1DRVA

Escherichia coli dhpr/acnadh complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1drvA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1drvA01
1MFPA 1GCUA 1XIVA 3GZ4A 1YL5A 4B3HA 3F1KA 2Q49A 1GL3A 3NDIA 5THQA 1AXEA 4JJGA 2IODA 3AFMA 2ZJ0A 3F3SA 4KWHA 4DQUA 4Z0HO 3COSA 2W2KB 1K0UA 4RPJA 1ZUD1 1V3UA 1HT0A 4PLZA 2B5VA 3G79A 4AJJA 4E4YA 1C1XA 2FN7A 5CEJA 2C5EA 3N74A 3WGTA 3V1YA 4OXYA 3H9EO 1ZEMA 1DDOA 3HDYA 1U5CA 5JY6A 4GKBA 2VNSA 1UDCA 3QWBA 5AXDA 3ZHXA 4MKRA 2FP4A 4OSOA 4CMAA 4CV1A 1ZK3A 1E92A 3WS7A 3HADA 2ZB4A 2B0JA 1TB4A 5TIIA 3OA2A 4XZ3A 1Y5MA 3AI3A 3BHJA 5JCJA 3ADOA 2O23A 3HDHA 1IHYA 3CINA 2HK7A 3FCOA 3SXPA 1I30A 1DIBA 3HFSA 1WDLA 4JK3A 4FFNA 3V1TC 4DMMA 3KYCB 3NX4A 1T1SA 4WASA 3TNLA 1N9GA 3STHA 4O6VA 3WBFA 4NJMB 3AJRA 1A9ZA 4Z0PA 2NQ8A 2VT3A 3ABIA 1HZJA 1ZW1A 3L6DA 2VOEA 2I9PA 2FR0A 3W6UA 3ZV6A 3LYLA 5KTKA 1E3WA 3TZHA 2ZYGA 1F12A 2DT5A 5T6BA 1DAOA 1NXQA 1FF9A 2DPHA 4FFRA 3LZ6A 4IDDA 4E2XA 5JC8A 4B4VA 1ML3A 1N1GA 3JYPA 4MIEA 5F5NA 3U4CA 3UF0A 1ZXLA 5L7WA 3ETEA 3N7UA 5ES3A 4BGEA 3BAZA 5KKAA 1ZK0A 2GN4A 1R4NA 8ADHA 3PP8A 2NU6A 4IINA 4Q9NA 4PG7A 4DPMA 1I32A 4RPGA 1VSVA 4P8RA 4J43A 3KSZO 5KOIA 3QJ5A 4ALJA 2XAAA 4R16A 5IDXA 2IEDA 2DFDA 1LDMA 2DBQA 3HZZA 1V6AA 4R3WA 2D8AA 1I24A 4PLGA 2GZ1A 3QE3A 1TA4A 3D3EA 3PWSA 3CSDA 4P4NA 4XQCA 4D44A 4UAGA 4K1LA 1SOVA 3GNQA 1UZMA 2FOIA 1U7HA 3ZU5A 1GUZA 4EJMA 3KETA 1IB6A 1EE9A 4FFLA 4RF2A 4YA6A 1VJ0A 1B3BA 2Y99A 1TT7A 4PLPA 4RF4A 5DCWA 3KYCA 2NTJA 3S1LA 2XXBA 1WMBA 1Y9EA 3QWFA 5JCXA 4MVJH 1E6UA 2Q1UA 4URFA 2NLOA 3ZGYA 3VPSA 1LLCA 3WSVA 3INTA 4EJ0A 1IPEA 1PTJA 1HEUA 4GQAA 4RVFA 1A7AA 2X22A 3W4JA 4M54A 4R4JA 4YJHA 5DP2A 1GD1O 2A9FA 4O63O 1HYGA 3I9LA 4NBRA 4C4OA 3E5MA 4CPDA 4TMFA 4HFJA 1E1NA 2H1SA 3KRTA 1UP4A 4Q3DA 3KYBA 4GSKA 3AFNA 3EAGA 3LDHA 5T64A 2VQ3A 3GAFA 4N5NA 5A06A 4EUHA 4TSKA 5BSHA 4WLEA 4AJKA 1WDMA 2YDYA 2J5KA 2C5AA 3BMCA 5ITWA 4IJWA 4BNNA 4KMSA 3WGGA 1B15A 4I08A 3G0OA 3TZQA 4A7PA 3GGPA 3OICA 5C7LO 1LSSA 5IDYA 4MO2A 2NADA 4XJTA 2NVUA 1I0ZA 1SOWA 1IYZA 3S2FA 3JQ9A 3LF1A 3ZI0A 2VYVA 5TGDA 3IKTA 4J7XA 5G4LA 1VC2A 5AXCA 4RLHA 3DBHA 2VZ0A 1PEDA 4O5OA 5B4TA 2BKAA 2YV3A 2EWMA 4FOSA 2QQ5A 1DAPA 3PGJA 3CMCO 4M1QA 2NTNA 4IDFA 4BKQA 3EGOA 4GH5A 4W6ZA 3DBLB 4OHUA 4XD2A 3JQ8A 1DIRA 2VHWA 1XU7A 3D64A 3PHGA 3B6ZA 4QX6A 1B8PA 2D0IA 3IIEA 5TX7A 4C7JA 4A2CA 3WGZA 2A35A 2H9IA 3RFVA 2EEZA 3NDRA 3PHIA 5TLSA 1DJQA 3JQ9C 4FIZA 2EW2A 3BMQB 2PGLA 3DZFA 4U5QA 4QT0A 1OC2A 3A9WA 1OMOA 4D3FA 3DZKA 1WWKA 1NQAO 2WD7B 4BMNA 1ZSVA 4BMSA 5EESA 1YE3A 5DZSA 3SLKA 3ROMA 1A72A 2E37A 2HLPA 1UDAA 2OXIA 1EDOA 4ZVVA 2VZ9A 4YAEA 1KY4A 5F1KA 4BO9A 1KERA 1KVSA 1R6DA 3PJDA 3EZYA 3H4VA 2Q1SA 5KWEA 3VPGA 5G4KA 4EBFA 1T2DA 5ILGA 3OFSA 3MJCA 4E0BA 3DB2A 4XB1A 2V6FA 4ZU3A 2JD1A 3JD3A 1EUCA 3K8ZA 4LW8A 4E21A 1QXSA 1JU9A 4TRMA 5G0SA 1PJLA 3ZWCA 4XKJA 5ER9A 5IJZA 5KCZA 2GCGA 4GX1A 4J49A 5F21A 2PFGA 1V3VA 4K6CA 3VTFA 5BSEA 1PL7A 2GN8A 4AG3A 1P1JA 3WR5A 1UP7A 4CMHA 4E6PA 2VTEA 1QG6A 3F4BA 4BGUA 4II2A 3G3EA 1NWCA 1XQ1A 4R5HA 4I5EA 3QVOA 1Q0LA 2C7GA 5IZ4A 4HFMA 5CDGA 3W8DA 4RL6A 2FSVA 2Y0DA 1T26A 5DULA 3L6OO 4J6FA 2E82A 2G76A 1A9YA 4E2WA 1HSOA 3W6ZA 1ENYA 4GX5A 4RGBA 1U4OA 4OJNA 1YONA 5JNLA 1C0LA 4E31A 3GNSA 3U5TA 4NK4A 2X7HA 5F3RA 5DNAA 4PRKA 1M6WA 4W82A 1KEVA 2HK8A 4BB5A 1FDSA 3DONA 3I9KA 4L4SA 3ZWAA 3VDRA 4Z9YA 4CJXA 3GR6A 4CLOB 1SNYA 4XR9A 4OKNA 1T2CA 2BI8A 1LDNA 4B4WA 1D1TA 4PLWA 3B1KA 2Q4EA 4QO7A 3RQSA 4A5OA 1AHHA 4P22A 4YQZA 2POQX 1IZ0A 1HDZA 3EZLA 1E1LA 3JQEA 3RKRA 4R41A 1PJ3A 5F1OA 3KXDA 3WGHA 3NTRA 4LN1A 4XYEA 4RZIA 1M6HA 2DBRA 3X2EA 3GRPA 1P1RA 3JQAD 4HY3A 4CV3A 1P1KA 2DVMA 1X14A 2VRCD 2FZWA 2Z5LA 3AUAA 4R1UA 1GR0A 1D4FA 4LGVA 3FN4A 2ZTMA 3QA9A 1D1SA 2HMSA 2DTEA 3PPIA 4IM7A 3RU9A 4MVJG 4CQMB 1FDVA 2EKQA 1I8TA 3ICCA 3AU9A 1C3VA 1OOEA 4L75A 4WLUA 4E33A 4NBVA 5JAIA 2AG5A 2VNAA 2FMUA 3GA0A 2FZEA 4NZ9A 3IL2A 1JVSA 4L0QA 2Y1OA 4DGSA 4UUNA 4J7UA 1ONOA 2WJPA 3CKYA 1NFFA 4XQ9A 4Q3NA 4B3JA 4OXNA 4LISA 3E03A 3DO5A 3ANMA 1R16A 1CDOA 5JYDA 1AGNA 3KLPX 2OUIA 3WQRA 5EINA 1NPDA 3OH8A 1FXSA 1MGOA 5COQA 3GG2A 3H5RA 4TZKA 2JCVA 1NP3A 5JDIA 3ASVA 3JV7A 1DJNA 1LTHR 1V35A 3DZIA 4AFNA 4RLSA 1JLLA 3AM5A 4ZGWA 1PR9A 1UDBA 5I9LA 2R2GA 1NVMB 3BMOB 3FWZA 3PHLA 3OA0A 1PSDA 1B8VA 1KBZA 2SCUA 5MDHA 4B4UA 4WEOA 2HCTA 2NU9A 3R3JA 4I9NA 2CFCA 4UEJA 5JLAA 3OSUA 4F46A 1Q0HA 2PGJA 1KC3A 3TOXA 4AL4A 3P2OA 3VVCA 1N7GA 1Z6ZA 3HN2A 2PLAA 1EUZA 4JP2A 3HNPA 3JCZA 5COAA 1NX6A 1E7WA 3VZSA 5JDIC 3F4LA 1KC1A 4F6CA 2C7VA 3CTMA 4XX0A 3A14A 1HDGO 1ADGA 4UEKA 3TL3A 4J0FA 4QFCA 3K2BA 1EVJA 5CFZA 4NHEA 4BKOA 1H0KA 4DTIA 4AJNA 3PVZA 5L3ZA 4CV0A 1YQGA 3RJ9A 3ZWOA 3LT2A 1UAGA 2C0CA 4B8ZA 2DPGA 1PJTA 5HBRA 1NQ5A 2B37A 5FFFA 4RQUA 2PD3A 1GU7A 3LC7O 3E8XA 2G82A 1DRVA 3WB9A 2AEJA 5G2OA 3NKLA 4OMUA 3ZHZA 1SEVA 4D7AA 4ZJUA 1SB8A 4Q39A 4K26A 1U9JA 4BO0A 4AJLA 2H63A 5KJ1A 4PLHA 1H5QA 1HE3A 1XG5A 5HRUA 1ONPA 4X54A 1K89A 4DYDA 1DRWA 2DTXA 4Y6SA 2CVZA 1SZJG 3BMOA 4R3NA 1YDEA 1JQBA 3UVEA 4E13A 3QV1A 1E1KA 4RJTA 4RQTA 5FF9A 3K92A 3UCXA 2HDHA 1U1IA 3Q3CA 5T57A 3UN1A 3C3XA 3BMNA 3BHIA 1M2WA 3OBBA 3U4DA 5L40A 3I4FA 4ZQFA 1JKFA 1E5QA 1UH5A 3GHYA 4UREA 3WTBA 5L4NA 3FR8A 1E6EA 4K6FA 2EV9A 4J1TA 3PLRA 1KOLA 3OJEA 5JW6A 3BTVA 1ZCJA 4ID9A 3GZNB 1VJ1A 1WW8A 4JROA 1IZ9A 1FMCA 3M6IA 4OQZA 3I4CA 2FPIA 1GYPA 3P7MA 3ZW9A 3KB6A 2OBNA 1VL8A 4RPHA 2C54A 1PZEA 1PQPA 3OETA 5DCUA 3QVSA 5G0TA 3WG9A 3ETDA 1GDHA 3S2EA 3C24A 4W99A 2EJWA 1E3LA 3FPCA 1ADBA 1DEHA 3H6KA 5T67A 3C85A 2WEKA 4O59O 1RWBA 4CLDA 2B4TO 1NR7A 3RBVA 1Y6JA 3RWBA 4PZDA 2PWZA 2PGDA 5JY1A 4J4HA 3WICA 3JSAA 1DOHA 1W73A 2EIHA 4DYVA 1A27A 3C1OA 4GVLA 1X13A 2PNFA 2YHUA 1U8FO 3RD5A 4CUJA 2ET6A 3F5QA 1IOLA 3FBTA 3WGYA 1LNQA 1GPJA 2G5CA 1QYVA 3AY6A 5LDHA 1ENOA 2CSUA 3ONFA 3O38A 3NEPX 1EDZA 4A03A 5BSGA 1GADO 1ZEJA 4MPDA 5CG2A 3O8QB 3KUXA 2Q2QA 1R66A 3EY4A 3GEMA 4UVHA 2AXQA 1E7MA 3W8EA 5IZCA 1LRKA 2C07A 1A4UA 4YJGA 4RVDA 2PTGA 3AOEA 3FNGA 2DTDA 3OJFA 3GVCA 4MVJE 3JQGB 4E32A 5A1TA 4WNIA 1V8BA 3CEAA 2HMUA 4BNFA 2HJRA 1ONNA 2WE8A 2QRJA 4OO3A 1VM6A 2IXBA 1B0AA 2JCYA 3ZU4A 1RM3A 1JAXA 3WIEA 3R1IA 3GZNA 3ZWWA 5AXBA 4B8WA 4YAKA 1L7DA 1YO6A 1MXFA 2IDZA 1V0JA 4N7RA 4NI5A 3F1LA 2QIOA 2HKIA 4MVJM 1GTMA 1Z75A 4BNVA 2UYYA 2H5LA 3VPFA 3RFTA 3GH3A 4BO1A 5ICMA 3I83A 4IPTA 2BRUA 1T4DA 3NT4A 4EYEA 5EMHA 1L7EA 2QRLA 2R6JA 3VKVA 1B2LA 1LDGA 1N8KA 5IZCC 4NBUA 1NPTO 5CP8A 1MV8A 2I5PO 4UUOA 3UOGA 2RH8A 3JD1A 1DIGA 3PIDA 4YJFB 3B70A 1E6WA 4INAA 4S3MA 5A9TA 3JQ6A 2YFQA 1HE5A 1KEPA 1E1MA 4NBWA 3BTOA 3AY3A 4IDAA 2Y1CA 3RVDA 3UCEA 2X5JO 1R4MA 4FQ8A 4GLLA 1ZK1A 3EC7A 4I8XA 3BHMA 2PH3A 2ZQZA 4XIYA 4IXWA 2YW9A 1VL6A 2NU8A 4A26A 4LRTB 1HWYA 1E5LA 2VWHA 3ANLA 1TEHA 5HA5A 2R00A 3HDJA 5G0WA 3VPXA 3AUSA 5CPBA 4CQLB 2I76A 3PFFA 5A9SB 4RF3A 3C7DB 3SJ7A 1XLTA 5BNIA 1RM4A 2ZATA 5T73A 4YBZA 1OC4A 3WFJA 1EE2A 1MG0A 2Q46A 1KETA 5BNFA 3SEFA 1YJQA 5DF1A 2VYND 2VRBA 4O0LA 4ALNA 3KM0A 3E6AA 3CE6A 2PKRA 4RPKA 4CM8B 1QSGA 1I3MA 4YB8A 2O4UX 5I8WA 1GV1A 1X0VA 2GN6A 1JWBB 2TMDA 4FJ1A 1E3JA 2HQ1A 1B7GO 3JYQA 3LT0A 5B4VA 1Z7EA 1P1IA 3F46A 3UXYA 4OOEA 2R00C 4LMPA 1UP6A 3RBZA 3GF4A 1U28A 3M2PA 3VKUA 4BNXA 4TKLA 4KOAA 3I6IA 1VSUA 1YOVA 4WCFB 5L51A 4Z6KA 5A5EA 3QW2A 1OFGA 4QEDA 4ND4A 3OQ6A 5IF3A 5K0ZA 3A28A 2Z1NA 4RO0A 1QV6A 4YJFA 3M2TA 5J23A 1NFQA 1NQOA 2IXAA 1BW9A 1MG5A 1R0KA 3EYWA 4DBZA 1GV0A 1Z45A 3IOYA 2DLDA 4CODB 3O9ZA 1XELA 5AQ1A 1G0OA 3ADPA 1LJ8A 1ZJZA 3UAGA 4WJZA 3WFIA 1SAYA 3FTNA 1LEHA 1Y9AA 4O1MA 4CMCA 4M87A 1F14A 1LLQA 3DBRB 4KUHA 3DMTC 4PG8A 5H81A 3IUSA 5TC4A 1QLHA 2I3AA 5U1PA 4WNCA 1UXGA 5EIOA 1CIVA 3ROPA 4P38A 3GT0A 4TKMA 9LDBA 2X9GA 3AY7A 3L77A 5U9CA 1Y8RB 4OOFA 3VH4A 1U3UA 4IJUA 1EMDA 3ZV3A 1P0FA 1EFKA 4YPOA 2AHRA 2GN9A 3PDJA 4ESOA 5L4LA 3AUUA 2HK9A 4QQRA 2D1YA 1YS4A 1NWHA 2EG9A 3B1JA 4R1SA 2VYVD 2AQ8A 4OKIA 3RUCA 1U8XX 4D3SA 1KVRA 4FSHA 2EF1A 3V2UA 3RKUA 4PFJA 3GEGA 4YACA 4FCCA 4EEZA 4I1IA 1ZVMA 3Q2IA 4OYRA 1BVUA 3KYDB 3Q9UA 2C2XA 2RH4A 3WMWA 3VZQA 1VLLA 1RPNA 3JYLA 3BIOA 3TL2A 2X4GA 4N5MA 2P2SA 4A0SA 3K73O 5ILOA 4YT4A 1LC3A 2HMWA 4EJ6A 3UKOA 1MP0A 5BT9A 1EK5A 3S55A 1Q2XA 2WDZA 4ZQGA 3EVNA 3RUHA 4DQVA 1NYTA 3AI1A 3OEWA 4JX8A 1BHSA 1HXHA 4CLEA 4MIYA 1ZZEA 4EEXA 1JVBA 3F9IA 2P5YA 4TWRA 4YCAA 4CL3A 4R54A 4RVSA 4ZA2A 4AJHA 1KVUA 1PIWA 4ILKA 1RYDA 4R9RA 5IN5A 1DXYA 3OM9A 4BUCA 1Z7BA 3KO8A 4CM1A 2PV7A 3JQ7B 4FC6A 2W2KA 2CVQA 3S2GA 2EP5A 3GAZA 1DB3A 2B35A 4XCVA 3DBRA 4PZEA 5F1PA 2GD1O 2X5KO 5KKCA 1W0CA 4CLXA 1NTOA 4UVGA 3CUKA 3JQBA 4YRDA 4ZN6A 3CZRA 2VYNA 4HNGA 4D45A 4DC1A 4YT8A 4DLBA 2HO5A 1EVYA 4B7XA 2RBEA 4TZTA 3FR7A 1ZJYA 2O50A 2HMTA 4DA9A 3RCBA 3WNVA 3QVTA 3I52A 1H94A 4H3VA 4Q3BA 4RVHA 2C20A 2EP7A 1Y5RA 3GFGA 3WOHA 3ZU2A 1DO8A 2PH5A 2V65A 3EVTA 2BFOA 3I3OA 4QFDA 5TT1A 1IULA 3FD8A 1H6BA 1LXCA 3IS3A 3KYDA 3OF2A 3C8MA 2ZB3A 4NJMA 3QLJA 3MJVA 4ALMA 4II3A 3PFWO 1X7GA 1I5RA 3MOGA 5HS6A 4GGPA 1R0LA 5HM8A 5ICSA 4U0KA 2RHCA 3OQBA 4CM6A 1ISJA 1XGKA 3LQFA 1B3RA 1B8UA 3LT4A 3P5SA 4KQXA 4KWIA 1P0CA 4WLNA 1BXGB 3IC5A 2WM3A 1YJ8A 2FR8A 4UVEA 1KY5A 2GF2A 3D3WB 3GRKA 4PN3A 2O2YA 2OORA 4XJSA 1D8AA 3T4EA 2OGUA 3QRWA 4XDYA 5JYAA 1IL0A 1LU9A 1D7OA 1PGOA 2VWQA 2C29D 3GUYA 1IHXA 1YL6A 2GO1A 5BNTA 1TT5B 2J8ZA 3VPHA 4IBOA 2W4QA 3D4PA 1EBFA 5EL0A 4UVIA 1CRWG 1I2CA 2O3QA 5G0UA 3JYNA 4MP8A 2FR1A 3TZKA 3GGOA 3HB4X 1PGNA 3W4KA 2V6GA 4AICA 1P74A 2VHXA 3WGQA 1V3TA 4RDIA 3JD2A 5LCXA 3U62A 2BGKA 4E2YA 2OBYA 3BYZA 3LC1O 1YB4A 1MA0A 1SB9A 1PWZA 4CM4B 2HRBA 2O3JA 5CAEA 3H5AA 4NR0A 1ZNQO 5AYVA 4MVJF 3GFBA 2LDXA 3GY0A 2I67A 3GDGA 4J1SA 3L9XA 4NFYA 4ZQEA 2O3TA 1K6IA 1SBYA 1T24A 3DMYA 2Y68A 3DWFA 1AN9A 3OMLA 4OIMA 1BXZA 1VJTA 2X6TA 2RAFA 2AQHA 1YB1A 2VHZA 2WTBA 1PL8A 4GX0A 3VH2A 4GWGA 5B1YA 1RYEA 5FI5A 2CF5A 1NFRA 5KVQA 4JBIA 5COBA 4HXYA 4J4TA 1FK8A 1ZSNA 3KTDA 3D3WA 3JQCA 1F8GA 3M1AA 2IYOA 4BO6A 3W4IA 3ZCXA 1VKOA 4W7HA 5KJCA 1QYWA 1H6AA 2GUGA 4BS9A 1AHIA 3QQPA 3UCFA 3WSWA 2IE0A 5L7YA 1DRUA 2VHVA 5C3MA 1LLUA 2X23A 3PJGA 3ZWXA 2AQIA 1B14A 5I7EA 3RROA 3DOOA 1ADFA 4BNHA 2E6UX 3GMDA 4PLVA 1VL0A 2X0NA 2O3SA 5CDSA 1TT5A 4CMBA 2EGHA 1EZ4A 3MJSA 1X7HA 4MJLA 5JMWA 1ISMA 1PJQA 2OO5A 1H9AA 1I01A 3WQSB 3FNEA 3GK3A 1I33A 3NV9A 4G65A 1LA2A 1WPQA 4WEQA 2VT2A 4WOKA 2ZCVA 4JNKA 4LCEA 3LSYA 1DC3A 2WYWA 1QR6A 4Q3AA 1IUKA 1LDYA 1S6YA 2FWMX 1I2ZA 1YBAA 4NFSA 3DBLA 1NR1A 4WECA 3WYBA 2ZCUA 3K30A 1SEPA 2VOJA 3G1UA 5B12A 3DHNA 1DFGA 1ZIDA 2PD4A 4B3IA 3AM3A 3P19A 2D2IA 4FOOA 4PLCA 1ZBQA 4S1VA 1PU2A 5LDGA 1KEUA 4M8SA 1GEEA 3PQEA 3AI2A 1UXKA 4JJIA 3WJAA 3BMQA 3W8FA 4BGIA 3WX0A 1Y81A 4DC0A 4BO4A 1CJCA 3GG9A 4QUKA 5T5QA 4JLWA 1V9LA 4ALIA 3UUWA 5C7OO 2WD7A 3ZWNA 2DM6A 3KSUA 4LVUA 3DQPA 2QZ9A 4UUMA 1BRMA 3OQ1A 2HMVA 1Y7TA 4MOWA 4HNHA 4WE3A 4NNJA 3QSGA 4Y98A 4QSMA 3PYLA 3I5MA 1BTOA 1RM0A 1K5HA 2Q2WA 1I3NA 1E0DA 4MKZA 4XRGA 2DBZA 2X9VA 2YYYA 4ZICA 5JPIA 1N2SA 1UXHA 3ICPA 3H3JA 4FB5A 3NAQA 4CUZA 3ZWBA 3K9QO 3AWDA 4J2HA 5A05A 3RC9A 4Z3DA 2QYTA 1QKIA 4IDBA 5KJ6A 1I3KA 3PQFA 2Z1MA 4IGFA 2X5OA 1G0NA 3SLGA 4GMFA 1FJHA 1AE1A 3ZN2A 2P4QA 3PIIA 4XB2A 4HV4A 4I9UA 4Q3CA 2V6MA 3I23A 1C1DB 5DDIP 1MC5A 1X1TA 1I10A 3U3XA 2CF6A 3RUIA 5JYFA 4LVCA 4E5NA 4E5YA 3ST7A 2YV2A 4L74A 2HJSA 2UUOA 2O48X 2Y1DA 4UUPA 4CLOA 2BI7A 1HLPA 4BNTA 3UGKA 4E5KA 2FSSA 3DOJA 1CWUA 3I9NA 1CETA 1QV7A 1T2FA 2IZZA 3CMMA 4NFHA 3ZW8A 1UZLA 3FI9A 3SC4A 3RBXA 2PD6A 5C37A 3L4BA 1HSZA 1GFSA 1GCOA 1ZXBA 3ZWMA 3LVFO 2J3JA 1JAYA 4ONEA 1ARZA 3ULKA 4DUPA 1NASA 2ZYAA 4Y9DA 4MIOA 5DOVA 3EMKA 3QVWA 4GMGA 4CQMA 4FJ2A 5DBFA 4N54A 1O89A 2B4QA 4CMIB 1J4AA 4KUEA 5EQDA 1HDCA 2P91A 2VWGA 3H9JA 5I8ZA 3WYEA 2ZTUA 4NK5A 9LDTA 2G1UA 4DIBA 1XEAA 4BNZA 1DHRA 4W9NA 1I3LA 4WUVA 5A3JA 1DLJA 5LC1A 3H8VA 5JDCA 3RC1A 3DBVO 3U4HA 2GRAA 1OBFO 4M89A 1PZHA 4CMGA 2ZYDA 3PWKA 3L4BC 2HRZA 1LSUA 1B26A 1UUFA 2EKPA 4CV2A 3QY9A 2FHSA 4E5PA 3ZZNA 1YBMA 3VC7A 4WOJA 3D0OA 3K31A 4PZCA 4AJOA 1E7SA 1EVZA 1GQ2A 3DL2A 3PRJA 5AXAA 3GEDA 1BXKA 1Y8QB 5ENVA 4TRJA 1O0SA 3FTPA 4U6SA 3JD0A 1TXGA 1Q7CA 4W9NC 3DZGA 3NGXA 4KUGA 4XDZA 2EXXA 4ND3A 3VZRA 2Q1WA 4P4GA 4W7IA 5JDCC 4HUJA 4DIFA 3FF4A 4UEOA 3IMFA 2VUSA 1K6XA 1ULSA 2B83A 3GN2A 5B37A 4CR8A 1W6UA 3ZV5A 3JD4A 1FDWA 1CQJA 1YWGO 1MX3A 4YAGA 1JDJA 4YJDA 1P44A 1PS9A 5JBIA 1F17A 4BNWA 2QG4A 3BTSA 3WWZA 1GZ4A 4BNLA 4TRRA 3H2SA 3PXXA 1YDWA 4PG5A 4ZHSA 3Q0EA 2YFHA 4DPKA 2QX7A 1PZFA 1R37A 2JL1A 2YZ7A 4NJOA 5AOVA 3WIDA 2X0RA 4FFMA 4RV9A 3GVXA 4GAEA 4J2OA 3TZCA 1J6UA 3D4OA 2Y1GA 4IS3A 3VH3A 1DBVO 3L9WA 4ITUA 2ZKLA 3WMXA 3DZBA 2GASA 1E7RA 2FPGA 3ORFA 5TSDA 3ZWPA 3FSRA 4GSLA 3BZUA 2NV6A 3MWDB 2X0IA 4QECA 3O4RA 4JJFA 2D5CA 4H15A 2GZ3A 2Z95A 4HBGA 1N7HA 2GDZA 4YQYA 4E2ZA 5L45A 4NPCA 1O8CA 3CH6A 2CUKA 3GLQA 3PJFA 1IY8A 1CEQA 4G5HA 1K6JA 1LRLA 3A1NA 3RUFA 3MWEB 2NM0A 1GYQA 1YQXA 2FY8A 4HP8A 1Y8QA 4GLOA 4MP3A 3VTZA 2QW8A 1LQTA 4QO8A 4WPGA 2YHIB 5GZ6A 3NUGA 1O94A 1B16A 3BXXA 1J0XO 5GZ1A 1BMDA 1QMGA 1EVIA 2NSDA 1MLDA 1ISGA 1GY8A 2JAHA 3D5TA 3K5PA 4Y8VA 3HN7A 1GQQA 3P2YA 3SC6A 3ZWYA 3RI3A 1K2WA 1YB5A 4H7PA 4BO5A 2Y1EA 3RC7A 3V2HA 3CIFA 1LBEA 4Z9XA 5JMPA 4HKTA 5GMOA 2I65A 1N5DA 3DHEA 1HL3A 4LK3A 2JFFA 3LLSA 2W2LA 5IN4A 3PQDA 1E3SA 2BFAA 2C59A 2G0TA 3EW7A 3G17A 2J3HA 4RORA 5EJ2A 5KJFA 1PX0A 3I9MA 2B4RO 3JQFA 3KEOA 4BNGA 2G17A 4MVJD 1ENPA 5CDYA 5BSFA 4L4XA 1LLDA 1CF2O 1HYHA 3K96A 1ADCA 3A4VA 3PJEA 1T25A 3PZBA 4TVOA 1UAYA 2P9EA 1HE2A 1WNTA 3PK0A 4UULA 1M67A 5TRTA 4BQPA 3JTMA 3UFXA 3A06A 4PLFA 2O2SA 4BOYA 1F0YA 1A5ZA 1QYDA 3AOEC 4FPXA 1HYEA 4IGEA 3ONDA 5CG1A 4CMKA 1KS9A 2OZPA 4HX5A 1BDBA 2X8LA 4MP6A 4D41A 4PLTA 4PVDA 1Y1PA 1C0PA 4NH4A 1PGPA 1XSEA 4PG6A 2YQ4A 2XPCA 5JAZA 1NHWA 4RVUA 4BNYA 3JQFC 3EUWA 3OIDA 3R0IA 3ETGA 1NQTA 4HWKA 4QXMA 3E9NA 4AJ4A 3ON5A 1P33A 6LDHA 4U0JA 4F3YA 1QORA 5L53A 3ENNA 1BG6A 4Y6PA 3O8QA 5JE8A 4EDFA 4NG5A 3O26A 4L76A 3WBBA 4PRLA 5JXWA 5K9ZA 3V1UA 4A27A 1DFHA 3GDOA 1VI2A 4D79A 1LRJA 2GNAA 4IDCA 1UR5A 2V7PA 5L95A 3I9OA 3JQGA 1U3VA 5JC1A 2OP1A 1RM5A 4ND5A 1FDUA 2IYPA 4ND2A 2D5AA 3H65A 1ZSYA 2ZTLA 4PLYA 4AJIA 5ER6A 2DBVO 3TOZA 4DLLA 3E9MA 2EERA 2VWPA 4CMEA 4TRNA 2P5UA 4PIVA 5I9MA 4U6QA 1HLDA 2CY0A 3L6EA 5CPFA 3HWRA 4XGIA 4JXKA 4IQ0A 1LUAA 1W8DA 2JJYA 3HUDA 2CMDA 2D4AA 5T8KA 3DTYA 5GY7A 5IFLA 2Y93A 1S7CA 3V8BA 1KEWA 1HRDA 3IJRA 3PEFA 1E3IA 1WZEA 4R1NA 2VCYA 3E1KA 1N9GB 1PS8A 1E77A 2CDCA 5TJHA 1NAIA 4M55A 1MFZA 3AK4A 4H16A 4U8GA 4AJPA 1F8FA 1NM5A 3PWZA 2UVDA 2NUAA 4CMEC 3QWAA 4BKUA 2PKQP 1ZO8A 2BFPA 1WZIA 4ALKA 3UW3A 1E3WB 4HFNA 4FD3A 3DFZA 4CQLA 4B79A 3Q6IA 1HTBA 1UXJA 2YDXA 5IAAA 5A9SA 3GPDG 5T8KC 1LSJA 4BO2A 1HETA 2P9CA 4CM9D 3SJUA 1XKQA 2OHXA 4GPD1 4MVJA 1R4NB 2H6EA 4R69A 4CUKA 2CDBA 2O3UA 4J9UE 5FWNA 1UJMA 4J1NA 1ENZA 4RVGA 4JBGA 4D0RA 3AOGA 4FC7A 4CM8A 3RSHA 4TROA 8LDHA 2JHFA 4IMPA 4XRRA 3DAFA 3IQDB 2ZJ1A 3BTUA 5A4DA 2XOXA 3WNQA 3ZNPA 1NVGA 2B5WA 4J90A 4WCFA 1LSOA 1YKFA 1XWFA 5KVCA 2HAEA 4IXTA 7MDHA 4M49A 1M75A 1ISHA 1WLYA 3U49A 3VZPA 4OQYA 3HJAA 2A94A 4JN6B 4I9HA 3ZU3A 4Z0TA 1VE9A 2HUNA 3TFQA 4YR9A 4JP3A 3V2GA 1GZ3A 3PGXA 1NNUA 4DPLA 3HDQA 3T4XA 2GLXA 4IJKA 3DDNA 3LLVA 4N5LA 2WWRA 4NQZA 3INGA 5HS4A 1KIFA 4YJHB 2W90A 3MJTA 1U5AA 4FR5A 1N92A 4BGVA 3FNHA 3DXFA 1R12A 4MVJI 4IJVA 4R9SA 4XR4A 4BKRA 1XQ6A 2Q22A 1XU9A 3CZMA 2A92A 4ZQHA 5A3VA 2BH9A 5JAMA 4YT5A 1DIAA 2JCXA 4WCFC 1Y8RA 3WGIA 2Y05A 3H9GA 4BMVA 4LSMA 1XDWA 4IQGA 3WXBA 4YAJA 1GYRA 1PQWA 4J7CA 4QTZA 1M66A 3K6JA 3KEQA 4AVYA 5BQFA 4YRAA 1VRWA 5ENDA 5L7TA 3WLFA 3BMCB 5A03A 3L0DA 5TQVA 2NWQA 4CMJA 4Y67A 6ADHA 4OGWA 1Q1NA 3TSCA 3NDJA 1CERA 4NIMA 3NGLA 1T1RA 2NVUB 3H3FA 2DAPA 5THKA 4WGGA 4TQGA 4FBGA 2PZMA 4ND1A 2AW5A 3ROQA 3H9QA 5DCYA 4IDEA 2JFGA 3DBHB 5TS3A 1RJWA 1BSVA 4J1QA 3WGOA 3JQBC 5DBIA 2AMFA 4FFOA 3TRIA 2VZ8A 2P4HX 3HSKA 2BMAA 2HSDA 4IIUA 5I7VA 1P31A 4YYZA 4IZHA 4BO3A 3JQ8B 1X1EA 1YH3A 4IZIA 3NT2A 3INRA 5A04A 3PYXA 5EN4A 4YWJA 1JW9B 2GPTA 4K28A 4WLFA 4AJ2A 2UUPA 3VAZA 1EEHA 3SBOA 2XF8A 1HDYA 3JQ7A 4J9VA 3F47A 3X2FA 1JN0A 3GN1A 3V5NA 3Q9NA 3B20A 1Z74A 4CM9A 3DZJA 5KIAA 3D1LA 2EW8A 2DUUA 2TMGA 2VHYA 5I7FA 4IIVA 3NJ8A 2B36A 1MXHA 5DN9A 3QWIA 2NU7A 3TN7A 4DWVA 4XYBA 1KVTA 3D5QA 1X0XA 1CYDA 4IS2A 1O5IA 2NACA 4ROSA 3AW9A 1GZ6A 5JFOA 1R15A 1GAEO 2BLLA 5G4KB 1G6KA 3AU8A 2DU8A 2PK3A 3TWOA 2VN8A 1PZGA 4J3FA 1MC4A 1SC6A 1ZMOA 1J5PA 2Q45A 3MCVA 3IDSA 5KJEA 3WWYA 3ZNOA 1BGVA 1H2BA 4F6LA 2I99A 5H83A 5ADHA 3H5NA 3JQDA 5FI3A 3LU1A 3ZNNA 4YXFA 3I9JA 4PVCA 2GYYA 3CPSA 4BIIA 3PHJA 3RJ5A 3ZWVA 2W98A 4FN4A 2GR9A 1HDRA 2JD2A 1X15A 1PJSA 2ZIZA 3FPLA 2QRKA 2VTDA 1O9BA 4YAIA 5KVVA 2Q4BA 3WQQA 4YTEA 4Q3EA 4B4OA 1K3TA 2NNLD 1BXGA 1ZK2A 2W8ZA 2FPPA 4K9DA 1DHTA 4XQGA 4A73A 2AG8A 2D3TA 2RIRA 3DAGA 3ZHBA 1U7TA 1PGQA 1KVQA 2Y67A 3U09A 2ILTA 4ZRNA 4BO7A 1P77A 3KVOA 4D43A 1WXDA 5IDQA 7ADHA 4BL5A 4EGFA 1ZKMA 1X7DA 2RHRA 3ENKA 3PHHA 1IE3A 4I5DA 5I9NA 2GERA 3IUPA 1T2EA 1R0SA 2JD0A 4FDAA 4KDFA 4JCOA 1JTVA 1ULUA 4Z9FA 2I3GA 2RCYA 4NDNE 3Q11A 4BNJA 4UVDA 4NU5A 3S8MA 4XIJA 4FGWA 4CQMD 4MVJP 1KYQA 3ASUA 1PJ2A 3VVBA 4CM4A 5TF4A 3GC6A 3BA1A 1CQIA 2GSDA 5DT9A 3N58A 2UDPA 4XYGA 1GUFA 4YDRA 3TZ6A 1XCBA 4DMLA 4FJ0A 5HWSA 4GL4A 1P9LA 4C7KA 3DHYA 3CXRA 4YVFA 2YV1A 5FYDA 5M6DA 3D4NA 4YEDA 3PTZA 4I5GA 4EUFA 3MEQA 3RC2A 3C7CB 1Q7BA 2Y0EA 2DFVA 4U7WA 3RFXA 3VH1A 1G1AA 4BVAA 5KVSA 1LQUA 1DC6A 3PDUA 4FW8A 4KZPA 1DPGA 2CNBA 3PI7A 4OXKA 3R3SA 3IP3A 1VPDA 1PQUA 5I7SA 1EUDA 4AJEA 4KTVE 5EERA 3DEYX 1WDKA 4EITA 2O7QA 2PA3A 5H82A 4BNKA 1W4ZA 4BQRA 1Z73A 3MOIA 2DUWA 1O6ZA 2UAGA 2CDAA 4OSPA 3FNFA 2GZ2A 1PJBA 3U0BA 4XGKA 1RKXA 3NRCA 3RUEA 4FS3A 4L8VA 3T7CA 1E7YA 2QYSA 4J0EA 4HFRA 4JBHA 2GGSA 2C82A 1PJ4A 2HU2A 5FEUA 4MINA 1EFLA 3OECA 3ITKA 4M86A 1I36A 2O4CA 3SX2A 4GX2A 3S2IA 4ZRMA 3GOHA 2O7SA 3R6DA 4LCJA 1OZAA 4IY1A 4DQXA 1I2BA 4WLOA 5HTOA 2UV8A 4FFPA 3GGGA 3RASA 4CM5A 1PS0A 1NAHA 1AUPA 1LX6A 3OIGA 5CHEA 4RZHA 3I6QA 3GUCA 1H2HA 2BELA 3VHRA 1U2GA 3KV3O 4J91A 5IG2A 2QHXA 1PWXA 4XYLA 1P45A 1NPYA 3W1VA 2X58A 3GPIA 4EW6A 1U4SA 2NVBA 3H9UA 3WDSA 4E3ZA 2X1HA 3OP4A 3IP1A 3RAJA 2F00A 1MB4A 1NHGA 4HADA 4RF5A 3TQHA 3WTCA 3DZHA 3UH1A 5CDUA 5JS6A 4NU6A 5TJ9A 4BNIA 1Q7GA 1EQ2A 1A7KA 3ZV4A 1H93A 2BFMA 1UZNA 3PZRA 3MTJA 4GVXA 3GQVA 4JIGA 3FHLA 1JKJA 5CEFA 2J5RA 4DREA 4N18A 1YVEI 4L73A 2AE1A 2P9GA 3U9LA 4L9RA 1TI7A 1O95A 3WLEA 1D3AA 3LT1A 2AEFA 3JQAB 4OM8A 2PZJA 3QHAA 4E30A 1NBOA 3FRJA 4RPLA 1GUYA 2VUUA 2J3KA 4AJ1A 3GNTA 3EHEA 1YRLA 3HB5X 2D59A 1QP8A 1C14A 4PCVA 4TVBA 2Q99A 4P4LA 5DBGA 4DVJA 4OH1A 4LSWA 5L9AA 4A10A 4DRYA 1BWSA 3BMNB 4NMHA 5K6AA 2W2LD 1HE4A 2CD9A 3QP9A 4CLRB 3DAPA 2WD8A 1L1FA 3T7EA 1HDXA 1WVGA 1HF3A 2FRDA 1AXGA 3C1TA 4BNUA 3FWNA 1EBUA 1C1DA 2ZTVA 1PJCA 2BHLA 3H7AA 3RIHA 1E3EA 1DIHA 3HFGA 4J4BA 1HZZA 3QWHA 5KNLA 3L4SO 3IJPA 1P1HA 2EHDA 1XHLA 5DOZA 5EQFA 1VKNA 1A71A 3DFUA 3HHPA 3VDQA 2WMDA 3NTOA 2WYVA 4DXHA 1GQYA 4BV8A 2JHGA 4W4TA 5CDTA 5K6AC 3ZNQA 1ZH8A 1QYCA 3TJRA 3G1TA 1FDTA 2NVWA 4OL9A 1JKIA 3TFOA 4R68A 1LDBA 3ZHYA 4EZBA 5JSFA 1J49A 3SVTA 2ZB7A 1Q0QA 2B69A 2BGMA 4CR6A 4ALLA 3HE3A 2IZ1A 4XQEA 1YQDA 4B7UA 3MZ0A 1NVTA 4R51A 3U4IA 3JQAA 3Q1LA 1JA9A 2AEMA 3OJ0A 2ZQYA 2I6TA 2VRCA 1YGYA 3NT5A 4CMIA 3KBOA 4Y6RA 2Y1FA 4D46A 1YXMA 2JAPA 3OIFA 3GHHA 1ISFA 1C0IA 5C5IA 1ISIA 3OJOA 2BD0A 5IXYA 2ZK7A 3K2EA 2E49A 1GPDG 4YJGB 4PG4A 4L4RA 2X86A 4MDHA 2I66A 3IKVA 1HDOA 2PKQO 3OHSX 2IRWA 1C0KA 2Y66A 4XWYA 5J9GA 2XXJA 4CLRA 2OMEA 4MKXA 2OOSA 2Q2VA 2LDBA 4RCVA 3UICA 1LI4A 2JKVA 3MTGA 4Z3KA 4KQWA 1TVEA 5ITVA 3FBGA 2EKLA 4FGSA 1OI7A 3QIVA 4R01A 3TPCA 3KOUA 4G2NA 4CL8A 1UXIA 4GBJA 3C7AA 2X0JA 4XEHA 2F1KA 2AE2A 1ORRA 1T2AA 1WP4A 4KTTE 3TF5A 1JWAB 2DKNA 1P1FA 2Q50A 4IUYA 1YBVA 4G81A 1A4IA 3E5RA 2AA3A 5JO9A 4GKVA 1T4BA 5DP1A 2CVOA 4J16A 1F06A 1H6CA 5JYEA 4KDEA 1PGJA 4OAQA 4DIOA 4EI2A 4BNMA 2OFPA 1PL6A 3DTTA 4I5FA 4BB6A 4PGFA 4IMRA 4ZD6A 3UHAA 1U3WA 3ANNA 3B1FA 2Y0CA 4XA8A 1R4MB 2J6IA 4ZQBA 4CR7A 3H2ZA 3F5SA 4D42A 3OJLA 1DC5A 1H6DA 4DL9A 5A9RA 4DBVO 4CM3A 2Q3EA 2QZZA 1HKUA 2YY7A 3TDKA 5A5FA 1IPFA 2WE7A 3OEYA 3M1LA 4YT2A 1XA0A 2J5QA 4GGOA 3EDMA 5JAQA 2E4AA 4F45A 4D0SA 3HG7A 3NYWA 2AQKA 1H9BA 2Q1TA 1ID1A 3KLMX 4JQCA 2C2YA 1N1EA 3D7LA 3L07A 2EGGA 3NJ4A 1GEGA 1OAAA 3KSDO 1QLJA 3RUAA 1YL7A 4RDHA 5F5LA 2OL4A 1XR3A 3C1AA 5JCJD 4JGBA 3LK7A 2YUTA 5U4QA 5TT0A 1DLIA 5CEEA 4WCDA 5A02A 2DC1A 2WSBA 1EK6A 4IQ8A 2YHIA 3DOCA 1PR3A 2OP0A 1YOVB 4WLVA 2PR2A 5EPOA 2J3IA 1XYGA 5MGBA 1SMKA 4WKGA 3LF2A 3KZVA 3IAHA 5JO0A 4CM7A 2PZKA 1BW9B 3DR3A 3ONEA 5IXSA 1U2DA 4WK6A 3E18A 5C7IO 1BDMA 5BR7A 3I1JA 4DLAA 1LC0A 3NTQA 5L4SA 1EQUA 4LRSB 2NTVA 4R1TA 4E5MA 3Q2KA 1SO8A 4XGNA 1ZMTA 4KP7A 5TNXA 2P68A 1C1XB 2IEBA 4EUEA 5IDWA 3ZDFA 2PY6A 3PLNA 1ZK4A 4BHTA 3ZH2A 4CLHA 2O3RA 2NQTA 1SPXA 3G49A 3GDFA 3GVHA 3E48A 3JYOA 1BVRA 3E9QA 4GWKA 3ITDA 1M76A 4XYMA 3MJ4A 1ZFNA 2YJZA 1WMAA 2X9NA 5AVOA 2ZB8A 4BKPA 3VOSA 3WYCA 3KHUA 2EJVA 2BGLA 3QVXA 4R5MA 3PYMA 1SCUA 3GMSA 3WJ7A 1LDEA 1TLTA 3LC2O 2YQ5A 4BV9A 3AUTA 3E82A 1DSSG 3GVIA 4NBTA 5GZ3A 1MUUA 2PZLA 5B4UA 1QYXA 5G0VA 3HQ4O 2JFHA 3AM4A 2BF7A 3EK2A 3F6YA 4D3DA 1U3TA 3DMTA 2CZCA 2IZ0A 4BO8A 2E48A 3ROKA 1QRRA 4YRBA 1DFIA 3RUDA 2DQ4A 1DC4A 3DC2A 3MJEA 1P3DA 4LMRA 4GI2A 2V6BA 1E7QA 2A4KA 2VUTA 1WAMA 4IDGA 3RU7A 4B7CA 1Z82A 3O03A 3GVPA 4E12A 2WYUA
chains in the Genus database with same CATH superfamily
2WHRA 1MFPA 3RT9A 1RU3A 1FZTA 4LS3A 3MB5A 2V9CA 2NZXA 5IJWA 3QXJA 1NSYA 1PT9A 4JJGA 2C4KA 4KYVA 2IODA 3K35A 4FEYA 4AXBA 3F3SA 3Q72A 1N2CA 4Z0HO 2WT4A 3QUTA 2QRZA 3COSA 4KFRA 2VTBA 3G7SA 2VQFB 3PWTA 3TB4A 3ME5A 5HMMA 3ZVKA 3IT0A 4YBRA 4X93A 4E4YA 4HXGA 3L06A 2EX1A 4QPZA 3V1YA 1ZEMA 3N2KB 4HTFA 1G64A 4N40A 5JY6A 4GKBA 2LE0A 3SR4A 2VNSA 1QJ4A 2EYQA 4Q4LA 3ZHXA 1XI2A 3ESAA 2RHGB 1PO7A 3B6JA 4LHZA 4MKRA 4OSOA 5U4XA 1POWA 4MI3A 4IH1A 3FUUA 1JLSA 4HQLA 4RSHA 5G3ZA 1W75A 3AI3A 3EA5A 3BHJA 2O0HA 2AC2A 3ADOA 3IBYA 4GPTA 5LZ2A 3FF1A 2Z4SA 5E4TA 3GWGA 2HK7A 2GNOA 3FCOA 4RGVA 3SXPA 1DU4A 2HT1A 1DIBA 2AX4A 3HFSA 2V6IA 3A1VA 2MTBA 2I7TA 2PT5A 2O2DA 2V74B 2FEMA 4P08A 3COJA 4DMMA 3KYCB 1X94A 4IFTA 4DEYA 1E1QD 5KQRA 2FJUA 3BXHA 4O6VA 1T4MA 4LYFA 4PPNA 4Y2TA 3UAXA 3D3NA 4RHXA 1IN6A 1ZVJA 4GFDA 2R4UA 1A0OA 1G291 4G63A 2CC2A 2VOEA 2I9PA 1VJGA 3B5IA 1H9CA 3QBDA 4COOA 2PZFA 3GFFA 2OFOA 3LYLA 4O2LA 3WIOA 2XXAA 2AWNA 1JU4A 1HI9A 1XEWY 3A0RB 2DPHA 1HT3A 1RTTA 2BHRA 4RY0A 1QAMA 4Q7LA 5HUQA 2PS0A 3LM8A 1AS3A 2OSBA 3NC1C 2FEWB 2J0UB 4N3AA 1RLIA 4RTMA 4QQFA 4MIEA 1CSEE 1JFFB 2F43A 1R27A 2F1OA 3I2HA 1DC7A 3IBFA 3IOMA 2D7JA 4B46A 1ZXLA 3OIWA 3ETEA 4AZSA 5L7WA 4L6AA 1OFHA 3FFXA 4LPKA 1ZK0A 2VJYA 2GN4A 5FLEX 2WTEA 1QAOA 2YWXA 4NZOA 1IH8A 4GLFA 4MQEA 4PG7A 2GKOA 1P1BA 2VI5A 4QLOA 2FQ1A 3B6IA 2GAFA 4RPGA 2AMJA 2ORWA 1VSVA 1HK7A 4N82A 5EIHA 5C1PA 3QJ5A 3UJ7A 1Q92A 3LDGA 4R16A 3T7IA 3EWNA 4AN0A 2O2EA 5AW2A 2A9QA 2IEDA 2HU7A 2DLNA 2DFDA 2CUTA 1LDMA 2DBQA 5K3BA 4BZZA 1Y34E 2HUPA 4HPWA 2EYUA 4O33A 2HDNB 2GZ1A 2XKAA 4YCLA 3B3AA 3U7QA 3E2MA 3CSDA 3TZBA 5BWMA 4K1LA 5KWJA 1IUPA 1RI4A 1TE2A 1ABBA 4RD2A 1KZ4A 1J8DA 4EJMA 4HYTA 2XWBF 2IYAA 4C0JA 3OOJA 5CAEB 2OE2A 4RF2A 4PHCA 5AUPB 1VJ0A 4RABA 4DDTA 4OLAA 5DCWA 3S1LA 3VNUA 4QOEA 4DXAA 5JD3A 5DX8A 2QTVA 5JCXA 5K8CA 4MVJH 4RZXA 3W04A 4F8JA 3ZGYA 3VPSA 3MGKA 3WSVA 2I80A 2VO1A 2ZJBA 1XLUA 1UEIA 4ECAA 5ARBA 1IPEA 1PTJA 1HEUA 2CNNA 3C2QA 3PR3A 2ZSJA 1E63A 1A7AA 3W4JA 3TZLA 1W1IA 4GQIA 3MHPA 4LPSA 3EZNA 1FSPA 3GT7A 4WESA 1ZJ4A 2A9FA 2W4IA 1IHUA 2VXBA 3ODGA 1FNDA 5CYOA 3VKHA 2CLOB 2OXFA 4TMFA 2DWOA 1M6YA 2PJZA 4M9UA 3THSA 3DL0A 4QU9A 5BN5A 1E1NA 3H5IA 5BUZA 2AFHB 2M1XA 1DCMA 3IUNA 2IYUA 4F72A 3K70D 3AFNA 3KJIA 3MD0A 1O8BA 2XDQA 5KI6A 3DTNA 2VQ3A 5BPFA 3HJNA 4M1WA 2I8LA 4FQ5A 4C20A 1VQ1A 3FFTA 4WLEA 2Z8XA 4EA7A 4G0UA 3VKFA 4J76A 1QPGA 1CUUA 1E4OA 3D2AA 5AW7A 4IJWA 4WXEA 4FB4A 3FHTA 1QUEA 1QE3A 2E4XA 3ZWQA 3SZLA 1MNQA 3N75A 4I55B 3OICA 2X42A 2XYPA 3PD0A 4MO2A 4XJTA 1KPHA 1SOWA 2QRPA 3S2FA 3JQ9A 4JWTA 4KEAA 1CY6A 4KH0A 3ZI0A 4MYTA 1VL1A 3M1IA 3IEMA 1C9DB 1SVSA 3D6TB 1MC1A 4J7XA 5G4LA 5AXCA 2V96A 2ZS9A 4Q12A 3DBHA 1M0WA 3U3RA 2VZ0A 4B3GA 1LY1A 1PEDA 4HLUC 5IJ9B 1WPGA 4PSVA 4X8OA 4FOSA 1AHPA 2Q3HA 4HWGA 3CMCO 5AKJA 2IKSA 1OT3A 5LQCA 3AY0A 1TLLA 4ZCPA 4OHUA 1EK0A 4XD2A 3I62A 4FYPA 4KLCA 2VHWA 1P81A 1KPGA 3C39A 3NVDA 3EC1A 3EXFA 3OE5A 3PHGA 1NKVA 2FKAA 3N8IA 3PRKE 5AI6A 1N5KA 1S1MA 1YASA 2GI4A 2Q3MA 3IIEA 3JASA 2PUVA 4WERA 1W88A 5FUXA 3Q8WA 2H9IA 3G2HA 3UUEA 3NDRA 4DRZA 1RQNA 2WJIA 3EP9B 2A8YA 3BMQB 2PGLA 2VVTA 5F5XA 1YV9A 1OC2A 2HV9A 1WY7A 1Y4SA 4K9LA 2ZIAA 4G0WA 4EFMA 4LNAA 2WD7B 2WIJA 1XTJA 4AF8A 5DZSA 1A72A 2E37A 2ZWVA 2GJ4A 2OXIA 4EJ2A 5K6TA 4PCUA 1EDOA 1K7CA 3FWKA 2VP3A 4PRZA 4S24A 4K86A 4ZVVA 2WG2A 4TZ0A 1KERA 3U1BA 1U8ZA 5AJVB 2Q1SA 5C31A 1T6XA 2ZUSA 1P4AA 4DCNA 4UHHA 5KWEA 1MO4A 2PS9A 4C0AC 3KK0A 5CB4B 3DB2A 1UDRA 2Z8YA 5D6OA 1NBIA 2Z30A 1N6IA 1EUCA 1DE0A 2A2ZA 2EWWA 3II6X 3K8ZA 4OQXA 3UGQA 4K0KB 5JJIA 1KYYA 3UGTA 5IPFA 4TS4A 3ZWCA 2BJWA 4Y1RB 3J7AC 3SYMA 2XTAA 5JS8A 3WNZA 5EJAA 4ILEA 1G20B 4Y0AA 1K5DA 4L2IB 1PWHA 3F67A 3C70A 3R7FA 4Y2YA 4CMHA 2QTBA 1V39A 2VTEA 3KE9A 3LLUA 4H1WA 1I7NA 2H2FA 2QNBA 3EVAA 3G3EA 5BV8A 1NWCA 1JSCA 3QX7A 2ZJ3A 4D9JA 4I5EA 1L1RA 2C7GA 4PEVA 5IZ4A 5CDGA 3W8DA 1RYFA 5IBRA 4RL6A 2CZQA 2QN6A 4B43A 1T26A 3L6OO 5BOVA 1IQPA 3DZ5B 3EZGA 2BMJA 3OE4A 2FW6A 1ENYA 1RHRA 2H1VA 2PQ0A 3MWKA 1RT9A 3C97A 4IOLA 2W71A 3BSSA 1KMIY 4GX5A 4YP5A 5JXHA 1PWYE 1OBHA 4FFBA 1U4OA 1N0VC 4NTZA 4BMPB 1P4GA 4LXXA 4C4XA 3IVXA 4NK4A 3A6FA 1K3FA 3FUWA 4OEHA 5F3RA 4ICIA 2O8CA 1M6WA 1KEVA 2HK8A 2ENWA 3UKJA 2QQ0A 1KGSA 3I9KA 4L4SA 1KEEA 1FTNA 5K0NA 1XJWA 1Z3CA 2ZRBA 4Z4IA 4XR9A 3KAPA 4LI0A 4QUDA 1M6VB 2QRMA 2BI8A 1LDNA 2YZKA 3B2NA 3DJFA 4G36A 2CNDA 4HAOA 5DI3B 4C2TA 2I7XA 3M4NA 4K2HA 1UJ5A 4YQZA 4A5OA 5HQJA 4GOND 3EZLA 1C4WA 4JEUA 3RKRA 2FSVC 3T9BA 3RSCA 1SK8A 1RZ3A 2JGRA 2DERA 2QX6A 2QE7A 2RK3A 3F7MA 3T1YB 1P1RA 1ORTA 1S2OA 3QYFA 1P1KA 3NANA 3DNFA 3QENA 2DVMA 4QU8A 3H2KA 4UNSA 2B1GA 4YP9A 1F7UA 2Z5LA 4U5XA 3AUAA 4R1UA 2IUUA 4ZKDA 5KYVA 1UJ2A 2B8JA 2HMSA 4L08A 3SZ3A 1KFBB 1XALA 1LPAB 5EMNA 5DMHA 4HAXA 1WB5A 2QYOA 3VDNB 3PQ5A 5EIXA 2OGWA 2CK3A 3PA8A 4M9XA 3NHJA 1OOEA 1SG6A 1W8IA 2XMCA 4DUYB 5AKKA 4Q3OA 4XJVA 3T1HB 3SR3A 3MQ2A 1PRYA 2AG5A 2G70A 2VNAA 1PVVA 3CLRC 4M99A 5E7JA 2VF5X 4EY4A 1R8SA 2FZEA 2XDAA 4F6RA 3MTBA 1A8IA 4JITA 1NXTA 1Q17A 2GVDC 4EYKA 3NNSA 4U7JA 1M73E 2H00A 1KNXA 3CKYA 3K0CA 1YMUA 3A6HA 3E15A 3CGWA 3SIXA 5KREA 4ZPXA 5BWOA 3AETA 1X1DA 2P78A 4OXNA 4B45A 3T34A 3DO5A 3ANMA 3ADDA 4OMCA 1CDOA 2JJ8A 3N39C 1RRKA 2YOGA 3CZ9A 5FADA 1CZKA 1AO0A 3KLPX 2OUIA 2PX8A 2VDPB 3T7SA 4G89A 3OH8A 4JVMA 5COQA 3QH4A 2HF9A 3BH0A 2WBLC 2JCVA 3W6PA 3H3XA 1VE3A 2M6SA 5B1HA 4B87A 3K72B 2HMAA 5JDIA 3FAZA 4TM8A 5AVJA 4I36A 4ERXA 3UT5A 1V35A 2D1TA 3DZIA 5KYWA 5DHUA 1NY6A 3NYQA 3AM5A 1PK8A 3MJRA 2B4AA 4OJKA 4UUAA 2FUG6 1KDYA 1NLYA 3RJZA 3SYLA 3M3DA 4MQBA 2R86A 4UOEA 1NVMB 5JWOA 1SOMA 3H5VA 1QIGA 1I6WA 1P2SA 1VSTA 2JVIA 4JYCA 5EI5A 5BYBA 1PSDA 4XTRA 5CVDA 4V0OA 1CLUA 1Y1KE 4CG1A 4MNTA 2VSNA 5MDHA 4WEOA 4C5AA 5DTRA 1WPRA 3OJWA 2Z98A 3R3JA 3EFHA 3GV0A 3K7EA 4G0YA 2V55B 3ICVA 3ZCRA 1Q0HA 2JI8A 4MR9A 4ZO9A 1BO6A 1TDJA 3TOXA 4AL4A 2B34A 4MDEA 3CKLA 2VDVE 1B8OA 1GNLA 1UQRA 4LJKA 5AI4A 3U81A 2PLAA 5AVSA 4OMDA 5CVJA 5A7FA 5LYJF 3I72A 5IDVA 4NRDA 4FI3F 2DQZA 2YXLA 4JVSB 4XIFA 1NX6A 1E7WA 3DPSA 1WEHA 3TE7A 1EFUA 3VZSA 1EGVB 1E2IA 1JLHA 4CT0A 3FPAA 3JWEA 4XX0A 3MS4A 3FCXA 5IAKA 4U9HS 1RLOA 2CXNA 1WLSA 2O8EB 1KI3A 1ADGA 1M74A 4V02A 1E0AA 4J0FA 1YZUA 4ZARA 1XNRB 1INLA 2WIFA 3UB2A 3O8DA 4BKOA 2YS6A 4NAVA 3VR5H 5KQMA 2PKEA 1GAQA 2R8EA 1UBRS 5D51S 3PVZA 4G5QA 3HUUA 4X8LA 1RRGA 2UXDB 3U7GA 4ZVNA 2WVGA 4KLAA 1JEAA 4XGRA 5J9FA 3RHZA 5JH7F 3R5XA 3IQHX 5D86A 2WW8A 2Z4TA 5EE5B 1Z8NA 1QANA 3LBFA 1QE5A 4QUGA 2AOWA 1Z0UA 3PEWA 5FFFA 1SJ9A 1T4CA 4RQUA 1IY0A 1T10A 1WR8A 3MTQA 1OWOA 3E8XA 4O0MA 3EEQA 5DK6A 3A3KA 3E5NA 4KR6A 3IQEA 3ZLBA 2I8AA 3MB8A 5AHXA 4ZJUA 1JFLA 2E7ZA 5K99A 2XZDA 4XWAA 1HE3A 1Y1RA 2FW7A 2EFJA 2ZIXA 3HCOA 1E3DA 5C7YA 1FVFA 1UPCA 3EH2A 5LQJA 4WK2B 4X54A 4DYDA 2Q9AA 4I9GA 2ZBPA 5K0TA 4OX9B 1CUVA 1NDHA 1UQTA 4HPJB 2DTXA 3DD1A 5F33A 4QYXA 3BMOA 1GNQA 4ENTA 1JQBA 2O8BB 1M8JA 2FI1A 1SHTX 1GSAA 1EJ0A 1G63A 3UCXA 4C3OB 4V2UA 4Q4HB 2OESA 4FDTA 4AS1A 4ENWA 3UN1A 4M36A 3C3XA 4RCZA 3BMNA 2GZSA 4AWXA 3TGWA 1M2WA 3OBBA 1M5RA 4I1OA 1MX5A 2XOKA 4I50A 4JJZA 5K8VA 4RTJA 1FJGB 2YJ5A 2AIRA 2PRSA 3WTBA 4FZ5A 4BMXA 3SJZA 3YASA 5BPHA 1E6EA 1JDBC 4K6FA 3WWEA 4DNXA 4CCWA 2QN2A 4J1TA 3I92A 2P9FA 1JQ3A 1JDNA 1Q22A 5JW6A 1XZHA 2VTVA 5DRTA 4ID9A 1GPUA 4LG1A 4A23A 2BP7B 1FVHA 2REQB 3CV3A 2C8KA 1E60A 3I4CA 4MS4A 4FN5A 4K3VA 4RM3A 1W29A 1H22A 3GOQA 1UJCA 4OYLA 6REQB 1HLGA 3O95A 1SXJE 2AFIE 4M46A 1VL8A 3S5JA 2DY1A 2AJDA 2PGIA 3SIWA 1AMNA 3AB8A 1P0IA 1CKEA 3QVSA 1W5EA 3P97A 4KU4A 3T9CA 3W6OA 1GDHA 4AYTA 1G21B 4OHBA 4WZBE 4W99A 2X14A 2D1RA 3E35A 4JUBA 1ADBA 3BILA 3PX3A 4NE2A 3CBGA 4XOUA 5K01A 5AR1A 1OH6A 3QLUA 4MWZA 3MRSA 1V6SA 2Q5JA 4H1TA 2B4TO 4CLDA 2A7XA 4FEGA 5CBPA 1W5AA 3WIUA 1J25A 4ARBA 1P17A 1K8XB 1R0WA 2PWZA 1Q0ZA 1TK9A 3W2FA 3KPWA 5JY1A 1O4WA 3JSAA 3AEYA 1W73A 1A97A 1FSFA 4GVLA 3ZE7A 2DUJA 2PNFA 1U2QA 1U2TA 1W59A 1U8FO 3CGGA 3DHWC 4BLQA 3FBTA 1EFAA 1OF1A 4GP9A 3E22A 4EGSA 4C30A 3HFJA 4MV8A 1LNQA 1GPJA 4ARVA 1DX6A 5LDHA 5AJTA 5A4JA 3AI7A 1E5TA 3ZK7A 1GADO 1R66A 4EM6A 4JMLA 3EY4A 3STYA 5KMGB 4IMJB 3AEUA 2AXQA 3EIHA 2AUNA 5B3JA 1DQSA 1K27A 1NXOA 3E9CA 4MUFA 3IPXA 1VMIA 3GCWA 1E58A 3WGJA 3GEHA 1P7CA 3GVCA 4LYDA 4MVJE 1R1DA 4D9BA 5A1TA 4CBVA 4WNIA 1I2MA 1NN1A 2PWBA 2QRHA 4JIMA 3WC4A 4CKWA 3W9SA 3R6WA 3KJHA 3D4BA 4OO3A 1VM6A 1B0AA 1H4VB 4PQGA 4CEIB 3DVAA 3ZU4A 2GD2A 1RM3A 3ZYZA 4ER5A 5DNVA 3WIEA 4IVQA 3GZNA 4MA0A 3TYXA 2VDLB 2ZI3A 2DB3A 1YO6A 1X9HA 3V34A 5IBCA 1V0JA 4N7RA 4CEHA 1BFKA 2I87A 2BFFB 2TMKA 2XCQA 3RUPA 1MPTA 2UYYA 3PU6A 3AVXA 1DP4A 1JAHA 1U11A 2I4RA 3JQRA 2YINC 1W4CA 2QMQA 2QTLA 4BO1A 4DMHA 1A9XA 2XRYA 2BRUA 2O2ZA 4URZR 4ZDKA 4MW0A 1T5OA 5EMHA 4IWNA 1L7EA 3LI2A 1DAFA 3E4CA 3VKVA 1X77A 4Q6WA 3K1YA 1QP4A 5IZCC 4WUTA 4NBUA 3VR6D 2IEZA 2BZSA 1CY0A 1CJSA 4G4GA 3RH0A 4I1RA 4Q9AA 3JD1A 4K46A 1IUOA 5FFNA 3PIDA 4EUKA 3B70A 2Z3VA 3GUZA 4TTQA 5E9WA 3B3QA 1P9WA 1SZDA 1USUA 1HE5A 1FRNA 3FDZB 3JQ6A 5A9TA 3W2HA 1JEOA 4BMCA 4FGUA 2AXEA 2PMKA 4NBWA 5F51A 4M1YA 2XTNA 3GW8A 4JLDA 3U4QA 1NVAA 2OEPA 1Z5ZA 3D81A 3BIXA 3GRCA 2I4IA 5FA8A 5CDHA 2AD5A 2X5JO 1R4MA 1PD0A 2QA5A 2EQ5A 3EC7A 4I8XA 4DSUA 1PLJA 3IP9A 2G36A 3N76A 1ECCA 2ZQZA 3RTDA 1IEWA 1ULTA 1WW3A 5EJMA 2HSEA 4UTNA 5BSMA 1TO1E 2VWHA 3ANLA 3DGFC 5HA5A 1KOJA 1PW5A 3WHKA 4D4KA 3O2NA 3VPXA 3SNKA 3IE1A 3OPQA 4RF3A 5EEHA 3EC2A 3AQIA 5FUWA 4C78A 2BH2A 1MJGA 2YXEA 2W42A 3TTYA 4B9AA 1I14A 3SU8A 3ZUGA 4YBZA 1VB3A 4W5OA 1OC4A 2EJCA 1NUUA 2YJTD 3O2SB 3PD7A 3QK7A 4QUAA 3VU0A 4E4TA 1KU6A 3EGIA 5D01A 3PGLA 1KETA 1C0EA 2VZLA 5BNFA 3WGMA 3DA8A 2IQIA 4IQFA 4O0LA 3A37A 1H0SA 1JNYA 3CE6A 2CKDA 2ZBQA 3B6EA 4CM8B 4LC9A 5JATA 4TTPA 2HHLA 1SUPA 3E58A 1GTG1 4Y9RA 2WHPA 1K9VF 4OATA 1YI1A 4CU5A 1S9HA 4EHIA 1I4OA 5I8WA 1GV1A 2KW5A 3NHKA 1JWBB 1YJAA 3VSEA 1CS0A 4I14A 1E3JA 4RNCA 3EDCA 1QH8B 1TCUA 1CP2A 1XNJA 2GM5A 1ZLYA 1P1IA 2C3PA 3KKZA 3F46A 4QYSA 2A59A 3V8VA 4EHBA 2R00C 4QBTA 4M7OA 1AKNA 4LMPA 3GLIE 1UP6A 1Z34A 1GPYA 3RBZA 2IP4A 3GF4A 1GZSA 4NCHA 4BNXA 1YFLA 2BEVA 4KOAA 1AKQA 3WGKA 4AUEA 1ZI8A 5A71A 2NXNA 5E7QA 5L51A 1J70A 2WSIA 2NN3C 1EK2A 2QX4A 4FDLA 4HATA 2H2WA 3A28A 1HEIA 4R40A 3SQDA 5IF3A 5K8LA 4EI9A 4H31A 5J23A 1NFQA 4QXQA 1R0KA 1V3QE 3EYWA 4DBZA 3OLWA 2I29A 2ZBEA 3OM0A 2JC3A 4H0FA 1ECGA 1G0OA 2BN4A 1RAFA 2K7ZA 2PR7A 4FEEA 4MUKA 3EH1A 3RW9A 3FOWA 3VHXA 3JRXA 4F4IA 3BD7A 1SAYA 3CNEA 1IHOA 3V55A 1UINA 4O1MA 3UG7A 5DNYB 4M87A 3BE6A 1F14A 1LLQA 4KUHA 2XIQA 1IY9A 5CFLA 3IUSA 3KB1A 1XXHA 4C6RA 2I3AA 1EJ2A 4I6GA 1JQAA 3P1JA 1L7QA 4IJ5A 1SUSA 1ZP6A 3THOA 2X8BA 3ZXXA 1W4LA 3GT0A 4TKMA 1U28C 3CRVA 3L8EA 3IQXA 4HQ0A 4IIGA 1ISPA 1BQ4A 3GXOA 3AL0C 3OEED 4D9GA 2H16A 5FKJA 3UT6A 1HMYA 3HJBA 2AHRA 3CURA 5FTMA 1BEZA 4B47A 4C03A 2EFHB 3GJQA 3WK4A 1YHYA 5L4LA 4QQRA 1ZPDA 3AP3A 4M60A 1QG2A 3R7BA 2VYVD 1C2YA 4OKIA 1WHTB 2FKNA 1HUQA 1U8XX 5FUYA 1J1UA 3RREA 4D3SA 3IO3A 3CEHA 4ETIA 1BOFA 2KE5A 4CN9A 1ONBA 1OYVA 1FTYA 4INPA 3RKUA 3ZV7A 2IS2A 5GIOE 4V2IA 3NR2A 1ZCFA 2DKOA 2VBIA 4RNDB 3RT7A 1BVUA 3KYDB 2R1VA 5JNSA 2NZWA 2RH4A 1NBEA 1MBZA 5A9SB 5DYGA 3BIOA 3EXAA 4L5YA 1SBZA 1U04A 2X4GA 3A3OA 4MAAA 1NP7A 3T0GA 4A0SA 4AIIA 5KNCH 3DQZA 2JGAA 5ILOA 2BR3A 1SBTA 2OV6A 3IQIX 3NBKA 2ID8A 3AEQA 1CDDA 4OHRA 4QM6A 1G4UR 1E2BA 1A50B 3PQ4A 3L7LA 1EK5A 4BJHB 2BONA 2JH8A 1NYTA 3HHEA 3NATA 3QKSA 4HEA6 1BHQ1 4L50A 1UJNA 3D8RA 4ZAWA 1HXHA 3WHLA 4MWEA 3T1NA 4CLEA 1VYTA 5AM5A 4C3ZA 2OQ2A 3BL6A 4PHFA 1W25A 4CL3A 2FLKA 1XZIA 2I7CA 4RVSA 5TMBA 2ZVQX 3EIWA 3FOFC 1PIWA 4D3XA 3NETA 4DA8A 4E6EA 4JJEA 2BUAA 3MTDA 3QJGA 1Z7BA 1TOAA 3T94A 3MBOA 3S7ZA 3TOCA 2CVQA 2QVBA 2EP5A 5T4HA 4G25A 2B9VA 1JPNA 3QNMA 4M0MA 3PSHA 2B35A 2ECQA 1JDUA 3FA2A 2LP4Y 1K63A 2P9YA 4M0DA 2VJMA 2GD1O 1MAVA 3AR4A 4OI2A 4PZEA 4RCYA 3STVA 4LYAA 3ZWKA 5KKCA 1U5BA 5HP4A 1XPRA 3RHTA 4UVGA 1CUBA 3L8DA 2OCGA 5GP1A 4HH1A 3JQBA 4KWTA 4RK7A 1XPUA 2LTAA 3EMBA 3LYAA 1JB1A 1E8DA 3DB1A 4JZYA 5FWAA 4D45A 4DC1A 3KSAC 4KFSA 4L6CA 4R2XA 3AJ8A 5DOVA 4B7XA 1FJ2A 3IPCA 3PUIA 2ID4A 1VZ3A 3AEKB 1TL7C 4MIKA 5FWYA 4LJ8A 1ZJYA 4OQNA 3LQ1A 4G1EB 4EB6A 3QM1A 2HHJA 3PDHA 3UWSA 1PN3A 1H94A 4H3VA 1FFBA 3A1TA 4F7WA 5BVHB 4EQ6A 2EP7A 3GFGA 4K9PA 1DO8A 2PH5A 1Z25A 4ITVA 5AI9A 4YMVA 2DQKA 5JD5A 2O5CA 2BFOA 2NYAA 4A6DA 4NDAA 2QY9A 4QFDA 5AW1A 2PHZA 1WZUA 2PYZA 2H54A 5C5CA 4H6WA 5FB3A 5FLKA 1RXSA 4NAUA 5CJPA 5ALDA 3C8MA 2XUGA 3T1TA 4N39A 4NJMA 1P6XA 1DT3A 1A1SA 2WZCA 3QLJA 3RGGA 3A6EA 1XHFA 5HTKA 3F3KA 2HWXA 2G4LA 3MOGA 2OBBA 4EARA 4L85A 2GHIA 2CE7A 4DQDA 1KI6A 5HM8A 4U0KA 5HIIA 1SXQA 3UXMA 2Y71A 5EIBD 5T6MA 2G3YA 2E6KA 2JFQA 3O8OA 4KQXA 3TR6A 1W85B 2CL0X 3R7WB 2ZUTA 3WWCA 3IRVA 1MHTA 3NBMA 1Q74A 1FP7A 1YJ8A 2J08A 4OU5A 3GAAA 3I1YA 3O0TA 1MJNA 1IZ8A 3TLZA 5CLJA 4H6XA 2AVDA 1XTIA 2V03A 4XJSA 1D8AA 1XU4A 1XKXA 2JJ2D 3BL8A 3QRWA 4FDMA 4QATA 4KODA 5FR2A 4K6KA 3R8XA 4K6MA 4B2LA 3O3MB 1PGOA 2VWQA 3O92A 3GUYA 1IHXA 1V9SA 3DE3X 5FPKA 2VUHB 1YL6A 2GO1A 2VL7A 3U7EB 5FL7D 4JDPA 4BZWA 2ZSKA 2XDWA 1K97A 4G56A 3G23A 2J8ZA 3KOZA 2BKVA 1ZD5A 5EL0A 1XQVA 5L3RA 3A26A 3ND5A 4L02A 2C9YA 3L6BA 3IDFA 1Y6GA 5JTUA 3NHUA 5M34A 2BFBA 2FR1A 4NE9A 4HJXA 4KFTA 4UDXX 1I7DA 2HCJB 4LV5B 4B6SA 2JFPA 1PGNA 3DKIA 3HP7A 1GXSA 2OM6A 4Y2UA 3Q1KA 1TIBA 3WGQA 2J67A 1NN3A 3Q7SA 4RHEA 1C3OA 2EGUA 1YJXA 1W36B 1O87A 2OBYA 4E2YA 2PEYA 1JE1A 3BYZA 2ZI7A 3CRZA 1G98A 2OORC 2NG1A 3UJ8A 2JJQA 3D6NB 1J0DA 5FJIA 3TKYA 2DX7A 2WAYA 1GA1A 4NR0A 4KR9A 4DA0A 4EDHA 5KKNB 3G0HA 1LVGA 4P84A 2I2WA 4MVJF 1Z5VA 2GEUA 1BWQA 2I67A 1Z0KA 4J1SA 4CRWB 4MW5A 3JVIA 4I8IA 2XQFA 3FJOA 1L4NA 1SBYA 5LQNA 3MWGA 3DMYA 3SS9X 3OMLA 2P79A 1R10A 4N49A 4QXAA 2X6TA 2PU5A 4NL4H 1MIOA 1F5NA 1NL3A 2AQHA 4J0DA 1M1ZA 2F3SA 2X5XA 4V0ME 3AVTA 1V16B 1U8EA 1PL8A 2QD5A 2WTBA 4GX0A 2AZDA 3N05A 3VH2A 2AKAB 2C7PA 1Z8DA 4E51A 3OTIA 4CNBA 3SM3A 3UMMA 2O7NA 2VF4X 3KGDA 1ZJJA 2Z2ZA 3C48A 4Y6OA 1TJ3A 3KPUA 1PTKA 5IHPA 5FWXB 4HDOB 1OD6A 3DLIA 2ILVA 3KTDA 3G2KA 1BX0A 3RAPR 1F8GA 3WQBA 3BSYA 3ZCXA 3W4IA 1H6AA 2GUGA 3IBSA 5LYJA 3UCFA 1PAUA 5L7YA 1DRUA 3ROTA 1D1PA 3MAGA 1FC0A 1NQVA 3O90A 3ZWXA 1B14A 3ZDEA 5I7EA 4UHEA 4HOYA 1RMTA 3H04A 3VR4H 4F3CA 3GL9A 1VL0A 4DUGA 3S29A 1CNMA 1TT5A 3B9PA 5BWBA 5EWLA 1E79D 2JBWA 3K9HA 4FYMA 2EGHA 1RXUA 4LHXA 4WN3A 5JANA 1K88A 4KIFA 2Y9MB 3OU6A 5EWJB 1FU4A 4ZHQB 4XDHA 1KMQA 1H9AA 3IVAA 3B8HA 4G65A 4WOKA 4EH1A 3CNBA 3O4GA 4LXYA 3LSYA 4HDNB 3HFRA 1W9HA 1UFVA 4GOLD 4Y2RA 5JH7A 1L6RA 1IUKA 1OZ0A 3QFFA 5CCBA 3ZTYA 3GLGB 1H8HA 1I7LA 2ZBUA 3ENZA 3R0XA 4HYYA 1PR5A 2HEIA 4G24A 3VJLA 1NR1A 4WECA 1SEPA 2PKCA 4Q9IA 1FNSA 2XIJA 2NX2A 4KQJA 1FLAA 3DHNA 3NHZA 1L4EA 4FMDB 4C3UA 1H1LB 2QSUA 2YXDA 5JYCA 2A1UB 3FYUC 1ZGBA 3Q3EA 4FKZA 2HJVA 4PLCA 4CNQA 3KG2A 2QRNA 1G3UA 4UNRA 1PT5A 3AI2A 2JGFA 4WKNA 4BGIA 4RWZA 1A8SA 3WX0A 4KFUA 4BO4A 2GMWA 1RQPA 2PQ6A 2FSIA 5KDDA 5T5QA 2PBFA 4JLWA 4LZAA 4N0MA 3ETHA 1LWNA 5C7OO 2DM6A 3KSUA 1BX3A 4D4LA 5E3HA 3J81A 4Q0MA 4RS3A 2HIHA 3ZEAA 1BRMA 2OMKA 1IBRA 2H11A 4E11A 1JG7A 1UFKA 3OFVA 1RZUA 4MOWA 4X1OA 4YJ3B 4BLOA 3BJZA 1NRIA 3V4LA 1H1TA 1KIAA 4A8HA 1X2BA 1P1CA 1Z6QA 1DKOA 4KRXA 3G2LA 4S1TA 1ZH0A 4BTVA 1RM0A 1DQYA 1GLVA 5M29A 1F1BA 4R9NA 5IVPA 4MKZA 4UU7A 3EODA 2I2DA 2GJKA 5HF5A 3TBKA 3HY4A 1CB7A 1VMKA 4UHDA 5JPIA 2G0AA 8OHMA 4K40A 4M53A 5AVZA 4YCNA 1UXHA 3ICPA 5DM1A 5LP6C 5LQMA 1C7JA 4O2BF 1JIUA 3I6ZA 4JHXA 1BN7A 1CJKC 3KZ1E 4QSHA 3AWDA 2F9FA 3GGSA 5CT6A 2PN1A 2WVJA 1R88A 2W58A 3TNFA 4F9GA 4WOBA 3ZR4B 2LNDA 5J4YA 3MC1A 4DV1B 1QKIA 1R6TA 3DFMA 4UBKA 3E8SA 1NI3A 4V0LA 5AHOA 4X6XA 3R09A 4IGFA 5GTDA 3GFTA 1M1YE 3DDZX 2WF9A 3ZJTA 2X5OA 1KO5A 1LZLA 4I4TB 4EPRA 3T35A 2B4KA 3AHJA 3B89A 3B60A 4AK9A 4JLBA 4LF4B 3ZN2A 1XL0A 4N03A 2P4QA 4XB2A 4IHJB 4QFBA 4NU8X 4HV4A 4GXRA 3LBNA 4F1JA 3ZVMA 4CGYA 4OL0A 1C1DB 5DDIP 4N0PA 2XD4A 2GX6A 4RL4A 5M7EA 4RTRA 3IWCB 1I10A 4LFAB 1ODKA 3O73A 1GR1A 1AF4A 2GCOB 5LKRA 4G5RA 4E5YA 3TM5A 5HKBA 4MV9A 4G4SP 1DAEA 4NARA 2OCYC 1BD4A 3H8JA 4Y2JA 3WB2A 4CLOA 4ZAGA 2W37A 2GZHA 3QXGA 2ES4A 3ZHSA 2QU7A 3RIGA 2G08A 5FQNA 1XUOA 3A9UA 4L5IA 3DYVA 3DE0X 1CWUA 3F6SA 3U40A 1KK1A 3T0FA 3TINA 2IZZA 2O57A 4JXXA 2BTOA 2H06A 1ECBA 1K08A 2WG1A 4X7RA 4X97A 1KYTA 2JLSA 3DDWA 3SC4A 2IW1A 1WCV1 3RBXA 5I7UA 4PZLA 4DR4B 4ANFA 3W9YA 1JHOA 1ZXBA 2VK1A 3NH9A 4TVKA 1V5WA 4PY2A 5HRAA 1KAOA 1FSSA 2XNJA 4RFLA 1ARZA 1T6NA 3GX1A 3NBUA 2W2QA 1Q21A 2NXWA 5DBOA 4DUPA 1RC0A 1XDBA 1ZN9A 3FPFA 4MIOA 1IHDA 3N8NA 3OZEA 4EL5A 5HKKD 2CLKB 3KQLA 3KAQA 4FJ2A 5C46F 2OCKA 1DDIA 3MA0A 2IXGA 4CMIB 4KUEA 1E20A 1E9EA 4Y9SA 3ICQB 4EG5A 2P91A 2NZYA 2BFCB 4P7BA 2QT9A 2HF8A 2XUJA 1DKRA 5FOUA 1DHRA 1SUWA 3VTAA 1E1CB 1X92A 1ZWLA 3FJ1A 3UBTA 2ORVA 2RGNC 3H8VA 1WE2A 4KVGA 1L7XA 2CN1A 3U4HA 1OBFO 4Z4FA 3U3ZA 2ZYDA 3AP2A 2PXHA 4MHTA 1X3SA 5LOVA 5TR9A 2HRZA 3TOVA 3EF0A 1UUFA 2RH5A 2EKPA 1UMCA 2KS6A 1OTHA 3SYNA 4BE9A 5A2QA 3QY9A 1KS2A 2OT3B 4MLDA 1YBMA 3D8NA 2XE4A 2Z43A 5IKPA 1TGVA 4PZCA 3B51X 3TH5A 4B9EA 3RYCB 5AM0A 2G06A 4EGQA 5CNJA 1QV9A 4J0IA 4N8EA 1GQ2A 3G0GA 1US8B 1IOZA 2ZPUA 5SZJA 3PFHA 4RZ2A 5AXAA 1Y8QB 1O6FA 1JIJA 2L0XA 2VP2A 3MGAA 2BSQA 3EGWA 1GL9B 2WI8A 1ZRMA 3FTPA 4OH7A 4X64B 4RIFA 3JD0A 2JIZD 2B21A 3UMVA 1DO0A 3DZGA 5BVGA 5C4MA 1V5GA 1W44A 4ND3A 2Q1WA 2IOQA 1C8LA 2PBZA 3DWIA 5AOAA 5JDCC 1ZY2A 3S2SA 3TSYA 4UEOA 5DK4A 3U0VA 2ZVDA 3INYA 1K6XA 1ULSA 2PX5A 3GN2A 1W6UA 3ZV5A 2W2VA 1RRVA 4GPEA 3GCDA 1ZCZA 1CQJA 3HPQA 1YWGO 3PNKA 4G9GA 2CMKA 4YAGA 3EEOA 1N1MA 1ZX1A 2P2YA 3P0RA 4A0GA 2B2XA 5C3UA 1PS9A 5JBIA 1T2UA 1F17A 5K2MA 4BNWA 4TWJA 4M37A 1KSHA 3B78A 2CBXA 5J3JA 3WDKA 3LY8A 4RIHA 5CD9A 1Z4PX 4MUEA 3O4FA 5THXA 4DPKA 2OGZA 2AOUB 1R37A 5AOVA 2YZ7A 3JATB 4F84A 4QTYA 3LUHA 3BCHA 1FUUA 1XMOB 4JVLA 3QEOA 5KAMA 1ICEA 4FFMA 5DNWA 4OI4A 3UW1A 3FPKA 1HBJA 3GLSA 4BVBA 1UPTA 4BNDB 2XCTB 2OAQ1 1JI3A 4BP1A 1J6UA 4DCCA 3VH3A 5KOHA 3OG9A 3L9WA 5C4IA 2JCBA 5BOSA 1NBHA 4BBJA 3UHJA 1DCTA 2YNMA 3VOTA 1K8QA 1AA9A 1L4FA 3O93A 4UFPA 1E7RA 2NUBA 4HX2A 1SWWA 1TAUA 2GA8A 4W6QA 4KBYA 1JR3E 1KAHA 2GTIA 2NV6A 2X0IA 3P9PA 4RA6B 2C97A 4E1AA 3C7TA 3N3BC 1WF3A 1Z37A 3F6CA 1UKBA 2FPOA 3UV7A 1OKKD 3S2YA 1SH7A 4NPCA 4WBNF 2V7GA 3Q7IA 4OQ4A 5MF6A 3VFDA 4H35A 1LRLA 3AGPA 5ES4B 2JARA 1W7AA 2A30A 2EKZA 1GYQA 1ONSA 3HL4A 3EOAI 3DQQA 3OJCA 3R7SA 1EQAA 2ZIUB 2FFRA 2CXPA 2PGNA 2QM7A 3B53X 3CZCA 4KKXB 3VTZA 1SQGA 1PR1A 3HBLA 1R6XA 4QO8A 4DCTA 4IF6A 1YUNA 2YHIB 3K70B 3DOUA 3EA4A 1H2ZA 1GZHB 2CFSA 3BXXA 3FOCA 3LHIA 4FWIB 1AX9A 3HKCB 1NZJA 1DINA 4HYEA 1GDTA 1EVIA 1Q91A 2NSDA 3B48A 3PQVA 1EM6A 2AZMA 2GS9A 1KMHB 5ARCA 1G66A 5ISMA 3HCNA 2Y4OA 2ZRMA 2F1HA 1OTYA 3HN7A 1HR0B 2HT6A 4G0ZA 3HR4A 5DTEA 2P62A 4BO5A 1BKDR 1X87A 3C3EA 3L4KA 1YS7A 3CIFA 5ECDA 2VJNA 1JYSA 2J9GA 3FNQA 1YC2A 2DKFA 4ZREA 2QDKA 5E6SA 2PL1A 2X8WA 2JFFA 4W1SA 1M0TA 2ZBVA 3ANYB 4WI1A 4KWCA 4XFJA 1BVHA 2WA1A 1AQJA 2KLHA 2GAIA 4U2FA 4LX8A 2DPLA 2OBXA 2J3HA 2O59A 4TKVB 1D2AA 5EJ2A 5KJFA 1TFUA 5FTLA 3PGKA 4BNGA 1ENPA 3ZBTA 4UC0A 4CKCA 1LLDA 1G7RA 1CF2O 3LL7A 1V11A 4M6WB 2JGNA 1EX9A 1HYHA 3VU9B 3HCBA 5LIRA 3OD1A 3CF2A 5SZKB 1W5SA 4JT2A 1T25A 3PZBA 1XZMA 1J2YA 2ZWIA 4MUJA 1UBHS 4X7PA 4BFUA 4B76A 1XA3A 4UULA 2MU1A 4BQPA 5K09A 3KZMA 3UFXA 3A06A 4LXHA 4PLFA 1WX1A 1XQ9A 2O2SA 3LQ4A 4RQAA 2IX3A 1F0YA 2C4MA 2F8LA 5JVDB 1SCUB 4JNCA 4GPIB 3KL2A 5B1IA 3I34X 1NOJA 3H83A 3I76A 4J94A 4ZOAA 1BMFA 5HKOA 3KX2A 4DWJA 1NVUQ 3CX7A 4ZZ3A 3G8BA 5C18A 1YZNA 4D41A 4PVDA 1Y1PA 4NYJQ 4I4CA 4NH4A