1DRVA

Escherichia coli dhpr/acnadh complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
b'ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1drvA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1drvA01
4E0BA 2P2SA 3P2OA 4MKRA 4JN6B 4J1SA 3PXXA 1VSUA 4QFCA 3BMCB 4BOYA 4DL9A 1OAAA 3TOXA 5TF4A 4NFSA 4GX5A 4YJGB 3DFUA 6LDHA 2PH3A 4YT2A 4XD2A 4U8GA 3ZWPA 1HYGA 3NGLA 3RI3A 3VZRA 3WGIA 5FWNA 3HN2A 1C1XB 3ETGA 3W8DA 5DN9A 1ADBA 5L7TA 4DIFA 5CHEA 4BNXA 3O03A 5B4TA 4CQLB 1X1TA 4MP8A 3PIDA 2ZYGA 1Z73A 1VL8A 4TKMA 1S7CA 3FWNA 1EDOA 3PFWO 1QV7A 3ASUA 4KUGA 4N7RA 4YACA 3U3XA 4KQXA 3WWYA 3ANNA 5B4VA 1EQ2A 3GQVA 3HWRA 3OFSA 2VHWA 2C5AA 1E6WA 5DP1A 3JQDA 4OKNA 4W82A 4CM1A 5BT9A 3ITDA 3A14A 3LC2O 3WGGA 2FPIA 3PJGA 3ZGYA 2PGLA 4YWJA 2GZ1A 5K6AC 3NT2A 3QA9A 5CEEA 1ORRA 1NPYA 5B4UA 1C0IA 1PJBA 4BNTA 4JJFA 1H6AA 1QV6A 4TRJA 1H6DA 2NV6A 2AEJA 3ETEA 4DLAA 2ILTA 2QYSA 2YY7A 3LYLA 3ZWAA 2Q2WA 3DAGA 1O9BA 2CSUA 1R4MB 4XEHA 5EIOA 4M89A 1P3DA 2O3SA 3BMOA 4AJKA 5CDGA 2PA3A 4DXHA 3W8EA 3VVCA 3KEOA 4R9SA 1UXKA 5G4KB 4FR5A 4QSMA 3TWOA 4PG4A 1HSOA 3FNHA 4FN4A 2JFGA 3E1KA 4G2NA 4JLWA 3ON5A 4CQMB 1MUUA 4E13A 5F5LA 2IRWA 1Z6ZA 1ZW1A 1ENYA 3DZIA 1I30A 4RVDA 2NQ8A 3JYPA 2J3HA 2RIRA 4PRKA 5L7WA 3WNQA 5G0UA 1NR7A 5DT9A 1ENPA 5GMOA 4YJHB 3H9GA 4J90A 3ZDFA 3GFBA 2PZMA 3JCZA 5AXCA 1ZCJA 5A06A 4I5DA 4Y6RA 1I2BA 2NUAA 7MDHA 1UZMA 1FDTA 3SVTA 3K8ZA 4BO5A 3E18A 1JN0A 1N7GA 3F5SA 5F3RA 4WECA 4YJFB 2Z1NA 4DMMA 3ZNNA 4BV8A 3RJ9A 2YZ7A 5JO0A 4LGVA 3BHJA 1DRWA 4E12A 2VHYA 1KEPA 5DBIA 4IS3A 3Q2IA 4Z0HO 3KTDA 4ND3A 4Q3BA 3DZJA 4EJ6A 5KKCA 2H63A 1PJTA 4BV9A 2CVZA 3WFIA 1C14A 1XCBA 1Q7CA 3QWFA 1DIRA 1LLUA 4J9UE 1UAGA 4EJMA 2W2KA 5TQVA 3RUEA 4G5HA 4YBZA 3C3XA 3DBHB 2HDHA 1JU9A 2C59A 4GQAA 2WE7A 4NJMA 1Q0HA 4IJWA 4P8RA 4UVGA 3OHSX 1KEVA 2EF1A 3RBZA 4D46A 4WOKA 2F00A 1JAYA 4L73A 5T64A 4IDAA 2X5KO 3QVTA 1Y8RB 2VWGA 4UULA 3ULKA 3E6AA 3FR7A 3C7DB 4MVJA 1P1RA 2UUOA 3IKTA 3QY9A 1I3NA 2VWHA 4HFNA 3I52A 4AJOA 3G0OA 1C1DA 2O3RA 2DFDA 2ZTUA 2C5EA 4QXMA 1U7TA 4RLSA 1HE4A 3DOCA 5CPFA 3D3WA 4E6PA 4IDGA 1ARZA 2AEFA 1O5IA 2C20A 4RZHA 5L7YA 4B4VA 2PD4A 5BSGA 3UUWA 3BAZA 2DQ4A 3RD5A 4WLVA 4S3MA 4LVUA 2OP1A 1HKUA 1DAPA 3PWZA 2Y93A 4OSPA 2O23A 4FJ1A 1U3TA 4CLRB 4E21A 3D4NA 2GZ3A 1FF9A 3C24A 1VKNA 1QLHA 2O4UX 1H93A 3NJ4A 5EPOA 4BNUA 2Y68A 4BO8A 1HDYA 4MVJE 5JCJA 4WLEA 3CEAA 5AXDA 2DFVA 3KRTA 3D5TA 1R4NA 3P7MA 4GWGA 4HX5A 4FGSA 4OQZA 3OECA 1P1IA 1XEAA 1E3EA 4MIEA 3L77A 4CM4B 1FDWA 4C7KA 3ZV4A 1N9GA 1DC3A 4O5OA 2LDXA 1TXGA 5IAAA 4A03A 2BH9A 1I3MA 4ESOA 2BGLA 3DDNA 1SBYA 1Y7TA 2HSDA 5JC1A 1U4SA 3KETA 3K2BA 2RAFA 4BKRA 4XYLA 4LRSB 2GN4A 1PGPA 3RUIA 3UCFA 1RM5A 5A9SB 2W2LA 5ER9A 5JC8A 3DFZA 3WGOA 1P9LA 3ZHZA 2Z1MA 1ZSNA 4DQXA 3N74A 3FNFA 4LMPA 4NR0A 5DCWA 3ZU5A 4DTIA 4WLUA 1DPGA 1PJ2A 2AG5A 2Q50A 4IDEA 4RF3A 1SCUA 3JQ6A 4YT4A 3GNSA 5HRUA 2QYTA 3RUAA 1R15A 4K6FA 5IXSA 1A27A 1EE9A 4BMVA 3GVIA 3IDSA 4ZQFA 2NU6A 2FRDA 3PYXA 2Q99A 5HS4A 2OBYA 3PHLA 1GUYA 4EBFA 1B2LA 2BF7A 1OMOA 2FPPA 4G65A 1YB4A 3GGPA 5JSFA 5A5FA 1H9AA 3CPSA 1D8AA 4Q3DA 1J4AA 2AQIA 4WEQA 4B3IA 1DDOA 1E1KA 4WEOA 4ZQEA 2PY6A 4DUPA 4RCVA 1LX6A 4QO8A 1I0ZA 1BHSA 3NV9A 1WPQA 1A5ZA 3DMTA 4PG6A 1DSSG 3CUKA 2CNBA 4RVGA 5IZCA 1UUFA 4XYGA 3GVCA 3DHNA 4FFOA 1R37A 3ZWOA 5KJEA 2B35A 1U3WA 1O6ZA 3GOHA 2YYYA 1TI7A 3K2EA 3K73O 1LQUA 2JJYA 2QRJA 3U0BA 4BO3A 3RFVA 3JD0A 4R68A 4IXWA 3ADPA 3ADOA 2JCXA 1DO8A 4IQ8A 5JYEA 1E0DA 3PJFA 2PR2A 4GX0A 2E82A 3W6ZA 4Z3KA 1BW9A 5I7SA 3DBHA 4NBVA 3UGKA 4BO6A 1OC2A 3KYBA 1DC5A 4OYRA 1XU9A 3WB9A 2EJWA 1DJNA 1T24A 3ETDA 3D5QA 3ZU2A 1KVUA 3EK2A 1PS0A 2I6TA 4ZRMA 4BKOA 4ZQBA 4CMJA 1PJQA 4I5GA 3RUHA 4J4HA 2V65A 1BTOA 3FPCA 3RVDA 5F1PA 2GRAA 5L51A 1DAOA 2JHFA 1AXEA 1ZXLA 4R3WA 1X0XA 2BFMA 1Y81A 2VOJA 2TMDA 1KY4A 4FQ8A 2B37A 1F8GA 3NRCA 3F47A 2HMUA 1F14A 3AFNA 4RO0A 2A35A 4PRLA 5JYAA 1DRVA 4LK3A 1GUZA 1E3WB 2XOXA 1BWSA 3FRJA 1K6XA 4NIMA 1XGKA 1VI2A 4FB5A 3K31A 3WWZA 3A4VA 9LDTA 2Q4EA 4TRNA 3GFGA 3KOUA 4WNIA 3GG9A 4I9HA 1H5QA 3WYCA 1H0KA 3JYQA 1Z82A 4K26A 4WLOA 5HWSA 3FCOA 1DC6A 2D3TA 2JAHA 5L53A 1N8KA 3LVFO 1IZ9A 2FSSA 2EKPA 5TX7A 3TNLA 3AFMA 2I3AA 4ZGWA 2G76A 5ITWA 5FYDA 1Q7BA 3AJRA 3AK4A 3ZH2A 5ENDA 4J1QA 4CQMA 4XGNA 4AJJA 5FI5A 1EEHA 2FZEA 5EQFA 3AY6A 2X6TA 4JIGA 3HQ4O 1DXYA 4PLCA 2Y1EA 4NU6A 3WLEA 4EI2A 5L3ZA 3AI3A 4CV0A 3DL2A 4CLOA 3UCEA 1T2AA 2FWMX 4DPKA 3EW7A 3RQSA 2Q22A 2WD7A 4UVHA 4J7XA 2BGKA 3VDRA 4BO2A 5CDTA 4XB2A 4D0RA 4WLFA 5THQA 3ONEA 2Y1CA 2PZLA 3G17A 3PJEA 4GL4A 5AOVA 2FSVA 5K0ZA 4JX8A 2FMUA 4Y98A 3RKRA 3VPGA 5ADHA 1P0CA 1DJQA 3I9MA 2JKVA 5MDHA 1LC3A 4ALNA 3GGOA 2RH8A 3KEQA 4UUOA 1HE2A 3L6OO 4B7XA 1ZK3A 2CDBA 5KWEA 2GERA 3U9LA 3LK7A 5A9TA 3AM4A 3E5RA 1XU7A 4RPLA 1OFGA 2GASA 1C0KA 1JVSA 2ZJ0A 4GVXA 3CMCO 3ENNA 5GY7A 7ADHA 1NQAO 5IDWA 1NWHA 3FD8A 2OXIA 3ZZNA 1LI4A 2J5QA 5IF3A 4ZICA 4YJDA 4CMBA 2NVBA 4YAGA 5A03A 3P2YA 2J5RA 3QJ5A 1K3TA 1U4OA 4J0FA 4RPKA 2IDZA 4A0SA 1A9YA 5EQDA 1DEHA 3QVXA 1VLLA 2X58A 4WLNA 1Y1PA 1FJHA 3PFFA 4HFRA 4ID9A 3A28A 3AOGA 3SC6A 1YXMA 3EMKA 3GAZA 2BI7A 2Y0CA 3RJ5A 5CPBA 1W4ZA 1I3KA 4II2A 5JAQA 1T4BA 3I4FA 4AL4A 5L9AA 2P91A 1GAEO 3O4RA 2OGUA 1ISFA 3WQSB 1GYQA 5BNTA 2AMFA 5F1KA 4PLVA 2DUWA 2V6MA 3V2UA 3UOGA 2ZJ1A 4AICA 1M2WA 4IXTA 1T2FA 3G1UA 4NH4A 3C7AA 3H2ZA 3G49A 4CM3A 2OL4A 3OA2A 2Q45A 4YA6A 3PI7A 4BQPA 1U7HA 3U4HA 3FNEA 5BQFA 4MP3A 1VJTA 1EVYA 2WYWA 5H81A 4RDHA 3CXRA 4D42A 3DAFA 3E8XA 4LN1A 4XGKA 5DOVA 3MTGA 1VM6A 4Z6KA 1X14A 3GY0A 4L76A 3JQAB 2W4QA 4RGBA 1PQWA 3HDYA 3QV1A 1Y9AA 4U6QA 2HKIA 4WPGA 1MB4A 1IYZA 1GUFA 3WBFA 5C7LO 3GT0A 1B3RA 1P74A 4EEXA 2IZ0A 5KNLA 1X7HA 2Q1TA 3SBOA 3WTBA 1RYDA 2HJSA 4S1VA 2BHLA 3D7LA 4U5QA 2AE1A 2EHDA 1YRLA 5JDCA 3QWBA 4C4OA 5U9CA 4TROA 1LRJA 5A05A 1DIAA 3QVOA 5B12A 4IZIA 3WS7A 4FFRA 1VL6A 4L0QA 3D64A 1HE5A 1RJWA 1ZZEA 2Q2QA 4UAGA 3GGGA 4BO4A 1YDEA 5A4DA 4YT8A 4EUEA 2ZYDA 1ZXBA 1NQTA 5IN4A 5JDCC 2PKRA 2I76A 2V7PA 1WZEA 2X1HA 3KXDA 3ZNQA 1PIWA 4Z9YA 1M67A 1YB5A 1K89A 1SOWA 2NACA 1LDEA 1YQDA 3ONFA 4HWKA 1YWGO 2C7VA 3TN7A 1HEUA 4ZVVA 2VZ9A 1WDLA 1B14A 1GDHA 4UVEA 3TL2A 4R69A 2EEZA 4XR4A 1E7SA 2J3IA 3K96A 1Z7EA 4PGFA 5FF9A 4CM8A 4II3A 1JLLA 1M75A 3HADA 3LQFA 2PK3A 1EE2A 1BVRA 3F3SA 3RUCA 1C3VA 1DOHA 3PZRA 4YAJA 1NHWA 2VT2A 1GV0A 3STHA 3JQGA 4GBJA 3S8MA 1MXFA 3HJAA 3PHGA 1LDBA 1BMDA 3MCVA 4DC1A 1PSDA 2X0RA 1HL3A 4CLEA 3EUWA 2W2KB 4BNMA 4BS9A 3WJ7A 1YVEI 3L4BA 1XQ6A 3QWHA 4JK3A 3LC7O 3QW2A 3SJ7A 3ZW9A 1HDXA 2NTJA 3ANMA 3QSGA 1JAXA 3LC1O 2CY0A 1OBFO 4IMPA 1YL5A 1NQ5A 5IDXA 3C1AA 4NZ9A 1HT0A 4OQYA 4JXKA 2BMAA 3E03A 3IP3A 4A7PA 3ZWYA 3UXYA 4CR6A 4MIOA 2EP7A 2I9PA 2R00C 4KWIA 3GF4A 3HB4X 1V8BA 1HXHA 2PLAA 2Y1GA 3ZWXA 3FN4A 1PS8A 3O38A 1TB4A 4XQCA 4BNFA 3LZ6A 3DO5A 1Q0LA 2PD6A 4WCFC 5JY1A 3TZKA 2PZJA 1LSJA 3PK0A 3GDOA 1CERA 1GPJA 4JNKA 4B3JA 3E9QA 3WFJA 1LU9A 1NXQA 4GKVA 1R0SA 2BFOA 5TC4A 3HDHA 2EGGA 1CETA 2W2LD 1GQQA 3KBOA 4FIZA 3M2TA 2YFHA 3JQ9C 4IGEA 3QLJA 3WGHA 3UW3A 2RHRA 4X54A 3VAZA 5CEFA 2D4AA 1N5DA 1UXIA 1W8DA 1U1IA 4GSLA 1E3WA 1PR3A 1U5CA 3S2IA 4PZDA 4UUPA 1YS4A 5A04A 4J7UA 1V3VA 3EZYA 1YQXA 3KYCB 1Y8QB 3UF0A 4BGEA 2DBQA 1R4NB 4HBGA 4YAKA 5I9LA 5COAA 2VYVD 4DMLA 5I9NA 3RAJA 4B79A 1A7KA 2HAEA 3INTA 1ZFNA 2NVUA 2B4QA 4OIMA 3WICA 1I24A 4D0SA 4XWYA 4YDRA 1UJMA 1WZIA 4URFA 4YTEA 2GLXA 1JVBA 3NDRA 5BNIA 4YQZA 4QQRA 3DZKA 3PHIA 3AWDA 3IL2A 3B1KA 1VPDA 4BMNA 4FFMA 3MZ0A 5JMWA 2Y1FA 3KLMX 3EAGA 3M1AA 1QRRA 1X0VA 3IKVA 2Y1OA 2ZQYA 2HK8A 3N7UA 2NU7A 3D1LA 3HDJA 1HLPA 3TPCA 4J43A 4BVAA 1IZ0A 4ZQGA 4WNCA 4IJKA 4FC6A 3TFOA 1P1JA 5U1PA 3VH3A 4GMGA 1R0LA 1KVSA 1HTBA 1ZO8A 2D2IA 3AU9A 1AGNA 1YOVB 3GEDA 4WCFA 4CMEC 2X4GA 3I4CA 1YGYA 5GZ1A 3V2GA 1NFQA 3WNVA 1TA4A 1TEHA 2CVQA 2GUGA 2ZQZA 2GGSA 1VC2A 2PWZA 4NK5A 5LCXA 1XQ1A 3ZNPA 4DWVA 5C37A 2Q1SA 4YYZA 3LT2A 4LW8A 4MVJP 1CQIA 3GEGA 4FW8A 3DONA 1F17A 4M54A 1GCUA 4PIVA 4E4YA 3QE3A 1FMCA 4KZPA 2J3KA 3B1JA 1TT7A 1QYCA 5HM8A 3GLQA 5IG2A 1MG0A 1TVEA 3ZN2A 3T7EA 1UP7A 4F6CA 1E3LA 2C7GA 2X9VA 3RU7A 1Q0QA 2A4KA 3PJDA 4HNHA 3E48A 2AQKA 3H5RA 3RBXA 4HUJA 4PLGA 1RPNA 2C0CA 1GYRA 2RH4A 2HMWA 3UKOA 4P4NA 2OO5A 1PZGA 4NNJA 1XSEA 3HUDA 4CLRA 1NYTA 4IPTA 3VVBA 1BXGA 1KETA 3IQDB 3AUSA 3CH6A 1L7DA 5AXBA 2ZTMA 5DBGA 4RF2A 3SX2A 5CG2A 2O3UA 4GVLA 1KVTA 5LDHA 5L4SA 1PL8A 1G1AA 1LJ8A 3OMLA 3ZWBA 4JROA 1PZEA 4BGVA 1LDNA 3KO8A 4DLBA 4BNVA 3OJEA 3VH4A 4RORA 1PJ4A 1M6WA 4FGWA 5FEUA 1QYWA 4XB1A 3JYOA 2P4HX 1HSZA 5J9GA 3KZVA 1ISJA 4RF5A 2DTXA 5IJZA 2EIHA 4GI2A 3V5NA 4O63O 2GSDA 5LC1A 4EUHA 2C2XA 5IN5A 4HP8A 2W98A 3WMWA 1B0AA 4QFDA 4XGIA 3M1LA 3UVEA 4J2OA 4QECA 4IQGA 4WUVA 2EERA 1MGOA 5B37A 1O0SA 2W90A 5BSHA 3GR6A 1PR9A 2O3JA 1NAIA 3F6YA 3GMDA 2WYVA 4BL5A 4D3SA 2VRCA 3BMNB 5TT1A 4C7JA 4L75A 4RF4A 3UAGA 3G1TA 3GMSA 3BTUA 5JAIA 3OSUA 1VJ0A 2A9FA 2C2YA 4J91A 2Q46A 3KYDB 3NTRA 5DP2A 4GMFA 2EWMA 4LISA 3GN1A 2H5LA 2FOIA 4O1MA 2WDZA 3TZQA 1JWAB 1UP6A 1DHRA 3Q6IA 5K6AA 3UH1A 3WQRA 1C1XA 1NP3A 1PGQA 3MJCA 3QIVA 3F1KA 4J16A 5COBA 2DTDA 1MC4A 3SLGA 3ZV3A 1I36A 4NJOA 3IAHA 3ROKA 3DHYA 3S55A 1AHHA 2YV2A 2X22A 3S2EA 3GDGA 1R66A 1ZMTA 2VCYA 4FCCA 3C8MA 1EVZA 4HY3A 4RLHA 2YHIA 4KMSA 3TZHA 1D1SA 1I10A 4AJIA 5A5EA 1ZBQA 2FHSA 3OICA 3VPSA 4E2WA 2HRBA 4ALIA 3ZHYA 5AVOA 1VRWA 1UXJA 4Z9FA 1KVQA 5H83A 2E48A 4EYEA 4R16A 5KVSA 3AW9A 1NVGA 4FOSA 4E32A 3EDMA 4PLYA 2ZTVA 1KYQA 4R1SA 1XDWA 1PGNA 2OORA 1GADO 1E7RA 3RROA 4BNHA 1ISIA 1C1DB 1HYEA 1V6AA 1XR3A 3JQCA 4A10A 1VKOA 2WYUA 3F1LA 1RM4A 3PLNA 3ICPA 2X9NA 1OI7A 3TDKA 3INGA 3OJ0A 1U2GA 3L6EA 1XHLA 1XKQA 3NAQA 1YDWA 1T2EA 2YDYA 3DMYA 2B83A 1SNYA 2EJVA 4JCOA 1B3BA 4RVSA 4N5LA 2QZ9A 2LDBA 5DCUA 4GLLA 3PGXA 5B1YA 3C1OA 1CJCA 5EINA 1EUZA 5JFOA 4U0JA 1NWCA 3NEPX 1O8CA 3LF2A 3FTNA 1M66A 4E30A 4DGSA 2D8AA 1AHIA 4U6SA 4CV3A 1ZH8A 3H9UA 4PLWA 4IQ0A 5COQA 3ZHBA 1UDBA 4J1TA 4ILKA 4U0KA 1PX0A 4H15A 5G4KA 3VTFA 4FJ0A 1VE9A 2VRBA 2EP5A 2JD2A 3IJPA 3X2EA 1YQGA 4BNLA 1EUDA 1KIFA 2CF5A 3HZZA 3QWIA 4TMFA 4WGGA 1CYDA 2DTEA 3GVHA 4PZEA 2DU8A 3W4KA 4BNWA 2ZKLA 4YB8A 4ND2A 3WIDA 1Z74A 1KEWA 2IYPA 2PGDA 4PG7A 4MVJD 1N1EA 2WWRA 4QO7A 3OA0A 2JFHA 4FJ2A 2VHXA 2D59A 1AUPA 2I3GA 5DDIP 3LLSA 1V3TA 3IMFA 4YQYA 4L8VA 1G0OA 1BRMA 1UZLA 3VH2A 3VPFA 1SO8A 1I2CA 4IBOA 4XDZA 2E37A 4KP7A 4LVCA 5JNLA 1YJQA 5A9SA 1NM5A 4XJSA 1G0NA 3QWAA 3RFXA 4R54A 1LTHR 1IHYA 4L9RA 1KBZA 1NAHA 2XXBA 4NFYA 4A73A 4XZ3A 4MVJH 5DOZA 4YT5A 3C1TA 2YW9A 1WXDA 4XKJA 1YOVA 4WCFB 2DPGA 3CINA 1LNQA 3BTOA 2AQHA 1ZUD1 3UN1A 4FFNA 1WNTA 4J0EA 5FFFA 1BSVA 2DVMA 2VZ8A 4DPMA 1A71A 2OBNA 2QZZA 2ZATA 4FS3A 3ZU3A 5C5IA 3U62A 4IDCA 1SB9A 5JYDA 2Z95A 4DIBA 2HK9A 4P4GA 2O2SA 1SEPA 4A2CA 5TLSA 1X7GA 2I67A 3AY7A 8ADHA 3BHIA 1DB3A 4UUNA 3AUUA 5JLAA 3KV3O 5AXAA 5BSFA 1E5LA 5IZ4A 3RU9A 4GWKA 3MJTA 3ONDA 2ZTLA 3MWDB 2ZCUA 2EKLA 1H94A 4OSOA 2CDAA 3C7CB 4E5KA 4ZU3A 5H82A 4ALLA 3AM3A 3PQEA 1SB8A 4WJZA 4YRAA 4PLZA 4XYEA 3VTZA 4INAA 1S6YA 2FPGA 3ZWMA 3FSRA 5GZ3A 4Z3DA 3W1VA 4E5NA 5I7FA 1NPDA 1SPXA 1PL7A 1AN9A 2ZYAA 1MC5A 2YUTA 5JAMA 4DBVO 3PHHA 1CEQA 2P9CA 2DKNA 4N18A 5TGDA 3IUPA 4AVYA 3H5AA 1OC4A 4Q3NA 2GNAA 3H9QA 4ALMA 4J2HA 4XIJA 3OJFA 3LLVA 1NFRA 2PH5A 4KUEA 4R01A 4CL8A 5I7EA 6ADHA 2B4RO 1ZNQO 1EQUA 3WG9A 4DBZA 1MLDA 4RV9A 4PN3A 5CEJA 3SEFA 1YL6A 5T8KA 4LCEA 1UP4A 2OUIA 4PLPA 3FF4A 3EVTA 4ND1A 4B8WA 4DIOA 4NHEA 4FD3A 3S2FA 2HLPA 3WGQA 4K1LA 1H2BA 2BFAA 3JTMA 2YV3A 1EDZA 4CODB 3TF5A 1R12A 1ULSA 1WDKA 8LDHA 4GLOA 3HG7A 3RC7A 3GUYA 1O95A 1BW9B 3EHEA 3A9WA 2YJZA 4D7AA 3DBRB 4GGPA 4D3DA 1P1KA 4RQUA 5LDGA 3JQEA 3DR3A 3V2HA 3S1LA 2QX7A 1KC1A 1U8XX 1M6HA 2WD8A 4IGFA 3PEFA 4KDFA 4NDNE 1GU7A 4Y6SA 5JBIA 1EFKA 1Q7GA 1YL7A 3HFGA 2XAAA 2G5CA 1JQBA 4JBHA 1G6KA 1PJ3A 1BXKA 3L4SO 4ND5A 4ZJUA 1E5QA 1QR6A 2IODA 3OH8A 5ILGA 1J5PA 2A94A 3W8FA 1HDZA 5CDUA 4FDAA 2VT3A 3M6IA 4IDDA 4RPGA 1U5AA 2SCUA 1NTOA 2IEBA 4ALJA 4I9UA 4OXNA 4M49A 2JD1A 4H7PA 1SOVA 4CM4A 1I2ZA 1HE3A 2AW5A 4TZTA 1O94A 2QQ5A 1PJSA 2DM6A 4Y8VA 4ZD6A 1LUAA 4IJUA 5T6BA 4NI5A 2XPCA 1T26A 1BGVA 2QRLA 1ZK4A 4MO2A 2R2GA 4NBWA 1ENOA 3CMMA 2UUPA 4EJ0A 2BKAA 1PGOA 4JJGA 3GNQA 3D3WB 3OETA 2E4AA 1WAMA 1WMBA 1NBOA 4RVHA 4IIUA 4A5OA 4E31A 1MFPA 3V1YA 4CMKA 1GZ4A 2DLDA 3KYDA 3PGJA 4RQTA 3W4IA 1H9BA 2D1YA 2ZCVA 4HV4A 1E7QA 1BXGB 1H6BA 5T57A 2VYVA 2VHZA 4IMRA 3VKVA 4UUMA 4D44A 1N92A 2QHXA 3M2PA 4PCVA 3I23A 1JKIA 3ZI0A 3PDUA 1P1FA 3H4VA 2Q1UA 3OQBA 3HHPA 3L07A 5A3JA 1SZJG 1Z7BA 1XG5A 2NLOA 3PIIA 2CZCA 4M55A 4CMEA 1ISGA 4HXYA 1Q1NA 2D5AA 2VRCD 3GEMA 2YHIB 3QP9A 3QVSA 4R5MA 1IPEA 4BB6A 4NBUA 4AJPA 2DUUA 1LQTA 2EV9A 3DQPA 3NKLA 5JPIA 4BO7A 4CM7A 3GA0A 3WXBA 2BELA 3MJSA 1P45A 1QLJA 3NDIA 4ROSA 1QYXA 1W0CA 3NTOA 2ZB4A 3EZLA 4DRYA 4EZBA 3QRWA 2VQ3A 1U28A 4OO3A 4CMIA 1LDYA 1ZVMA 3EC7A 2WM3A 2WTBA 4YJFA 4H16A 3U5TA 3L9XA 5L45A 5DCYA 5L4LA 4GAEA 4R51A 3HNPA 4RL6A 2R6JA 2ET6A 4E2YA 2Q4BA 4L4SA 2XXJA 3H7AA 4GGOA 5C7OO 1P44A 2CUKA 5KJ6A 1I01A 1IY8A 2HUNA 1Y8RA 2PTGA 2VUSA 1ZEMA 1NX6A 3WBBA 4ALKA 1YBMA 2FP4A 2Y66A 1NFFA 1VL0A 2O7QA 5ES3A 5CDSA 5BSEA 1OZAA 1P77A 3WGZA 4AJHA 1YJ8A 3OJOA 2DPHA 1PL6A 2TMGA 2VYNA 1Y9EA 3KVOA 4Y9DA 3GG2A 2VNAA 4JQCA 3D4PA 2P5UA 1NPTO 5FI3A 1I5RA 4NJMB 1GL3A 4R41A 1YBVA 5KJFA 1LA2A 3NT5A 3LT0A 4W7HA 4E3ZA 4PLTA 2OZPA 4M87A 4MVJF 1VJ1A 3PQFA 5CDYA 2P9GA 3V8BA 2EGHA 3SC4A 4R5HA 4WKGA 4EEZA 1ZEJA 4UEKA 3ST7A 1U3UA 2Q2VA 4YEDA 3BMQB 4CR7A 3O9ZA 2EG9A 3B70A 4F45A 1BVUA 3PHJA 1I32A 1IOLA 3LSYA 3OEWA 4KDEA 1CRWG 3NJ8A 4QTZA 3I9KA 5C7IO 1E77A 2YQ4A 1ONPA 2POQX 4TRRA 2AG8A 1Y5RA 1CQJA 1XWFA 3GRPA 4Y6PA 1SMKA 1P33A 2RHCA 1ZSVA 5I8ZA 4YCAA 3I9OA 3ZW8A 1E3IA 4Q39A 5KKAA 4E33A 4TVBA 1WW8A 5G0VA 2IZ1A 4BKPA 2BGMA 1ML3A 1MG5A 4EGFA 5G4LA 4BO0A 1ZJZA 2NVWA 3Q9UA 3QHAA 5JXWA 1N7HA 4EDFA 3PWSA 5EESA 2G1UA 4UVDA 4PG5A 3GHHA 1ZKMA 3LT1A 3VPXA 2ZK7A 5JO9A 2Q49A 3GRKA 1WVGA 5G0WA 5CAEA 3G3EA 4ZA2A 1B15A 4R3NA 1GR0A 1QP8A 2IXAA 3MJVA 2FR1A 4JBIA 3HSKA 4PVDA 3BIOA 4OH1A 3Q3CA 5TJHA 3K9QO 2G82A 3R0IA 1T4DA 4BUCA 4NPCA 3BMCA 4TQGA 3ROPA 3WMXA 5M6DA 2VYND 1GYPA 3UICA 1IL0A 1J6UA 3CKYA 5DF1A 3D4OA 3D0OA 4CM5A 5TJ9A 1ULUA 2D0IA 4XDYA 3DBVO 2B69A 4QEDA 4MINA 4PLHA 1DBVO 4OMUA 1DLJA 1GQYA 4EITA 3DTTA 2OFPA 2OOSA 2VUTA 4MKXA 1KEUA 1WMAA 5EN4A 4BGIA 2WD7B 2AXQA 2GPTA 3BTSA 1PJCA 1EBUA 1ZSYA 3DZFA 4BQRA 4PG8A 2WSBA 3CE6A 2OP0A 4BO9A 1P1HA 3JD4A 3JQFA 5F1OA 5JDIA 2X9GA 1T25A 3COSA 3CZMA 1MP0A 2AE2A 3FI9A 4FSHA 4AJEA 2I5PO 2IXBA 3FPLA 4WK6A 4DQVA 5DNAA 3V1UA 2X5OA 5ICMA 2IEDA 4WCDA 1ADFA 1A72A 2GR9A 4CMAA 5L4NA 4DA9A 1Z75A 1WWKA 4PLFA 2QG4A 1UH5A 2CFCA 4PVCA 1O89A 4DREA 5KVVA 1IE3A 2JFFA 5JY6A 1HF3A 1D7OA 3NX4A 3VZSA 4Z0PA 4RJTA 4BNYA 1ONOA 4OHUA 4I1IA 4CM9A 2G0TA 4IS2A 1PWZA 2PKQP 3JQBC 2H1SA 2HU2A 2PZKA 2DBZA 4O6VA 4B8ZA 3LF1A 3ROQA 4XR9A 3H9EO 3H3FA 2Y05A 2JL1A 2JCVA 2DBRA 2EW8A 3JD3A 4P4LA 2P9EA 1PZFA 3FWZA 3K6JA 3U09A 3JYLA 3I6IA 5MGBA 2V6BA 4BGUA 1V9LA 5CP8A 2BFPA 4E2ZA 5A9RA 4OXYA 1RM3A 2QIOA 4BKUA 3RSHA 4QX6A 1E1LA 1EVIA 4CUZA 2J5KA 5C3MA 2WE8A 5GZ6A 1QSGA 2FR0A 5JCXA 1PQUA 3Q0EA 4KOAA 2J3JA 1P0FA 3DZGA 3E9MA 1Z45A 1I3LA 5A02A 3DBRA 3IOYA 1UDCA 2X23A 1WP4A 2X5JO 4HFMA 1LDGA 4XQ9A 3E82A 1YO6A 3NDJA 1LEHA 2X86A 4CV2A 4J6FA 4TZKA 4UEOA 2GN8A 3GUCA 2QRKA 4HADA 4CM8B 4NMHA 1BDMA 1JDJA 4ZQHA 1A4UA 1SEVA 4CMCA 2WEKA 1ZJYA 3OP4A 2DAPA 3BMOB 3IIEA 3OQ6A 3CSDA 3ZWWA 2UYYA 2P5YA 3INRA 2EW2A 3PYLA 2PGJA 3K30A 4KWHA 2GYYA 5DULA 3VZPA 5IZCC 2AEMA 3GC6A 3BXXA 2IE0A 3VH1A 1YH3A 4OXKA 2X8LA 1UXGA 1FDUA 1V3UA 1ENZA 4XYBA 3HE3A 3WX0A 4MVJI 4JP3A 5TRTA 3EGOA 3JQ8A 4P22A 4GX1A 1JKFA 2NADA 3DOJA 4GX2A 1EK6A 3RC1A 1MA0A 3JQ9A 4BB5A 3P19A 5A3VA 3WJAA 3DZBA 5KTKA 1WDMA 3OEYA 2J6IA 4HNGA 4UVIA 1FXSA 4GSKA 1BG6A 2FZWA 3DZHA 1XYGA 1FDVA 2E6UX 3VC7A 5T8KC 3NGXA 1QMGA 2GCGA 2YDXA 3JV7A 3WTCA 2NNLD 3QQPA 1BDBA 1YBAA 3KSUA 1X1EA 5IDQA 3UFXA 5AYVA 1C0LA 3R3SA 4M8SA 3F4LA 4R1NA 4FOOA 4J7CA 4WASA 1CIVA 3F4BA 1HDOA 1EFLA 2W8ZA 3JQFC 1HDCA 2FN7A 1ISHA 4OL9A 3LT4A 4JBGA 3I9JA 3S2GA 2ZB7A 1A7AA 1E6UA 2BLLA 3F46A 1IHXA 4MP6A 2B4TO 3NYWA 4D41A 1GQ2A 4B7CA 4GKBA 1HDGO 3ZWVA 4Q3AA 4J49A 4CUKA 4B3HA 3SXPA 1Y8QA 2PFGA 2GN6A 1P31A 3MJEA 4DLLA 3KLPX 5JYFA 4XRGA 1NNUA 1GEEA 3HB5X 1NASA 1MFZA 3VZQA 5L40A 3I9LA 4XIYA 2B5VA 4P38A 1T2DA 2Y67A 3I1JA 1T1RA 4IUYA 4JJIA 1UXHA 4IZHA 3JYNA 3OIFA 3IP1A 4AJLA 3H3JA 1IPFA 1LLCA 4KTVE 2FR8A 1XELA 3DHEA 4I9NA 1AE1A 1CWUA 1E92A 5BNFA 3Q9NA 4Q9NA 3MOIA 4I5FA 5JAZA 4CR8A 1LBEA 2WJPA 4EW6A 1F12A 1Y6JA 4IINA 4J1NA 3TFQA 4N54A 3T4EA 3TJRA 4D45A 1E7MA 4M1QA 2C07A 3L6DA 4HFJA 5HS6A 2P68A 3JD2A 3ANLA 3O8QB 3ZV6A 5ER6A 5TNXA 1LXCA 3AI2A 3WQQA 2V6FA 3JQAA 3ZWNA 5F21A 1I33A 3UCXA 1B16A 5HA5A 4RPJA 1PWXA 4BO1A 4D79A 1IULA 3IJRA 4QUKA 1ZMOA 3H2SA 2RCYA 1H2HA 1E6EA 1DC4A 1SC6A 4ITUA 3U49A 3WSVA 1NQOA 4DYVA 3PYMA 2O48X 3RFTA 1C0PA 5CFZA 3PLRA 5T5QA 3P5SA 4BHTA 2VN8A 3KSZO 2ZB3A 3JQ8B 4BNZA 5HTOA 2C82A 1DLIA 4MKZA 1JA9A 1HRDA 1PEDA 3CTMA 1PTJA 1UAYA 1X15A 1HYHA 1U2DA 3TL3A 4B7UA 3B6ZA 4FFLA 2VNSA 1GY8A 2O7SA 4MVJM 5G0TA 2R00A 3H8VA 3W4JA 3U4CA 2EXXA 4L4XA 4KQWA 4LMRA 4CM9D 5TT0A 2NQTA 1XLTA 1U9JA 2NSDA 4RVFA 1GFSA 1N9GB 1XA0A 2OMEA 4MVJG 2UAGA 3JQBA 1DHTA 1GZ3A 1XIVA 2X7HA 5G0SA 1FDSA 1RM0A 2O3TA 3GH3A 1DFIA 1GCOA 4FC7A 4JP2A 3VKUA 5KCZA 3GZNA 1DRUA 4TSKA 5ITVA 4RZIA 4CV1A 5KIAA 2YFQA 3ICCA 3QVWA 4CLXA 4O0LA 3IS3A 3RBVA 2HK7A 1B7GO 4UEJA 4I5EA 4OM8A 1X13A 3R6DA 4ND4A 4YVFA 1T1SA 9LDBA 5ILOA 4NG5A 4DYDA 3O26A 4BIIA 4IIVA 1E3SA 1QORA 4IJVA 3DXFA 4B4UA 3OM9A 4DQUA 2G17A 1YKFA 3H9JA 5BR7A 1R16A 1R6DA 3FNGA 4IY1A 1EMDA 2BD0A 3ORFA 1L1FA 4CLDA 5JDIC 2Y0EA 3AOEA 3E9NA 4GPD1 4ONEA 2VWQA 2NTNA 3VHRA 1N2SA 1GZ6A 3O8QA 1NVMB 4OJNA 4BNIA 4YXFA 2P4QA 1UDAA 1YE3A 5I8WA 4LRTB 3R3JA 1OOEA 4N5NA 4KTTE 4MOWA 4YRBA 4J4TA 1E7YA 3JQGB 1LSUA 1JWBB 3JD1A 4R4JA 3ROMA 3K5PA 4XQEA 2PKQO 1M76A 4D3FA 3RASA 3W6UA 1KS9A 3KHUA 4K28A 1TT5B 4BNKA 1K5HA 4YRDA 3RUFA 3WGYA 3ABIA 1B8PA 3FTPA 3VDQA 3GNTA 1SAYA 1PS9A 2J8ZA 1TLTA 3BTVA 2V6GA 2WMDA 5ICSA 3SLKA 1LDMA 3EY4A 1W73A 5IDYA 4A26A 3SJUA 3MEQA 4AJ1A 3OIDA 4TRMA 4Q3CA 3PRJA 3I83A 4TWRA 1GV1A 1I8TA 4MPDA 2A92A 4R1TA 3ZHXA 4AJNA 1HZZA 2X0IA 4LSMA 4DPLA 2GO1A 4CM6A 4E5PA 4F46A 3GDFA 3GAFA 4E2XA 1WLYA 3VPHA 2EKQA 2VTDA 2AHRA 4ZN6A 2F1KA 5EJ2A 5TIIA 4WOJA 3WYEA 3D3EA 5JS6A 3KUXA 1A9ZA 3HDQA 1GPDG 1D1TA 2DC1A 3MTJA 4YJGA 4JGBA 2VOEA 4K6CA 1KC3A 1B26A 3NUGA 1UR5A 3CIFA 3DAPA 1DFHA 2PNFA 4CMHA 3Q11A 4BNNA 3DWFA 2GD1O 4NFHA 3WR5A 4NK4A 4XQGA 3GPIA 3B1FA 2HQ1A 4R1UA 3VOSA 4CMGA 2H6EA 1HLDA 3OJLA 1E3JA 1PGJA 1RKXA 1K6JA 5J23A 3DMTC 1CF2O 3X2FA 1K0UA 2IZZA 4W9NC 2YHUA 3TZ6A 4QT0A 1JW9B 3PQDA 2VTEA 1ADGA 3BMQA 3JQ7A 4YAEA 3KM0A 4G81A 4AJ4A 4Z0TA 1EZ4A 1NR1A 2NTVA 4FPXA 4F6LA 4E5YA 3E5MA 3AM5A 2CMDA 4I08A 2AA3A 1HDRA 3AUAA 3Q1LA 3V1TC 5A1TA 3RCBA 3DB2A 1ADCA 3AOEC 3C85A 3L0DA 3ENKA 4EUFA 3A1NA 3I6QA 3PDJA 4FFPA 4OOFA 1F8FA 2CF6A 3WLFA 2E49A 3I5MA 4CLHA 2QW8A 1CDOA 3PPIA 2H9IA 4YPOA 4XRRA 1D4FA 1F0YA 3IUSA 3AY3A 3EYWA 4IM7A 3OQ1A 3U4DA 4CPDA 1LRLA 3EVNA 4LSWA 1V35A 3WSWA 1PZHA 2BRUA 1L7EA 5U4QA 3FHLA 1R4MA 3ITKA 2OHXA 3H6KA 1UZNA 1D3AA 4GH5A 1QXSA 3BHMA 1PQPA 3ZWCA 3GPDG 4NU5A 2HJRA 5EMHA 2HO5A 3TZCA 1YONA 3PWKA 1ZK0A 2RBEA 2O50A 3T7CA 2I66A 3BZUA 3CZRA 2JCYA 4Y67A 4Q3EA 3GZ4A 4FBGA 1KVRA 1W6UA 1X7DA 3I9NA 3Q2KA 3T4XA 1ZK1A 3WOHA 4OOEA 2UDPA 1FK8A 4OAQA 1KOLA 1LLQA 4CQMD 2HMSA 4B4OA 4DVJA 3MOGA 1HZJA 5IFLA 1AXGA 2DT5A 1B8UA 3RUDA 1LC0A 2CD9A 2NWQA 1EVJA 3GK3A 1PJLA 4CLOB 4W7IA 2PV7A 3AU8A 3ZNOA 1GTMA 5KVQA 5TSDA 3UHAA 3DC2A 1ZK2A 1GEGA 1QYVA 3FBTA 4XCVA 1Q2XA 1HETA 2X0JA 5JMPA 1F06A 5KOIA 1K6IA 4MDHA 1LSSA 1BXZA 2C29D 4RPHA 5DBFA 1LSOA 3WIEA 4OGWA 3FBGA 3G79A 1E1NA 1Y5MA 2VUUA 2Q3EA 3ZU4A 2VZ0A 4AG3A 2ZIZA 3U4IA 1U8FO 4MIYA 1E1MA 1IB6A 1MX3A 3GVPA 3OIGA 4TKLA 1HWYA 2B5WA 4J9VA 2NVUB 5HBRA 1RYEA 2GN9A 1E7WA 4LCJA 3RC9A 3PVZA 4NBRA 3KSDO 2Z5LA 4YJHA 4IDFA 5KVCA 3RKUA 3FR8A 3A06A 5THKA 5JW6A 4R9RA 3WDSA 1ONNA 2UV8A 5KJCA 2HRZA 2Y99A 2HCTA 5JE8A 2GDZA 2UVDA 4UREA 3TOZA 4AJ2A 4CMIB 4E5MA 2BI8A 5EERA 4H3VA 3RC2A 1QG6A 3JSAA 3N58A 4CUJA 4ZRNA 3MWEB 2ZB8A 3AUTA 5TS3A 3NT4A 4RDIA 2XF8A 2AQ8A 4AFNA 4N5MA 2IYOA 2I65A 1NHGA 4TVOA 2NU9A 2HMVA 1DIGA 4CJXA 2CVOA 4HKTA 3LDHA 3GZNB 3GHYA 5G2OA 3OF2A 1EBFA 3F9IA 3H5NA 4RVUA 2O3QA 5CG1A 3HFSA 2GZ2A 4ZHSA 2B0JA 5T67A 3H65A 5L95A 3JQAD 3ZV5A 2JAPA 4MJLA 2GF2A 5EL0A 2FY8A 3ASVA 4XX0A 2DBVO 3I3OA 3TQHA 4W4TA 1LLDA 3MJ4A 3DBLA 1IUKA 5I9MA 1DIBA 3GVXA 3WYBA 2VWPA 4K9DA 3JQ7B 3PP8A 3PZBA 1GD1O 4Z9XA 2NU8A 5JCJD 5KJ1A 4PFJA 4A27A 1ZIDA 1QKIA 4B4WA 2I99A 4XYMA 4I8XA 4YAIA 3BA1A 4KUHA 5DZSA 4BNJA 4O59O 4IDBA 4W6ZA 2YV1A 2JD0A 4D43A 4W99A 3DTYA 4J4BA 1T2CA 2Y1DA 2B36A 3KB6A 3B20A 2YQ5A 3WGTA 1DFGA 2O4CA 5F5NA 4BMSA 1JKJA 3ZCXA 1TT5A 2PD3A 5ENVA 4F3YA 1EK5A 2Q1WA 3RWBA 1MV8A 1RWBA 1R0KA 4OKIA 2C54A 5AQ1A 1LRKA 3HN7A 3L9WA 1N1GA 5IXYA 3OBBA 1J0XO 1H6CA 1QYDA 1V0JA 1U3VA 4XA8A 5I7VA 2HMTA 4L74A 3F5QA 1KERA 4L4RA 4NBTA 4PZCA 2D5CA 3GN2A 1A4IA 3TSCA 1NVTA 3DOOA 4DC0A 2CDCA 4BNGA 1PU2A 4YR9A 5K9ZA 1JTVA 1B8VA 1YB1A 2NM0A 2Y0DA 4WE3A 3RIHA 1DIHA 3TRIA 1K2WA 3K92A 3L4BC 4BKQA 3NTQA 5T73A 1MXHA 2JHGA 1J49A 4J3FA 1KY5A 3BYZA 3AI1A 3DBLB 2X0NA 3R1IA 4NQZA 4U7WA 3LU1A 4CQLA 3BMNA 4CL3A 3KYCA 2VHVA 4XJTA 3IC5A 2O2YA 1EUCA 3DEYX 1ISMA 4M86A 4W9NA 1VSVA 3PTZA 1ID1A
chains in the Genus database with same CATH superfamily
1D2MA 1YR1A 3DUWA 2Z3WA 2JAUA 2VKQA 3I2HA 3WL6A 2FXIA 3KKOA 1YFLA 1J8QA 2R1UA 3JZDA 1VSUA 5HRAA 3BMCB 2EBWA 2ETVA 1TYAE 3TOXA 3OT5A 1VE6A 2CNKA 1G2IA 1UJCA 3H9BA 3IALA 5TF4A 3CVVA 4ZO9A 4LF5B 2C5GA 4EVQA 1Y3DE 1YC2A 2H1CA 2PH3A 4JR0A 4M99A 4R83A 3UT6A 2EF0A 1JMKC 2FPUA 4U8GA 3ZJ4A 3CJRA 1UWVA 2IE8A 4L8LA 5AHKA 2ZU6A 2BGUA 3REOA 4DMKA 3LHIA 1EGMB 4NCAA 1QV9A 5IMSA 3FHTA 3MAJA 5EI5A 2GB4A 5JZMA 2J3MA 1BNCA 1N6NA 5KO2A 1C1XB 5EOVA 2ZJAA 3W8DA 4W9MC 1Z7GA 4XSHA 3RIMA 1BFKA 2FQWA 2HCFA 2WD9A 4P33A 3TG8A 5CHEA 4BNXA 2P0YA 4CQLB 2GVDC 2ZYGA 3SYNA 4C88A 2FMIA 1EDOA 3IXLA 3PFWO 1W76A 1Z2NX 5PGMA 4GOLD 1G20A 2XVAA 3ANNA 5D3ZA 4YMUA 5HJ5A 3C45A 1EQ2A 4LDZA 3OFSA 4ND6A 1ADJA 1E6WA 3KQWA 5BQ3A 5EWMA 5CRIA 2DHQA 3PFNA 3PNOA 3DT6A 4YONB 1VMKA 2AXEA 4TWJA 3A14A 5IX8A 1RSZA 1Y34E 3RVRA 4MGZR 1EFHA 4HGRA 3ZGYA 1QM5A 1EDDA 5KSWB 1JFSA 1QP7A 1CQXA 3NT2A 2FAXA 1AM4D 5EZ6B 1OH5A 5CEEA 2YJ3A 4B3SB 5JUWA 5DHPA 2J0QA 4B3DA 1RU3A 1C0IA 1X3LA 4BNTA 3ILYA 1KO1A 3TTTA 3UZUA 4ADSG 2EKDA 1H6DA 2NV6A 2XKJE 5CLFA 5DM1A 5E38A 1IAQA 3UHOA 1MQ8B 2ILTA 4X94A 1YULA 1UMBA 3IO3A 1IOVA 3SVZA 5LN1A 2HQBA 1YZHA 3UFBA 5EIOA 1EM8B 4H0NA 4EKIA 3AFGA 5CK5A 3BMOA 5CDGA 4DHWA 2PA3A 4R05A 4FMCF 4MARA 2PSJA 1QAMA 1L5GB 1VPVA 2B6NA 3KEOA 4N0PA 1VYTA 3AESB 2PIAA 2WFMA 3OEED 4IWYA 1AKRA 3HY6A 1GFIA 2BFWA 3TWOA 1HSOA 5KTYA 1IDN1 4OAOA 3CO0S 2PS1A 4HWOA 2NO4A 5FPSA 2HM7A 5HVNA 4MR8B 3S0JA 1NU8A 2ZJ7A 3RSOA 5K45A 2CN1A 4LX0A 4X71A 1IHOA 3DZIA 1I30A 3PEVA 2O2DA 4Y2QA 2J87A 3EBPA 3T3GA 3V8NA 4PRKA 5L7WA 2Y3IA 1NDQA 1C3JA 1GU0A 1JSRA 1M9NA 2HZBA 4FQ5A 4OQLA 4TTTS 4KKVA 5H59A 4KR6A 1SHTX 2PZMA 3GFBA 5AXCA 5ALHA 4BVJA 1K5DA 4O1HA 4HRVA 4X8LA 4Y6RA 2YXEA 5AKZA 7MDHA 1UZMA 3T5GA 2OYCA 1UKEA 4BO5A 1T15A 4JR1A 4DLTA 1V6SA 1W75A 2HN9A 5K0BA 2BFCB 4MUMA 2ZOSA 1FQWA 3F5SA 4WECA 5AI0A 5K8IA 2ZXUA 4GM4A 4DMMA 4P6VF 1L5VA 3OCVA 4IJ6A 1CDZA 3TGPA 2FUG1 2JIDA 1BC5A 3HRHA 4LOAA 3RJ9A 2P9YA 5JO0A 4REMA 4DZZA 3O8OA 3DKVA 4HPWA 5EHGA 3A1UA 5I3CA 3E9RA 5IUNC 3THSA 3MILA 5BN3A 2NT3A 4B81A 3DZJA 3AKYA 3QK7A 5IMBA 1PJTA 1MGPA 1QF7A 3RWOA 4BV9A 1PO7A 5AM3A 1E1RD 1KZGB 3Q72A 1Q7CA 2P9QA 2Z8XA 3LQYA 1D6JA 2Q4TA 4DJ5X 1L5MA 4EJMA 3MXTA 4XDHA 1IH8A 4R1OA 2G6TA 3H5WA 3OY7A 3FOZA 5TQVA 3H8JA 2LCQA 3RUEA 1H1LB 1RI5A 2KBEA 2KW5A 2RGEA 3C3XA 3KPUA 1MDBA 5J5AA 5HSGA 1LJUA 2HDHA 2GTPA 3W5IA 2ZBQA 4HH3C 3NBAA 3REQB 4Q15A 4XEUA 2MSKA 4HDNA 3SJBA 1B42A 3M5CA 4WOKA 3NTXA 3ND5A 4L73A 4XUCA 5TE9A 3T4PA 3UMCA 3AXTA 4AB1A 3Q8WA 3E6AA 2UYGA 1ACLA 3C7DB 3FR7A 3ZTTA 4US2R 3S2SA 4Z4EA 2O52A 4MRMA 4UTZA 4XCQA 1RAFA 1UJNA 1I0LA 2YC2C 3AB7A 1XZPA 2FOXA 3I2JA 4LV8B 3RVBA 3IKTA 1NBME 4J3JA 2C3PA 1HLFA 5AESA 4EG5A 1CUVA 3CTPA 4XLZA 1IOWA 4EP1A 7YASA 2VEDA 3RAFC 4AJOA 3A2MA 2ZTUA 3OTQA 3OFJA 2AOXA 2G83A 1HE4A 4RLSA 2ZJ4A 5TQ2B 1CUYA 4EA6A 1CUGA 1NW6A 2YUIA 3N8GA 1J8VA 2N1BA 1ARZA 2AEFA 1O5IA 2K87A 4NE9A 4J0DA 4RZHA 3RS7A 2DFPA 3X1XA 2CL7X 3ADBA 1RACA 5H9VA 1BHQ1 1O2DA 4KOEC 3RD5A 4WLVA 4WI1A 3L8YA 2A5FA 2LZ0A 2RK6A 3AQ4A 4LVUA 4F4UA 1SHJA 2XUZA 4OSPA 1U7WA 5CT6A 4E21A 3HJGA 4JBLA 4RD0A 1Z5PA 1FF9A 1PJAA 1VTKA 4UUAA 2OZEA 3EC2A 4F8YA 4PPNA 4CE6A 3NJ4A 2VP5A 5EPOA 2Y68A 1DCTA 3RTBA 4B47A 1BOFA 4WLEA 4HX5A 1XMOB 4ER3A 3P7MA 4Y3UA 3Q8LA 2IYWA 2RIPA 5ECWA 2NV0A 3DNPA 3AV0B 1D2AA 4O2AA 4MIEA 3OIVA 3DMFA 3QPCA 4R81A 3UMSA 3ZXIA 3N6VA 3OBIA 1F8XA 3ZV4A 5I3ZA 1IZYA 1GWNA 4M7PA 5FUQA 5FWYB 2BH2A 2HH9A 2LDXA 1XCMA 2CNWA 3LP8A 4JXJA 3K9GA 4YUZA 2YX1A 4Q48A 2HDOA 2BH9A 3E4DA 3N2EA 4D8TA 1U7UA 1I3MA 2G1JA 2QTMA 5JBNA 1QF6A 3I01A 5GJBA 1Y7TA 1R6VA 1XVIA 3CZQA 3KUKA 3O8RA 1R8JA 3KKKA 3OIYA 3UMVA 4R9VA 3BHNA 3WI7A 4LRSB 1NDHA 1PGPA 4IGKA 4AMGA 3B7GA 2BL4A 3NIGB 3WGOA 4FYJA 4GMXA 3RAGA 2XUOA 2WPDA 1TK9A 4K9PA 4KSCA 5AJXA 1ZSNA 2NXWA 3IHKA 5CDHA 3FNFA 3K16A 4LMPA 2ZSFA 1NL3A 2QA5A 1YRHA 2Z6UA 4K8OA 4KX5A 1JT9A 2O2EA 4IDEA 4WLUA 4B6GA 4JLOA 5AP9A 2AFIE 2HPAA 2HJ9A 5A0VA 2H1OA 1JBQA 4JUCA 1K4KA 1X8LA 5KINB 3GJ5A 3RUAA 1R15A 2CDNA 3MM4A 4K6FA 1N5LA 2FSGA 3O2SB 4PX2A 5KQPA 1EE9A 2HHJA 2PGAA 4X1OA 1MORA 3GVIA 2E1PA 4RD1A 5HS4A 2CHUA 4NC9A 3KTOA 3ETJA 3TEJA 3U3MA 4DV6B 3EDRA 3NAZA 2DXIA 1AQJA 1EWQA 1IC6A 3S40A 3PHLA 4C0BA 1DTWB 1NXPA 4G07A 4V0RA 1B2LA 5EGSA 2BF7A 1OMOA 3FCUB 3N5CA 2MSLA 4IEEA 4HDKB 4MYCA 1KFCB 5ICFA 2Z8ZA 1GU1A 3RRFA 1RADA 3EUAA 4ZOCA 1COZA 3CPSA 4MGIR 1J4AA 3SSAA 1FA9A 1RYFA 1E1KA 1AVTA 4RWZA 4ZQEA 2H8GA 4IUDS 2W93A 2PQ6A 5MFPA 3S8YA 3L84A 2I80A 5JTUA 3E2MA 4FM9A 3MF4A 4GC9A 1NSYA 2UYQA 4MV8A 3P94A 1V7CA 2J3DA 2CJWA 2Y0PA 3S28A 1X92A 2EX1A 4RHFA 2TS1A 5IZCA 1UUFA 3TV1A 1U9YA 2P9FA 2ZZMA 1IWOA 4FFOA 4PNEA 2CVFA 1YVDA 3ZWOA 4GLJA 4KXXA 2DH6A 2ODPA 2WILA 4BE7B 1O6ZA 3EB9A 2BFFB 2YYYA 1U2ZA 3JWIA 1QKKA 4O3MA 2QRJA 1LQUA 2JJYA 3FWYA 3AVTA 3RFVA 2JGFA 4R68A 2CNWD 1RJDA 1XROA 1CNFA 1DO8A 3PXDA 3G68A 2XCTB 4ZVMA 1T6YA 2BTQB 3PJFA 4QKQA 4FNOA 2E82A 3SSOA 4HAUA 4P7FA 5I7SA 1FRVA 5AICA 1IUPA 8OHMA 1LZLA 2D0OB 2C8KA 3DBHA 3OUZA 4NBVA 4QDOA 4YC7A 4QGFA 1QVZA 1ZNZA 4FBLA 4QUAA 1Z0SA 4ETIA 1DJNA 3ANSA 1WPXA 1PS0A 3CO5A 4JMLA 3RUHA 4JQSA 3NYIA 4ZEWA 5CGZA 1SXHA 2I2BA 3RVDA 2OESA 3ZE7A 2XCSB 3I9V6 1G8AA 4CIXA 1SBTA 1AXEA 5AVVA 2VHEA 4TYQA 1FEZA 2HK6A 3EISA 2X3FA 1Y81A 3DNMA 4DMGA 3DTVD 3G13A 3I8OA 4HDMA 2HY7A 2WM8A 2B37A 1KI6A 3BICA 2GA8A 3BCSA 1NQVA 1GTSA 4KRFA 2IZ6A 4QBTA 3V1LA 1NULA 4TYNA 3ND9A 5ITWA 2ZAIA 2BBTA 2Y1LA 3G9TA 1BWSA 2FV8A 1TNDA 2XTJA 4NIMA 1W1WA 5ALOA 4BAGA 3U7GA 1PEAA 3W6NA 2QG6A 3KOUA 4WNIA 3G8AA 3B3FA 5F51A 5B58C 1XUOA 1L7AA 3B8EA 2AX3A 5BQPA 4X7BA 5JHGB 3MFQA 4D8WA 4S1WA 5K8JB 5L53A 2A1UB 3N7TA 1AC5A 4XLTA 2DY1A 3K1TA 3SICE 1N33B 2PSEA 2EKPA 2JHCA 1P3Y1 3IEUA 3IIKA 4WINA 2I3AA 2BBOA 2H1LA 1L1EA 2Q6VA 3B13B 2A5LA 2ADMA 1DMSA 4OXRA 3TEMA 2DE0X 3TL6A 2Q2OA 3ZH2A 4DF3A 1IJEA 5EEGA 5ENDA 4B6PA 4J1QA 1X1RA 1E96A 3FPJA 4Q02A 4AJJA 1D09A 2DUJA 2C3YA 5FBZA 4JGGA 2YWGA 3W04A 3AY6A 4YFVA 5BWMA 4NV1A 5BT8A 2R1ZA 4ZJYA 1DXYA 4BQIA 4ZO8A 4JP1A 1JG6A 3GB9A 3EGWA 3NANA 4PLCA 2Y1EA 1YQTA 1FUKA 3I1IA 1E9EA 1EXVA 4CLOA 1OZHA 4XH9B 4TWIA 3UCEA 2I87A 3YASA 7GPBA 5F2NA 4LF6B 4UXHA 1OIWA 3EW7A 1NLMA 2Q22A 1V37A 2WD7A 4J7XA 3V48A 3VDRA 4BO2A 1M0WA 1RC1A 4WLFA 4EY6A 1KJYA 2OAGA 2J9YB 2P75A 2WU4A 4KBFA 4BV3A 1VQ1A 1SUEA 1YA6A 1N9KA 2FWRA 5HF8A 2PZLA 5EJFA 2WG2A 5D00A 1XL1A 3C5VA 2FSVA 3LCUA 5K0ZA 3UWPA 3Q6MA 4IVQA 4MV4A 4Y98A 4PSAA 2JI9A 2OCBA 2OTCA 1P0CA 2YNMD 3VPGA 4AUEA 1AJEA 3I9MA 2OGWA 1LC3A 1C3LA 3P9NA 4NZYA 3GGOA 3MUNA 3VRHA 1MQAA 2CDBA 5KWEA 4PSDA 4YS6A 3FVWA 3LK7A 4BEBA 5HBGA 2QX9A 3PRYA 2C5FA 3L7JA 4HNQA 2CJWB 4IIJB 3E3MA 1PR5A 3KKZA 3PWTA 4RPLA 4Y0NA 1YR6A 1C0KA 5AVRA 2ZJ0A 1M2NA 5BSRA 4RC9A 3I0ZA 3R7WB 1NQAO 3WLRA 3EXG1 2J5QA 5KQRA 4ZICA 1UZAA 1Y6ZA 1TW3A 2GILA 4CMBA 2V03A 3E9ZA 3L7DA 4UU0A 4YAGA 3P2YA 4AP9A 3QJ5A 3LGXA 1K3TA 4RPKA 4DUYB 2VSXA 1A9YA 1HY3A 1SR8A 2O0MA 3QVXA 2QMUA 2X58A 2NVUB 1Y1PA 4RD3A 4B0OA 4UNRA 5BW5A 1X7XA 3ORHA 1J2UA 1FX0B 5ALQA 3EXHA 3SC6A 2QYHA 4S35A 3DLIA 4RZXA 4II2A 1IRIA 3VDNB 3THWA 3I4FA 2G40A 3EN0A 1PT6A 4TUYF 3RSCA 3RAPR 1JHOA 1N9ZA 1PEYA 1OR8A 3LUDA 1IY0A 1UBOS 4E7OA 4QGBA 4N1AA 3J80A 1GYQA 2H29A 4N47A 5F2OA 1TKCA 1NVBA 3OO1A 4PFSA 1GPBA 3UOGA 2IHYA 2ZJ1A 3JALA 2QLTA 1JLSA 1AA9A 4NYIQ 4AICA 3W5DA 1NUTA 2E89A 2XJ4A 3GI1A 2UZ4A 1T0PA 2UUBB 3G49A 1GRQA 4CM3A 1KFKB 1XCLA 2Q45A 3PI7A 3OC6A 4JBXA 4Q4JB 1DWUA 2FX2A 2G4LA 1W88B 5LZ5A 1GQRA 3RYCB 1E2FA 3OO0A 2JLCA 2IYLD 3V6LA 3U16A 2XUGA 2VJMB 3CXRA 2AT1A 2Q5FA 3E8XA 1MIOB 4LN1A 4LXXA 1LGYA 3MTGA 4KLZA 4LZNA 4PS0A 1VM6A 3UYKA 3ZYCA 2P90A 5DB4A 4Z6KA 4A1OA 1A7UA 4L76A 5EJ7A 3SZOA 1E61A 2BJWA 2XWJI 3U60B 4YY3B 4OFXA 4U6QA 4D5GA 2M9MA 3KQSA 4V1CA 2GCNA 5ICEA 1F0NA 1GUFA 3EUFA 3LQ4A 5C7LO 1U7OA 2J30A 4EEXA 5JD5A 2OGSA 1CY8A 2IZ0A 3EXFA 3AIOA 3WTBA 4M0DA 4V0LA 1Y0BA 3D7LA 4U5QA 4XSGA 3RJTA 1VCIA 2P6MA 3DDCA 4I9GA 1JHRA 2JGEA 3EVFA 4OB6A 5U9CA 5BYKA 1DMRA 2W5UA 3DT9A 3R5KA 1FFDA 4ZOLA 4BQSA 2O54A 1M1NB 3J81k 4FFRA 1RVDA 1E5XA 4RWEA 3RS9A 3B1ZA 4G26A 1U5BA 4EUEA 4NDZA 5GM2A 1ZXBA 2HYIC 3O8LA 1NBMD 1NQTA 1Y8AA 4XARA 2WJZB 1G9TA 2PKRA 1X8XA 3OY2A 1WZEA 5KKNB 4Y1EA 2HHAA 4EKDA 3U26A 1QC5A 1AV6A 1TMYA 1RJ9A 1QK3A 1VFPA 2FG5A 1LDEA 4K9NA 5I4CA 3FSGD 3ONFA 4YBRA 3CVXA 3TSAA 2FVYA 1E0AA 1IXYA 3HUUA 5IJ9B 4O4HA 4PZYA 4ZVVA 2VYCA 2VZ9A 1T8WA 3TL2A 3I5UA 4R69A 2EEZA 4K6OA 5G1NA 4EMUA 2J3IA 3K96A 3QTTA 5EJAA 1PUJA 2UZ1B 1IG3A 4PGFA 1V1MB 1QE3A 1JHZA 2WFLA 2PDAA 3ERCA 2W43A 2HTEA 4JLAA 2RE8A 2J08A 1JI0A 1EE2A 4Q9KA 1BEZA 1BVRA 2Q0HA 4TTVA 3FCEA 3TG2A 3UAOA 1AMNA 3HYCA 1DOHA 4C89A 2ZVJA 5FORA 3EA5A 1NHWA 3L0IB 3HJNA 2CNLA 2XZDA 2NZ2A 1GV0A 4JASB 3PF8A 3SX0A 4R0VA 3ZJ5A 1TQ6A 2QTRA 4UZEA 1KP3A 3OQNA 3PHGA 1BMDA 1BVYF 3UJPA 1JENB 1WDTA 3MCVA 4DC1A 3NZEA 1SK8A 3GEIA 4V1CB 5LOVB 4CLEA 1ODJA 3TLZA 4M83A 4BS9A 3KLNA 1WXQA 4C3UA 1Z6PA 4RUKA 3V3TA 2NP7A 5KX5A 3OAAA 1L5HB 3MWEA 3QWHA 4JK3A 1IVNA 4ZVTA 3LC7O 4AZSA 1U0LA 3KUUA 2EU8A 3R8FA 3D6NB 3SR4A 2DR2A 5DLEA 3SD7A 1XTUA 3QSGA 5ELLA 5A7GA 1RZRA 1C3EA 5JANA 1T3TA 2WP0A 2FF7A 2FLVA 4TLDA 1JFLA 2Y8EA 1QJCA 2JBAB 3TX2A 2NT4A 2W4MA 2XMSA 1COWD 2CHGA 3WLIA 1UPCA 4AKIA 2JLYA 1M2FA 4FCWA 3QX3A 2GO7A 2CLFB 4DHEA 4L95C 1ZNWA 2LCIA 2JZCA 4RAOA 4JJ7A 5CDFE 1BCSB 4A7PA 5LDDC 4G63A 2JFQA 1ORWA 3KR2A 4MIOA 4DARA 2RKOA 4ENQA 1JEEA 4TXJA 1IQPA 2E4XA 4ZCRA 2I9PA 3W1WA 5DM0A 4M0UA 1XZQA 4LK2A 4DBLC 2OUKA 2WTAA 6AT1A 4R98A 3WKBA 2O2ZA 3LBHA 5HKKA 3TRFA 3HBLA 2QMHA 3HDTA 3FUVA 5EXXA 4L9SA 2CUNA 3FN4A 1PS8A 3DXYA 3O38A 4F4CA 4NDAA 2WM9B 3OPNA 2LV8A 1CXZA 4XQCA 1GT91 1UWCA 1L7BA 2I1WA 3FSGA 4BNFA 2JH9A 5K0TA 2PD6A 1GARA 4WCFC 3OLZA 4C4RA 4YRSA 2XA9A 4D8VA 5KOHA 2QNRA 2XDYA 3I34X 4WWHA 1NMSA 4S0XA 1AK9A 3MSCA 3GRVA 4FFSA 4D99A 4KVFA 3GDOA 4KN6A 4FW9A 3T7TA 1CERA 3LFHA 2X0DA 2B3TA 1XMIA 4CT0A 1NXQA 3V80A 1W1IA 2D54A 2H5EA 2QR2A 1ELOA 4NE7A 3TQFA 2BFOA 4BQOA 5KOJB 4F60A 2DQSA 5C8XA 1U80A 6GPBA 2BSQA 3S68A 4MLDA 2DEUA 3GZTB 1S4QA 4AX8A 3QLJA 5HTKA 1XJ0A 4NKRA 3KWJA 5AKGA 1B4DA 2OLEA 1T9AA 1UM8A 3H1BA 1Z16A 4NFLA 1N5DA 4EVSA 1X87A 2W2NA 1DG3A 4GSLA 5LJLA 5LMZA 2UXDB 4WESA 1D2EA 1NJ8A 4OQEA 1TD9A 5AOAA 1D7AA 5A04A 3QPVA 2YVKA 2IW1A 4I8IA 1OBCA 3KYCB 4J7UA 4CW7A 1Y8QB 2JGDA 3UF0A 2CB9A 1WY5A 1R4NB 4NXMB 2JBHA 5I9LA 1BROA 3HR7A 2FTKE 5EUCA 2CLCX 2VHQA 1VGVA 4UW9A 3ZPXA 2HAEA 2Z04A 3BFJA 3FMFA 2ZVQX 3MW8A 3INTA 3RS2A 4KSYA 1OB5A 1XJCA 5BUSA 5M34A 1Y5IA 4DV5B 1E89A 1UJMA 3WB2A 2LGJA 1DAKA 1JVBA 1WD5A 3NDRA 3TD6A 5BNIA 2AEEA 4INOA 4QQRA 3RS4A 2CYBA 2RHMA 1UDRA 2AG6A 4RJ2A 5F76A 4I4TA 5EP1A 1NKTA 2GHTA 2ZTHA 4MB2A 4U7FA 3B1KA 1M2HA 1ODIA 3MTBA 2IDKA 2KS6A 3ENZA 2GCIA 2Y1FA 4CKCB 5E1OA 3C5WP 3EAGA 4JI0B 3M1AA 5JI2E 2GZHA 1DT5A 1KAEA 1QO0D 1QRRA 1X0VA 3G9UA 2X5NA 4Q0MA 3D6AA 3SEZA 3I8SA 4AWAA 4EG0A 2NU7A 4Y0VA 4X20B 1H2WA 3BJMA 3GD5A 4YJ3A 1HLPA 5C9ZA 4MIKA 3V9AA 1N8NA 1SXIA 4I8DA 4IIYA 4EMBA 4HZGA 1WV1A 1DKQA 1KVSA 4G4IA 4PZAA 4WXMA 2ZT7A 3H42B 1M6VB 4OQXA 2GD0A 3ELBA 2D2IA 1C1YA 4OHPA 2ZRNA 3GEDA 3OSZA 1RKQA 5AW3A 3JAMA 3GL9A 2EBFX 4GPIB 3V2GA 3WNVA 4QAJA 5LFAA 4ARIA 3U39A 2OCAA 1YQ9A 2GUGA 2QDKA 3M33A 4NU8X 4P3XA 2GXQA 2EAUA 2PWZA 4Z1MA 4YCLA 5LCXA 2J0UB 2OVBA 4DWVA 2AS0A 3TLYA 4KQIA 4U9HS 1E9VA 1JIVA 3ET4A 3THOA 4KPGA 4QREA 4MNTA 4Q37A 4RH3A 1CQIA 3WGMA 3QXGA 1YAHA 1VI6A 4FEYA 3GH1A 3DONA 1F17A 5ISMA 4M1KA 4EKEA 2UYHA 1MRZA 1SXJA 2IF0A 4GUDA 2SHKA 3ZXUB 1B76A 1UK9A 2AJTA 2WU1A 3BIXA 1SUCA 2HWUA 3CE9A 1FMCA 3PUHA 4AF6A 1BS2A 2Q8PA 2J3KA 2TSYB 2HCJB 3IDQA 4HL6A 4AP6A 5HM8A 2IXDA 3SZ3A 3BWDD 3GLQA 3LOPA 3PQ5A 4G1CA 1TVEA 1XN4A 1ZUIA 2NSHA 2VK8A 2REOA 3ICWA 2FZ5A 2A4KA 3PJDA 1IN8A 4HNHA 4RTJA 3E48A 2AQKA 3H5RA 3P2IA 4R8SA 4FMBB 1BH6A 2C03A 4L4UA 1RPNA 3D81A 2REXB 3UKOA 2HMWA 4JP5A 1PZGA 4ILEA 2VHCA 2ZS8A 3EVBA 5KDOA 1DJMA 3MJHA 2G06A 3QXJA 5CTJA 1SCBA 5HR5A 4GPBA 1BXGA 4RFVA 2DSNA 4EARA 2KJQA 3RRMA 5FBWB 5REQB 3BB3A 2JZOA 4QOFA 1YFZA 1KSHA 1T9KA 2FE1A 3DE7X 5DBGA 5CG2A 3TSYA 2IYTA 4A8JC 4DSZA 4M22A 1A76A 4GVLA 5H3HA 2PG3A 4D4MA 4JHLA 1QIFA 3VYWA 3OMLA 1UEXC 1Q3KA 4UXJA 1KU0A 4YJKA 3H1FA 4M60A 4X65B 1RAHA 1YACA 4DLBA 1FVFA 1UBUS 1M6VA 3VH4A 4CCYA 2Q0QA 4MRNA 3FUUA 1TZKA 1GITA 2OR3A 3G9XA 4FGWA 4XB1A 3ANTA 1KH3A 2QJOA 4Z53A 2OQ2A 2P4HX 3KZVA 4IX1A 5CFMA 3MGAA 5JQGB 5D3MA 4GI2A 4YV7A 1DP4A 1B2RA 3L4JA 3Q4GA 1MB0A 1RRVA 4X20A 5AVWA 1BWRA 4HXFB 4EUHA 2BTEA 2BEVA 3CWCA 4NF2A 4ZCPA 1B6GA 2BFNA 5CLQA 5IN5A 3RV3A 4DM3A 4ZYVA 1F2UB 4MGHA 3W9YA 2B3DA 4UBIA 1FP4B 1EI9A 5BSVA 1SVOA 5AKIA 4UQOA 4JYMA 4QFDA 3M1LA 3UVEA 4QECA 1U9IC 2BPOA 3AV3A 4W8OA 4JKYA 4EPYA 1JR2A 5BSHA 2P27A 2QLBA 3PGVA 4R2MA 3S4YA 5C8VA 1MH9A 3OIWA 5EP3A 3ZCQA 2VRCA 3GGJA 3CNEA 5IK2A 3NVKI 4RF4A 1W2GA 5EMJA 3MCWA 3AUYA 4FFWA 9GPBA 5JAIA 4EI7A 3H3XA 1VJ0A 2C2YA 2EWVA 2HHCA 1N2JA 2Q46A 3PFGA 2J7PA 1AF4A 4A23A 4EJ6A 2EWMA 2BR5A 5GIOE 4B84A 5DVZA 2Y92A 1ZD4A 1FJXA 1NI4A 1AX9A 5E1DA 3OLWA 4URZR 4YCJA 1UP6A 2C8LA 2I0FA 2ZPTX 1E1QD 2CE2X 1ULHA 4DAEA 1UQTA 4DLRA 4UNQA 5K3FA 2AI1A 3KVVA 1ODFA 1Z5GA 4QSHA 4TKVA 2BHSA 2J48A 3MJCA 3SLGA 3ZV3A 2RGRA 5AHRA 1I36A 2H2FA 4KHZA 1SKAA 4ETWA 3DHYA 1AHHA 3B9BA 4P2BA 3KB8A 3S2EA 3CGWA 3GDGA 4IMIB 1L9KA 1Q7RA 3IXQA 3M6VA 4JQYA 4BBPA 5L3SB 1LV7A 2GYUA 1EVZA 1NC3A 5BV8A 1JGTA 3TZHA 1PE0A 1I10A 1W0KA 3A1FA 1ZLYA 2ORIA 4KX3A 3ACDA 4UCFA 1CS4C 3I45A 3ZHYA 1KOFA 3T0GA 1VKZA 1L4NA 4AC9A 1GTJ1 2CE7A 1JJFA 1HDEA 3FPKA 1XLUA 1RCTE 3AW9A 3IO5A 4WKNA 2ZRKA 3EZ9A 1NVGA 3BK7A 2CEAA 2PM8A 1KYQA 1XDWA 5TVKA 2OORA 5CFNA 1CULC 1J2EA 1L8XA 3VZDA 1FTQA 1XQ9A 3UG7A 2OAP1 3JQCA 4UTXA 3ETCA 1VKOA 3PLNA 1CW2B 3ICPA 1L0BA 4UMFA 2D7JA 1OI7A 4JOSA 1MJHA 3OJ0A 3GEPA 3TDKA 3VTAA 1XKQA 2FZ4A 3ETNA 3R76A 2BHTA 4YV0A 1U0FA 4MR7B 2YDYA 3LQQA 3W7VA 2QMQA 2JF0A 1NSTA 1H9CA 4N5LA 1XN1A 2LDBA 2GCOA 1EFPB 4GLLA 3W3AH 5B1YA 2NUPB 1CJCA 2WSMA 3OX1A 1EUZA 3VYSB 4U0JA 4I50A 4JKOA 3E7XA 3C6ZA 4EJSC 2BGIA 3L43A 1SQSA 2O19A 4F2PA 3C3AA 1AHIA 1M10A 3KB1A 4RVNA 5K3EA 2JHPA 4IQ0A 3P9ZA 3QEKA 4MUXA 1UBLS 1QOZA 1LWNA 4Y9UA 5BURA 1F2UA 3KZKA 1PR1A 4YUXA 4PV7A 4GMHA 4ILKA 4Q82A 4U0KA 1A98A 4DM7A 1VE9A 1SXJD 2VRBA 4JR2A 4MUAA 4XOIA 4I4IA 1Z26A 2JD2A 4BPBA 5D3MB 1EUDA 1KIFA 3H5VA 1WVMA 3HZZA 4F1WA 1ODCA 4MW5A 2BR3A 1CYDA 4URWR 1FC0A 2JFOA 3GVHA 2DU8A 5KYVA 4F5EA 5BV0A 5I45A 2ZKLA 1XNRB 3QG1A 4YB8A 4EA9A 1SVUA 4NPAA 3V3KA 3DXXA 1GPKA 4K5QA 5KMGA 1ZD2P 1U9ZA 2WJAA 4RHXA 4OD0A 1KEWA 2GWHA 1P6QA 4QO7A 1N1EA 3GLUA 4RGQA 3OA0A 2JFHA 5GVRA 1AUPA 3MTQA 2M98A 2YC4C 3CJQA 2V1XA 3VPFA 3L7CA 1JG2A 1I2CA 2QU7A 2C1XA 1ISSA 3P0RA 1GTRA 1Q2UA 2AYZA 4EHIA 4XDZA 5EG5A 2BGRA 3ECAA 1VLMA 2B20A 4LVCA 2ZJ2A 4HDRA 2ATEA 1KQFA 3FYTA 4CNQA 1O5OA 4XJSA 2B4AA 4BAUA 1D2GA 1G0NA 4PX5A 2CXRA 3EGXB 1RLTA 4JI6B 3WWCA 1E63A 2REQA 1KAGA 1VDZA 3OOJA 3RHFA 5HIKA 2RHDA 4A73A 2D1RA 2E4ZA 5DYIA 2A9RA 2IOFK 1R6TA 4HHEA 5DOZA 4UNSA 2TRSB 5HFNA 4FILA 1HMPA 3IP8A 4NRDA 2YW9A 3VQTA 1YOVA 4O8CA 3IIMA 4YP7A 3I04A 4FFNA 1WNTA 4CEJA 1QIGA 3L7IA 2HA3A 3CUVA 1A8UA 4HMOA 4X63A 1KQ3A 2QQGA 5LPNA 3BQ9A 5JCPA 3SHWA 4FS3A 1ATZA 2FXVA 4IDCA 4PONA 1L3BA 1YSCA 2GTIA 1KAOA 4AZTA 5CAEB 1EM8A 4JP8A 2B0CA 3ZD9A 1Z6TA 3ZTWA 3BBLA 3FVRA 4H6WA 1YC5A 2C78A 1M1NA 1NMEA 3NAMA 1ZHOA 2I67A 4TQ9A 5KYUB 2IYAA 4IH1A 4P31A 1RAAA 3AUUA 4UUNA 5JLAA 3KV3O 3WYDA 2WJHA 1J1ZA 2YL2A 1TECE 5IZ4A 1Z5VA 3RR2A 2EATA 1Z88A 2ZTLA 4AK1A 5ABPA 4ZI7F 4F2HA 2ZCUA 1THTA 1ZOLA 1OI3A 1TM3E 1XA4A 4P34A 4U2EA 5JNRA 4OSOA 5HE9A 3EXFB 3H2HA 1II0A 3CH7A 3PICA 4NYMQ 4X8OA 5KNBD 4HXEB 1Z17A 4LMBA 4BMYA 4GL2A 2O8DA 5C80A 1GNLA 4MKIA 4LDNA 4BVLA 5J2TB 3VPAA 1IWPB 2CMKA 2VP6A 1D6NA 1NVVQ 4INAA 2FPGA 1TJPB 2VJDA 3H1AA 4DM4A 4Y9TA 3W1VA 1IM5A 3QVUA 4YJ3B 4X61A 2ZREA 4NWIA 4UFPA 5I7FA 1E6MA 1EESA 3RHTA 3DZCA 5FULA 1QOPB 1SELA 3BKXA 3FDIA 1PL7A 3A4TA 2ZYAA 1RJEA 2YUTA 3E22B 1IN6A 3LS2A 1Z34A 2YYZA 5JAMA 4HC4A 2P9CA 3W3AA 2NZ8A 4N18A 3HNRA 4AVYA 1X80A 1VL5A 1CEEA 1KI6B 1VHLA 4LTNA 1R5JA 2JRLA 1DCMA 1OXBB 2PZ8A 2PH5A 5F7JA 4CL8A 5I7EA 3R7FA 2VDVE 3CUYA 3NIDB 1ZNQO 6ADHA 3I61A 1TAGA 4DBZA 3UWKA 1M2JA 1KMIY 5EHIA 3K6RA 3WRYC 4PLPA 1JXMA 1ZDMA 2A33A 1QQ6A 3FF4A 4ND1A 4B8WA 2WQ7A 4H59A 4JB8A 4FD3A 4X7MA 1DJLA 1PNQA 1RWXA 2Q5EA 5J43A 3WGQA 2JEYA 1PFQA 4AULA 4MO9A 4ARCA 3FPEA 1EDZA 2P0AA 5C0OE 1R12A 1ULSA 3CEJA 4MUYA 3IUEA 1RR6A 1E5DA 8LDHA 4GLOA 2V3CC 2HW8A 3HG7A 2A8YA 2J9FA 1QONA 4GVPA 3BXPA 4XI9A 4OQ4A 1USIA 3A6ZA 3I2IA 5LB2A 3ZV7A 3RHSA 2WHEA 2O14A 1UJ2A 5LDGA 3JQEA 2NU9B 4BJ5A 1JQKA 3THYA 3V2HA 1AF7A 3RVJA 3RT1A 3S1LA 1GN9A 3OZIA 1M6HA 5FPYA 2OM2A 2Q0SA 5AKXA 4P5EA 3U40A 1P5JA 1GU7A 2CXQA 3FPFA 1EFKA 3NIWA 5SICE 5JBIA 1Q7GA 1YL7A 2FG7C 2C2OA 2YICA 3PCRB 2XB2A 5FJJA 1TQ8A 5F73A 5JVDB 3SYLA 1PJ3A 2JLWA 4ND5A 4EAQA 3HVRA 1QR2A 2GJ8A 2IODA 1J5PA 4IW3B 2VSFA 3I6YA 5JAOA 4LZJA 2VT3A 4QDKA 2EFJA 1TGVA 3AF0A 4K6KA 5EZSA 5BW4A 1U5AA 4LYHA 3ANXA 4FN5A 1HM5A 2HNKA 4KAXA 2OB2A 3H2JA 4G24A 2HA4A 1DI0A 4I9UA 4O89A 3P2JA 4H7PA 2R5FA 5BYAA 1SOVA 4S04A 1I2ZA 2IYXA 2OGTA 4AD8A 1Z0IA 4HX9A 3D7KA 4IWNA 2QQ5A 3CCBA 3TLCA 4BTEA 4U7PB 4UEQA 1P18A 1B6RA 3D0RA 1CX9B 2QAGC 2SECE 3GUUA 4QUDA 4L07A 4EFLA 2BISA 5ICCA 2Q3FA 1MPXA 4XD7A 5LVAA 1NURA 4H0CA 5LU9A 3OZTA 3ZX5A 1P91A 1T26A 4C6TB 1ZK4A 4DT1B 2FQXA 5FO1A 4FOPA 2D0PB 3QE2A 3EDCA 5KU7A 3HYRA 3QW4B 3UQZA 3TDNA 3WK4A 1P80A 4FEGA 5F9MA 5DK4A 3BK2A 3UK1A 4YMTA 2PUGA 2BKAA 1PGOA 2CJPA 4LF8B 3OETA 2E4AA 3P45A 3KAQA 3FNQA 3ESAA 3HKEB 5K6TA 2DHDA 1NBOA 2GJKA 4RVHA 1F60A 4IIUA 3TUIC 2Y1KA 4E31A 3V1YA 3LK6A 4IIJF 1FSGA 1FS4A 5B1DA 3VM6A 3W4IA 3SS8A 1PQYA 5HYVA 2AF3C 1GNRA 1XAIA 4G56A 1Y1SA 3RYIA 1H6BA 5T57A 3VR4D 2VYVA 4IMRA 1COWA 2PX2A 4D44A 1ZVJA 1VSQA 2ZBRA 1O0CA 3T15A 4I5IA 3T1NA 2QL6A 3HBMA 3Q7PA 3M2PA 2Y2UA 3OZWA 3B36A 1T3LA 1T91A 3QXSA 2E6KA 4Z4QA 1I7SB 2WMNB 4R2JA 3SZUA 1E2EA 3PDUA 1E9FA 4EUSA 3KLBA 5MHTA 3H4VA 3AL3A 4GOJA 1XDUA 3OQBA 5ES4B 1AD2A 1TUIA 3AHCA 3CXUA 5JEDA 2CZCA 4M55A 3TAXA 1A2KC 1EG2A 4V1CI 2FW0A 4HXYA 1UOEA 3UAXA 3THXB 1CB0A 1L4LA 1V43A 4NYJR 4ZDKA 1TUEA 2YHIB 1GLGA 1ZU5A 1E98A 3QVSA 1REQA 2VJOA 1U3DA 3EW9A 3QP9A 4IP0A 4NBUA 4PYNA 3DOUA 4BB6A 4CF4A 4CM7A 1J8MF 1KHHA 4BU0A 3EF3A 2XYHA 3F73A 2BELA 3KQTA 3MT9A 1O0BA 2L42A 4MA5A 1UBKS 4ITVA 3A1SA 4CEIA 4NOLA 3TNFA 1W0CA 4ER5A 1W25A 3GO4A 3QY0A 4GQIA 2HLDA 3WLQA 1WZCA 4N6GA 4YV2A 2JJMA 1N3LA 3RFCA 4DRYA 2OLKA 2SCUB 2VQ3A 3RVLA 5ADWA 3V4OA 3EC7A 2WM3A 4FWIB 4YJFA 3AVWA 1RJ9B 4NABA 3T3IA 3ZYZA 1C0EA 1WHTB 4KN9S 5L4LA 5KDDA 5KYYA 3P0IA 1YS1X 4R51A 3HNPA 3REFA 3WLNA 3ZIAD 3CISA 2AUNA 3U31A 4DMUB 4E2YA 4GPTA 5IULC 4DIDA 2AB0A 2XDQB 1JEJA 2FPGB 3NHZA 4Q47A 4B48A 4YX9A 2XXJA 1PWHA 4COOA 5C7OO 2WZQA 1P44A 2CUKA 4MPRA 1I01A 4UXIA 5DISB 3ZQ4A 1ZRNA 3M3PA 1IY8A 1Y8RA 4RZ3A 4ARZA 1W36D 3BD9A 3WAGA 2VUSA 2ABWA 3OU6A 2FP4A 2PWBA 3HBJA 1SU8A 2Y66A 1VL0A 2O7QA 5ES3A 1U02A 1FNDA 2R3SA 2GBGA 1EPUA 1QZ3A 1GG2A 4D3YA 5JASA 3P1JA 1MENA 2WJWA 4MAMA 4AG6A 1YJ8A 3QKRA 1BMTA 1OFVA 3ZH9B 1VJ5A 1JF8A 2PZAA 5FLXA 4TQAA 3TI9A 2ASVA 2CHFA 3GG2A 3CB2A 2W6JD 3ZK9A 2P5UA 3G23A 1WQ3A 3EXEB 1MIHA 1TUGA 2BCJQ 2H4YA 3OT4A 1SCAA 4R41A 3PUIA 5TMDA 4Z49A 3NHRA 4W7HA 1I94B 1OD6A 2LKDA 4PLTA 2H4FA 2OZPA 4OHVA 4Q5IA 3RGGA 4BX0A 5I6DA 1PCXA 1VJ1A 4HUQB 3NCTA 4XPIA 3W1EA 4C0AC 4D6PA 3CPHA 3SC4A 4R5HA 1VE7A 1K86A 4BLQA 3RK0A 3A6JA 2FRXA 3F98A 4IIHA 3RO7A 3S5UA 5C18A 1ZEJA 3L02A 4I7EA 5MN5A 4YJ2A 2ZE8A 3IRVA 2CJFA 4GOND 1ECFA