1DRVA

Escherichia coli dhpr/acnadh complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1drvA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1drvA01
1IHXA 5JE8A 2IE0A 3AWDA 3LC1O 1P1JA 2Y66A 3KYDB 5G0TA 1GD1O 3TQHA 2CF5A 2V6GA 2YFHA 4F6LA 3CKYA 5K6AA 5G4LA 4BGUA 4XGIA 3WGOA 1V3TA 2Y05A 3BAZA 4XWYA 1O8CA 2Q45A 1HT0A 4BOYA 1ADCA 3T4XA 5JBIA 1OZAA 1T1SA 1KYQA 3OA0A 4IQ0A 3WB9A 1SCUA 3WGQA 2UVDA 3JD2A 4E2ZA 3KEOA 3SC6A 4JIGA 2NU8A 1SMKA 1BWSA 3ZU2A 3LSYA 2QYTA 4JXKA 4D44A 4RPJA 2Q4EA 4NK5A 4OL9A 3ZWYA 3H2SA 5IDWA 4GVXA 4R1SA 3RAJA 5ICSA 1BDMA 2I66A 4R4JA 3AY6A 4R9RA 4IQGA 3MWEB 1XHLA 1MA0A 1WDKA 2XAAA 1TVEA 4HBGA 4N5NA 1T1RA 4IGEA 4WOJA 1QYXA 1C0PA 3QHAA 4ZQEA 4CV1A 4R16A 4P4LA 4YAEA 2QYSA 2A92A 2OP1A 4BNWA 1YRLA 3PI7A 1D1SA 3L4BA 3HJAA 3PJEA 3Q11A 4XDZA 4BNJA 4CR8A 1K6XA 5HBRA 1E5LA 2YFQA 3OECA 1UUFA 4PLGA 2FZWA 3GPIA 3RU7A 3ZW9A 2P5YA 3DMTA 5F1KA 4IGFA 1PQUA 5JY1A 2SCUA 3ZI0A 1A7AA 1FDVA 2DKNA 4C4OA 3NDJA 2WM3A 1XG5A 5ILGA 4CMIA 2O48X 4O6VA 3H9EO 3PYXA 5JDIA 4YAIA 4CM1A 1QYVA 4YWJA 5AXBA 3MTJA 4WECA 2VNSA 1B14A 2R00A 2I65A 4BNUA 2Q1WA 1UXIA 4RPLA 4W9NA 2DTDA 4IS2A 3GR6A 3RSHA 5DZSA 4BO7A 4YJHA 4Q3BA 3H9GA 3R0IA 1WVGA 1WW8A 1HKUA 1DC3A 2O4CA 1BXZA 2C7GA 4F46A 4BO1A 4J7CA 3UVEA 1BDBA 3OSUA 1P44A 1IHYA 3G1UA 1I5RA 1XELA 2CUKA 3O03A 2DBZA 3FWZA 1ZKMA 5J23A 2NVBA 3CXRA 1YL6A 1OOEA 5JO0A 2WSBA 3L6EA 4B7XA 4CQLB 4P4NA 4RF2A 3LZ6A 3NEPX 3WR5A 1WDLA 1DJNA 3C1OA 5JXWA 4D43A 4IQ8A 5DCYA 1T2CA 3DBLB 4ILKA 2C29D 4MP8A 5CP8A 3OIDA 4FJ1A 3B1KA 3NGLA 3JD4A 3PK0A 3UGKA 1CRWG 1ONNA 3AUAA 4TMFA 4BQPA 4QTZA 1UXGA 4J1TA 3KYDA 1SPXA 1XQ1A 1EVIA 2EW2A 2P9GA 3OQ6A 3VDRA 4BNZA 3AM3A 4PCVA 4J2HA 1DSSG 1EMDA 1XQ6A 1A27A 4BGIA 2NADA 2AEFA 1O0SA 1R66A 1BRMA 2C59A 5TIIA 3VAZA 2HMVA 1NQTA 4WCFA 3PXXA 5C3MA 1P9LA 2Q99A 3C24A 2QZZA 4WLNA 5EPOA 4PLCA 3FBTA 3ZCXA 5COAA 1QV6A 1V35A 1WZEA 3MEQA 4D45A 2CFCA 2NTNA 1JLLA 4OXYA 3T4EA 2QW8A 2P68A 3LT4A 1QORA 4JNKA 4NNJA 3QA9A 4I5FA 4RVGA 3ON5A 3SXPA 3E6AA 1JKIA 1PS9A 3GVCA 4GX1A 1EFLA 2ZKLA 4XQEA 4XQ9A 5FFFA 2ZYAA 3HDJA 2QIOA 3UKOA 2G76A 3GEGA 3W8DA 3ZWBA 1ZH8A 2EF1A 4Q3NA 4EUFA 4FB5A 3NDRA 1AE1A 4RZIA 3FN4A 1RM4A 3S2FA 2PZLA 2Y1FA 4EEZA 4HKTA 1LSOA 2X1HA 3ZHBA 1VJ1A 5KTKA 1Q0LA 3EHEA 3WGIA 1LSUA 3WDSA 4EW6A 3AU9A 4JGBA 1X0XA 1YKFA 2NSDA 3DOJA 4XA8A 3WIEA 4ZQBA 3S55A 4TZTA 3JQEA 3PZBA 5DOZA 4YRBA 3VTZA 4LRTB 2FZEA 4WGGA 1I3KA 4NMHA 1DO8A 1DB3A 4XYEA 2J3HA 1R12A 3IP3A 4BO0A 2NVUB 1PZFA 1GQYA 4KTTE 4HFJA 4RDIA 2BKAA 4XCVA 3CTMA 2G82A 1YS4A 4DIBA 1EUDA 4Z0TA 3VPSA 4O1MA 3ZWMA 1LI4A 2C5EA 4E33A 4JROA 5DDIP 3W6UA 5JAQA 4JQCA 5T64A 3DBVO 2VUTA 4HADA 2CDBA 3KOUA 4J1QA 1NR1A 3H5NA 4PVCA 4WLVA 3EYWA 2V7PA 1NQAO 5JSFA 1X1TA 4ZHSA 1KEWA 1XU7A 2ET6A 2PD6A 2C54A 2J3KA 2P91A 1ARZA 3G1TA 1QG6A 4FFPA 1U9JA 3I9KA 4MPDA 2HJRA 3SVTA 2GF2A 2P2SA 4A0SA 4ALIA 4IDDA 3B70A 3V5NA 3BYZA 3W4JA 3WYBA 1DHTA 1DAOA 1ZK1A 3C7DB 1PEDA 5L7YA 2DM6A 1R4NA 1U3TA 2V6FA 3H2ZA 3DOOA 4GWGA 1EBUA 3FCOA 4IJUA 1G0OA 1LJ8A 2PLAA 2W2KA 4PGFA 5LCXA 2E4AA 2GYYA 5BSEA 4E31A 4S1VA 2PD3A 1ML3A 2FRDA 3EVNA 1B16A 1U8XX 3PVZA 4U7WA 2VOEA 4MKXA 1U4SA 4AL4A 3EZLA 2BF7A 3RI3A 3WGGA 1UDCA 4MVJI 1H93A 3GAZA 1SO8A 3E48A 3HE3A 4FC7A 2ZCUA 4DUPA 2I67A 2O4UX 3NV9A 1ZNQO 1LQUA 1G0NA 4QEDA 3QY9A 1YJ8A 3V8BA 1GAEO 1V9LA 1YXMA 3UICA 5KOIA 5EINA 5C5IA 1O89A 3U4CA 4BUCA 1PWXA 3NX4A 1PGQA 1FK8A 2UYYA 3GF4A 4TWRA 5I7SA 2IRWA 1EVZA 4DRYA 2WDZA 4KMSA 4YQYA 2OMEA 2PFGA 4HP8A 3EY4A 1JTVA 2VZ9A 3WIDA 3D4OA 1E1KA 3WX0A 3FF4A 7ADHA 1NTOA 4AVYA 1Y8RB 4UVEA 1T2DA 5FI3A 5DF1A 2C0CA 5LDGA 1EZ4A 3ZWVA 4XB1A 3RFXA 3WSWA 3B1JA 4CLRA 2OFPA 4MIYA 3LC2O 2GASA 4L9RA 1HSZA 3M2PA 1UZNA 1WLYA 4IDBA 4HWKA 3H9JA 5TT0A 3ZH2A 1GCUA 1E5QA 2XF8A 3C8MA 3CEAA 1ZEMA 4RO0A 3RUIA 3GOHA 3X2FA 1FDUA 1EVJA 3GNTA 5AXDA 3KYBA 3DZKA 2C2YA 2FR8A 1P0CA 3D3WA 5DP1A 5BT9A 3K8ZA 2BI7A 2GD1O 1XLTA 3W6ZA 4NBUA 3CZMA 4KP7A 5L9AA 1UH5A 5JNLA 4OGWA 2Q2WA 4IJVA 1KIFA 3KV3O 3D7LA 4BMSA 2RCYA 1E7MA 4UUOA 2PNFA 5FI5A 4CMEA 2XXBA 1F8FA 3P5SA 1LTHR 5A5FA 5C7LO 3OFSA 3IUSA 3FSRA 1TA4A 1XA0A 4XQCA 5F5LA 1O6ZA 2GN4A 1HDGO 4PG6A 1U2GA 1VLLA 2VCYA 4PZDA 1PJBA 4A03A 4FJ2A 3INRA 4H3VA 5FF9A 2AEMA 4O63O 3I9JA 4M89A 3PFWO 4JBHA 4QUKA 1LSSA 4UVIA 2AQ8A 1MB4A 1GEGA 3MJEA 1Y7TA 4LSWA 1KETA 4MVJH 3IS3A 3KBOA 1ZUD1 3TWOA 3WGYA 4OO3A 2DBQA 3IKVA 4NU5A 3R3JA 3PIDA 5F3RA 1P77A 1Z75A 4II2A 2VYNA 2JKVA 2V6BA 3GFGA 1M67A 1ID1A 3DC2A 4CPDA 2RHRA 2H9IA 4ZRMA 3DTYA 1U28A 2NLOA 4DGSA 2HO5A 4BB5A 4E5KA 3E9MA 3OH8A 5ITWA 1B7GO 4EGFA 1G6KA 3PDJA 3FPCA 3WNQA 4A10A 4P22A 3RC2A 1ZZEA 2ZTUA 3KB6A 4J4TA 4QFCA 3UFXA 3RUFA 2PKRA 1YDWA 2PGLA 2HK7A 3PHIA 2JCVA 3MJVA 5JAMA 3OM9A 3G3EA 2ZTVA 3AI1A 3DTTA 4MVJE 5HRUA 3AK4A 1HLPA 1E7YA 4K6FA 3LC7O 4J2OA 5A03A 2O3QA 1C3VA 3DMTC 1I30A 2NU7A 1GCOA 5JMWA 3NUGA 3VH3A 1J4AA 5H81A 3I83A 3HDHA 4XYBA 4IXWA 1PJ4A 1LRLA 1DC6A 1HDYA 1NVMB 3HZZA 2OHXA 4PVDA 1DRWA 3ZN2A 3GZNB 2AE2A 4M54A 3GUCA 1H6CA 4XEHA 3Q1LA 5BNIA 1YL5A 5A9TA 1H9BA 2X9GA 2VHYA 4R5MA 3HQ4O 4RORA 2DQ4A 3JYLA 2C2XA 4L4XA 1I3NA 1P45A 1MXHA 1MG5A 5M6DA 3GY0A 1YONA 1LDYA 1N9GA 1PL6A 3RKRA 3UF0A 4Z0HO 2O23A 4J3FA 1HXHA 5DNAA 4YPOA 1IYZA 4AJEA 4Z0PA 4AJLA 1DPGA 1OMOA 4K6CA 3W8EA 3WMXA 5CDUA 5ENVA 4I5GA 1PQPA 3I1JA 1J5PA 1P1FA 1LU9A 3WLEA 3F1KA 2OL4A 3QWFA 3E18A 3GZNA 1M2WA 3GMSA 1UXJA 5T8KA 2B4TO 4LCJA 2GERA 1U7HA 2YV1A 1ORRA 1DAPA 1EDZA 3DXFA 3U5TA 2LDBA 2PK3A 4J43A 3GAFA 1V3UA 3GK3A 3L9WA 5L53A 2IYPA 1D3AA 4RVUA 4XJSA 1CQIA 1T4BA 1WXDA 4XKJA 4ID9A 2EV9A 1U3UA 4U6SA 2DPGA 3QRWA 4NZ9A 4WEQA 4QECA 3HUDA 3D4NA 2IXAA 4DA9A 3CMMA 1ZK0A 4BO6A 4E5NA 5A3JA 3BMNB 1ZVMA 3QVTA 1YBMA 3WTCA 3HDQA 4BNHA 3WSVA 5TJHA 3R3SA 1WWKA 4NBTA 5ITVA 4BV8A 3ROQA 2EG9A 2VHVA 4JK3A 3HADA 1MFZA 3GHYA 2C82A 4FOSA 4EJ0A 2CY0A 4RQUA 1LDEA 2JFFA 1DIRA 3JQ7B 3KUXA 3C3XA 4LMPA 3RBZA 4DYDA 3TRIA 4D0SA 1E3WA 4LVCA 5L40A 3O9ZA 3IAHA 4GBJA 1PJCA 2EKQA 2HJSA 3HSKA 1YE3A 1F06A 5L4LA 3CZRA 4H15A 1BSVA 3UCFA 1NNUA 1R0LA 4ESOA 1R0SA 3TSCA 4BNNA 3M1AA 1GPJA 3E82A 3AU8A 3ENNA 4OXNA 1UP7A 1W0CA 3ONEA 2YW9A 6LDHA 4NH4A 3K2EA 1UXHA 2YV3A 2Q3EA 2W2LD 4L75A 3D3WB 2HMUA 3BZUA 4LSMA 2JAPA 5U9CA 2P9EA 3D5QA 4BKQA 1WPQA 1X1EA 1KEVA 1S6YA 3STHA 2HCTA 1ADGA 4MVJF 1Q7BA 2O3RA 3JQGB 3UHAA 2I3GA 3DZFA 5JC1A 1ZJZA 3K2BA 3KYCB 4NIMA 4TQGA 1VE9A 3MJSA 3MCVA 3WG9A 4M87A 2AG5A 4D3DA 1XIVA 2FOIA 2CDCA 1QRRA 4IDAA 5THQA 5IAAA 2J8ZA 1FMCA 3UH1A 2CDAA 2JFGA 1DXYA 3WBFA 3GH3A 3NRCA 3PRJA 3TZHA 4D79A 1E1NA 4PFJA 1I24A 2ZB8A 1QLJA 4LCEA 5TF4A 4YJGB 5TGDA 5FWNA 4BGVA 3WFJA 2Y99A 2BGLA 4A5OA 5JAIA 2V6MA 1HSOA 1JW9B 4U0JA 3N58A 4OYRA 4GGOA 1R4MB 2FPGA 1IOLA 3FR7A 1I0ZA 1ONPA 2DFVA 1GY8A 2AQKA 2GSDA 4YACA 1YQDA 2PR2A 3VH4A 4TRNA 4OH1A 4RL6A 3TZ6A 3EAGA 4AJNA 4PLFA 4OAQA 3PIIA 4A26A 3PZRA 1N92A 2HLPA 3HN7A 1PS8A 1TB4A 3B6ZA 2CMDA 3ZHXA 1I2BA 2GR9A 2J5QA 3QQPA 2D1YA 3KEQA 2VTEA 4JJFA 3JQ8B 3OBBA 4OIMA 4L8VA 1KEUA 4OOEA 3WGTA 5F1PA 4B3HA 2PTGA 1LA2A 4MVJP 3PHGA 3DBRA 1IZ9A 2PV7A 3EW7A 4WASA 3N74A 5KIAA 3CIFA 2B83A 4CMHA 1CERA 4Q3DA 3INTA 4RLSA 4S3MA 4DYVA 4GX2A 5L45A 1EEHA 2RAFA 4B3JA 3L4SO 3JQ7A 2Q2VA 4HUJA 2GZ1A 1HDRA 1WZIA 3HN2A 1C0IA 5I9NA 2NVWA 1CQJA 3ANLA 3AOEC 3O38A 1BVUA 5EERA 2X0IA 5EN4A 5F21A 5KVQA 4WLUA 1OC2A 2ZB3A 2P4QA 4BNLA 3W4IA 1EUCA 4XIJA 3AI2A 4C7KA 1W73A 4PLVA 5IZCC 5COQA 3W8FA 3KXDA 3GDGA 1P31A 4Y6SA 4I9UA 1LDBA 1ZMTA 2BD0A 4JP2A 3SX2A 4P8RA 5A05A 3ETGA 3LU1A 2E49A 4ITUA 1OFGA 2QG4A 3NAQA 1I2ZA 2VHWA 3IKTA 4UEOA 3CE6A 4ND5A 3ZNPA 2PKQP 2BH9A 2JL1A 1ZEJA 2O2YA 4HFNA 1E3EA 2DTEA 3DFZA 3AI3A 1JVBA 3AY7A 2G0TA 4XQGA 3ITKA 1A72A 2QRJA 4P38A 1WP4A 1PZGA 3IJRA 1R6DA 2AXQA 1HDZA 2FP4A 5A06A 5L4SA 4MJLA 2VUUA 3LQFA 5JCXA 1VL0A 2Y1DA 3CUKA 2NUAA 1PGNA 1RJWA 2EKPA 3JQAA 2DBRA 4MIOA 4H7PA 1UAGA 3DAPA 3RC7A 1VSUA 4E4YA 5AXAA 3RQSA 4DWVA 1NWCA 4AJ1A 2RBEA 5JFOA 1GR0A 1X0VA 4RF4A 4LK3A 4TZKA 4KWHA 4IDFA 3AOGA 3S1LA 1PR3A 1E77A 4HFMA 4R41A 1UP6A 1NASA 1OC4A 2X23A 1ZCJA 4B79A 4BV9A 2GGSA 4XD2A 3GQVA 4XYMA 1LLCA 4ALMA 2JD0A 1JKFA 2Q2QA 4GH5A 1U4OA 5DP2A 4BKPA 1GEEA 1H6AA 2JD1A 4R9SA 1B3RA 4BGEA 3EDMA 4AJJA 3GRPA 4IPTA 2WMDA 3M1LA 4KZPA 4EUHA 1HE3A 4ALLA 3RUAA 4AJ2A 2OXIA 2D0IA 1BXGA 1Q0HA 3ORFA 4LRSB 3OEYA 4DQUA 1VI2A 5DN9A 1ZK2A 1E7QA 4FC6A 1P1RA 4BO5A 2NVUA 4J6FA 2TMGA 3V1UA 4ZJUA 3ZWWA 3G49A 2O3TA 2NWQA 3RFVA 5DBGA 5MDHA 1M6HA 2D8AA 1YOVA 3VHRA 3JQGA 5AXCA 2AW5A 3GDFA 4TKMA 1PZHA 2A4KA 1D4FA 3I9NA 4PN3A 2B5WA 3JQCA 3OETA 3CPSA 1A7KA 1T2FA 3QWBA 5C37A 5T67A 3ZWAA 3G79A 2ZYGA 4D7AA 3QV1A 1NM5A 2Y93A 1X15A 1HE4A 2D5AA 1TEHA 1VL8A 1JVSA 1H6BA 2W90A 3PTZA 1GV0A 4NU6A 3PWSA 1KY4A 4M55A 4M8SA 2Z95A 4AJOA 1SEVA 3F9IA 5IF3A 2GLXA 4IJKA 2BFMA 3PLRA 3C7AA 3RC1A 1T24A 1MP0A 3GMDA 4FW8A 4Z3KA 3ZDFA 4INAA 4IJWA 4UAGA 1PTJA 3O26A 3Q9NA 4XYLA 3WS7A 4FPXA 4YQZA 4WJZA 2ZTLA 3RUEA 3TL2A 4A27A 4DREA 4YT2A 4EJMA 4YT5A 4XIYA 4EJ6A 4W7IA 3WQQA 4FQ8A 1LNQA 4NFHA 5G0VA 1BHSA 3MOIA 2E82A 4FFLA 4OJNA 4CV2A 4BMNA 4TRRA 3C1TA 4MINA 4JJIA 2QX7A 3P2OA 1VM6A 3I4CA 4RZHA 3ZW8A 2HMWA 1RM5A 3LF2A 5TLSA 3RJ5A 4IUYA 5JC8A 4YRAA 2O50A 2HAEA 4ZQHA 1XU9A 3KRTA 4Q39A 2ZQYA 2PZMA 1SOWA 1C1DA 1C1XA 2HDHA 5EQDA 5TNXA 1ENZA 4MDHA 3TL3A 2J3JA 3AM5A 4AICA 4E30A 2VYVD 1ZFNA 3EUWA 3OP4A 1MV8A 4CV3A 3U09A 4F3YA 3WYCA 1HDOA 2H6EA 1Z6ZA 2UUPA 3H3JA 1BW9A 2ZB4A 4DLLA 4I08A 2YHIA 3NKLA 2V65A 2H63A 2OBNA 2EKLA 2Y1CA 2C20A 4QFDA 3QWIA 1LLQA 2J3IA 1AGNA 1NPDA 3GFBA 4CODB 1ISGA 1VJ0A 3QVSA 1AN9A 2LDXA 1LUAA 1YB5A 3ASVA 3PJDA 3LK7A 5A1TA 4IBOA 3ANNA 5F5NA 5IJZA 2NACA 5CHEA 1KS9A 1PGOA 3GNQA 1N7GA 3GRKA 3ADOA 1YB1A 1Y1PA 3E8XA 1B3BA 1BGVA 3L0DA 2NU9A 3DAFA 4B8WA 3KETA 2X4GA 4E13A 1GU7A 3JV7A 2R2GA 5I8WA 1O95A 2HUNA 3V1TC 4DC1A 1I8TA 2W8ZA 4BO9A 4CM4A 3F6YA 4R54A 4W7HA 3KO8A 3QWAA 2DVMA 4NQZA 2VWQA 3VTFA 1RKXA 4MVJG 4ZA2A 3LDHA 3GVXA 1G1AA 3ZWOA 4AFNA 5I9LA 1NFQA 2O7QA 3IMFA 4GWKA 5TJ9A 4KOAA 5LC1A 3ST7A 1J6UA 2Y68A 2GN6A 1GZ3A 1PWZA 4E3ZA 2IYOA 3ZV6A 4DVJA 3CMCO 1X13A 4WCFC 3ZV5A 1OBFO 4PG5A 5J9GA 4MKRA 4TKLA 5ENDA 5CFZA 1SBYA 1SB8A 3D4PA 1R4MA 5FYDA 3DO5A 2D3TA 2W2KB 4AJ4A 1ZK3A 3RUDA 4BNYA 1O9BA 4ZGWA 1YVEI 3WNVA 4I1IA 3RD5A 4BB6A 3IUPA 1EQ2A 1VSVA 1BG6A 5COBA 2A9FA 3DZIA 3A06A 2NQTA 2W98A 4RVFA 4IDEA 4GQAA 2GCGA 3PDUA 2AQHA 4UULA 1HYHA 5IXSA 2B69A 1PJ2A 2O2SA 3VVBA 2DUUA 3PWZA 4H16A 3PHJA 3COSA 3UXYA 1TLTA 4N5MA 4OSPA 3PHHA 6ADHA 3RKUA 5JCJD 4OXKA 2WYVA 1L7EA 2DAPA 2VT3A 5KVVA 1W4ZA 4BHTA 4YT4A 4RV9A 1A71A 1ULSA 3JYNA 4D46A 2NTJA 4FFNA 4KTVE 2I3AA 3GEMA 3RJ9A 1JWBB 2R00C 5IZ4A 3K92A 1NPYA 5F1OA 4B7CA 4GLLA 2NNLD 1DBVO 1PJLA 1YBVA 4R51A 4QSMA 5KNLA 4RVDA 1MGOA 4PG4A 2G5CA 1E7WA 4YAJA 5B4VA 4Z9YA 3R6DA 2JAHA 1L1FA 2GN9A 1DHRA 3SLKA 1LLDA 5L7WA 1I10A 1KC3A 2DUWA 5HM8A 4CQMA 1E3IA 3F3SA 4FN4A 5IN5A 3U9LA 1Y6JA 2OUIA 3KM0A 5TS3A 4I5EA 2CNBA 3PLNA 2JD2A 2EWMA 4ND4A 4Q9NA 3V2GA 4MVJD 3DB2A 3B1FA 3TZKA 1B2LA 3RCBA 5KJ6A 2O7SA 4URFA 5B4UA 4UEJA 4YJDA 5I7FA 1NHWA 2ZIZA 1DLJA 2J5RA 3JQFC 5THKA 3D0OA 3OEWA 3RBVA 2FHSA 4G2NA 4RQTA 1PSDA 3D64A 1VL6A 3JQ8A 3FNHA 1HLDA 5TC4A 4CL3A 4CM4B 2GN8A 1E3SA 5EESA 3ONDA 3MWDB 4LGVA 2F00A 3VZPA 2GRAA 4CM3A 1IY8A 5T5QA 1DFHA 2IZZA 1IL0A 1M76A 5BSGA 3D1LA 1LLUA 4I9HA 1M6WA 1A5ZA 2YZ7A 1JN0A 4G81A 3VZSA 8LDHA 3AW9A 1K89A 4YA6A 4A73A 2VHZA 4CM8B 3WTBA 2QQ5A 4GI2A 5JO9A 1PL8A 2B5VA 4HNGA 3TFQA 2X0RA 2J5KA 1N1GA 1I3MA 1LSJA 2VOJA 1GZ4A 5K6AC 2ZQZA 1E3LA 1ENOA 3ZWNA 3HG7A 3MZ0A 4ND2A 1FDTA 1DIGA 4FFMA 1OAAA 4Y67A 4GKBA 3DZGA 4YRDA 2VRCA 1XCBA 4IZIA 4Y8VA 1A4IA 1GPDG 3GEDA 3MJ4A 5KJEA 1QYWA 2I99A 3VKUA 3GDOA 3ZWPA 4GX5A 1ZJYA 3RFTA 1C1XB 1P1KA 2GO1A 1NBOA 3ICCA 4RPKA 1D8AA 4E6PA 2P5UA 2Q1UA 4DIOA 3DOCA 1KC1A 2EGHA 4CQMD 1XR3A 3A9WA 4CMAA 3GZ4A 3TZCA 1NQOA 4DC0A 2DTXA 2VQ3A 3S8MA 3I9OA 1RWBA 5KJCA 2FN7A 1V8BA 2OO5A 4BS9A 1ZSVA 1Y8QA 1F17A 5BNTA 2Q1SA 4QO8A 4A2CA 2QRKA 5GY7A 2HK9A 5EMHA 3NGXA 1PIWA 1U5CA 4IIUA 4IM7A 4O59O 5A4DA 2VWHA 1DIBA 4Y6RA 4WNIA 2YYYA 1N1EA 2WD7A 1R15A 3OHSX 2X5KO 9LDBA 4EEXA 2AE1A 2HSDA 5JY6A 1IE3A 3PGXA 3JQ9A 2XXJA 3ENKA 4ROSA 4RPHA 4TVOA 5IN4A 3KLPX 1YWGO 1Y9AA 4O5OA 1SZJG 1JAYA 1GDHA 1HE2A 4ZN6A 3JYOA 3P7MA 3FRJA 1Q1NA 3LT0A 4ALKA 3GVIA 5ADHA 2YHUA 2VUSA 4RVSA 3NT4A 1ISJA 1WNTA 1UAYA 3JQFA 4ND3A 2DT5A 5G4KA 2D59A 3U4DA 2OOSA 2EP5A 3NTRA 4CUJA 1A9ZA 4NI5A 4D3FA 3HNPA 1KVQA 3LT2A 4XJTA 1HTBA 1MUUA 4CQLA 2PGDA 2E48A 4YBZA 3L6OO 4L73A 3INGA 5KVSA 2X0JA 5JYDA 1RM0A 2CVOA 2B35A 3CINA 4CMCA 1IUKA 3FBGA 4CUZA 4EZBA 3GHHA 3VC7A 4IINA 2PH3A 4IMRA 3C1AA 5CDSA 4BKOA 4MKZA 1AUPA 3I3OA 3DHYA 4GSLA 1UZLA 5CDTA 2EHDA 4PLWA 5KCZA 2EP7A 4UVDA 2Q22A 4DMLA 5DBIA 1DRUA 3I6IA 3QP9A 2CF6A 4FSHA 2VWGA 3VPGA 3KTDA 4BQRA 3OJLA 5BR7A 1C1DB 3ZHZA 2DPHA 1IULA 3I4FA 5BQFA 1E6EA 5G0WA 2JCYA 1Z45A 3EC7A 3P19A 3VZRA 4E5PA 1U1IA 4OKIA 1UDAA 3OIFA 4WCDA 4YVFA 2Y0EA 4KDFA 1BW9B 5T57A 4CLOA 1DFIA 4CR6A 2NU6A 3OQ1A 1XSEA 3BMOB 4G5HA 2BFOA 5A02A 2ZJ1A 3R1IA 4ZU3A 1GL3A 4UUNA 2E37A 2Y0DA 2NM0A 4NDNE 2C07A 3BTUA 3JQAB 4BL5A 4E32A 2FWMX 1ADFA 1RPNA 3T7EA 3BTVA 3FWNA 1R37A 2VTDA 4B4VA 1LQTA 2IZ1A 2ZK7A 1LX6A 4PIVA 5CEJA 3VPFA 3L9XA 2O3SA 2BI8A 4Z9FA 3K30A 3U0BA 3GG9A 1DDOA 1U5AA 3HWRA 5TT1A 4UREA 3WQSB 5CG2A 2I76A 4J7UA 3S2GA 4U0KA 3H4VA 4GPD1 4CMEC 1LEHA 4R68A 3BHIA 4B4OA 3JSAA 1NFRA 4KDEA 1GUFA 4FDAA 1Z7EA 2H1SA 3V2UA 4QQRA 5HTOA 3OJEA 5G2OA 1QXSA 3FD8A 3GGOA 2C7VA 1WMBA 1T2EA 4DQVA 1GFSA 1DLIA 3I52A 4DLBA 3H5AA 1IB6A 2PA3A 1CF2O 1DC5A 2AG8A 1IPFA 1P0FA 4U8GA 2OP0A 4BO2A 4BNXA 1H2BA 4RCVA 4L4RA 1B15A 2HU2A 2AA3A 3TJRA 4CMKA 4EBFA 1ZBQA 2Y1OA 3NJ8A 4ZQFA 1EUZA 5C7IO 4CM8A 4J1SA 3GN1A 2D2IA 5EIOA 5JDCC 2OORA 3JYQA 4IXTA 1E7SA 4TROA 5CDYA 4YAGA 2W4QA 3V2HA 2I5PO 2IZ0A 1ADBA 2VYVA 3IDSA 1QKIA 4L4SA 1H5QA 5IDQA 1M75A 1Z73A 3UCXA 1FDWA 1YH3A 3AFNA 4YDRA 3BMCB 4HX5A 1T4DA 4WKGA 2JHGA 5T73A 4RLHA 3SBOA 2GDZA 2PD4A 4ZD6A 2VRCD 1DIAA 3ZU3A 1UP4A 3TNLA 1ZK4A 1TT5B 4IZHA 3DWFA 4JP3A 5JPIA 2D5CA 4TSKA 2DLDA 2IEBA 4OM8A 4WOKA 2DC1A 3QIVA 1HEUA 2DU8A 2ZATA 1X14A 2EJVA 5AQ1A 1NXQA 4NPCA 1KVSA 1B26A 2EEZA 3PFFA 1I2CA 1LDNA 2ZYDA 4YR9A 3JQBC 2Q4BA 4B3IA 1FDSA 4RJTA 1HE5A 3H6KA 4Q3EA 5IDXA 1NR7A 2CSUA 1I01A 4II3A 3A1NA 4I5DA 4AJHA 9LDTA 2O3JA 4TRMA 3BMCA 2UDPA 1VKOA 3ROKA 1E92A 1KY5A 5ER9A 3ROPA 1JA9A 3ROMA 1K6IA 1YDEA 4W99A 4WLEA 5I7VA 1T25A 4HY3A 3MTGA 3PEFA 5H82A 1F0YA 5HS4A 5KVCA 3GNSA 5A9SB 5KKAA 4GMFA 4ONEA 5KJ1A 4J16A 4PLYA 3PJFA 1EE9A 2X0NA 5ICMA 1KVUA 2BLLA 3U4HA 1IZ0A 4I9NA 2GPTA 1B8UA 3TN7A 1QYCA 5AOVA 3BTSA 2A94A 1N2SA 1B8VA 4G65A 1I33A 1BMDA 4XGKA 4YEDA 3GG2A 2P4HX 4E21A 3RUCA 3D3EA 1ULUA 2E6UX 2WTBA 4AJKA 4CUKA 3PPIA 3K5PA 3KYCA 5TQVA 4J0EA 4JN6B 5K0ZA 2YHIB 1LBEA 3W1VA 3C85A 3B20A 2JCXA 4B4UA 5IFLA 1N8KA 1XEAA 3RWBA 4NHEA 4MVJM 1P1IA 1O94A 5IG2A 1Y81A 5AYVA 1PJQA 3JQ9C 1Q7GA 4CL8A 5KKCA 1Y8RA 3Q6IA 2QRLA 4R3NA 1CEQA 1YGYA 3BHMA 4PLHA 2W2LA 2EW8A 3AJRA 4UUPA 1ZIDA 3WJ7A 2VWPA 5K9ZA 1SOVA 1UDBA 2HK8A 5JYFA 1N7HA 4GVLA 3NTOA 2Z1NA 4M86A 4JCOA 4BNMA 4NFSA 2HMTA 4XB2A 3QSGA 3DMYA 3E9NA 3QVXA 1YO6A 1H6DA 1BTOA 2FMUA 4YYZA 2AEJA 3PWKA 2B36A 3QW2A 3ZWCA 3OICA 1J0XO 1Z82A 3IL2A 3OJ0A 4CM9D 4D42A 4AJPA 1QSGA 4IDCA 4OMUA 4YCAA 5CPFA 5DOVA 4A7PA 1YB4A 3D5TA 3DBHB 3CSDA 2CVQA 2YJZA 3A14A 5A3VA 1JU9A 3E9QA 4KQWA 3I23A 3ZV4A 4CLOB 3NJ4A 2NTVA 3OA2A 1K6JA 1TT5A 4FJ0A 1F12A 1QMGA 1Y8QB 3DBRB 1P1HA 3N7UA 3Q9UA 4MOWA 3RUHA 2HKIA 3JQDA 3RASA 4DL9A 4WEOA 4BNIA 4BNTA 4F45A 3LLVA 1SAYA 3AUUA 1K2WA 4CMBA 2X58A 1DIHA 5EL0A 3ZU4A 2BFPA 3FHLA 5JLAA 5CEFA 3E1KA 3DBLA 1ZO8A 4CLDA 3DBHA 1E6UA 3GA0A 1VC2A 5L3ZA 1NVGA 2F1KA 4GLOA 4WE3A 1LXCA 1Z74A 4J7XA 1JAXA 2XPCA 5DULA 3WBBA 4EI2A 1HDXA 1ENYA 3P2YA 4N7RA 1OI7A 1V6AA 2FR0A 5EJ2A 1HF3A 3O8QA 4K26A 1NVTA 3JTMA 4GX0A 3VH1A 4BNGA 3EMKA 3FTNA 2Y1GA 2Z5LA 3EGOA 5B1YA 1LC0A 1JQBA 2BHLA 1QLHA 3ZHYA 1E3WB 5CAEA 1DFGA 4LMRA 4BNKA 3K9QO 1MC4A 3PGJA 4DQXA 2WWRA 1EQUA 1GUYA 3GVPA 1F8GA 3KZVA 4OSOA 1LDMA 2YV2A 2VT2A 1Y5RA 4FFRA 5IZCA 3KSZO 1NAHA 4MP6A 4QXMA 5DT9A 1VJTA 4CM9A 2GUGA 5T6BA 3JD1A 3WWYA 3WWZA 1U8FO 1P74A 3FR8A 4W9NC 3BTOA 1QYDA 1N5DA 2B37A 3LT1A 4LVUA 3VZQA 1EFKA 1JWAB 2AMFA 1K3TA 4FOOA 2H5LA 2X9NA 2TMDA 5I9MA 2WD7B 1QR6A 4W6ZA 5JDIC 1GYPA 1MC5A 1MXFA 4J1NA 4E2WA 3DQPA 3GPDG 1KVRA 1DJQA 1NWHA 1EE2A 3SJUA 4J0FA 5FEUA 2Q1TA 1IPEA 5HS6A 1I3LA 1B0AA 3H65A 4AJIA 3ZWXA 3QVOA 2RH8A 4UVHA 3O8QB 4J9VA 5KJFA 1VPDA 1HZZA 4IMPA 1MX3A 4L76A 1FF9A 3U49A 2BELA 4NJMA 3L4BC 1QP8A 1ZSYA 3SLGA 4PLTA 3PQDA 4IY1A 5BSFA 4GGPA 3TOZA 3F46A 5I7EA 3HDYA 1P33A 3AFMA 4PRKA 4RDHA 1ISMA 3NT2A 1M66A 1PJ3A 3WGHA 3UCEA 1FXSA 4E12A 3FNFA 4CLHA 2VRBA 4J90A 1PX0A 3ABIA 1BVRA 4ND1A 1E1MA 3H3FA 5L7TA 1A9YA 5HA5A 4OHUA 2OGUA 3WICA 1TI7A 1GTMA 3GLQA 2UV8A 3ZNQA 3GN2A 4UEKA 2CD9A 1HL3A 4WNCA 2HRZA 3VH2A 4YT8A 3ADPA 1RM3A 3Q2IA 1L7DA 4R69A 1EK5A 1WDMA 3WFIA 4XRRA 2X7HA 1J49A 1R4NB 4Z3DA 4CQMB 2EERA 3V1YA 3RBXA 1D1TA 1HYGA 1UJMA 2WE7A 3WGZA 2EJWA 1D7OA 3F1LA 1H2HA 3PJGA 3K31A 3ITDA 1JKJA 4CMIB 4UUMA 2AQIA 2CVZA 4K28A 3WQRA 8ADHA 1ISIA 2WE8A 1GQQA 4ALNA 1PGPA 3JQAD 4KQXA 3TF5A 3JQ6A 4CM5A 2BRUA 4XRGA 5B12A 2PWZA 3FNEA 4GL4A 3GGGA 5CG1A 2Q50A 3OIGA 2EXXA 4LISA 4HXYA 2B4RO 4ZRNA 2Y1EA 4Y9DA 2HQ1A 3VPXA 1PZEA 4M1QA 3RVDA 3I6QA 3X2EA 2PKQO 3TZQA 1ZXLA 4GAEA 4QT0A 1NPTO 2QHXA 5U4QA 1H9AA 4GSKA 2JFHA 3OJFA 1HETA 4EYEA 3TOXA 2YY7A 3PHLA 3GC6A 3IP1A 1K0UA 3AUSA 3BMNA 3I9MA 1X7DA 3IOYA 3WLFA 3HB5X 4OQZA 1YBAA 2VN8A 5TX7A 4CR7A 4Q3AA 2I9PA 4E2YA 2J6IA 1LRJA 3IC5A 4J4BA 3WOHA 3H8VA 3FTPA 1KERA 3K73O 3OMLA 4XDYA 3AY3A 5BNFA 2PY6A 3NT5A 3VOSA 4QO7A 3ZNOA 1A4UA 4FGWA 5G4KB 4BNFA 4KUGA 4R1NA 3BHJA 1ZXBA 2NQ8A 3F5SA 1PGJA 1LC3A 3E5MA 1ZW1A 4NJMB 1DRVA 1E0DA 2FPPA 2VNAA 3LF1A 4O0LA 5CPBA 5L95A 1R16A 3VVCA 2ZCVA 3WYEA 3PYMA 3M6IA 2Q49A 3F5QA 3DAGA 3Q3CA 1S7CA 2PGJA 5HWSA 4RF3A 3ETEA 3OF2A 4CV0A 2EIHA 4PG7A 3HFSA 1DOHA 2FR1A 3DHNA 4RVHA 1N9GB 4XX0A 5GZ6A 3RIHA 4D0RA 1GZ6A 2VZ8A 3JD3A 5T8KC 2BGMA 3IIEA 4IS3A 5MGBA 3VDQA 1XYGA 3Q2KA 1YQGA 4BKUA 2WYUA 4XR9A 3FNGA 3IQDB 4TRJA 2YQ5A 2FSSA 4F6CA 5JYAA 3BIOA 4J9UE 2HRBA 3DZBA 3H5RA 5I8ZA 3U62A 1E3JA 1XDWA 5B4TA 5CDGA 3SC4A 2X5OA 3ONFA 4IDGA 4I8XA 4BO3A 3OJOA 3QVWA 1HRDA 2UUOA 4Q3CA 4NBRA 4JBIA 3GGPA 3U3XA 2PZJA 1BXKA 1MG0A 4WPGA 4XZ3A 1BXGB 3ETDA 2VYND 2X86A 3HFGA 4DLAA 3H9UA 3LYLA 3A28A 3NTQA 3BXXA 1KEPA 1Y9EA 4TVBA 5L51A 1YQXA 1TT7A 2YUTA 3AM4A 4R01A 4CM6A 1HYEA 2P9CA 1U3WA 4XYGA 2A35A 3DONA 4D41A 3F4BA 2B0JA 4FBGA 2D4AA 2Y67A 3L6DA 1NFFA 1B8PA 5JS6A 1HDCA 1SEPA 5A04A 1YL7A 4CMGA 5CEEA 1GUZA 1PS0A 3DL2A 4MVJA 1CWUA 3GUYA 4BIIA 4HFRA 3QE3A 4CLXA 3DZHA 4PZEA 5B37A 3ZZNA 4CLRB 2X6TA 3JD0A 4EDFA 4Y98A 4DIFA 2FPIA 3WMWA 1CETA 2HMSA 4FR5A 3CH6A 1NX6A 1AHIA 3G17A 4DBZA 2X8LA 2BMAA 4NR0A 4WK6A 3I9LA 4HNHA 3JYPA 1I36A 3JQBA 2G1UA 3MOGA 3HHPA 4MO2A 4DXHA 4C7JA 3PQEA 1HWYA 1MLDA 3LLSA 2Y0CA 2I6TA 1ISFA 4B7UA 4DPLA 3KHUA 3QWHA 5DCUA 4YXFA 1DC4A 4JBGA 5AVOA 1U3VA 1UZMA 3AUTA 3PQFA 3WJAA 2JJYA 4P4GA 5H83A 4DMMA 2XOXA 1W6UA 4JLWA 3KLMX 3DDNA 2X5JO 2PZKA 2WYWA 5BSHA 3KSDO 4JJGA 2RHCA 3BMOA 4BO4A 1VKNA 4CMJA 1E1LA 3IJPA 1R0KA 2VHXA 1SC6A 3JCZA 2GNAA 3A4VA 3E5RA 2ZTMA 4DBVO 3ZV3A 4N18A 5JCJA 1F14A 2RH4A 3U4IA 3SEFA 5JDCA 1I32A 1HZJA 1C0LA 2IODA 4U6QA 4Z6KA 3EK2A 3PP8A 1NYTA 4FD3A 3F47A 5U1PA 1GYQA 3ICPA 1Z7BA 1XGKA 5ILOA 3KVOA 2EGGA 2FY8A 4NK4A 4WLOA 1PJTA 1AXEA 7MDHA 3C7CB 3EVTA 2IDZA 1X7GA 3K96A 3UW3A 3DZJA 3UAGA 1EVYA 3GT0A 4WCFB 4YJFB 1U2DA 4YJGA 2ZB7A 1UR5A 1C0KA 4N5LA 1GV1A 4YTEA 3DEYX 4QX6A 5JYEA 5ER6A 3AOEA 2WJPA 5TSDA 3PYLA 4Z9XA 1NAIA 5JMPA 2IXBA 3GVHA 4PLPA 4CJXA 1E7RA 4XGNA 2OZPA 5DCWA 4DTIA 4N54A 3EZYA 5EQFA 2YDYA 3TFOA 2OBYA 4K1LA 1Q7CA 4KUHA 1GADO 2WD8A 2YQ4A 1NP3A 3BA1A 4NFYA 4FFOA 3RU9A 1E6WA 4ALJA 3L07A 3L77A 2RIRA 1NQ5A 3UOGA 1K5HA 3MJCA 4J91A 5G0UA 2ILTA 3NYWA 4L74A 4WUVA 5IXYA 4NBVA 3UN1A 3BMQA 1YOVB 4PZCA 4EUEA 2CZCA 4RF5A 5G0SA 2AHRA 3H7AA 1CIVA 3W4KA 5ES3A 3QJ5A 3OQBA 2DBVO 2POQX 5A5EA 3NDIA 1CDOA 5JW6A 1AXGA 2BGKA 4CM7A 1PU2A 1KBZA 2PH5A 4YB8A 4R1TA 5L4NA 1T2AA 4BMVA 2FSVA 3QLJA 3HB4X 1SB9A 4YJHB 1Q2XA 2G17A 2X9VA 4GMGA 1GQ2A 4NBWA 3T7CA 1ISHA 1Q0QA 1V3VA 3SJ7A 1FJHA 4E0BA 1WMAA 1V0JA 3BMQB 1SNYA 4OKNA 1GYRA 4U5QA 1ZSNA 2UAGA 2WEKA 4B8ZA 3VPHA 1RYDA 4FS3A 4FCCA 3DHEA 2Z1MA 3ANMA 3H9QA 1NHGA 4E2XA 4DPKA 2JHFA 1CYDA 4LW8A 3DFUA 1VRWA 2VZ0A 3TDKA 3Q0EA 1PL7A 4BNVA 4W82A 4YAKA 1UXKA 4BKRA 3FPLA 3G0OA 1AHHA 3TPCA 1ZMOA 4L0QA 5C7OO 4PRLA 1WAMA 4CLEA 3LVFO 1T26A 2GZ2A 3E03A 4B4WA 1Y5MA 4X54A 2GZ3A 5GZ1A 2NV6A 1CJCA 4OQYA 1KOLA 1KVTA 4NG5A 1LRKA 1H0KA 1LDGA 1H94A 4MIEA 1PJSA 3RROA 4FIZA 4J4HA 5DBFA 3VKVA 5JAZA 4ZQGA 1ONOA 5IDYA 3K6JA 4RGBA 3S2EA 2DFDA 2R6JA 1O5IA 1RYEA 5LDHA 4RPGA 3F4LA 5GZ3A 1W8DA 1MFPA 4HV4A 1P3DA 1PR9A 1X7HA 2BFAA 5A9SA 2C5AA 1EBFA 5TRTA 1EDOA 1TXGA 1QV7A 4YJFA 4ZICA 4EITA 3WXBA 3O4RA 4JX8A 4IIVA 3ULKA 4R5HA 1U7TA 2X22A 1C14A 3RC9A 3FI9A 4FGSA 2ZJ0A 4K9DA 4BVAA 3ZU5A 2Q46A 4KWIA 3DR3A 4Y6PA 1DEHA 4OOFA 4AG3A 4M49A 2O3UA 4MP3A 4NJOA 5KWEA 1JDJA 3UUWA 2B4QA 4J49A 4R1UA 3ASUA 4BO8A 5GMOA 3MJTA 4DPMA 4XR4A 4WLFA 5A9RA 4D3SA 3KSUA 4E5YA 1XKQA 4UVGA 1PQWA 3S2IA 3M2TA 2QZ9A 1ENPA 4GKVA 3ZNNA 1YJQA 4ZVVA 3I5MA 2IEDA 1XWFA 2YDXA 4PG8A 4KUEA 3ZGYA 4E5MA 4PLZA 4R3WA 1EK6A 4W4TA 4LN1A
chains in the Genus database with same CATH superfamily
1SCIA 2XBUA 5JE8A 4ZDKA 4JASB 3WISA 4OX9Y 3LC1O 2VP4A 5EHNA 2BBTA 1P1JA 5TMBA 1FEZA 1YVRA 2Y66A 4PE5B 1E96A 4RC9A 2R1VA 3NHWA 1RPJA 3L84A 3QEMA 4E5UA 4ZOAA 5E3IA 3TQHA 4DM4A 3HA7A 2CF5A 1UC9A 1K4KA 5K0NA 3CKYA 1LI7A 3L8HA 3FB1A 5K6AA 2OGSA 2YL2A 2GPWA 2QX8A 4ARCA 4BX2A 4HTAA 5E3HA 4P3NA 1U0NA 3OX4A 1HT0A 3N8GA 3B2QA 3T4XA 3JASA 2EKDA 2R87A 2XVMA 1SBCA 3HGTA 3LAWA 4HAUA 5FRDA 1XL0A 5JBIA 3I2GA 3F2IA 1T1SA 2J48A 4K3UA 3OA0A 1Q83A 4IQ0A 2J3QA 4MO9A 4PCLA 1Z29A 3EXG2 4JLMA 4EG6A 4MUMA 3C48A 5F2EA 3ODPA 3GLHE 2I78A 3D7SA 4NOJA 4OL0A 4YFYA 3IPYA 3SHFA 1IHPA 2WF8A 3LSYA 4QTXA 3PBKA 4X90A 4U2KA 3SXUA 3ZLTA 2Q4EA 1P1CA 2PWAA 3REQA 4R1SA 1EP3B 2NYUA 1WPXA 3V46A 5FUVA 4R4JA 1UWLA 3PG5A 4R9RA 3A3KA 3ICQB 1K6MA 1WDKA 2XAAA 4HBGA 4N5NA 2WAXA 2K7ZA 2JARA 4R1LA 3AL0C 3HVRA 4RGYA 1OAKA 5TPZA 4R16A 2FWPA 2W93A 3G2IA 4HTFA 1YRLA 4LTNA 5JWOA 3CCBA 3EJWA 4GMXA 2IGTA 1EIZA 2QYOA 2G09A 4NS4A 1G4HA 2YWHA 1L6RA 1KYVA 2GPBA 1FTSA 4C5BA 3VHLB 3UT0A 2ZR0A 4HNVA 4DCVA 5DM4A 3H6GA 3LXXA 4G1VA 3R8XA 4XCQA 3EBOA 4H7IA 2PA0A 4FYXA 5K05A 1GR1A 2XGOA 3DD5A 1ZD1A 4IGFA 3UUGA 4X66B 3K70D 1XNQB 2P77A 3SYMA 5JHHB 2CV0A 2I91A 3HACA 1JZQA 1BN6A 4KE6A 4V0LA 3ZI0A 1FDVA 2NTYC 1QFYA 4QYSA 1VLVA 2RAPA 2OK8A 2WM3A 1F5NA 4WFQA 1UFRA 1WZ2A 1GITA 3ZDDA 5ILGA 3TYXA 1T8YA 2O48X 2D1SA 5JROA 5JDIA 4CM1A 2E5LB 1QYVA 2O9JA 5AXBA 3MTJA 4WECA 1OTXA 2O20A 2VNSA 3NBKA 4G0QA 3EGXA 4WBSA 4I0WB 2I65A 3IIIA 3K6SA 4ZCTA 3T95A 4NCNA 4G0XA 4JL5A 1V6CA 3RRZA 3DE2X 4RPLA 5B30A 4W9NA 4IS2A 5L6MB 3GR6A 4ZT2A 1YKGA 5E9JA 3UH1A 3QBVA 5KDLA 4J0DA 1WW8A 1DC3A 4FEAA 1FSGA 4QGGA 4F4JA 1GAQA 3OLXA 3UVEA 4BRWA 4AF8A 1KI4A 1VQ1A 3WSTA 1BDBA 3CRVA 3OAAD 2VJAA 3OSUA 3HC7A 3DZCA 3BSFA 1VHDA 1OA0A 1X87A 3HKBB 1L5WA 1I5RA 2FEMA 2CUKA 4Y6LA 3EZ2A 1ORHA 3BXHA 3RS0A 3OPYB 5IT4A 3THXA 3PNLA 3HNRA 1TAGA 3CXRA 1MDFA 1SOUA 1RZRD 3QFFA 4M83A 3NEYA 5IJAA 1U3FA 1TZ2A 2Y0PA 4UFOA 4IHJA 4P4NA 1TKCA 4B7XA 3NEPX 4EVRA 1DJNA 2QOEA 2ODPA 5JXWA 1T2CA 3DBLB 5IMSA 5DX1A 1EXNA 3IRVA 2P62A 3F6EX 1KI7A 2QTAA 1N0HA 5LLTA 1YR1A 1ONNA 4TTAA 1E5VA 4HEQA 3EAQA 3QZUA 4QZVA 5BUQA 2BKEA 3KFVA 2A9JA 4BE7B 1F9AA 3R7LA 1WXIA 5A4IS 1IN8A 4BMXA 1EMDA 4N3CA 2HN9A 2ZETA 4MW6A 3GJ8A 2AEFA 5HIAA 4ZU6X 2IH4A 1YZUA 2QRQA 3VAZA 2HMVA 1NUUA 1NQTA 5BN3A 4WCFA 1BCRA 1Q12A 3PXXA 1DWOA 3JVEA 1H05A 2Q99A 2QZZA 2ZVPX 4HGNA 4TGLA 2IYAA 1QFSA 2RHJA 2JCBA 4WVFA 1RKUA 2HDNB 3UA4A 1WZEA 3H2BA 3NMUF 4LHWA 1IEXA 3IR6A 1IG0A 2CFCA 4OUDA 3ZXSA 4OXYA 3AF0A 3T4EA 4KI0A 2IU6A 2JBHA 1PEAA 2O2DA 2JI7A 3TLXA 4EGJA 4HDRA 5ULLA 4ZZ1A 3PPWA 4CDRA 5A5GA 1IQ0A 3DQZA 1XZNA 2P2CA 1I79B 1EFLA 1M73E 3GJTA 3GVCA 4UJ3A 5ALEA 3VJKA 1ZJ6A 4WBNA 3UKOA 3NANA 2PT7A 3W8DA 4EUFA 1ZH8A 3DYBA 3QUTA 4Q3NA 4UQLA 1WXEA 1BU8A 2OTCA 1CUCA 2QRVA 2XE6A 1O96B 3D2LA 2JJ1D 1QBKC 3FN4A 3I2YX 3N2IA 3QOXA 2ERXA 2Y1FA 3EPPA 4WKCA 2I8CA 1XTPA 2QRZA 1LSOA 2AT1A 1XFDA 2X1HA 4WH0A 3RQIA 5FA8A 3BAFA 3HXTA 4EG5A 2PMDA 3E7PA 1BVHA 1P7WA 3AU9A 1W4CA 4JGBA 1NVXQ 3D6HA 5TEVA 2NSDA 4XA8A 1JE0A 3PXUA 4E09A 2GTHA 4ZQBA 3MAJA 1DEOA 4HN4B 1NMQA 1PR4A 3PZBA 2JGKA 4G0ZA 1R5JA 1XCGB 4JD5A 4PEVA 5C0OE 3VTZA 4NZOA 1I3KA 3PD0A 1N57A 2W8BB 1DB3A 1W46A 2ZE5A 3M1YA 4XYEA 5AHRA 3UAXA 13PKA 5CBPA 4P32A 2DKOA 2ZU6A 2E21A 4N0QA 1HEYA 2W6ZA 2I4LA 3K0EA 3L7JA 3CLKA 1OH7A 3Q7EA 1GQYA 2OHVA 3DF9A 4KTTE 4Z4CA 4F2WA 1L4UA 1UJ2A 4HFJA 4YJKA 3VYUB 4X6XA 1JKMA 2G4VA 2WILA 4ZI3A 5ABPA 5JAPA 1R5BA 4XCVA 5J2TF 2G82A 3OCCA 1YS4A 1TLFA 2FSGA 4YY3B 4R9VA 4WSOA 1N0VC 5JSHA 1LJLA 2GYVA 2OV3A 4WKOA 1LI4A 3LVRE 1LPOA 2C5EA 4K88A 3KVNA 1V4NA 4HPWA 3PD1A 4JQCA 2GBFA 2CE2X 2VUTA 3LWZA 4J1QA 4KODA 4OJMX 1NR1A 3LHKA 3QIAA 5D7BA 4F4UA 1QONA 2VLIA 1CUXA 3KYIB 2MT9A 3UXEA 5DMHA 4C88A 3O94A 1XU7A 3EEYA 4MRMB 3UH0A 4BP8A 2QSYA 1KJZA 2VNHA 4G8DA 4Y2VA 3OJWA 4QWMA 1ARZA 1N1MA 3FPKA 4WDRA 4JI7B 3Q0IA 3BE6A 4Y1EA 1OX4A 2HJRA 3L18A 2PUCA 2OHGA 2P2SA 1CB7A 2PYIA 3B70A 1WQ4A 3T5MA 3V5NA 2A5JA 3V2IA 2Z5FA 3OKFA 4ER3A 1ZK1A 2ID4A 2JCGA 2Q6IA 2CXSA 3C7DB 1V1JA 1YV9A 2B7BA 3ZDCA 1Z6TA 2DM6A 3OZDA 4N8DA 3QXHA 5B2EA 4FP9A 3ZTYA 4F5WA 1JFSA 3BOSA 3DOOA 4RCYA 3EWIA 5B7PA 1ZN9A 3AHEA 4WA8A 2F8TA 2JDID 5LCXA 1I5EA 3QU5A 2BM8A 4O2BB 3T0FA 4EF6A 3K09A 1E9SA 1ZC3A 5KDDA 3M6AA 3LYUA 4HQNA 1EWTA 4OXIA 3ZZTA 5IVHA 1YBFA 4JB0A 2TYSB 1P7YA 2W5UA 4LHEA 4N7BA 4S1VA 1QTQA 1UINA 5DISB 3QE4A 1E60A 2JEOA 3E3AA 4TSFD 2FRDA 3EVNA 1B16A 3R8CA 4AF7A 4REQA 4CKZA 5IEJA 3K5HA 1K86A 1IHOA 4U7WA 3TRFA 1SC3A 4MKXA 1U4SA 3KE9A 5BN4A 3DBIA 1XRSB 4HYQA 4XH9B 1YFLA 3R77A 1T3HA 1RXYA 1F3OA 3COPA 5EP4A 2FG6C 3A3YA 3BSYA 1PYGA 1EG2A 4FC7A 2ZCUA 1ZLYA 4M1ZA 2EG5A 2Q8QA 4FDMA 2O4UX 1IAQA 4MPTA 2P11A 3WB1A 4MQ6A 1ZNQO 5I48A 4US1R 3RYCA 2PVCA 3QY9A 5I45A 2O8FB 2HREA 4URXR 4CXMA 4RTKA 2NXNA 3AZOA 3SOZA 3U39A 5DEIA 5EINA 3KXLA 2OAEA 4GNKA 1O89A 4QDZA 1Y4UA 1PWXA 1PP4A 5IC5A 2M1ZA 1KE1A 3E3NA 2UYYA 3RR2A 2V0NA 4B47A 4EB3A 5I7SA 2IRWA 3A6GA 4ROTA 4DRYA 4YQYA 3ZVKA 3H9CA 1ZJ5A 3QPDA 3VU1A 5KYYA 2PFGA 4HP8A 2VZ9A 2EVWX 2QQEA 3EGWA 1E5DA 2ZRMA 4XGRA 2OM2A 5GAJA 3D4OA 4W5QA 1QCDA 3L6CA 1V9CA 3FF4A 3SQDA 7ADHA 1KZ1A 1JDPA 1Y8RB 2ZYHA 3N2GB 1QU2A 4TV8F 1G18A 1CP2A 5FI3A 1ESNA 3ELWA 4B0PA 2RKOA 3ZWVA 3QU4A 2G88A 4XB1A 3DE0X 2WUGA 4MIYA 2LR0A 3KKZA 4CLRA 3EGVA 2H2GA 5JANA 3WZLA 4W1RA 5TT0A 1NQVA 4M98A 2XF8A 3RSZA 2OKCA 2XBLA 3C8MA 4E1BA 5LJIA 4RO0A 3RUIA 3UAWA 5HRCA 5JU6A 4IX1A 1Q14A 2UYOA 3NIFB 1FDUA 4A0HA 2REOA 1BEUB 5AXDA 3BZWA 3EP3B 3KYBA 4BN5A 2FR8A 1MIHA 1P0CA 1ULBA 2HSEA 4RU1A 4B6FA 3UNXA 2ZRBA 2M9MA 3HVIA 4NBUA 2QMYA 3TTUA 1IZ8A 2XWPA 4H7JA 1E2NA 1QVZA 4BVFA 1WHSB 1F1BA 4CIYA 3GJ0A 2H5EA 1XF9A 3KSRA 3D7LA 4C3OB 1EP9A 3FM9A 2XXBA 5A5FA 3UC9A 3L8YA 2WWXA 3D3QA 4I1VA 4UC0A 1VBMA 4HI0E 3I37X 4YMLA 2LNDA 2X0EA 4XQCA 1YCGA 3FPAA 1O6ZA 4PG6A 1YZFA 3AXTA 3RVRA 3KLOA 1P3Y1 3OPQA 2RB4A 4PZDA 2WKPA 1PJBA 2KX7A 3EEIA 4A03A 2GJ9A 4LY6A 4FJ2A 3SDBA 5BWOA 1GCAA 2R79A 1Y89A 2PEZA 1UM9B 1G8PA 2Z4SA 1I7QB 5IYZA 1KJ9A 4BECA 2QUBA 1PNVA 4G5QA 3TQOA 1OILA 1Y7TA 3VMFA 4EMTA 1KETA 5CU7A 4MVJH 3WZ2A 4D4GA 3QEKA 2Z4TA 4KXYA 1DO2A 3IKVA 1RYYA 2ZIXA 3R3JA 2QTZA 2HA7A 2I87A 1W44A 1JGTA 2B1JA 2BFFB 4KXVA 4II2A 3WLOA 1R6AA 5LOVA 2ENUA 2VYNA 3IOBA 4CPDA 1OI2A 3DC2A 1JH9A 1A9TA 2OV8A 2RHRA 1M5TA 4MR9A 1VRCA 2O8NA 3NHBA 5C2JB 2NLOA 3AHFA 1YASA 4DGSA 3M6UA 5T6MA 2Y1XA 4BB5A 3MSCA 1ZD8A 3E9MA 1YI8A 4G1BA 5ITWA 3P27A 2BFDA 3R3UA 1PDOA 4OQDA 3UWDA 2ZTUA 3KB6A 4J4TA 1P5RA 3UFXA 3R5HA 4IRUB 2PGLA 3W1WA 2HK7A 1GKKA 5EWMB 4Y18A 3GBVA 2B7LA 3OM9A 1E2HA 1W5BA 4Y1GA 3RSGA 3DTTA 1QK4A 3PWTA 4MVJE 4TXLA 2F3UA 2QX4A 3WIUA 5G02A 3ZHRA 4RENA 4EG8A 4X7RA 3D7KA 4AMZA 2PCLA 4ETWA 1C3VA 4RFVA 2OV2A 3DMTC 1JHAA 2EFYA 3COWA 3OY7A 4B9EA 2QN8A 2VL7A 2X2PA 3FTCA 4IILA 3WYGA 3MSXA 3GX1A 3NUGA 4B0OA 3IUNA 1Q15A 3OI7A 4EHIA 4ZCIA 3EIHA 3V97A 5K03A 1N5OX 2ENWA 3ZZ0A 4IXWA 1M5RA 1TKBA 3K0CC 4B17A 1QGUA 1TM5E 1OW3B 1Z3IX 3ZGZA 2OHXA 3CNNA 2AE2A 2ADOA 3P71T 3TV1A 3GUCA 4Z7OB 4RNCA 2EYUA 4DG5A 3Q1LA 5BNIA 1YL5A 3U6KA 4D26A 1R8XA 2BEJA 1E18A 3ANXA 3LWBA 3DEZA 1NXVA 3HQ4O 3KQWA 3Q3HA 4RTRA 1Q1BA 1QM5A 2C2XA 5JALA 1CXZA 2QU7A 5CK5A 1MXHA 2I6FA 1ECGA 1GXSA 2J30A 4FI3C 4MGEA 2OCAA 3JWJA 5K99A 5ED4A 1LW7A 5E4YA 4ZODA 1QG2A 3RKRA 1DWUA 4PZUA 1QHXA 2O23A 2ZDGA 3UF0A 5F4ZA 5BWCA 1C9YA 1OMOA 2HYDA 4OA5A 2BZ1A 4BCBA 1N4DA 2W70A 5CDUA 3GFRA 4I5GA 4RE5A 5ISMA 5LA6A 4EAQA 5J58A 4KQ2A 2O8EB 4A2QA 3QWFA 4OCZA 3URKA 2FEKA 3SYKA 2R0QC 2NUTA 1ISSA 4S12A 5DW3A 4LF8B 1MQ8B 2GERA 3OCJA 4KVAA 1KTVA 1M2OA 3AKYA 3AVYA 1HR0B 2BFNA 2G7ZA 3HCFA 3UJ3X 1G8JA 2AC2A 4P1ZA 3P2MA 1JPNA 2K7FA 1O77A 1U2EA 2GM4A 2VJBA 2WJ6A 1J99A 3EASA 3GAFA 2HC9A 3GK3A 1C30A 3L9WA 4XI9A 1N6IA 2PZAA 1XPRA 5IWCA 3UANA 4RVUA 4XJSA 3TW0A 1GL7A 2EV9A 3NU1A 4O2RA 3IT0A 1XQWA 3HUDA 4Q05A 3D4NA 3OLCX 4HGZA 5ALQA 1IJEA 3G8CA 3TGWA 4DA9A 2FFJA 3WQHA 4JI8B 4R2IA 1IY1A 5FP0A 5LFAA 1KJWA 1V2GA 1YBMA 2DPYA 3HDQA 1N2OA 1HDEA 1XRQA 4L27A 5JATA 1F0PA 2Q6TA 2PMFA 4F4DA 1W76A 2JEYA 3K35A 3RYIA 4MH0R 2FFAA 3T1QA 4RAQA 2EG9A 1ZHOA 1NQUA 4MPRA 4TT8A 2I22A 1MFZA 1TMYA 2V7QA 1QRUA 2CY0A 3AEYA 1V16A 4KGDA 4D9CA 1LDEA 1DPFA 4IOMA 2FG7C 3BE4A 5HE8A 1S8AA 1WKBA 1AK1A 4JODA 4MTLA 5CLHA 3ZKWB 1QH0A 4YUVA 1VLHA 2VJDA 4U7FA 4KPEC 1E3WA 1P4JA 1UKYA 2G9UA 1AK2A 1Z7WA 3RS7A 3TEFA 2YZ2A 3IAHA 2IYRA 4F2PA 4OQLA 5GPBA 4RETA 2IUFA 2WU4A 3SJBA 9ABPA 1F06A 3L0PA 5L4LA 2VVTA 3CZRA 4DA7A 3UG7A 1BGXT 4WWHA 5B2ZA 3FZQA 5KNBD 3PQ8A 3T15A 3SFZA 2KB0A 4ESOA 2D5LA 2XOKA 4PR0A 2FJPA 3D4BA 1UKZA 4M6WB 3TSCA 2FFBA 1S0UA 5JCPA 1W88B 3ENNA 4DA8A 1W0CA 1YR7A 3ONEA 2ZUCA 1FRQA 4NH4A 4DJTA 4JMPA 4MYCA 3ZQUA 2W2LD 2HMUA 4Q7EA 2NTEA 4WL0A 2H52A 5CVTA 2XA2A 2ONZA 1FBNA 2BBOA 4DSUA 1Z2DA 2Q5QA 1NZDA 1YKSA 1X1EA 3RJMA 4ML3A 3STHA 1P1BA 2HCTA 1Z2OX 1Q7BA 2RK4A 1P19A 3UHAA 4D96A 4DMUB 1WCIB 4UBJA 2X8AA 4GL2A 1ONBA 1CRQA 3KKKA 4NIMA 3ORRA 1PR6A 5JEDA 4QJBA 1SGWA 2P0EA 2P1RA 3H5VA 2M6KA 1WR8A 4TZ0A 4IDAA 1QRRA 3ASZA 1L8QA 4J07A 2C4TA 2PXAA 5IAAA 1X8LA 1UMBB 1VHWA 5JMOA 2DB3A 3X1ZA 1FNDA 5EWJA 1S2IA 2GN1A 2ONYA 3ENWA 2EARA 3FETA 3R3WA 1EWRA 2VF2A 3BFXA 2OOKA 4LHVA 2EEPA 3TZHA 3LBHA 4PFJA 3SEQA 4GLJA 4BJ3A 4QUDA 4UZEA 3JPYA 1BZYA 4YJGB 3WK8A 5BSTA 3JASB 4QBIA 2REQB 2ZBPA 2Y99A 3WFJA 4A5OA 2UXDB 2V6MA 1J22A 5F76A 1SUAA 3KU4A 4U0JA 3PHBE 4XIGS 2WUWE 4RHCA 2I6UA 4B6QA 3UGJA 1ZOOA 2L42A 2RHTA 4B82A 1PKEA 4IKOA 2AX3A 1Z22A 2VUIB 3J7TA 4UMFA 2FPGA 4FFVA 1N2CA 1DKLA 2YWCA 2DFVA 1GY8A 3HGQA 3N76A 1J97A 2WDPA 2XDWA 1RIFA 4Q3KA 5E4JA 1HGXA 2P6PA 1YQUA 1FUUA 2J0VA 2ODWA 4IEFB 2FX3A 3U3DA 1GZSA 1QQ7A 4AJNA 2W2VA 4Q7KA 4A26A 1E2QA 5JZOA 1XLWA 2C84A 1UM8A 4RTMA 3NRJA 4GKAA 1W36B 2WT9A 4UHFA 3DFMA 3W8RA 4LVNA 3TSYA 3DPUA 2JFYA 5KOYA 1KU0A 3H83A 1YHZA 3N0XA 4I9GA 1WU8A 4JJZA 1IEVA 2AOWA 2FPMA 3THSA 3U17A 4F71A 4ZYTA 5KNBA 1H2XA 6ABPA 4HVTA 5GM2A 4KOEC 3ZHXA 1I3CA 4H08A 1DTEA 2J5QA 4PQEA 1PFGA 4PHTA 1JDTA 3GRAA 5E1BA 5K8UA 2WVHA 2Q6OA 3JQ8B 1FX0A 1UIRA 5E7IA 3O3NB 1KEUA 1NVEA 3MBIA 3ZWDA 1OZGA 2BMEA 5F1PA 1DS6A 4MVJP 2YJ5A 3R3XA 3F6PA 4LJ8A 2AZDA 1Q19A 4JL6A 5KIAA 1I1OA 1ZVKA 4EHDA 2OFXA 1O9HA 1P0QA 4JKYA 4CMHA 3NWEA 2FZCA 1CERA 4RLSA 3INTA 1YC5A 4S3MA 5K3OA 1AF7A 2C61A 2ZT7A 4XM1A 5IKMA 3JQ7A 2I6GA 3D8BA 2QROA 4HUJA 1KYWA 4FFBA 5DGXA 1U90A 3HN2A 1VJGA 1CUEA 4C0SA 5C9ZA 3NYIA 4FEYA 1EGVB 1KWGA 4EQZA 5I9NA 3I92A 1P7CA 2QXTA 4DCTA 3A6PC 2GETA 3AOEC 1Z0KA 4B9AA 1BVUA 1CE8A 5EERA 1YZQA 2X0IA 2XCQA 3A6JA 4TKZA 4Y2TA 4DV7B 4I1PA 3P45A 4KC0A 5KYWB 1NN5A 3EQ9A 1KZGB 1A95A 1TF5A 3V3KA 1W4AA 1L4GA 1KQFA 5KYUA 3JALB 3FMOB 5ILQA 3DVAA 3DZ3B 1P31A 3Q40A 2ZPAA 3EB9A 3HCCA 4RX1A 4GPTA 5E6UB 5E3JA 4UFPA 3JX9A 5DPMA 4Y6SA 4LV6A 2WF5A 1K2VN 3PR3A 4IAOA 2ORYA 5I5EA 1GGMA 2D3WA 1J8MF 3SX2A 4S1PA 5JSUA 3I1FA 3I32A 2CBZA 3E2PA 1VI6A 1CZNA 4YN3A 1XMOB 4L85A 4FMCB 5LYYA 2NOAA 4WVLA 3HU3A 3FUCA 3WV4A 2PU7A 1Q16A 2HPVA 2ZITA 2P2ZA 1ISRA 5EXXA 3AIOA 1VHQA 2ZR7A 4A16A 4MRRA 2GKOA 1JEOA 1NW5A 2PXXA 1IRXA 4KE8A 5H5JA 4F21A 4HFNA 1W36C 3AQ4A 3DFZA 3R9WA 2G0TA 1Y3CE 2QRJA 1GT91 2M2IA 2V7UA 4U9HS 3SSAA 1CFJA 1ZINA 3PX2A 1OXXK 3F97A 2PVSA 4KQFA 2HZBA 3FMFA 2GHRA 3JVVA 4RTSA 3T3PB 5EWLA 3BICA 1HDZA 4DV0B 3I0MA 1RRFA 1DXQA 1SXIA 5DB4A 1UAAA 3ISJA 3P0IA 4TN5A 4D8VA 1YQWA 4ZP1A 3VHXB 4LRUA 1JQAA 1WUYA 4G85A 1EAYA 2ERYA 1BRTA 3MA0A 3CUKA 3WMFA 4AZ3B 1PGNA 1Z5GA 2GZAA 4MYDA 1QTIA 5K8CA 4XWKA 2F1JA 2OM6A 2OD7A 1X7ZB 3IIKA 5F78A 4UDXX 5HJ7A 1VSUA 2W6PA 1FSZA 4HGPA 4JDUA 4X3CA 1MEOA 4DWVA 1NWCA 1MA3A 2G7MC 4LOKA 3ACBA 4AJ1A 2RBEA 1X0VA 2W2QA 3DVRX 4RF4A 1NNLA 1Y6RA 4LK3A 2WSMA 3C3PA 3Q8LA 2W6JD 4IDFA 1PR3A 3B9PA 3ONWA 4UNRA 4QAQA 2Z9CA 1DG1G 1UP6A 1NASA 2QNBA 1FSFA 2HIAA 3K3PA 1H4SA 1A04A 2FXIA 4JA0A 3MTDA 5DGDA 2JD0A 1JKFA 1GGJA 4BKPA 5JXIA 4QYIA 1A8SA 3NGMA 1E2IA 2O2EA 2QVGA 2W2TA 2JD1A 1W34A 4XD7D 1T36A 4R9SA 4ZWNA 4G5RA 2ON6A 1GKYA 4BGEA 1G6OA 2W83A 5HGXA 4ZK2A 2YN2A 5EJ4A 1O6BA 3EOBI 3GRPA 3VU0A 1BH6A 3QMWA 2RGYA 4CETA 2OXIA 1UBOS 1BXGA 2AJLI 4QTUB 3ORFA 1VIDA 4F4CA 1VI2A 3EG5A 1UEIA 3LLUA 5DN9A 1ZK2A 3ZHOA 1UOEA 1P1RA 1Q3TA 2BUBA 2M98A 2NNWB 4LOJA 3SS8A 1MNQA 3WHPA 4DNFA 4DVGA 4DJFC 2J31A 5EZ5A 3TNFA 1ATZA 2FSPA 3BEDA 4KI7A 2ZAYA 4MWGA 5FD8A 1GO2A 4EJSB 1FY2A 3GMTA 4AS3A 3HMQA 4Y9RA 1YOVA 2VUHB 2WB4A 3VHRA 4L9AA 2DXIA 3JQGA 2ATVA 2YBEA 4CEHA 2DF8A 4JMLA 4ZHQB 2XQIA 4OHFA 2A4KA 1QR2A 1YZYA 2E1PA 3EXAA 4MB2A 2F1HA 4Q24A 1YDFA 1NBMD 3WNCA 4P92A 1U9CA 5CLFA 2GD2A 4U9IS 1SCKA 2CNLA 2IDMA 4E70A 3CZ5A 3QSYA 3LZDA 5C53B 3UEOA 5CT6A 3OT4A 5JUWA 2P30A 4H60A 1CY2A 1MAWA 4HGRA 4D7AA 2GFIA 2R11A 4LC9A 4XIIA 4PPGA 4UPEA 1YS7A 1NM5A 3B82A 4QRIA 2X3UA 3L93A 3BQ9A 2VC2B 1USGA 1Z5VA 1O95D 4JENA 3R0VA 5JI3E 1GV0A 1KY4A 1US8A 3MWEA 4E15A 2EFJA 3GLIA 2VPTA 4IXNA 3ZD8A 1OFUX 1O54A 2OGTA 4NOLA 2IHUA 5EPUA 3F9IA 4ER7A 5IF3A 3OQIA 1VPWA 4JJEA 1MAAA 1YCHA 3CPJB 3NWJA 1YDMA 1FP7A 2VYCA 5K3CA 4CIWA 1C3OB 4XYLA 3WS7A 3RUEA 2HSZA 1JEYA 2CB0A 3L8MA 3QMPA 4A27A 4EW1A 4KXUA 3QTBA 5AM0A 4DREA 1JQ5A 3NBZC 1ZUNA 4EJMA 5KWSA 5DBEX 1F6BA 4RFSB 3EHDA 3DWGA 4EUSA 3PB3A 1A82A 4KWCA 2WHQA 1J1UA 1L0BA 1R0RE 2VYFA 3NHZA 4FFLA 2NXCA 4ZT6A 1Y3BE 1CUHA 2AJDA 3FGOA 3QKIA 3PEVA 4BMNA 1NUAA 2ZE6A 5KEIA 5FA6A 3P0RA 2CEAA 4RZHA 4RA9B 3EQ6A 1RM5A 3A1WA 5TLSA 4TLMB 4ZOEA 2XQFA 1PW7A 2O50A 3V32A 3GEPA 3NEAA 4NICA 1Z56C 2YWDA 2AFHB 1XU9A 1RAFA 3FLMA 2CUNA 2IXGA 4Q39A 1C1XA 1Q92A 3IBYA 5EQDA 1ENZA 3KQSA 4N0PA 1Z2PX 2SKDA 4ZVSA 3DB1A 4B6PA 1NLFA 4W7SA 4U39A 4OHWA 2QAIA 1QHFA 1ZFNA 3EUWA 4G4SP 4ANFA 3IR7A 3KHTA 4YP6A 4Q1FA 3RTEA 1MV8A 3I45A 1SD5A 1NJ1A 1HDOA 4OIFA 2W48A 4O4IF 4M9CA 4O2AA 3PQ2A 2FLKA 4RPCA 1BW9A 1HNXB 4LZZA 1E3DA 1EK1A 1WTAA 3D0QA 4K9SA 5EEHA 5WRFA 3TCKA 2IYVA 4BAZA 4FNOA 4ZEVA 1RXCA 3NKLA 4M60A 2VIIA 2OBNA 3JWPA 3KVYA 3QKWA 2Y1CA 3AERB 5LZ4A 4CEJA 2J3IA 2QG6A 5IK2A 3IWDB 1RKQA 4LDRA 1ISGA 1QLWA 5AJVB 3O95A 1AN9A 1TKAA 3ASVA 4CHTA 3O8CA 2YYAA 3DE1X 3FW1A 4IBOA 1U2SA 5IJZA 5CT4A 1KZ7B 1XVVA 1DUIA 4PANA 4LF9B 3A8TA 3MXTA 1N7GA 5JD6A 3E8XA 4B3FX 2QGZA 1B3BA 1BGVA 5SYNA 1MBZA 1J42A 4AKGA 4M53A 3KETA 2YR0A 4RFSA 5I8WA 4L6CA 1Y1SA 1O95A 3A3PA 3KKQA 5TB5A 3TO5A 1K5DA 2BUAA 2WD9A 1GZUA 3A31A 4DC1A 4B6SA 3HYTA 4BO9A 1QHHA 2C4KA 2BPOA 3F6YA 4UASA 4W7HA 5IVIA 4QHTA 1PR0A 4XJXA 3TINA 2DVMA 3UAVA 4BEJA 5KOJA 4Q19A 1KZHA 1EXVA 3VTFA 4MVJG 3BWMA 5F51A 1U2QA 3LDHA 2CVFA 4GUAA 4WFKA 1GNTA 2R751 3GVXA 1G1AA 2HEGA 1GTVA 1Y48E 2QV0A 2ARKA 4HSEA 3HWSA 1L5ZA 2Y68A 4CZ2A 1GZ3A 1PWZA 2OLJA 4DVJA 3HBAA 5CR9A 3EPAB 5EZYA 2AF3C 4HQ6A 2IKSA 4XPIB 3G0BA 5FNVA 1CX9B 3ZV5A 1OBFO 5J9GA 4MKRA 4U4AA 4TKLA 3IOEA 1QIGA 3AEKA 3K1YA 3AR8A 4INJA 2FPWA 3C4JA 1DZIA 1R4MA 1Z0UA 4X1KB 1VMAA 3SHWA 1P2UA 1O9BA 4DDVA 4G24A 3H2IA 3RD5A 2GVZC 3ICOA 5B6PA 3PFCA 2HY7A 3SIWA 4K9NA 2YICA 3FYUC 4LEIA 3A06A 2FUNB 1WZNA 4O4HF 5GM1A 5E1DA 1VPTA 3TOCA 1M6VA 3H2JA 3ORSA 4M0PA 2XIQA 2GCGA 3I5YA 1MB3A 3AL2A 3GAAA 1KMHA 1HYHA 5IJ0B 4QQKA 1DINA 2VPZA 4GPEA 1U8TA 3N3AC 2XCLA 3P4XA 3QVJA 4IHAA 4CIVA 3TPZA 3ETCA 1QYIA 4N8EA 4HUQB 1BMTA 3MUFA 4OBXA 2DUUA 2O2GA 3K4HA 1OXMA 1Y0BA 2LZ0A 3CGWA 3MJHA 3R3YA 4H16A 3TJMA 1TLTA 3Q6MA 3UXYA 2ZOSA 1TEVA 1FFXA 3NM5A 3PHHA 5BQXA 3RKUA 1D6JA 4KN8A 2VHQA 5KVVA 2AOXA 1REQA 1XD8A 3HKCB 1W4ZA 3I2KA 1RCTE 3W34A 1DQZA 4YT4A 3BBPA 3DKRA 2DEUA 5BQOA 4KBFA 5F1YA 4YPVA 4MWSA 1IXKA 4DCGA 2MINA 5HTKA 4TXNA 1YS9A 4LYDA 4DCSA 5IZ4A 5DM70 2XF2A 3K92A 2X2EA 3QEOA 5F1OA 4B7CA 2C9ZA 2JFWA 4CCSA 4ZHQF 1CCWA 4G5YA 4NOMA 2W6NA 4C9BA 4PG4A 1GA1A 1F6WA 3MLEA 4A4DA 3ZY3A 4YAJA 1G4UR 1KGSA 4Z9YA 1P4GA 1DHRA 3CIOA 1LLDA 2CMKA 3TLKA 4K0RA 4P7FA 5FUMA 5L7WA 3E0QA 1N5MA 2RIPA 2RI6A 1FDRA 4QGFA 2HSGA 2HSWA 3BS4A 2H2WA 2C7OA 3GFSA 1JHYA 3B3GA 2OUIA 3KM0A 1K8YB 3STVA 4DMMA 4IXDA 4HZGA 2JD2A 3GWZA 4FYPA 4ND4A 4TLBA 5TXGA 4Z4FA 1ZM9A 4Q9NA 5ANRB 4LBYA 4JOQA 4EKNB 3DTVD 3CF4G 4EHKA 3RCBA 2H4FA 4A8PA 2YASA 3MK31 4KMOA 5EJ7A 1A4XA 2JAQA 4NENB 1M9NA 4XLLA 4YJDA 5I7FA 4DMCA 2J5RA 5THKA 4Z9AA 4N41A 1DU4A 5E0KB 2CBXA 2OZEA 3OEWA 1G9XA 4LF7B 2GAAA 4L02A 1AV6A 1PSDA 3OTGA 1M8FA 1L4HA 1PFUA 1BIFA 1VL6A 3D64A 3FNHA 3JQ8A 4OMCA 1YAHA 4R84A 2J45A 2GN8A 3CLSD 5TC4A 3ZE6A 3HU5A 5EESA 4JR1A 3MWDB 3A70A 2AFIA 4HATA 4KN6A 4LGVA 3RS3A 4RK4A 2NZJA 5K3DA 4CTMA 2R6HA 1IY8A 4Y2HA 5T5QA 5IDVA 2XBMA 3TD2A 1XDZA 1ZIXA 1IL0A 1CZRA 1UOPA 2B9EA 1PN3A 1LLUA 2OG1A 2ZR8A 3B48A 2P9JA 3EGDA 4QPDA 4G81A 4V1CA 2AOTB 3A1SA 4RTNA 4KMMA 5JS7A 3OD5A 2NO4A 1W0JA 2PH1A 2VHZA 2C88A 3O3CA 2XODA 1GWNA 3DHWC 4FOLA 3S68A 4UU7A 4CHGA 4WZBE 1RYMA 3MHTA 3JVDA 1N1GA 2XTAA 5KU7A 1DDGA 3PI6A 1CG6A 3ZWNA 1I4OA 3EIWA 2F1OA 3EGIA 1NVVQ 3JSXA 1DIGA 1OAAA 4JJAA 4ZIRA 4GKBA 2R44A 4NBLA 5F12A 3NNSA 3ZEAA 1AY0A 4RCZA 4ZYYA 1XCBA 3L04A 3AJ9A 3B1XA 4Y8VA 3GEDA 1GPDG 4AN0A 4ARUA 2XEXA 5LQMA 3ZWPA 2GNOA 4BZWA 2ID8A 5HHTA 3S2YA 5JYCA 1JWLA 2B30A 3ILSA 4N6NA 3RFTA 6GPBA 2B82A 4WACA 1P1KA 1JH8A 1NBOA 1HG0A 1GKUB 2F6RA 4KLCA 3MWLA 4ZARA 4CF4A 4O4IB 4MS3B 4I55B 3KZMA 4WT7A 3UHPA 4RXTA 1E2LA 4P4TA 1DBIA 1R4AA 1FQJA 3GZ4A 4RDXA 3QUCA 3PNYA 4MI9A 2FDCA 2AN4A 1ORDA 4UNSA 3I9OA 1RWBA 5EE9A 4BS9A 1J2RA 3QX9A 2OAP1 2XZDA 4Q3LA 4UHHA 3RYHA 1CEYA 4DT1B 1ECCA 4PXYA 1U0HC 4WRRA 2B1GA 2X4LA 4A2CA 4JBYA 4PTZA 3NGXA 1PIWA 2YYSA 3BGSA 3GRVA 1PK8A 1SG0A 1N3LA 2H1WA 4MRNA 4O0MA 3ZCRA 1E9DA 4JEHA 2XUJA 2KBFA 4HL6A 4KO8A 5DM2A 2X3FA 1CY4A 1LPNA 2PMEA 2ZBEA 3CNBA 2DX7A 2WD7A 1EFHA 2YMQA 4OMDA 2OECA 3HABA 2CLLB 4HQLA 1SVKA 5LBUA 3RT9A 4UQOA 4ZJPA 4EEXA 1AU9A 3C39A 1L1QA 2PT9A 2HSDA 4PC3A 4AULA 5JY6A 1WEHA 4MUXA 1CY7A 3LW7A 1F4LA 3CH5A 4FMDB 2PSDA 2KM1A 4EUNA 1CU1A 4ROSA 1VJRA 4ZVKA 5JWRA 2COEA 5F3DA 4R2HA 4DMHA 3L3BA 1YWGO 1Y9AA 4O5OA 5KTTA 4HLQB 5PNTA 5BUZA 5LXTB 1RYHA 1JAYA 5FOVA 1U2TA 3CO5A 1JA1A 2ZCJA 1EFVA 4BIMA 1Y8CA 3IA7A 4FNAA 4FOPA 1W0JD 4N40A 9ATCA 3R0XA 5JV5A 4URZR 2C8VA 4IQFA 5ADHA 2VUSA 2G8LA 4G3XA 2XUOA 4QGHA 3U3MA 4BFCA 2WJVA 3JQFA 4I1YA 2DT5A 2D59A 5BW5A 2EP5A 1O5OA 2YZGA 5KOHA 5AHKA 5YASA 4C6SA 4DNOA 1E63A 1S3GA 1WD5A 2AHOA 1BS1A 2GD0A 2WSYB 3AYXB 4XJTA 3ZTTA 2OG2A 3KEFA 4CQLA 4D0NA 2FMTA 4KXLA 4LWQA 4EGCB 1SKBA 2XMRA 1NUSA 4RMGA 3TQTA 2NT3A 1EVLA 2X0JA 2C2ZA 5JYDA 4LHSA 2UU9B 2JIZA 1ZD4A 4KXFB 4PFSA 4OVKA 3CINA 1Y1KE 1KY3A 3EIOA 4EHNA 2OCPA 4G5FA 1PAUA 3AI7A 3EMBA 2ZJFA 3MG9A 4CUZA 1JXQA 4EZBA 5AW1A 1NJ6A 5EFOA 1UWKA 5HF5A 4LFBB 5JAMA 2F2TA 2VDWB 5E38A 4BMOB 5M5BA 1R00A 1Z5ZA 3AGPA 1RRMA 4IMRA 4F8YA 1K7FB 2W00A 2IDJA 4L8LA 5JADA 2AYYA 5PGMA 1U63A 5DHUA 2R4QA 3A4IA 4NCAA 3RFFA 3A6KA 3K4PA 1PFWA 2QM0A 4NWIA 4QDTA 2G9NA 3RAPR 2OAGA 2EP7A 4DMLA 3VNVA 5D87A 3QLVA 1GPNA 2BEKA 2CF6A 2J09A 5CJ2A 4YAOA 2K4MA 3TLGB 3TK1A 3OJLA 1FVHA 3G2MA 1MZVA 4DV1B 2FWJA 1IULA 2VH5R 1E0AA 1E6EA 1R18A 2E4XA 2WJGA 2E6KA 2P5SA 3Q3IA 3MFYA 2B92A 1Z36A 4JB3A 4BEVA 1L7XA 2HF2A 3P19A 4JUDX 4OKIA 4O25A 4BATA 1UDAA 1ULTA 3HJRA 3OIFA 4CT0A 4YVFA 3OUZA 4KDFA 1OX5A 3ELBA 3NHMA 4O8CA 5T57A 1DFIA 1CQXA 1E64A 4GP7A 1B74A 2RSLA 4POAA 1SVNA 1P75A 1M8KA 2BV3A 2NU6A 1NVVR 3BMOB 1VHJA 4G5HA 4PC7A 4RM2A 1XRMA 5IH3A 3R1IA 4B6EA 1T4MA 3N5KA 4UUNA 2QGNA 2FMHA 1QC5B 2NX2A 4JV5B 3KL2A 1SBHA 2VK8A 2W43A 3NKFA 2NO0A 4MIKA 4Z4IA 2FWMX 3D6FA 5EZYF 5C1PA 3A1TA 1ELOA 1U2GC 1OLUB 4PYKA 3NBXX 4RHFA 3L40A 3O8DA 3FWKA 2WYOA 1TUIA 2QRHA 1C50A 1LPPA 3QA3E 3OQOA 4HZUA 2E18A 4LXXA 3R4CA 4UREA 4AJ9A 2O5EA 3QVLA 6NULA 3VAYA 1SA0A 4CMEC 3U56A 4R68A 2OKGA 3GEIA 4ENSA 1TYBE 2QS9A 4LG1A