL8A 4F60A 3DL7A 4N8EA 4M0EA 1AX9A 1ZI9A 4J0GA 3ESCA 5K5EA 4Q3KA 1AZWA 5ESRA 1QIGA 1QE3A 5CT8A 3QMMA 4UBLA 1VJ5A 2WTNA 2XLCA 2BFNA 5C81A 4EUSA 1IZ7A 1ZGBA 2QUBA 4CI9A 4W63A 3ESDA 1ODSA 1CUFA 4QDOA 1DWQA 4FKBA 4C87A 3DD5A 3SWWA 1AQLA 2QXUA 1TIBA 3QH4A 1XFDA 5ALIA 2PSHA 1EX9A 1X2BA 4MEBA 3ZI7A 1LPNA 5ALRA 5AI4A 5FUMA 1CPYA 4C6HA 2XE4A 4AX4A 3KD2A 1BS9A 3IVMA 5K3FB 1MAAA 2C0QA 4EY7A 1CUCA 1CUHA 3HACA 3QZUA 1CQWA 2JGJA 3U0VA 3WA7A 2WHRA 4Z49A 5DNVA 4B80A 4DYHA 3H0CA 3X3HA 2B61A 4MQMA 5FLKA 2Z3WA 3ZLVA 4J0DA 3CXUA 3S2ZA 5CRIA 4AN0A 5EIEA 2FUKA 1GPLA 5AKYA 4AZ3A 4C89A 2JEZA 3CCBA 2FX5A 4O08A 3ANSA 5JD4A 3IDAA 2ZYHA 2PVSA 5JARA 3ESBA 1XZBA 3KSRA 1DTEA 1YASA 1YS1X 1QIMA 4BP8A 3AZQA 3D5EA 1UOOA 3AZPA 1G4HA 3WWEA 5BV7A 4X92A 1QIEA 2CBGA 3IUJA 5ALGA 1XLUA 1A88A 3RARA 5CH3A 2VSQA 5LYYA 3BJRA 1BCSA 1IUNA 3GA7A 2OCIA 1GKKA 1OXMA 1L7AA 5AI6A 1C4XA 2JIDA 3V1MA 2XMDA 1K8QA 3G9TA 4BDTA 1TKRA 1VXRA 3ZPXA 5A62A 5JAUA 5KWJA 4IH1A 4A16A 4C88A 2PM8A 3ILSA 1CUWA 1FFDA 3DCNA 4QWMA 4FNGA 4X91A 1Q84A 1VA5A 3HLKA 4UHEA 2OGZA 4ZV7A 3T52A 1E5TA 2QJWA 4BZZA 1SCIA 3HXKA 1MX9A 4G8CA 1R88A 5AI9A 4OYYA 2WFMA 4AO8A 4BCDA 2I3DA 2QOEA 5HF6A 4DNOA 2WIJA 2B9VA 2K2QB 3WK5A 5FPQA 1CUSA 4MYSA 5AKJA 2PSJA 4IHAA 1N5RA 1TQHA 1TCCA 2WIFA 3L1HA 5FV4A 5ALYA 4KR0A 1ZI8A 1UK9A 3T4UA 3QMWA 5HZGA 4INZA 3MGAA 4BATA 2XUFA 4RPCA 1VXOA 2XB6A 3I2IA 3A6ZA 4UHHA 5ALFA 4D9JA 4Y2SA 4OPMA 5HKAA 5F4ZA 2DSNA 1LZLA 1B41A 2HA5A 3EQ8A 1YAJA 3D3NA 3PUHA 3WKCA 1JMYA 1F6WA 5ALVA 1JI3A 2PSDA 2G5PA 3H18A 1ZOIA 4AQDA 2VF2A 5IVHA 4G5XA 4Y2VA 1MO2A 2ZJ6A 4E11A 1QLWA 3G9ZA 3ESAA 4JEIA 1WCYA 1MNQA 1WPRA 4TVKA 1GPNA 2OCGA 3BWXA 1AKNA 1E8MA 3HYSA 4DMCA 2QRUA 4UHDA 4OB7A 3WWOA 1EVQA 2WM2A 4LYDA 3O95A 1UT6A 5JZBA 2WG2A 3H1BA 2GBFA 1L7QA
chains in the Genus database with same CATH superfamily
3CG4A 3OQPA 3JQRA 1P39A 3PFNA 1M1XB 5FUVA 4C4SA 5BQOA 3L7DA 5K3DA 4YONB 1W36B 2WICA 4RZHA 1NXWA 3RS4A 4HZGA 4JLAA 1CF4A 4K7JA 3MJDA 5C4IA 4O25A 1TB4A 5JIBA 2RKBA 1ZK3A 3WYNA 4CLDA 3D6FA 2XHEA 2BC9A 4X1KB 5LKRA 2J6CA 4RW0A 4IYJA 3KT8A 3C3JA 4FNAA 2VDRB 3HJBA 4PVCA 1J4AA 1WABA 3TEMA 5AT1A 1YZKA 1G9XA 3LXXA 1TO1E 1FU8A 3CXRA 4G63A 1X1SA 2HLNA 2GN9A 3QLEA 2V45A 2ZSEA 3V33A 2IH2A 3LBHA 4HGOA 4IJVA 3CQ9A 1CBUA 2OCDA 3M3DA 4PCVA 1TEXA 4G5FA 1YBAA 3BCHA 3COVA 3IV6A 2H2GA 1GILA 4IHJB 1M2VA 1HMYA 2AHOA 3TCXB 3C3YA 1KEUA 2BKLA 2R8RA 2YV5A 1E1RA 4BZPA 2DUNA 1CY7A 5JPCA 2QRJA 1UIRA 3N39C 5DBOA 2JLYA 5LDDC 4AG6A 3KKZA 1ORRA 4XEHA 4WOCA 2IXDA 1UXJA 1TW2A 3L8EA 5D1NA 3HDQA 3RIGA 4RTNA 3WWZA 2G17A 3C14C 3H9CA 1XJQA 2PT9A 1P4SA 1IJBA 4QGHA 1OJ7A 2Z2IA 4ZOCA 1P5FA 4A8JC 2H07A 1EZ4A 2VTVA 1AHHA 3IL2A 1OX4B 3ADKA 1NXXA 4I55F 4ZQBA 3F3SA 1M1NA 4QUGA 3RHSA 4E4TA 4ZZ3A 1PI3A 1C14A 2AW3A 1UWLA 1EFLA 3HDHA 2OGSA 2FLVA 5CT4A 1XROA 5FNVA 4DAOA 1PV2A 1M7GA 1KF0A 3CLSD 4XWGA 3MS7A 5AMXA 3HYCA 3RG8A 2IE0A 3A36A 2CFRA 3SKVA 5JNUA 1IYZA 1BE6A 4E1VA 2XB9A 3L2OB 4MEJA 5KOHB 1SBHA 3RWBA 1KU6A 1VJ1A 2XTNA 1G98A 1BHJA 1M0TA 3MT0A 4ZCQA 1TIPA 3COYA 5ELLA 2O8FA 4G8JA 4JI6B 4P5DA 1YKFA 3A2NA 1HEIA 2H9YA 2OBYA 5IUNC 2QR5A 3AESB 3FDZA 1M34B 4A03A 3I9NA 4WLFA 4JYCA 2D62A 3U49A 5J4KA 1DE0A 4YJ2B 4L0DA 2CBXA 2W2KB 4YRPA 1PT8A 3DBHB 3F6CA 3ZK9A 5CCXA 3JYNA 1ZI6A 2F3PA 3DFMA 1VC2A 1AXRA 3D6UA 3JX9A 4G41A 4GIBA 4UM8B 4EG3A 5A0TA 1X14A 1Y7TA 4V39A 3O8OB 5HUQA 3U16A 2J30A 4LXGA 1G3QA 4EUNA 4I8IA 1Z3IX 3WK8A 4CNQA 2DPYA 5ALPA 4JENA 2IS6A 1XTJA 1RRMA 1QCZA 1FZQA 1YQTA 2O59A 5IUKC 2WOJA 1BHO1 2FPGB 3LG2A 1JEYB 5LZ9A 2VDPB 5D2CA 3THYB 4JDPA 2JHCA 3OZ7A 3Q3HA 1SJ9A 4HB4A 2H51A 2IITA 1ZJJA 5AUOB 2XCQA 3S70A 3PHCA 3UK6A 2A5GA 4TXNA 1E0JA 1HLGA 1EDBA 2FSFA 5EQTA 1PRYA 3V7UA 5DHQA 4Y7CA 5AVQA 4H4EA 2CEKA 2YHSA 3ANTA 1JT9A 4RESA 3D7LA 3K31A 4WKPA 4GO1A 2J3QA 4EJMA 9MHTA 1UXKA 2XX3A 1RWOA 2QF7A 4I2VA 5CUQA 3OWHA 4HDQB 1RAAA 2BGGA 5KSZA 1LSSA 2NXNA 5A9SB 4M2LA 2ENWA 4CIAA 5A71A 4LZAA 2QTBA 2CDRA 1Y9ZA 1DC4A 1NOJA 3JQBA 4S1NA 4TTPA 1ISSA 1JFFA 1T2DA 4UHBA 5DM2A 5TC4A 2HLDD 3SPXA 3W7VA 4ENRA 4YRSA 3VSCA 2C7RA 2AOWA 2VP3A 4RMNA 2VK2A 1DJPA 1NYLA 1VIVA 2JJMA 4UU7A 2CDNA 3WDMA 2ACEA 2R00C 4CPDA 4JCCA 5IMBA 4D9BA 2Z95A 3ZWXA 1DO2A 4W9MC 4BS9A 5F5NA 1RI3A 1VDMA 3GFRA 4QYXA 5LZ2A 3TIIA 3THYA 3E3OA 1CJMA 3ZD7A 1SC4A 3I53A 4FWBA 4JI5B 3DDCA 4CTNA 3P71T 3PGJA 2QT0A 3F7TA 2DXIA 4ZAXA 4HLCA 2F8TA 5ALUA 3BGSA 1C81A 3BE5A 3DPUA 4FN5A 5KNDA 3MWGA 4PAGA 4HTAA 3UOGA 4FCTA 1YS6A 3OZTA 2FPXA 3IERA 1XDGA 1G291 5JCXA 5TQ0B 1FVHA 3EY9A 3P9KA 3H4MA 2H0QA 1R4ZA 2VF7A 1M75A 1X87A 4J0QA 3G5MA 2EGGA 3CN7A 4EB8A 1KYWA 4YN3A 2W6JD 5FI0B 2XQIA 1ZK1A 3EGOA 3QLUC 5ESWA 1L9KA 1YKSA 5JTUA 4IIDA 2VSOA 2BW0A 2OHXA 4IXMA 3DVSX 4J7XA 2OP0A 1NMYA 2WFLA 4PHCA 4C2UA 3NT5A 4UEWA 3PGMA 3RK0A 2ZRLA 3UJ6A 2OHHA 4MWDA 4MVJP 2HCTA 1JFSA 4RTQA 4W8OA 3BB3A 3EEYA 5EFOA 3RM3A 3CRRA 3T9AA 4BMCA 2YWJA 1Y6JA 1ZD3A 4FYWA 1E6MA 4AD8A 3VHXA 1PT9A 4L2IA 3MM4A 3U26A 2Z5FA 2ZT5A 1VPWA 4AI6A 1VQ1A 3QVXA 4HHEA 1P0IA 1R3DA 2NZXA 3OG9A 1SXJB 3C3MA 3FKSA 4EIWA 3UJ3X 3G79A 4BUZA 1LDNA 2YJGA 3DZFA 3N6XA 4RD2A 4EPYA 5C0OE 1U1CA 4PG6A 3L7IA 2JLSA 4YJ3F 4AMUA 4KQMA 4Q4HA 4EB6B 2IQ5A 5HOQA 1QS0A 4YT8A 5FF9A 4YBZA 4MULA 3NUGA 5C46F 4YAUA 1M1UA 5DV9A 1FP4B 3KYBA 2V6BA 1ZD8A 3D3KA 2AC4A 5ER6A 2VUSA 3BFJA 3B9BA 4NLLA 4BUCA 1E9DA 1OXVA 4UVGA 1UT5A 4BVEA 2BPOA 4M83A 1E7YA 1RBMA 2V7QD 4KO2S 1D8TA 2I7CA 5HF5A 3VO2A 5A5VA 5IF9A 1RCTE 1SUIA 2F00A 4WJKB 4EHLA 2HB6A 5TGTA 5ADUS 7MDHA 1SUAA 3O8RA 5AQEA 1VLJA 4UDXX 1SUDA 4WCDA 4DJEC 3A04A 1VRVA 4RTMA 1C7QA 2GM4A 3G17A 3ZGYA 4ARSA 3OJLA 3HCOA 4C3VA 4E31A 1H0KA 1MPTA 1SQFA 2HNAA 1NW5A 3ZGNA 4X54A 3IV9A 5I5EA 4I4TA 5HIAA 3M0EA 1BCSB 4PICA 1JJAA 3FNRA 3KFXA 1L8XA 3HABA 3H17A 4BPBA 1F9AA 4QQFA 4BP9A 3K7EA 2DHEA 3MRXA 5CX1A 4QBIA 5F3WB 2I8CA 2J4CA 5ETJA 1JF8A 1SCUB 1QVZA 1V2HE 1ZOSA 5C3UA 5JDCC 4KDRA 4J07A 4DMUB 4EYKA 5IYZB 3TGLA 2PYDA 4CQNA 2X3UA 3GJYA 3BHMA 3E5NA 3SIRA 5DHTA 4Z3KA 1CJUC 4BB9A 2H2HA 3QUCA 1ULAA 4KN5A 5LZ4A 2VNKA 1JFLA 1U0RA 3ELYA 2ZS8A 1TYEB 1YR9A 2RSLA 4IRXA 4X90A 1N8NA 1P1RA 2ZBQA 2ZRCA 3GCDA 4C06A 1MRSA 3ZY4A 2MIIA 1LNZA 1PLKA 2ZR0A 3R6LA 1LX6A 4Y2YA 1EDDA 1R0SA 1HDXA 1XP8A 2B2XA 2CJWA 3CKYA 4P92A 3VVLA 3VKWA 2J59A 3BK7A 1Z6QA 3JD2A 5CDTA 1AUXA 3C8HA 3KZCA 2HYIC 4IWXA 1Z2OX 3OLYA 3P4YA 1P6XA 1E4EB 4LC0A 1LFAA 4K9RA 3TRFA 2QB5A 3U40A 3ZGOA 4MUNA 2APJA 2P62A 2VP5A 4LVNA 9ATCA 4MYHA 4CEIA 4B7UA 2EZ4A 4N01A 2GLXA 4HNSA 4QUAA 4D4GA 3Q5GA 1MEOA 4YFVA 4L9AA 4AMZA 2YV3A 3IXMA 1Z34A 1DS6A 1RXEA 3HSSA 2BGIA 4EECA 2ZJOA 1TJ3A 1W36C 1CUJA 3BMOB 4OM8A 1T2VA 2JANA 4DSAA 3P96A 2B1IA 2HT6A 3TLCA 3MYRA 3UJCA 1Z4NA 4ZHSA 5BOSA 4HF7A 3ZDQA 3KLPX 1DTSA 3OT5A 2OLKA 1IEQA 2GNAA 1KI9A 4HUQB 4QFCA 2PX4A 3HVKA 3LUGA 2BMFA 3DZIA 3ERCA 3S3TA 3MCAA 5G1PA 4PQGA 3H3FA 3BE4A 3I5YA 7REQA 5JRJA 4C6SA 5LLTA 2NO1A 1NJ2A 3GQBA 4EYEA 1L7MA 1VKZA 3MINB 4FYVA 5JZOA 4DEYA 2YV1A 3OOHA 3W9BA 2C0CA 2HR1A 1USUA 2GS9A 1YA6A 4G5OA 4JA0A 1THGA 4A0GA 3SJZA 1RRGA 1ISHA 5CGQB 1RHQA 3COWA 1N1EA 1TKCA 2A14A 4QDXA 4ZMRA 1P61B 2HA3A 2J7PD 2I3GA 1C41A 1G66A 1E2JA 1MJFA 1T10A 4MVCA 1YZYA 5KNCD 3GAMA 1QYWA 1FLDA 1IMOA 1FFWA 1NASA 3DKIA 3KM0A 4JKOA 1TUBB 2CMFA 2HZBA 5IG2A 3GMSA 4YIKA 4ZDKA 2V6FA 1JSLA 1XLWA 3E1GA 5B58T 2BN4A 2ECFA 4P7FA 3QMPA 2YIMA 3GLGB 1FDWA 5CYFA 2PD6A 4WCVA 3DHYA 4YUXA 1ZR4A 2Q0QA 3RVSA 4CV2A 1XJWA 1U5CA 3FTNA 4JI4B 2FFAA 2YHBA 2FFBA 2RGEA 1J0XO 3EDOA 1NBMA 1U28C 3MFYA 5EIHA 1L5NA 1TLLA 2C9CA 3AL3A 2B2CA 4OK5A 4U6SA 1MJGA 1QUFA 3WQQA 3TK1A 3P5BA 5B37A 2H0RA 3LUHA 4MZXA 5ICMA 4JL5A 3ECAA 1EBUA 1BFDA 3ZJTA 2ZATA 3LM8A 3G88A 3NLLA 2GKGA 1EG7A 3NOVA 4MIOA 1G2OA 4A5OA 1XNRB 3JZIA 2BR5A 1UXOA 2FPSA 4KRYA 8ATCA 2Q28A 2PU5A 1GNTA 1O9GA 1RLOA 2WF6A 1HQYE 2CL6X 4JN6B 5B2EA 3WGKA 4P7JA 2WAOA 5L8VA 3TPCA 2JD2A 4IZ6A 3REGA 1EWRA 2QMEA 1XZEA 3H2YA 4OAPA 3BGOS 3W7BA 2J87A 3WNZA 3V80A 5AIBA 4E5NA 2YWGA 2G77B 3WK6A 3MSXA 3JAWA 1BXZA 4Z9BA 1DAMA 4RHTA 5E2IA 1HORA 4OMDA 8OHMA 4FZRA 3A58B 2OMKA 1F8YA 2MDTA 2V9ZA 4UVHA 4YX9A 1Z6GA 3AUJB 3RC8A 4NU6A 3HJFA 3QYPA 3FPGA 1H2WA 4UU1A 4YT4A 4NS4A 1G21B 1B23P 1ESCA 1HDRA 3VX4A 4LYHA 4B8YA 1O95D 1PGOA 2PUCA 2FQQA 3NYWA 2JGRA 2UZIR 4UNSA 5DLDA 3RRMA 5B3JC 3D0KA 4R3UC 3RS5A 2CLMB 3U9LA 3EIXA 2FU5C 3QUTA 4DLZA 2ZULA 1HC7A 1SOMA 4G4JA 4LJKA 4JP3A 1O1YA 4DRXB 3TLGB 1U2DA 3Q11A 1K86A 4EJ0A 3ZE8A 5A6SA 1ECGA 2I4LA 3GJRA 3QFCA 1ZNQO 3FIUA 4PNPA 1OYWA 1I2DA 5AOVA 3NM5A 1A95A 1NN0A 5H82A 4L4YA 4FEAA 3BWCA 2W70A 1M76A 3IE1A 4BGVA 2JJ8A 3RWOA 2VAPA 1Z29A 3FGOA 4PWZA 1OF1A 4GECA 1CT9A 1JLMA 3WV5A 5BQ3A 2FEMA 3A3KA 3E7FA 2C29D 1NPTO 2JA1A 3UV7A 1M8JA 3LNCA 4P0QB 4GKJB 4FHEA 2RGWA 3LWBA 1JXQA 4ALJA 4ZCMA 2NACA 2QLLA 1MXFA 2O1SA 3AOEA 1K7EB 2YWXA 3FBTA 1EZZA 5JALA 4N8DA 4EVSA 1Y9JA 4LYYA 1YONA 2IIPA 4PC2A 3HUFA 4BYGA 2NG1A 2VFAA 3L8FA 3W8DA 5IK2D 2XSZA 5JXWA 2QT1A 5KDOA 2GA8A 5KTPA 4TLAA 5D3MA 3SFZA 4HNVA 4MI1A 4NK4A 4FLMA 3ANMA 4R9NA 1WNTA 2HLDA 5J9FA 3T0GA 2IU6A 4DJTA 1J1UA 4Q1AA 2FDXA 1X9GA 2VHVA 1KPIA 1E4OA 1SXJA 1E66A 3B9QA 3OLWA 4GLFA 4X94A 2PLFA 3AL2A 3D8NA 3V4SA 2DP4E 2AOTB 1EFDN 1T5IA 1HLDA 2VL7A 4KQ6A 1BROA 4EJSC 4G0UA 1N2CA 2PH5A 3H2ZA 4E7PA 3RIMA 3I1FA 1OUMA 4RY8A 5KHOC 3ROTA 4XR9A 3C7DB 4BO3A 2RK3A 1V6CA 3UHPA 2Q3CA 2YZNA 3GPIA 2BMVA 4RELA 4YDQA 2ZCVA 4FZ3A 3PTZA 1W6UA 1XZJA 2QUJA 2XQVA 5EE3A 3AVOA 2Z5LA 5JCOA 2E48A 1XVTA 2QTTA 5TF4A 9GPBA 1J20A 2ZSKA 2AC2A 2JCYA 3GJSA 5G53C 2CD7A 4RDXA 1LF0A 5EJ4A 1R6UA 2P8SA 1MB0A 2HU2A 2ZZNA 4Q16A 2JB9A 5BT9A 4MQBA 4ID3A 4LBWA 5IDYA 3RRBA 4PVDA 2O8DA 1G8YA 4NCKA 3W2EA 3ZE0B 4F7DA 4X1OA 4LBVA 5G41A 2RAUA 2HWWA 1I2CA 3HYRA 4QO7A 4D7AA 1DQPA 5JCJD 2WEKA 3I09A 1CYEA 3OOSA 4Q66C 2CHUA 4K03A 4WLVA 5K1ZA 4CLXA 3S40A 5I4IA 1VJGA 5HUHA 1R0XA 2F2TA 3SHWA 2GEFA 3DOHA 2EYUA 2LV8A 1LWNA 1XRRA 2X2FA 5EMMA 4YJFB 4I4TB 5AVSA 2GEDA 2R6DA 1OT3A 1A8SA 5C3MA 1XQ9A 2F9FA 2XNDA 3DO8A 4PSVA 2IS1A 2HIHA 2MYPA 3B3QA 2ZSBA 1UJBA 4B73A 4RH1A 1PFQA 1UKYA 3PA6A 4NIMA 4BLRA 2ZJ1A 1BW9A 1DKMA 2BMAA 1JR2A 4DJDC 2IBTA 4ZZ2A 1E3LA 4P3PA 1Y1RA 4QJBA 4JLSA 5L3ZA 4AZTA 4BASA 2A30A 1XD2B 2X77A 3Q1LA 1E8NA 1L5VA 4RQAA 1LPOA 4H31A 3KQTA 1E2DA 4MP8A 5ALKA 1HDYA 1SNYA 1HE4A 4P4SA 2NNLD 2H7YA 2D0PB 2ZIVB 2RBKA 1Z8DA 3CWCA 1G5QA 5JAHA 1PJ8A 4HH4A 4MKIA 3TKYA 3UAXA 1OTHA 3LT5A 5EIFA 2QLTA 2Z9DA 1TADA 1U8XX 3HCAA 4HQLA 3ZDFA 4JUAA 2XTMA 1ABBA 5DDIP 4ZRDA 2Z6AA 1RR6A 3A4VA 1V5FA 2C5FA 3K30A 2QZJA 4CLHA 4GDFA 1S89A 1ZGHA 4WY2A 5D8DA 4B35A 1JDZA 1RKUA 4EHFA 1N2CE 2CK3A 5HUJA 3CKLA 1DXYA 1WL8A 2PGJA 5CH8A 4EQ6B 4Q1CA 3QITA 2R7AA 4KK3A 1EA5A 4TVBA 3SFVA 4BTLA 5A5GA 1QRAA 1XA0A 1NY6A 5K0FA 1B7GO 1RJWA 5TE9A 4AZWA 4DCTA 2X22A 2BE7A 5EOVA 2DFLA 1V35A 3PCXA 3KYJB 1PR4A 1JLHA 2WF7A 2XQGA 4CJXA 6ADHA 5BUQA 4V1CI 5JSQA 2ECPA 1AKMA 1ZJZA 4EW3A 1LRJA 1BSVA 2Q46A 2FXVA 3D4LA 3IAUA 2FZ5A 3L01A 4JB2A 5D6OA 1ZVQA 2CUKA 2VBFA 3GVHA 2LIVA 4IINA 5DGDA 1YQXA 5JT1A 1U9IA 3Q9UA 2P4QA 2NYRA 2IOFA 1T1EA 4B0OA 6GPBA 2PK3A 1R9NA 3FTQA 4JEMA 2YJZA 3JQPA 3M5WA 3C4VA 3LOUA 4LC1A 2NUAB 5JAOA 1OIWA 5B1DA 3S4YA 2H4FA 1UFRA 1RCUA 1PTKA 1NUAA 4E03A 2G06A 1RXYA 3B6KA 3KZ1E 1KKMA 1US8B 5FA8A 4KXVA 5EINA 3WHPA 3RAFC 2C88A 3VPDA 1UR5A 4YVFA 4DWWA 2JFUA 5JBIA 3P8ZA 1QIDA 2QP3A 5F1KA 3HU5A 2YIVX 2PX0A 3GZ4A 3DJYA 1OXTA 2WHYA 2PGNA 3QV2A 4XH9B 5HTOA 1KJQA 1X8JA 3IQFA 5DH9A 2QUKA 5P21A 4X60A 4QGFA 1NMZA 2MSCB 2ONZA 1H2ZA 2ZYAA 3OU2A 1W88B 4Q7JB 2FA9A 3CWZA 5AICA 3STWA 3S2UA 3DOCA 2GKOA 2HBZA 1RJEA 4L4SA 3VH1A 2DKOA 2GJ8A 4HCJA 1GLVA 1BA3A 3TF5A 4KTTE 3OHMA 5DTMA 2LR0A 1WB5A 2OPBA 5JDCA 1KEZA 2QGZA 1TQ4A 2AVDA 1UL1X 1WBBA 3T7CA 5AVUA 1QIIA 1I3CA 1OOEA 2YIDA 2SKDA 3DWGA 4LBYA 3OJXA 3T0IA 3SY8A 1KR2A 2AN9A 2JAXA 3IGFA 3LIPA 3RYFB 3VR0A 1EVEA 3GCGA 3GV0A 3WP0A 3G85A 4PAWA 1L5HA 1JAXA 1VL8A 1XA3A 2JASA 3G89A 1E77A 3N9IA 1YI0A 3IEMA 2O5EA 2QYOA 4HDCA 4Q47A 2CV2A 4HLUA 2PMBA 1K7CA 2WZQA 4XX1A 3WAKA 4A8HA 3VPAA 1BU5A 1E6WA 1JX6A 1MMFB 1P2TA 1RWNA 1RYYA 4NE9A 5IAKA 5GWXA 4D79A 3MAAC 2QVYX 5HCNA 4PGGA 3SM3A 2MJLA 1NXQA 4L6AA 4PLYA 3KJQA 4QICA 1PO7A 1MJHA 2R6HA 4R31A 3KCQA 2WV7A 2YDXA 4GWLA 2ZUFA 1R8XA 1XU9A 3QRWA 1HNNA 1T4GA 2A5FA 3TMAA 2GHRA 2WMOB 3TCKA 5B7PA 3WTBA 5CVUA 3LSTA 3FMGA 5LD2B 1XU4A 2WT9A 2OQVA 1IBRA 5JH7B 3ER8A 1E1DA 4GX1A 4IRMA 2JHFA 4WNAA 1CVRA 1TKAA 2QZ4A 3MGCA 4CU2A 1AF4A 1E8DA 4RTKA 4NZZA 2O9JA 3HDYA 2CK3D 2R6R1 2FJ0A 4TKUB 4Q9KA 3O03A 4XIFA 2PZGA 2PXXA 4R1QA 1P7ZA 1V1RA 1GR1A 1CHNA 1PWEA 1Z4LA 1G3UA 1H6AA 3JPYA 2ZQYA 1XFAA 3Q3GE 4XM1A 3SIWA 3PJFA 4AECA 5KOYA 2XNKA 2HCBA 3RCBA 3AB7A 3G8AA 2FSVC 5T4FA 4BWVA 2G1PA 4CIBA 4TUYF 3LQ2A 3RFTA 1L4HA 3RRYA 5JZVA 4D99A 3TG2A 1EUDB 4YMHA 3ROZA 1RADA 2WUEA 1WUYA 2DHCA 3HUDA 3O83A 1NVVR 4WX2B 4YREA 3ZE6A 2HA2A 3I1YA 3P9PA 1Z12A 1WTCA 3VI4B 1DO0A 1VHTA 1ZLYA 2C5HA 2GASA 2WP8J 3C6BA 2YWHA 3N86A 4F12A 1SXPA 4K87A 3BC1A 1J2RA 4UOZA 1E1NA 5KTNA 1N5DA 3QLUA 2INGX 3KZVA 1E3EA 3TXYA 2YYAA 5TDHA 3E8MA 2OV4A 3MW8A 4X8LA 3P2EA 2H52A 1XK7A 1DT3A 4HH3C 2GYYA 5DP1A 1HBJA 2VT2A 1K6EA 4E5KA 3HJCA 3F9CA 2CHFA 5HMMA 1ACMA 1I3MA 2ONYA 5ECDA 4B3IA 3H11A 3A14A 2QA5A 5HWSA 3S1AA 1AT1A 5I47A 1Y1TA 2A0XA 4OATA 3U3DA 4UUNA 3CISA 5LSAA 5M5BA 4Y1RA 1RACA 2WWIA 2BZ0A 2CSUA 2V3VA 1JDBB 2C57A 4WNCA 4AMBA 2Y8EA 4L5YA 5KSPA 3BXPA 4DXAA 1Y7HA 3R0JA 4OJTA 5J1TB 5CDUA 3TW4A 3BRWD 1KYYA 2HADA 4JB0A 1KIMA 4I81A 4JEHA 2VBCA 2BEWA 2FE4A 2QN8A 4PZ0A 3B7PA 2BCEA 4U3JA 1SRQA 2AZMA 3LGXA 1TL7C 1B16A 2B5WA 3M2TA 3VPSA 3IAEA 5GAJA 3VH2A 3PZBA 4B4VA 1E0AA 1KVTA 1OZGA 5DOZA 3ZY3A 5JSUA 2IUUA 4ZOQI 2R4QA 3LC7O 3DHVA 2FMXA 3FUWA 3K92A 5AWFC 5FBHA 1DRUA 3UC5A 1IXZA 4AFNA 5JMOA 2H1HA 1O96A 1GXSA 1IB6A 4R9SA 4TRJA 2O2GA 3UWOA 4G0QA 4PN7A 1VSUA 4CTOA 3H7AA 1VMAA 3PQ5A 2DQKA 1G4AE 3TTSA 3L43A 2J9YB 2Q49A 5FLYA 2YXEA 2AC7A 1KSFX 5D5PA 5M34A 3SEZA 1FB5A 2FPPA 5IWCA 2WB4A 3IIJA 3R5SA 3ZWCA 4WA7A 4DPLA 3NXKA 1PBNA 2R1VB 1IHOA 1X0VA 4HP8A 4BB5A 1QAMA 1NY5A 2JVJA 2NQTA 3HKDA 2QAIA 4PSDA 2EAUA 4FJ2A 4RORA 2R5WA 2DFDA 3LFUA 1XU7A 3BL6A 1AF7A 1DCTA 5FCDA 4C43A 3E3LA 3SJBA 1P4HA 2BRUA 3FVRA 3B1JA 4YRQA 1WQ1R 1Y7IA 1QQTA 2Q29A 3L1VA 2V7EA 2OBNA 2GHQA 3PD7A 1MLDA 3BB1A 4KACA 1U7WA 1AGRA 1XTTA 2EFGA 3DH0A 3F8TA 3HZOA 3PYXA 4HQ6A 4NJMA 4P7BA 4Z9AA 3T7IA 2YN2A 5ARCA 3R7AA 1XZGA 1OLOA 5CVEA 4FNOA 2GYVA 2IY7A 4IAOA 3NWBA 4OHUA 2E5FA 5HK8A 4CG1A 1H9CA 2KBFA 1IBKB 4IIVA 2CL0X 3R4VA 2J5KA 5DM1A 5SZJA 1PNRA 2RG7A 1S2MA 1Z56C 2CFCA 2QTZA 3GFVA 5LP6F 3GT7A 4KDCA 2G9VA 3I9KA 2XMQA 3JYLA 2OFWA 4X66B 2HSGA 3DM9B 3GFQA 1FMCA 1T0PA 2P6MA 2HM7A 4E4RA 3QXXA 4RZQA 3EZFA 4F3KA 2UU9B 1C1DA 3ABIA 2Y1EA 5K03A 4XVQA 4XLTA 3CVJA 4NENB 3CSUA 3ZJ4A 2PX5A 4LOHA 4YMIA 5P8WA 4J49A 3RC9A 3EN0A 3GAZA 4WGFA 3EUEA 3CLRC 1SUWA 4OHCA 2ONKA 1H6DA 2ZRFA 4NJEB 4IKOA 1WKVA 2BVNA 4GDMA 4B76A 4EWLA 5DI3A 2G70A 3FWPA 4NH0A 4A8JA 3Q1KA 1CTQA 2SCUB 3C8ZA 1BKDR 4Q03A 3D3JA 3KBBA 3CX4A 1U4NA 2C2YA 4DSTA 3NDRA 1E79D 4R9VA 2UDPA 1GFIA 1UMBA 1VSQA 2CVQA 1BEZA 3H8SA 2RGXA 3P32A 4UUOA 1X9IA 5TNXA 1KGDA 4L74A 1G21E 2PZKA 2M6LA 1XN1A 4H7DA 3OJ0A 4RA6B 1AHNA 4ADSG 4U7DA 1P2SA 1KI7A 4QTUB 4TN1A 2P6PA 3KR1A 4Q3BA 2C9MA 1UK8A 1M2WA 3CSSA 1PR0A 1FX1A 5JV5A 4DWVA 4F96A 5C35A 1JHVA 4QSHA 5BQPA 5FX2A 1E1KA 1VB5A 2BISA 2D4HA 3PS9A 4OOFA 1E60A 4JA2A 3EVFA 3CF2A 1IB0A 3CR7A 4PO8A 5PGMA 1A1VA 1NXOA 3Q40A 1BXGA 1AUQA 3OCJA 3W5JA 5E9JA 3G0GA 4MUGA 4QT0A 1UJCA 2P7IA 3ESZA 4CMCA 5L4NA 1GZUA 2JF0A 3WRYC 2OXCA 1AXEA 2P9YA 4DA4A 4PLZA 3PDHA 1XEFA 2YYZA 3HMQA 2DULA 3C5WP 2C2XA 3FNFA 5IT0A 3AY0A 2RHWA 2WWWA 1J8MF 1SIUA 1TIKA 2VTDA 2W6PA 4G85A 1NQUA 1RI4A 4IVQA 1CZUA 5HJ5A 1I10A 3EC1A 1JEEA 1IEVA 1QV7A 1UH5A 3ETLA 4LY6A 3IPRA 1HSOA 2G5TA 3C97A 1KK2A 8ABPA 4BC1A 3ICQB 3VNUA 2A6PA 2YHAA 1CETA 3GT3A 3H86A 4QLOA 3TLBA 1KJJA 4KR9A 1NLFA 1UM9A 3MTAA 3SHVA 1KORA 5CHEA 3VMFA 1E7MA 2VOJA 5A4DA 1DLJA 3TL2A 2D2VA 3NHRA 2GZHA 3HB9A 6REQA 3HU2A 3RRXA 2Q4OA 1ULHA 4JJ6A 2Z9BA 4PNHA 4LCEA 2BGTA 2FB9A 2YUIA 1REQA 3PXDA 1PV1A 1YCFA 1YR8A 3K72B 4HAIA 4EATA 1UBRS 3I4LA 4HNHA 3RIHA 2HDNB 2IEIA 2PUJA 5CM8B 5K2OA 5EJFA 3GC6A 3U7QB 3BHNA 3SBEA 3WXBA 4WJZA 4ZVMA 1QFZA 2JGMA 5JY6A 2ORVA 3O5AA 4A7PA 4R8KA 4MS3A 4FGSA 4HX2A 5AKIA 1SXGA 1QYDA 3HR8A 3HU1A 4F21A 2WJPA 1OB5A 3L5KA 3MQ4A 1TUIA 4WK4B 3PT9A 4KAXA 1JL3A 3GT4A 3OWOA 4WCFB 3VYRB 3W2TA 2O0KA 2JLUA 1T8RA 3RAJA 3O7MA 4C03A 3KPVA 4OQMA 4DLSA 4LWOA 2W0SA 4CNBA 1XF1A 3AY3A 2XZOA 2G8NA 3INRA 7MHTA 5KAMA 1WY7A 2E21A 3VJRA 4MH0R 5DK6A 2Q3DA 3R40A 1N3YA 1PN3A 1KK0A 2W8BB 4H0FA 4YMSA 5FUYA 3QVOA 2XT0A 1A9RA 1BH6A 4X3PA 4F2GA 4YRLA 2VUIB 2B5OA 3NAZA 4BV3A 2XKKA 5G3YA 1GKIA 2VI5A 4BBPA 2HGSA 2IYRA 2HKIA 2AJTA 2JGKA 5AK6A 1I2BA 3N2LA 5TJ9A 3ON5A 2XLBA 5AW0A 5GZ6A 1JG3A 1N92A 2IXEA 1J1ZA 1SKAA 1K63A 4WUVA 1IJFA 1R0LA 3C2QA 3LVFO 1VJDA 1P2FA 4P53A 2G9NA 3RUEA 1PT7A 3ZV3A 4BV8A 3DOIA 4R2LA 3A1DA 4UDOA 1T2NA 1XD9A 5J40A 6PFKA 3OECA 4U1RA 5I8WA 4L4UA 4EBFA 5IKMA 2NXWA 3RF6A 4MV3A 1UBHS 2OKGA 1YHNA 3OVMA 4QDTA 5IJ9B 3TS1A 3UJAA 4Q01A 1MFZA 1WZIA 2MYNA 3WLSA 2GZ1A 1P3DA 1JAHA 4LMBA 4YAJA 3K71B 1IQPA 2PX6A 4S04A 2ZS7A 3TQRA 4KQGA 4XX0B 4FR5A 5H5JA 3UB2A 5KSWB 2VJCA 2ZR9A 3IB3A 1FMTA 1GPDG 4DYVA 3CNBA 2ROQA 4MKZA 3ZJUA 3V1NA 2DEUA 2MHCA 2H11A 3QNUA 1Y9DA 1COZA 2XB2A 4ZT7A 2DG2A 1GLNA 2JGDB 3SZLA 5BN4A 4WD3A 4AY5A 3JCZA 1PK9A 1TKBA 5CYPA 1UKEA 1PGNA 4YCSA 3QQPA 2JI8A 3Q85A 5BNZA 2E0IA 4BNDB 4F4CA 3LDHA 5B6IA 3U17A 3LW8A 1L1QA 1L4KA 1S3GA 4HDRB 4JJ7A 5FQNA 3OQVA 3DW1X 4P83A 2BGWA 4JJZA 5FYDA 4EJ2A 1SVKA 2IPMA 2C9OA 3AIMA 1XTQA 4UC0A 3S68A 5GONA 1LB1B 3TW0A 1VHWA 3PC7A 1TK9A 2P4SA 5ABPA 1MDBA 1ZK2A 2V74B 5DTIA 4E2XA 4I5EA 3MCUA 2B1QA 4G4IA 2X9VA 5JZ9A 3NETA 2QUHA 3PHJA 3C1AA 2BHNA 2NV6A 5KYUA 5FNZA 4NP6A 3UT5A 3D8SA 2ZI3A 1XEXB 3CSDA 2VWGA 3T7JA 1SVMA 1EWTA 5CFZA 2R5FA 1LJLA 3DDHA 4XIJA 1E9RA 3RSZA 4ZVSA 1DKNA 1C8KA 1QZ3A 4ENVA 5M29A 1N2EA 2VP2A 4X6LA 5GY7A 1F7VA 1H8HA 3A3PA 5FV7A 5JD3A 3NKFA 3OCCA 3T9EA 3L77A 5F12A 5BMVF 5EIWA 4QOFA 4IIEA 2JLQA 4RHEA 3QSYA 1Y3IA 1DLIA 1CUIA 1ZA1A 1I0LA 1WBJB 3K16A 4EITA 1CUUA 2WAXA 5EHGA 1XVIA 2X3YA 2H00A 4TVOA 4BNUA 5KEIA 1ZGGA 3A9WA 1O6CA 1OFVA 2P4HX 1VPDA 1EVIA 1Z83A 2YQ4A 5DNYB 2BGKA 3EEBA 5EZ5A 3ES9A 3CLKA 5IC4A 2A86A 5KOJA 1T4BA 2COEA 4ZJUA 2XYQA 1Z0FA 3A26A 1DX6A 1VRCA 1HYGA 2XIQA 1QP8A 2ZFUA 4R8LA 1MIHA 3QUAA 3EF3A 1XVAA 3ZH2A 4B6SA 5FPYA 1OI3A 2DH6A 1DBRA 4OM7A 4Y9SA 4YEDA 4EHAA 1GNQA 1OLUA 2C59A 1DC8A 4I66A 5TMEA 5DJ5A 3WZLA 3PXUA 2HL6A 4I50F 2EYQA 3WLHA 5HVNA 2F3QA 1QO0D 1W73A 1WE2A 2B37A 4YAEA 1DCKA 2E4WA 3NIGB 3U5ZB 1L5KA 1EP2B 1WSBA 2H54A 1UADA 1P44A 2PKEA 3G0CA 4W1RA 1X1CA 3LPCA 4UE3S 2Y0BA 4B3DA 4B2LA 2FR8A 4FW9A 4RU1A 2WT4A 4K9DA 4MR9A 4RF5A 3U48A 1TM5E 4MPRA 2O8FB 4LHEA 1PQPA 3FX2A 2PKWA 3SC6A 3QUQA 3WMXA 3NBXX 5IH3A 1VLHA 4ZI2A 4EI2A 4DCJA 4I8XA 4O2BA 2D3WA 3TL6A 4D3DA 2CLSA 2BFBA 4RK6A 4X1IB 2ZJYA 2WU4A 3CO0S 2PEYA 3DPSA 1BQ4A 2B78A 3IQHX 1V71A 2EP5A 1BHQ1 3KTDA 4UTRA 1KZ9A 2DPGA 5HFAA 1UPUA 3KXKA 4K6FA 4C9BA 4PG5A 4WINA 2O2DA 1IWPB 3BDIA 1DFHA 3KZNA 4ARZA 4BQPA 1JPVA 4C22A 1JGTA 2QTCA 3V7WA 4LJ6A 4Z4CA 5TX7A 1WXQA 1KXZA 2W37A 4UU8A 1VDZA 3KKKA 4CKZA 3NGXA 2OG1A 4LRQA 3ZI4A 3GRCA 2RIPA 4MNTA 1ZONA 2PNFA 1UKAA 3W34A 1EP9A 1NF3A 1XDZA 4EPVA 5D51S 1W34A 1QYXA 1QF9A 1ORHA 1Z5NA 3V8EA 1NDUA 3OE1A 3QI7A 2DU8A 1FVFA 2QRNA 4WY8A 4A6PA 1JG7A 4HY3A 4YO8A 3U3JA 4WZAB 621PA 2WSMA 4M8SA 5A6SB 1JB1A 1XZAA 4FFDA 4FE7A 4UUAA 3TQHA 1ZMOA 1E1QD 2I2WA 4UAGA 5LC1A 3P0JA 4NOKA 4NXNB 4FXPA 3DF7A 4F85A 2QE6A 1D6JA 1MG0A 2MYUA 3M33A 4TSRA 1U2ZA 3GK3A 4GEGA 5HM8A 4P98A 4WKBA 4I4NA 1C9YA 1PHPA 4DCNA 1GL9B 1EA7A 2PMWB 1A96A 3I34X 2W00A 2PZEA 1YQDA 3E8XA 2POCA 2WOOA 4N39A 4H7EA 5DMXA 5IAGA 4IJKA 4CN9A 3F67A 5CB4A 2R9VA 1JTFA 4CIYA 1Q1BA 4E2YA 1YS7A 2C94A 3GFFA 3PEUA 2WDZA 4UULA 1GADO 2CHVA 4HJXA 4CM8B 1DKPA 3NHJA 2YS6A 4OV6B 3HB5X 4AYXA 2ATXA 2IHUA 1W9MA 2VP4A 4TLDA 2NO5A 4RJTA 4MQFB 5IJ9A 3DM5A 4HAXA 1CRPA 2ONCA 2P2NA 2GK6A 3KQLA 4HADA 5AVKA 2DAPA 1PDWA 4WA8A 3QBJA 4RIGA 1Z47A 2RHLA 5B6JA 2A1IA 2C99A 2QPAA 4L15A 2ZUUA 4URYR 1BN7A 4OMUA 4M0MA 3IO5A 4QTXA 5IVPA 2QMYA 2W2LD 3WGJA 3E70C 3T5AA 1ZWLA 4HWKA 4ZICA 2NO6A 5BW5A 1UZAA 3PWZA 4WV3A 2QV0A 4PCAA 5DNEA 4QPZA 4NAVA 3TAHA 4TOIA 1KAEA 1KJ9A 3PITA 4RYLA 4BP1A 2X8LA 9LDTA 1R0ZA 2TECE 5EZYA 5I4BA 3RYCA 4PGFA 1IM8A 2HTEA 3G2PA 4W5QA 1XNQB 1ITZA 1YULA 4A0FA 4EA6A 1NJFA 1IQRA 3UK1A 2ZIGA 2N1BA 4I50B 1B26A 3CB2A 1E63A 3PUJA 1ZN9A 1P29A 1SCNE 2ZT7A 3QUBA 3ZQKA 2D1SA 1QK3A 3SC2A 1WY5A 3OCYA 1K6JA 1KH1A 4F56A 2BTOA 1JV2B 2GERA 1TCBA 1E5DA 3RVDA 1XMVA 4EKIA 2X14A 3O4FA 1OI2A 4M99A 4WN9A 2VPQA 5KNCH 1ODTC 4QHYA 1HPLA 3C3DA 3FR7A 1L1FA 1MA3A 3AWDA 3GL9A 5BN3A 1KSHA 3IBTA 1VSVA 2C8KA 4ZGWA 2VPYA 1PL0A 2DUWA 5KYXB 2QROA 4IJMA 3VNBA 3QX3A 3U9SA 3HYNA 3L8MA 3K32A 2H18A 1UDBA 5FT9A 4DN6A 3JY6A 4RL6A 1XZNA 4B3HA 4EG0A 4X95A 1T3GA 3Q7EA 1JQ3A 1R4NA 2PDAA 2RCNA 1MA0A 5CW1A 2CT8A 3QBTA 3VHLB 2GVZC 3IIIA 4NWIA 1AK1A 4NRDA 2JGEA 1PJTA 2BDTA 1S0UA 1H2BA 2CMHA 2NO0A 4JB8A 3U3RA 3HRKA 5F1YA 1QC5B 5CFRA 5HF8A 1JKXA 1SXJC 3DEHA 3EZ9A 1RBYA 3SYMA 4QUKA 5E7MA 3DA8A 4ZVTA 1VL1A 4XFDA 4HTFB 4YCBA 2OK8A 1EPUA 4LHYA 3R9XA 2DE0X 4B43A 1GZHB 3A6HA 4Z4EA 3O7WA 5EHNA 1G0NA 3RODA 3NS7A 4DC0A 1I7PA 4O33A 3FI9A 5BSFA 3BJEA 3P0HA 1PR5A 4JH0A 4ESOA 1PUXA 2IU3A 4H27A 1K8RA 1NULA 4E30A 5IXSA 1FZTA 4XWTA 1ZH8A 4D0NA 1CEEA 1EI9A 3GD7A 4X8MA 1ORDA 3E3AA 2A78A 2YMQA 4E4YA 1ICEA 5JMPA 3LHSA 4IFEA 1ZITA 1H85A 4AZSA 2MINA 3NBQA 1A69A 2QSYA 3ML1A 4RS3A 3R3UA 2AI1A 4RABA 4EABA 4EG6A 4BFCA 4K6HA 1S8OA 1U2EA 4BVKA 5CA1A 3NP9A 2BHRA 1A2OA 5D6NA 1T8TA 3G02A 3HFSA 3DTVD 3GCXA 3QVWA 4JWKA 1LSJA 4MUEA 3M4XA 1JJIA 4XVRA 5E6RA 4ZXFA 3I2GA 4BQIA 1SG9A 1P0FA 1DARA 4MA0A 4UQOA 8ADHA 3STXA 2CXRA 3ZVNA 4MIKA 4EJSB 2YRFA 1DBPA 5AW7A 3U4QB 1C1XA 4KJZA 1ZXBA 2ABWA 3HNOA 4EPRA 1HE2A 2JGIA 5TIIA 2GARA 3O93A 4DFDA 3PDIA 3JRXA 5J5CA 2IDKA 3ORRA 4BN0A 4CTJA 1RZRD 4L16A 3OFKA 4PZLA 1ACJA 2WKQA 3FFAA 4I4LA 2PYZA 2HIAA 4DAEA 4D0SA 5I9IA 2ZSUA 3NQ41 1Q3TA 1JQDA 1QKJA 1R50A 2ZRMA 3K2QA 3L7AA 4MUBA 4MVXA 3TIXB 3KVYA 2AN5A 4RAOA 1L7OA 5FL7A 4BO6A 1XZCA 2ZI5A 2X5JO 3HYLA 3ZX4A 4D3FA 4R2MA 1W59A 1NVFA 1W48A 1FXWA 4QOHA 2HTFA 2HWXA 1D9ZA 4JLPA 1G8JA 3MQFA 2IDJA 3U3XA 1ZIYA 2Q5EA 1KI2A 1JPUA 1QSGA 2BMJA 3HCFA 4L5JA 1Y1PA 3VTFA 1Y9EA 2O2JA 4CM9A 3TECE 5CW2A 1RIFA 5DRTA 2PO5A 1GPBA 1XL1A 3A70A 4JC5A 4MW5A 2RGRA 2YINC 4KIWA 2ATIA 3EOBI 2VK4A 3ZY6A 5B3LA 2EVWX 1GQSA 3EPPA 4N9QA 5D7BA 4L22A 1EAYA 1C1XB 1C8BA 1K92A 4N7MA 4V0KA 5J4YA 4TZKA 2GYWA 1P0MA 2RKWA 1PSWA 3DVQX 4KYTA 1CUDA 4RKEA 3ZOZA 3UGKA 3T4EA 5EMKA 2DMRA 3FCYA 1E2NA 1E79A 4OLBA 2YZMA 2GK4A 3ILVA 3IR6A 2IOYA 2O2EA 4GYWA 4LZOA 4MIYA 3ZHSA 5KJFA 5LIPA 1QU3A 4URUR 1FP6A 5C5IA 1QGOA 3CCCA 3IB6A 3ICCA 4G2TA 1RP1A 5GGYA 1C1YA 1JTEA 3FPBA 4JSRA 1L4LA 5FP0A 5MGBA 4HL6A 1PTJC 1W76A 2GA9A 1N3LA 3N07A 4ZV9A 3D6MA 3EGDB 3HXMA 2VJQA 3D9QX 4O5AA 4ZEXA 4DABA 3PEYA 1MPXA 1UBMS 1CR2A 4XB1A 2V7UA 4C01A 4IIHA 4YRIA 2J0VA 2OHVA 1O3YA 2IVFA 5LQMA 2ET6A 1P7WA 2E89A 4UFNA 2YMPA 4BNLA 4EG4A 4Y67A 4CF7A 4UPDA 2J5BA 4B5KA 2F3RA 1I36A 2Q3LA 3HB1A 3M3HA 1JXAA 1NNSA 2F17A 4YHHB 3T8YA 1SHJA 3BIOA 3JAKB 1X80A 4GD3Q 4ZARA 1VJCA 5KYGA 5DP2A 1WW2A 1QAOA 1SRRA 3VNRA 2QI9F 3KQQA 3P45A 5ECWA 3CJTA 3GLVA 2PWPA 3MGBA 2J32A 2AX4A 2GHTA 1EFRA 2CDCA 3IAS1 3F4KA 1RWKA 2WJJA 4H59A 2VNHA 4R4JA 2WD9A 3Q0IA 4D9EA 4JI8B 5KCZA 5DHPA 2GPTA 4GZ6A 1D1QA 3LXUX 4BU0A 2H7CA 3AI7A 3IAM6 5HE9A 3SF8A 2WTUA 4PCLA 5CB4F 3MWDA 1DEOA 1QYRA 1P0PA 2R2GA 1I6KA 3B1XA 4R2XA 1TQ6A 2AR0A 3A1WA 5HX7A 1PJ4A 1Y5RA 5AM5A 4W7HA 2CLCX 3RC3A 3LXRA 1E69A 1XXHA 1UP7A 2BJHA 2LWIA 1RHKA 2ZRQA 3IDZA 4RS4A 4V0QA 5DGTA 3WQRA 4AZ3B 3NTXA 1TF5A 3AEUA 4OQPA 2ADFA 5JU6A 3LZCA 5BR1A 5AH0A 1HT0A 3WO0A 1P60A 1W8DA 1W0JD 5BV1A 5KKNB 3RSLA 4FGLA 3I83A 3IAFA 2AKAB 3OMWA 4OUDB 1W4AA 1A9YA 2JFOA 1W4RA 4OHRA 2DHDA 5E0KB 4CLRB 4OGKA 4CODB 2FNAA 1Y9AA 2QWXA 3AW9A 2MU1A 4L4RA 1SK8A 3GJ5A 2VAMA 1WPGA 4I1RA 5KU7A 4EY4A 1A97A 4DJ5X 2OP1A 2OCPA 2UKDA 3RHFA 4Q7EA 1WB4A 3GZNB 3EIOA 1GUDA 3QWFA 4G9GA 5LP6B 1FS5A 1NM5C 1NOKA 3O1IC 3T1NA 3UOAB 4E14A 2P9HA 2Q2VA 3A6KA 1FRFS 3HNRA 3OFVA 3DVAB 4UUBA 3T7SA 1TMOA 1NMXA 3KYDB 1XDSA 3O3NB 1W5FA 4TZTA 1PG2A 1IPHA 5IKEA 2C4NA 1UAAA 3Q7TA 2A84A 1TF2A 2C3PA 3OCWA 4G0OA 4B87A 4RAQA 2OHJA 5G0VA 2DQYA 1K5HA 1S9HA 1Q0SA 3FWHA 2FZLA 3BH0A 1U7DA 1UMCA 2XUJA 3C45A 3KVNA 5BWOA 4RHYA 1W581 1BGVA 3S28A 3C6ZA 1JTVA 3WGHA 3WKEA 1GHTA 3M1AA 1QG2A 4KN9S 3IT2A 2Z9CA 1Q1GA 3CMCO 2FPIA 3NHFA 4DDHA 4FWIB 5FWYA 3HJNA 3V4FA 4EB0A 2QMZA 5KZMB 2QM0A 4I5GA 4H17A 4EEXA 3AVPA 1YZGA 4KXFB 3CJRA 1FBTA 2ZJAA 1B1CA 1J9GA 2R4UA 3OICA 3R3VA 1EDZA 4TS9A 4Y2JA 5F35A 3D3EA 3FH0A 3IJ5A 5K8TA 4N3GA 4F92B 1Z4OA 1ADBA 1Q15A 2ZJFA 5DCUA 4XI9A 5DSXA 3RDPA 3VHQA 4LOLA 4Y2QA 4CEHB 3U4MA 2UZ4A 3TTVA 4ZPXA 4RFSA 1RRCA 4EY3A 4TSFD 1TCAA 2QJOA 3PKZA 5KQPA 3AUYA 2FW6A 3OT4A 2HFJA 2WI8A 3PRJA 2B3TA 1QK4A 2C83A 4V0MA 3WADA 5LBTA 1DAFA 3UUFA 2PUAA 3FHLA 5LYJF 2H0AA 1K0UA 2XGSA 3PJGA 4ZTZB 3OQJA 3TH5A 3U3ZA 5IFKA 5AYVA 2XZLA 2X0FA 5FDFA 5DYGA 4WXMA 2HIGA 2I91A 3EB9A 2BM9A 4O0MA 3SQXA 1BVRA 4OD0A 5G0SA 2BE9A 1EJ2A 4OFBA 1Q50A 4PBTA 2IV7A 2OXIA 3UUWA 3HP4A 4X9XA 1LEHA 1CFZA 1CIPA 1P3JA 3I73A 4OTZA 4OXIA 2OFPA 3LLSA 4YFYA 5GP1A 2ZWIA 5IAJA 1YFJA 3GWZA 3CT6A 4D0RA 3EQ9A 2DT5A 5K4GA 3KYCB 3VYUB 3CJQA 2J8ZA 1LTHR 2NZ8A 5KYYB 2IS4A 5JATA 1TCUA 4C76A 1GGEA 3QVLA 1TJPB 5KVVA 3DVLA 4FNMA 5FLEX 3IHLA 2SKEA 1X2EA 4HQKA 2AB0A 2RFLA 3D4BA 4GKBA 2ZJZA 3LUCA 1JSZA 2L0XA 4EG1A 2RI1A 3EIFA 3HGTA 3P2OA 4RJJA 3IMCA 1A9OA 3OPYI 4WERA 1VECA 3M3PA 4GLLA 1D4ZA 3CLUD 4ML3A 3BSWA 3NI2A 4NH4A 2Q6TA 5IZCC 3GP8A 4BAGA 1Z38A 1WHTA 1XTPA 5FB3A 5KNDD 3MTEA 4RPHA 3P0FA 5K9ZA 3P94A 1AO3A 1RZRA 3KE9A 1A82A 3QMVA 3GGCA 4YJ3A 4RD6A 1XJ5A 1FNCA 1F12A 1PK7A 1GUYA 2CL7X 2WPNA 3D4OA 1A1SA 1LQ2A 4WADA 4D8XA 1QJ4A 2K4MA 2F67A 3S27A 1Y5NA 5BQFA 3VZQA 5IAOA 3T54A 2RB5A 2DFKB 3R3JA 4JHLA 1AHPA 2ERXA 1PZFA 3HFGA 3VKGA 4X7PA 1H2XA 4RMIA 5ALMA 1KA9H 1Q7RA 4P4LA 5FFMA 5LYJA 2LCQA 4DMKA 2QXTA 4F5YA 3H6HA 2FH5B 4V0LA 5CPBA 1LLDA 1CUBA 5JMWA 1V3QE 3RVOA 1JKFA 5KOJB 4EYOA 1C2TA 1VL6A 4KXLA 3UATA 2C97A 5HQJA 3DKVA 3ZQ4A 3E9QA 4UM9B 5BNWA 2F43A 5KU1A 3PJEA 3PXEA 3MJVA 3I45A 4RWEA 2CVZA 4OI1A 2XZPA 1T9BA 4N40A 1DWPA 3KJHA 2XD9A 4DSNA 2D3TA 3E7DA 3JTEA 3N58A 4BX9A 3Q8KA 2Q27A 5U4XA 1ORWA 4ZOLA 2B99A 4UBIA 2C2BA 3G9QA 4I3HA 2XAUA 3QX9A 2JDIA 3H8WA 1PUJA 2LZ0A 1NVVQ 3QEJA 4BECA 5J4HA 1VBKA 3CN9A 1WXWA 3FFXA 3FYUC 4KGDA 2H9IA 1NBIA 2I6TA 3L6CA 3OUTA 3UOWA 2FX2A 2I4TA 3FPEA 3JD4A 4R71A 5IANA 1N34B 4AZ0B 1KL7A 3FCSB 3D2LA 4MW6A 4BV9A 1GIAA 1U0EA 1S3IA 4DQXA 3ADBA 3KTAA 3DE4X 5D84A 5JVDB 2I99A 3MFQA 5LN1A 5DT2A 5CCBA 4YP0A 3ME5A 1J1IA 3Q6NA 5DE3A 2AN4A 4GT1A 4QXMA 4MICA 4PR3A 3RFCA 1FNBA 1CS0B 1GRNA 3PCRB 3TQCA 3DB2A 4KQHA 1NXSA 4TKVB 4NARA 1C9KA 1ZK0A 3KXPA 4U8GA 3GELA 3E5MA 3T35A 1S01A 3HB4X 2Q1SA 4LOKA 2QAGC 4QZVA 3EDMA 2SNIE 3OJFA 4P4UA 2XNSA 2UAGA 3GN1A 4IHJF 4EF5A 2RGUA 5F1OA 1OBFO 5KYVA 2HO5A 4FR2A 4AN4A 4EVRA 1EG2A 1ZM3A 3BZWA 3WB2A 1N6NA 3NIBA 4BKRA 4RLFA 5JZMA 3J7TA 4L50A 2VAXA 1WAMA 1LNQA 2ZIWB 3F49S 1G8MA 3VU0A 4ZIRB 2GPAA 2AYYA 5AKEA 3L0IB 5DTRA 5KYWA 1CQZA 5HCIA 1CP3A 1U1FA 1N8TA 3LVRE 4POOA 2BEUB 1PNOA 4F72A 3WYDA 1T34A 1V11B 3IVXA 1AC5A 3O26A 4DIOA 3SHQA 4QE3A 4CHGA 2W6JA 3FRIA 3HBFA 2H1CA 2FN3A 3NRBA 4KRXA 3FIJA 3DV2A 1GSOA 1DQYA 4N5NA 1HXHA 2GEJA 3URKA 3X2EA 1R8JA 1Y34E 2PZFA 1QH8B 1N2CB 3FJYA 4IWNA 1KDRA 3CCFA 4INAA 5C81A 2CWWA 5JAIA 1QGUB 4XD7A 4BVGA 4RIIA 1QHIA 2IHTA 4HOYA 1SXJE 2WE8A 4ES6A 3TTUA 3ZW8A 2BSQA 4WIAA 1DXQA 4N3NA 4B6JA 2VCEA 1G6OA 1D2HA 1ZSNA 3R1IA 3S2IA 1U0NA 3R8CA 2ZRKA 1D09A 2ACKA 3M83A 3N76A 3PUYA 4J16C 4L8FA 3VZDA 4AXXA 4F60A 1HTTA 2YVQA 3AJEA 4RZUA 3DHWC 5A5FA 3IUBA 4M0EA 3PSAA 5ES3A 1H8EA 3R9KA 2FVYA 3K5PA 2C7VA 1YB2A 2V6GA 1Y8RA 2ORIA 4YMTA 3T4XA 5U1PA 5HZMA 3PPVA 3GRYA 1F8GA 1N6KA 4Q3KA 4M9CA 5JFOA 1X7XA 3S81A 1UWKA 3ZEIA 4DLXA 3ISJA 2DTEA 2ECOA 5FO0A 2JIZA 5CT8A 2CVPA 3AM4A 4MV8A 3SF0A 1W8IA 3A1UA 3ABQB 4UBLA 3TBKA 2HI0A 2L2QA 4NESA 2XE7A 3ZHTA 5FPTA 2QUBA 5GINE 1NN3A 3H5NA 5AHOA 1X1QA 2G08A 4EG7A 4Z51A 5GIOE 2OD9A 3CPHA 1KS2A 3HDJA 1DWQA 1U4OA 2JFVA 1ZG3A 4OUDA 2WWTA 4KHPB 2OCBA 4MIEA 1ZEJA 1L5MA 2P5TB 5T6BA 1OA1A 1JYEA 2QXUA 3DUWA 2OSVA 1H6CA 5TARA 2CKDA 3RTEA 3V1YA 1XFDA 1O96B 1E2UA 2IDMA 3I52A 2H1SA 2VZLA 4KZPA 2IBMA 5ALIA 1XZ8A 4JROA 4PWYA 2OYRA 3TUJC 4RXMA 2I9KA 1MAVA 4MEBA 1ZR2A 5JXIA 4GVPA 5AI4A 5FUMA 1AN0A 3WIDA 2WY2D 5J1SB 5HFJA 3N28A 1NVMB 4KH1A 3QPUA 4BFSA 4US2R 1G8KA 3PWTA 5LWQA 3ZCVA 4KWIA 1NUTA 4UQLA 2X0EA 5FH9A 1WXHA 3FROA 3IVMA 4IDPA 4FDLA 1OD6A 3AWIA 1YBHA 3KR0A 2QL6A 2VHCA 4DANA 3IVRA 2EL7A 1Y4DE 3B78A 1MAAA 3ROFA 4EY7A 1A72A 5F7XA 1HNXB 4TYWA 2ZAMA 1RM0A 3I04A 5IJ0A 3QZUA 2GTIA 4CUJA 2H4XA 3THXB 1SBZA 4B46A 3TSYA 3AI3A 3NRCA 4R9UC 4WVFA 5KNCA 1X92A 2ZG6A 2R47A 2WHRA 1JAIA 3RSQA 4C1BA 1MF7A 4Z49A 3HVIA 1UT8A 3CX8A 3V2IA 4I9UA 5KKCA 5FBZA 2AUNA 4KKVA 1CJBA 3NHZA 2RH8A 3H0CA 3X3HA 1KAHA 2X0JA 2B61A 4QQ8A 5FLKA 1ESEA 4F86A 2JC3A 1XDBA 2JI6A 3OLQA 3EZLA 1U7TA 2Z3WA 4QFMA 2A3NA 2H5LA 3K0HA 3UCXA 5JSZA 3ZLVA 1FYXA 2V1UA 3BFVA 4RKRA 3VR5A 1KP2A 4GM4A 1AM4D 2XOKA 2H2DA 3O1HB 4YYZA 1BQ3A 1E92A 4KL8S 5HM6A 2ZIFA 3IUSA 1C9JA 1DO8A 4PLTA 2X1MA 5AKYA 4JBXA 2AWOA 1RPJA 3CPJB 4K86A 3Q41A 4RHUA 1MO3A 1GPJA 1L3CA 4N6NA 1JZQA 4Y6LA 5DFAA 5BQXA 2NTNA 3VR4A 1UBEA 3CVOA 3SR3A 4XJSA 1KI6A 5AXAA 5DM0A 2JKYA 3M6AA 2WTBA 4ZTUB 4BEVA 1G20A 4AJNA 2QPTA 1I1NA 2CSXA 1RCFA 2X9NA 3IHWA 4LDAA 4BLVA 3HJAA 2XEDA 3JYQA 4V38A 4IDEA 5FAKA 2ZRIA 3IDAA 1JHYA 3TDKA 1Y3AA 1EE2A 1BA2A 1B3RA 1YL6A 4GGPA 3KEFA 1GQ2A 2PE5A 3Q87B 1ADGA 3WYGA 1MB2A 4PQYA 1JDBC 1KDYA 4CQLA 1YASA 3AETA 1E9SA 2D1FA 3N5CA 2VRNA 1Z4KA 3QTBA 1K9SA 1IVNA 2ZDQA 3A6JA 1E3TA 2OMEA 4GPD1 5AJWA 5JRDS 4GUDA 4AJIA 2VDJA 2P3QA 4BP8A 4CN8A 3AZQA 3CE9A 2GPSA 3D5EA 3W3AA 4HLNA 2XCRB 3OE7D 1BWQA 3PSHA 3MTIA 2NU6B 5BV7A 1QWSA 4FZ5A 4BX8A 4GOMD 2M9MA 4BZXA 1QYVA 2V03A 5TGDA 2FPWA 1JEQB 1YO6A 2I7VA 3RARA 1XDDA 2J3JA 1XC7A 4JDUA 3RYFA 1P9OA 2A58A 1BCSA 3FHCB 1I0ZA 2OD7A 2V0NA 1WHTB 2XDQA 3EISA 3FWYA 3GA7A 5SY4A 4X62B 3AR4A 3VPGA 2QYTA 4PYQA 3HZZA 1XT6A 5JCZA 4DV2B 4YJ3B 4YGYA 3K09A 1YU6A 4IF4A 4ZVNA 4DY6A 3V1MA 2XMDA 1FRNA 2AW5A 1EVLA 1R5NA 3BBLA 3PNMA 3BMCB 1K1EA 3EXHB 1N0VC 1VXRA 3CRMA 3GRVA 5JQGF 1GPH1 5JS2A 3WVNA 4YDSA 2J5RA 3KB2A 5FUBA 5JJKA 3AR5A 4RDHA 2V65A 4O4LF 2HWKA 3UWKA 4IH1A 3JASB 3QEKA 1XJ0A 5B4VA 1SCAA 3ZWYA 2P41A 2QLMA 3HXTA 5CK5A 3WIUA 1YE3A 4PS0A 1XE3A 4RVFA 4TTIA 3SIPA 4YA6A 2YZ7A 2AQHA 3T1OA 1Y8CA 1B3BA 4MYTA 4DDKA 3TX2A 1QBGA 1US8A 3UGQA 1O58A 3IVCA 1Q92A 2GJAA 2FFQA 1S3FA 1M6HA 1RKXA 1EM6A 4LJ9A 4H3HB 3LCJA 3K6SB 4UHEA 3T52A 1E5TA 4CLOB 5I4KA 3NHMA 1KEWA 2GFIA 3AV3A 1MIOA 4R84A 3TTTA 4M89A 3SXUA 3SX2A 4JITA 3KAJA 2BBTA 4ND6A 4G8CA 4D1YA 1PVVA 5GADl 3BD7A 2I3DA 4RA9B 3P4UA 2WP0A 1Z8FA 1ZQ9A 2BZGA 3DXYA 3L4EA 5DXAA 1U80A 5CHYA 4ZD6A 3I9LA 2OV3A 2B9VA 3K09C 3NWJA 1APBA 4GLJA 3WK5A 1XMQB 4PFKA 3BFKA 5K01A 3VV3A 3BM5A 4OIMA 1ZSYA 1W1WA 3QOWA 4DRYA 2KJQA 1IK4A 1QHSA 5EMNA 4ZZIA 4LK3A 4O4JB 3LNTA 4K1XA 5BW8A 3IP5A 1NWHA 2ZTMA 1QG6A 1QB8A 4FMBB 1YZLA 3A6EA 3HN2A 2OHGA 4N6OA 2GRJA 1ZI8A 2P3SA 1QAQA 3OIUA 3UHFA 4B09A 3EEFA 4MJ7A 2X4GA 1J49A 1F1JA 2HK8A 1SOUA 2RGNA 3DHEA 3I8XA 3PNKA 4GPZA 4J2OA 3TYXA 2Q1YA 2FLKA 1SD5A 3MGAA 3MWDB 4RZIA 4BATA 3H11B 4Q4AB 4RPCA 1V7ZA 4N3BA 1EJ0A 1XKXA 5E9AA 3WJ7A 5KHAA 1E2FA 1Q0PA 1IWBB 4FS8A 4MW9A 3SHTA 2R60A 3WHKA 2R8XA 5ALFA 1K27A 3EDCA 1KZ6A 4C29A 3HO6A 3LQKA 5LQAA 2WMNB 1U5AA 1ZJYA 1TRKA 2BBSA 3JVDA 5JYBA 4PC6A 1COWD 1OFGA 2HA5A 2ZEJA 3AO0B 1GZVA 2Q5IA 3GYGA 4EK9A 1YHZA 3ZE2B 1J21A 4ZI3A 2FZ4A 2A1TR