1DSWA

The solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGKIGKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a monomeric, reduced form of human copper,zinc superoxide dismutase bearing the same charge as the native protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE (CU-ZN)
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1dswA00
1E9OB 2VR7A 2ZKWA 3L9YA 3PU7A 4BD4A 3LTVA 1OEZW 1SPDA 1AZVA 2R27A 1Z9PA 2WYZA 2APSA 5CU9A 2NNXA 1BZOA 1E9QA 4BCZA 2Z7UA 4A7VA 3HOGA 1F1DA 4A7TA 1QUPA 2XJLA 1F1AA 1ESOA 1Z9NA 2C9VA 1YSOA 5KBLA 1KMGA 1CB4A 3KM1A 2Q2LA 2JLPA 3MKGA 2AQSA 1B4LA 1SXSA 2WWOA 3GQFA 1IBDA 3ECVA 2WKOF 4N3UA 1SRDA 2AQNA 1PU0A 1CBJA 4L05A 1N18A 1SOSA 3ECWA 3GTTA 1YAZA 3GTVA 2LU5A 3GZPA 4B3EA 1XTLA 4FF9A 4A7QA 2AQQA 4MCMA 1F1GA 2E47A 1RK7A 3RE0A 1PTZA 1OZUA 1L3NA 1IBHA 3SODB 3H2QA 1EJ8A 1SDAB 2Z7ZA 1JK9A 2WZ0A 1HL4A 1Q0EA 3CQQA 2K4WA 1B4TA 1YAIA 3GZQA 3HW7A 1SXAA 2GBVA 3F7KA 1U3NA 5KBKA 1FUNA 1E9OA 3GZOA 4A7GF 1TO4A 4MCNA 1SXCA 1IB5A 4N3TA 1SXZA 2WKOA 2AQPA 2V0AA 3ECUA 1SDYA 1UXMA 3KBEA 5KBMA 1DSWA 2ZKXA 1E9QB 1OAJA 3T5WA 1COBA 3CE1A 2SODB 1TO5A 3K91A 2E46A 2C9UA 2GBUA 1XSOA 4A7UA 1OALA 3KH4A 2WZ5A 2AQTA 3QQDB 3S0PA 1IBFA 1BA9A 3MNDA 2WZ6A 1JCVA 2Z7YA 3KBFA 4BCYA 1SXNA 4U4IA 1F18A 1IBBA 2JCWA 2C9SA 2GBTA 3F7LA 4OH2A 1EQWA 1UXLA 3L9EA 1S4IA 2VR8A 4A7SA 1E9PA 1OZTG 2AQRA 2Z7WA 4A7GA 2WYTA 3QQDA 2WWNA 1DO5A 1XTMA 1MFMA 2AF2A 1SXBA 1HL5A 3CQPA 2AEOA 1E9PB 1PZSA 1P1VA 3HFFA 2XJKA 1JK9B 3KH3A 3KM2A 1N19A 4OJAA 3H2PA 2ZOWA 2ZKYA 2VR6A
chains in the Genus database with same CATH superfamily
2VLJA 2DQEL 1R5WB 4CW1A 1JERA 5EOCL 1BFTA 2GTWA 4OCXH 2NOYA 1INDL 1CDHA 3L95B 5JW3H 1NOLA 2HLAB 4ZMOA 4RISH 3MN8A 5BO1H 1TDQA 3BUYA 4PR5A 3LKPB 3EGXA 3GK8H 2DH2A 3BLKA 4W6XB 1PY0A 4WK0B 3TU6A 4AQZA 5D96B 3N0AA 1NMAL 4MNQE 1VZGA 4KRNA 2FJHB 3GBDA 3HZKB 1A64A 3HE7D 4OFQA 1CZ8H 4BK5A 3ZSSA 4P23A 2QV2A 5LGJB 5EORH 3V9FA 5AD0A 5LG1A 1WUNT 3B9KD 2J20A 3VSQA 1JAEA 1MJUH 4J4PC 3ZDYE 4PRPB 2XICA 3FSWA 2EKJA 1J0IA 1RXLA 3FUEA 1MI5A 2OTPA 2APWA 2OP4H 3KGTA 2CCVA 2VDMH 4UM8B 4DPBX 4JDEB 2VM3A 1OV8A 3G04A 5I19H 2CPUA 4PCSA 2X5PA 5GZNA 4Q6IB 1HL4A 5EZPA 2IH1B 3GS7A 5I1HL 4ZW5A 1ID2A 3C87A 3QP3A 5A2CA 5I73B 3HG4A 2YQGA 3H42H 3LV3B 4PGBB 3GZOA 4NNXA 2DQGH 3TZVB 1DJYA 2BX5A 5SV3A 1NGQH 5CLTA 4Q58C 1J8SA 5CZXC 3JV6B 3AS2A 5E7BA 4YE0A 1XGTA 1S5IH 3MI6A 1SF3A 3ULVE 1HSAA 4FQPA 1F6AA 4K7PH 4B95C 1COBA 1H8NA 4CMMA 4AGPA 3HNTL 2XZQH 3IDJB 1SOKA 5C86A 1GVIA 2E7CA 3ARGC 1JHLL 3ZIMA 1P2CB 4NQCA 4X5WA 1ASOA 3KBFA 3QZLA 4XTRD 4PJGA 3CDZA 3W0WB 1WS7A 1CXKA 4MKTA 2K0RA 3FRUB 4UTBL 4HISA 1NKOA 1AMXA 4YR6A 3G6JE 5I1IL 3HG1D 1U93B 2P8PB 3R0NA 3FBKA 4DO6A 1UZ8B 2HT2C 4IMKC 3S3BB 1R3KB 1X7TA 4GBXB 3WAJA 5T33H 1JZGA 4WFHE 1QFHA 3EW3B 5DR5H 3WBDA 5BV7B 1YMMD 1OGAA 2O4EA 3IXTA 3NSCA 2G3NA 3NT0A 4FKKA 3KH3A 4JFYA 3ESNA 1SJXA 4KQ3H 2NQ3A 5KSBE 2EC9U 3VXMB 5JXAL 1XBRA 1WWWX 5F7EL 3QORC 2O6CA 4NZDA 4QXTA 2EIJB 4ZUUA 3VFTA 3JT0A 2NY1B 5CN3A 3ZHNA 5DZNA 4U3SB 4JM2C 3OX8B 2YFNA 3RPKA 3FONA 2RCSL 4JQIL 2DIJA 1JVOA 5E1AA 4C4KT 3OKKB 4JDVA 1B6UA 2AMUA 5DHDA 4LVNB 1DSFH 3OJVC 4DCQA 4HXBL 4GSUA 2B1HL 2Z35A 3BLPX 3CDZB 2JLPA 5HGHB 2VMJA 4ZFGL 5C08E 2P43B 4C57C 5C0IB 3V8CA 1G6VK 4L29A 1Q72H 4S1DC 5IB1A 2EDQA 3X3GH 4O4YL 5EPMA 4A6YH 4A2MA 1A7OH 5JXED 4LPVA 4F15B 3E1F1 1UZ6E 2ED6A 4W81A 2YWZA 4QIRA 3V5HB 5D8JH 1JL8A 1ZK9A 4QHLA 5IOKA 5EC1B 2P46B 5D1QB 3QH3A 4QOKB 3ARYA 3O6KH 3TA4D 1J8KA 3BFWA 1CXLA 1XGUA 1P84J 5AOLA 2KH2B 1RUKH 3AZUA 5IFAL 4JKMA 1FNAA 1HDMB 1RZJH 2WHVA 2WLLA 2IOOA 3HB3C 4G6KL 5C0AB 4GG6F 3IU3B 3S5LB 4WUUD 1QLFB 2GW5A 5F0JB 5D72L 1VADA 3STZA 2OZ4A 1VESA 1A22B 4MD4B 3BWUC 4ZOBA 5D2NA 3TBVB 4JO3H 4WY7H 2F8IA 3O4LE 2C1PB 3VWKB 5IUSA 3G6JF 4EI5D 1OAUL 3VVVA 2W92A 1AHWA 2R4SL 2QGCA 4LP5A 2NXZC 2DQDL 4S2SA 5D1ZD 1UD6A 3MV9E 2K4AA 1OAXL 5F1KC 5KVEL 1M7XA 4AX3A 4L2YA 4DZBB 5E8DH 1N2RB 2PYEA 3VXUA 2GSGA 1KTKE 4IKJA 5LGKA 4U0RB 3GSWA 3TV3L 4ACPA 2DTSA 4JFFE 4G8FB 3HLAB 3K5SA 4RCAA 4H44C 2E7DA 4HU8A 3WNJA 4X9GA 1N6UA 3P4OB 1MJ8L 4G5ZH 4BBWA 4XAKE 1QASA 2EXTA 3TWYA 4F2ME 2M8XA 4LLVB 1OGAE 3HFFA 4ZX5A 5E08L 1FL5B 5GGSB 3KG5A 3MLPA 4WEBH 4Z3GA 3DOIA 1T66D 4WF7A 4RAVB 4N22A 5E70A 2EYSB 5F7EH 3QWNA 1YEGH 1E3FA 5F71A 1T2QL 4MB1A 5GRWA 1ZLVH 2F0CA 1LLAA 4PJBE 1VIWA 3CX2A 1KIQA 3CVBA 3V4UL 1J1OH 2CDGA 4NRYA 3RURA 5I2IB 4DAGL 3E80A 4Q14A 1N7ML 4D0DA 1BF5A 3D2TA 2APFA 2EDMA 4GI6A 4GSQA 4U1KA 4ELDA 2ZG3A 1MF2L 1ZY9A 3HIZA 5G5DB 1CMOA 1HC1A 1E8YA 2IOIA 2VQ4A 2WBJC 4HIQA 4KO9A 1KJVB 4XH2B 2X6VA 3N44F 4LCWA 3ECVA 4MHHI 3TURA 3H3PL 1LVEA 4L8BB 1NGZB 3X3GL 1N12A 1RUMH 5DMGC 5EZIL 2QZQA 5FO8A 3UP1A 3BZ5A 3ZGHA 3FTXA 4PPTA 3S96A 3X1FA 4OAWB 4DPCX 2B0SL 1UEYA 3NCFB 4U1JB 3KLDA 5K1JA 1D2OA 1SHSA 4JFOA 4WO4D 4AYMC 1MFNA 4MNQB 5IT2H 4A2HA 3CWGA 3KLLA 4YSOA 4Y5VC 1TVDA 4J27A 5MHSE 3BDYL 5DD3H 4WFGE 5JPMA 1NBVH 5E2JA 4ELKB 2J55A 2QSQA 5DGQA 5T5NF 2EYSA 3VJ6A 1BVLB 3S5ZA 3VFNA 3MBEC 4QXUH 3D50A 5CP3A 1CO1A 5LQBH 3PHQA 1P5UA 1NANI 1OB1B 4FI7A 4U6YA 5LBGA 3FZUC 4IKNA 4EUPA 2VNCA 1HKLH 4XP1H 4M5YH 4Y4FC 5ENWA 3D51A 1MW2A 1KFAH 4N2DA 3WXWH 2BNQD 4JM4H 1G9ML 2CCWA 2J44A 4DW2L 2ARJB 3UPRA 1I8KA 4I3SL 1U8KB 1DVSA 1S5HB 5DJ8A 1GOGA 3OKKA 5E8NB 5JIPA 3U7WH 1W72A 5E6IA 1N2RA 2PYEB 3SIKA 3VXUB 2FHBA 3PWPD 1KCWA 3WY4A 5DJDB 2JKWA 1GZQA 4W9KC 3UBXB 3RWHA 4KKQA 3WCYA 4ZSOE 5JO5A 3HI5H 4XP9L 5IVOA 3CQPA 2BSRA 2VZVA 4U1NA 3VWJA 2P5EB 1EGJH 3QUKA 2B20A 4JJ5B 1SYVB 4AGQA 4GXFA 2XKNB 1BF2A 2VH5H 2JV6A 4C4KO 2B16A 4OD2A 2HLFC 1SBSL 1FVCB 3CZFA 3V52H 4XC1H 4L8SB 2DIBA 2PUQT 3LQAH 3RVWD 3MRNB 1OAKL 2FBJL 3D85B 4MQXD 4U1MB 5F2FA 2LU3A 3PDDA 4PJDB 2V2WA 1JWMB 4XAWH 4R3SA 3REWA 5I30L 1MI5E 3D08A 5MERB 1UWEL 2GSMB 4KK5D 1Q1PA 3BWAB 2VMFA 1OSEA 1A3LH 1YYLL 4IOFC 1F1DA 1E4KC 2BCKB 5JLZA 6FABL 1GIGL 2HCZX 4P2OB 3MRIB 4WLCA 3SJVE 3MGAA 4JG1H 2F7OA 4QRPD 3AB0C 3CVIH 2DV6A 2O6FA 3MKGA 4FQLL 2H41A 1DZ0A 4YDVB 4N0UB 4Z3EA 3WFEH 3ESOA 4WI6A 1H3WM 5HYEA 4QTIL 3AU1A 2QBWA 4RDQF 5IF0B 3PP4L 1GZPA 1KYFA 1S7UB 4JG0L 3B8SA 4QHMA 5IGXL 1E27A 4E5XG 2ZUVA 1HN1A 5D7LD 4Z7QB 3IDGB 4LO9A 1F45A 4FYSA 3UIZA 3NCYS 4N0UE 2CSPA 3NYKA 4ODUB 3DUUA 4WWPA 4NM8H 3PG2A 5J3HD 4N0CC 3LKSB 2IALA 3ZZQA 3F2LA 1NCWL 1RZFL 3GNMH 4CMHB 4D2NA 4NUJB 1FFTB 4Y19B 1T22B 3WFHB 4A04A 2AV1B 4OFPA 3BX7C 2CBTA 2BVUA 4UV4H 4XX1G 3I6KB 1A7PL 3BQUB 1A6ZB 2NSQA 3GS4A 1ANUA 3I9GH 4DQOL 3L9RA 1UJ3A 1UOKA 2HG0A 1NGYB 5I24A 4JANB 1FL6A 4OFKA 3SCMD 4ETYA 3V6ZB 4PRNA 1OE3A 1IKNA 7CGTA 4Q52A 2V8MA 3NIFB 5BUAA 3IVKB 3MRIA 1FLRL 4B7IA 3CZNA 1XD0A 4HJSA 1J8HD 3KJ4B 2D3JA 1S7RB 1HOCA 1IC5L 1CVSC 2WMPA 3D25A 1RLBA 5BQ7A 1IJNA 3F7YB 5FO7B 2V9QA 3L48A 3GSRB 5AVRB 4KKBD 2A4EA 1C8QA 2KUTA 2X1PA 1KXQE 2WVSA 3HZMB 3OSVA 1FVEB 3EO9H 4PRAB 3MO1A 4RBPH 1DQMH 3ASWA 2XQ0A 1U30A 4AK2A 2K45A 2V5YA 5ID0A 5DVNA 1ETZB 4YBQD 3L54A 2QR0A 1QW8A 2FQFA 2PPAA 2VL5B 4JJ5A 2X4TB 4AC2A 5BJTA 3KR3H 2BERA 5DQDH 5AB2A 5FECB 4XXDB 2YKLL 3AT9A 1EX0A 2Y69B 1INEL 2AJYH 4DNLA 4XNUH 4NNXB 3TZVA 3PGCA 5BVJB 3CMOL 4I77L 4M7KH 1U8OB 2GK0A 1MKFA 5AW5B 2AAAA 1IGTA 3U4EB 3M45A 4UIMB 3VD5A 4PVMA 2D7PA 1DVFD 2UZIL 3G5WA 2VDRB 4M5YL 4EI0A 2DWSA 3DNKA 4NKDA 5HVWA 1PLBA 1B3IA 4B9JA 3WXWL 2ZWKA 1D6EA 1NANH 2VDOL 3ET9F 4P59L 1ORQB 3BVUA 3RZCB 3HLKA 4YNYA 4BQCA 1IGIH 4WK4B 3OR6A 1WC7A 1JK8A 4LHUD 5GRXG 1DQDL 5JOPD 1RUQH 1IFGA 4CILA 2DQGL 1EAQA 1F11B 4X99B 4QF1B 4W9JC 4WCYH 2H32B 1E8WA 4NJAH 3GZPA 3TPKA 4EUPG 1W2KT 3R19A 4NQDB 4BZ1H 2R23B 3TBSB 5ICXA 1AR1D 3F7VB 1EFQA 1IEAA 1MHPH 1ZA6B 2VLMD 3JWOC 2ZUXA 4KKRA 2EACA 5CEYB 3BEVA 2FD6H 4P2QE 4F58L 2JWYA 5GZOC 1OCOB 4B97A 2BP5M 1YN6B 4L1BA 4YLQT 5LJYH 2PP7A 3L3OB 4KTEL 5GISL 2R2BB 3JV5A 5JOEA 1NCTA 5AG9A 1SDDB 4P23C 1D5IH 2RFXB 3C5SA 3C9NB 3S3CB 4UU9A 3ZR6A 3NH7L 2XLLA 3TONA 3BSHA 1HH9A 1TFPA 1D7CA 4XNMA 2ZE0A 1R1CA 4C58B 4Y89A 3V4UH 1UH2A 2ZXEB 3O6LL 4HJIA 1J8RA 2Z8SA 1EEYA 2AJ3A 4K07A 5D6CB 1KB9J 1OALA 2P8MA 1JZHA 4IRZH 3DURA 1DBJL 2F1AA 3FF7A 1KG0B 4D0DB 4URKA 3WO4B 1FJ1A 4WI3A 3QQ4B 3QRLA 4HBCH 5DA0B 3K6FA 1XZWA 3TIEA 1AOZA 3T6QC 2DH3A 3NQIA 3JTBA 4GQ9H 4UM9D 2Z34A 1HE7A 4OB5H 1MXGA 4QKTA 4XI5C 3KPRB 2VRQA 4WWNA 5L2KD 3UP6A 2CK0H 4NRZB 5TPWL 1NLDL 2GYSA 4TSAL 1H3PH 3EO9L 3VXSE 1HK6A 2V2TA 5AL8A 1SJEA 4JPKH 5IESH 1EDHA 1SLXA 1RU9H 3MRDB 2A38A 1JP5A 1ETA1 5L0QC 1ASQA 3SQBA 1JK9B 1ZRUA 4GBXC 3IBOA 2AEQL 1QZ1A 5CLXA 2IBBA 1G7JA 1OTTC 2ATKB 3BQUC 3FHQA 3IS1X 5EZOL 2X6MA 1CGTA 2WTPA 4EI6A 5K69A 3ZT5A 4M62L 3D2UD 4IW4C 3GKWL 4KTGA 2XWCA 5L2KB 1C08A 2BHUA 3CLFL 1ZVNA 1SUJA 4HEMA 3QXAB 1ZV9A 4WHYG 1ESOA 2Y6TE 5LCVH 3FU0A 1AMYA 4ZSOA 4P48A 3B2VL 3PAYA 4R2GB 1Z3GL 2P8LA 1B4LA 1CDIA 2H32A 5IHLB 5E6SB 3GSVA 4I88A 4JHVA 4MDRA 1GMIA 5ACZA 2HX8A 5IVZB 1EWHA 4CU7A 1ACZA 2ERJB 3FU6A 3MRJA 1G0DA 4N6QA 5K59F 4JB9L 4P5MA 1JWUB 3BW9A 1KXVC 1S7TA 4ODVH 2LLLA 3VNYA 4G7SB 2AV7B 5C97A 4G42B 2Y23A 1B0RA 2A2QT 4X4YB 1NGPH 4GG6A 1VENA 2FLRT 4AQ1C 2VXVH 1X5IA 3MV8D 1G6RB 2UYLB 3OZ9L 3FPYA 3VB8A 3CHXA 3W9DA 1FZKB 4RWHA 4YIQB 4FEMA 4PAZA 1LE9A 4N9OB 1NJ9B 3PNWA 1F3RB 4XMZA 1U42A 4ZTPH 2VDQH 3R0MA 5HY9A 3TN0D 2XBDA 1EFXD 2B1AH 3DA0A 6PAZA 3T8XA 4FTVE 4AJVA 2IADB 4F58H 2VLRB 5DZ9A 1BQ5A 4UQ9A 5H35B 4YHLH 2QKIB 1R5IA 5A16A 5I6LA 5IB5A 3F04A 3RX7A 3RZCD 4P3WA 4JFEE 3NP4A 3GXPA 3WO4C 3SGEH 4KJQC 1ZLWH 5I1IH 1UXLA 4LCUB 3H42L 4NN5C 1A4KB 4OIIL 4N25A 3V4LA 4XCNB 4R8WL 3ARFD 4XNXL 3B7TA 4PV9A 5D7JD 5CZKA 1FG9C 2VCOA 1KGJA 3S5LG 3T4YB 3UG3A 5D2NE 3VXRB 4PFEA 5B7EA 1DVFB 2BC4B 3EO0B 2G2RA 3BCDA 3L08A 4U2ZA 3BPNC 1QI5A 3ESPA 3N1MC 3ZTNL 1I8MB 2NTFA 1W15A 2YEZA 4IU2A 1RHFA 2OL3L 4KI5C 2P24B 1K6QL 4YWGL 3RWJA 3PIQA 1ACXA 1H0DA 2X70B 4I13B 4MNHB 4LQFL 4PJBA 1JNLL 5DTFB 3DKHA 3VGDA 2XZCH 2TRYA 3VXME 3HR6A 5J12B 5IV2A 4R5XA 1KB5H 5DRZA 5J1AB 4DKDC 3SDDB 3PGFH 2VAAA 4ELMF 1QTYT 2IQ9L 5KANI 3VFMA 4F9LA 2PABA 1DLHB 3LRHA 3PY9A 3QG7L 4G8IB 4NUMA 3C5ZC 4YH6A 3VI4E 3SOBL 5CLZA 2E0PA 3V5KB 4N8VA 3ELQA 4JREC 3SKUD 2OMYB 5TE4L 3O0RL 4E42A 1MY7A 1U3HD 3CXHK 3JSSA 1J10A 3B83A 2DF3A 3CHPA 4LRNL 3WTYA 4AQAB 3G6JB 3BJ91 3HVNA 3WNNA 1JHKH 4CJ0A 3GQFA 4Y9EA 3RWEA 5C0AE 4G8EB 2JVUA 4BM7A 1GZPB 1HX0A 2FLMA 4WEMB 2NNFA 3D0VA 3WN5B 5L9DL 4EMZA 2A74C 3GMNA 3QW9A 4JRFA 3ZRSA 4HJ0C 3IJHA 4EO5A 3EAKA 4H25A 4AK1A 1W6LA 1A2YA 1J87A 5C0BE 3ISRA 5EWIL 2Q7YB 2YEVB 5E6UB 5EU7E 3TVMD 1GGYA 3PAZA 1TZGH 1PG7H 4L8CA 1MRFH 3H9SB 1G9NC 4OF5A 1AR1C 4AYDC 5D1QC 4OLYL 3ULUL 3ZE1B 1Q94A 4H2CA 4XP5H 4J3TA 1GS7A 3V4VA 1FN4A 4UQ3A 1I4FB 1TJMA 5E94B 1EEQA 1M05A 5IROC 3DSFH 1EK3A 2HVKB 4YAQA 1PSKL 1AH1A 3CZFB 3NN8B 4RFOL 3GUFA 3V7AE 4Z7VB 5HGGS 1DDHA 1VRSA 3CLFH 4NPYB 1T0MB 2QVIA 1AZUA 3VCLB 2BP8A 2A6KB 3MA7B 1HJBC 4NENA 3EHBB 5K9QI 1MJJB 4HHGA 3BZEB 4M8RA 4HUVB 2QTVA 2VH5L 3NACH 3VFSB 4DGWC 2A4ZA 2IAMD 3CSYB 4HS3A 2H8PA 5JPMC 2YS4A 1DBKH 3HS0C 5JHDA 4YUEH 3RGVC 3U30B 4X5PA 1GW0A 2YAHA 1AZCA 4KXZI 1JGLH 1CF1A 3F6JA 3NUKA 3QNYA 3QQDA 1NLBH 4YHMH 4PRDA 3QE5A 3EGSB 1S7XB 2D7QA 5K39B 4PP2A 3QWOA 1WCQA 1NMAH 1P5UC 2D31B 4FG4A 1Z9MA 5IB3B 3BAWA 1GOFA 2Y7QA 1MQKH 1U21A 1D7BA 3UAJA 4OJCA 4JM2D 3PGDA 3SQRA 4GMSL 2CU9A 4DKFH 5ABDE 3WGVB 1GIGH 5H94A 4I9WE 1YEGL 4AGOA 3L4ZA 4FD0A 2WJ7A 3X2QB 5ITFB 1CS6A 2P5ED 5FA4B 1UURA 1PX3A 1KB5L 3CFEB 3F58L 3QXVA 3WFCL 3TPUA 3DURB 1TNNA 2F2HA 2H1LM 4OFDA 3J7HA 3LS4L 3VGGA 1RK1B 1FDLL 4BWUA 5TH2B 4GKSA 1S9WB 3O8XB 3UL4A 4DTGL 1DVQA 1C7TA 3FF8A 7FABH 3FB7B 4L3CA 2ZT9C 5EUOF 1RZGA 5LUMA 2GC4C 1FNHA 2W0PA 4URTB 5MENA 1BD2D 3CBJB 5EUOB 1IVLA 3K6SB 2AQSA 1FFNB 1CLVA 4MXQC 2AEPL 4U6XB 2EH7H 5I6OA 1E43A 1W8NA 3P40A 4GQ9L 5EZIH 4B6ZA 4XVSL 4PRHE 3EOYG 3I2CH 4XNXH 1O7SA 3ZKNC 1MAML 2WVVB 4KQ4H 4MXVF 5MEQA 3KL5A 1CWVA 3BO8B 4H0GA 1KY6A 4MMZC 3TS8A 1BD2B 1X9RA 4LSVL 3TBYA 3WLBA 3VRIB 2JXMA 3KXFD 2EDLA 3FK3A 4KGLA 2WIIA 2F8VA 5FOBB 3QI9D 4Y1AA 1BVOA 3QFJD 3SDYH 4K8RC 2P26A 1MRCH 2QSTA 3T0VA 5FM5O 3VWJD 3COOA 3T77B 2EYRA 3BH4A 1DQKA 3IFLH 2ESVA 2XKUA 3K7UA 3G3LA 5A43C 4LLQA 1L9QA 3VI3B 3H9ZA 5JUEH 1DEDA 1GY1A 4IRSB 2PF6A 4UAOC 5IEHB 4FADA 4AOFA 3S88L 1AO7A 3L7FA 1IGYB 4N0YL 5C3TA 2CM5A 4R4BB 1MVUA 1HNFA 3IK2A 2JCCA 5BMFL 5KYUA 1F4XH 1T3FB 3ERXA 4YPJA 4NRXA 5B8CA 2BSBA 2X4PB 5IREA 3U2SA 4ETQA 3HC4L 2OCCB 1KBVA 3UJIH 4KNUA 5BS0D 3MNDA 2YARA 2NNRA 4PJFF 1TLMA 3RAJH 1DJHA 2KI6A 2NYYC 1IJ9A 3D69B 4MXWH 1S3KL 3QAQA 2XOTA 3WSQL 2Q5BA 2GBTA 4X7TB 4X6DA 3AREA 2ZF9A 3MRCB 2IAMB 2E8YA 2CCLA 3BEWA 3P3TA 5D7KD 4ZMLA 3SPJA 2ILLA 3AT8A 1GZHC 5CD3A 1NCCL 4YSUA 3QUZB 2ADGA 4E9XA 4WEEA 2QVKA 5I9QC 4I89A 3U1SL 4GBXA 4OGQC 1CFBA 4JQIA 5C3IA 4RZKA 4HIXL 2Q8BH 5I1LB 3ZE0B 3UBXG 1QI3A 3LRSB 4GQZA 4HD5A 3B4NA 3A47A 3SDXA 5DZPA 4HLJA 4JZOA 3LNIA 2XPGA 1B2YA 1P2CA 3JWDH 3M7OA 2QFPA 4M1DL 4NQCB 4X5WB 1Z9PA 3FQNA 1YN6A 4N26A 2XV6B 3DYPA 1N10A 1PZ3A 4JLRB 5EDXA 4BFKA 2V5RA 1UCBH 4NI6A 2MKLC 4MQSB 2NUTB 3CPLA 2EADA 3MKKA 4ODWA 1NCDH 1QI4A 3ZMRA 3GF8A 5T3XD 1KMGA 2ZYHA 3QCVL 1WD9A 4KROB 5C07E 3G5XA 3BT2L 3GMPA 4AE1A 2FD6L 1QFPA 1LP9E 3PWVB 2XTJC 4NHUB 2X6BA 1AY1L 3RRQA 5IGXH 1PU0A 3VWKD 1VAHA 3F00A 4PJHE 5GIRB 2NY0C 3IS0X 4HCIA 3EG9B 3LIZH 4HJTA 3SJVD 2CO6A 1QWNA 1L7IL 1QSZA 1MREH 3ILQC 4MB5A 3DXAE 4UF7C 3PHSA 1DR9A 2IANE 2DKSA 3DVGA 4Y2OB 1KIUB 3FQWB 2Z3FA 3OAYH 5C07A 4BELD 3ARUA 4GIPD 1TQWA 4FERA 4LU5L 3H4HA 3POCA 3E38A 3STLA 2R2CA 3AQZA 1QVOA 4LVHC 5EO9A 5HDOA 2DMBA 1ZPUA 4PJ9D 4KKZA 4LSSL 5A2IH 3TBWB 5IM7A 3TT3H 1JF6A 5EC2B 1YJDL 5FECA 2E6PA 2AJUH 3ATEA 2WN2A 2R15A 4PWJA 3VFRB 4TNFA 2HKHH 3KYNB 5F96L 2CIIA 3LKPA 1QSFD 1IL1A 3NK4A 5DJ6A 2CMRL 5SX5H 1MHPL 3EOBB 2G3ZA 3N85L 4XT1C 3MODH 3MYJA 1A14H 5KYYB 2CUAA 1E8ZA 2Q2EB 3GD1C 3ASOB 3JUYA 1UVQB 1TUPA 3PXLA 4JDTH 3QQ9D 1OHQA 5F3HA 3P0VL 1JV5B 3QEGL 4FMVA 4OZ4B 1JXGA 4PD4K 1N5AB 4F8NA 2P48B 1JNJA 3ZZSA 1A6TA 2I9LB 1MLCB 4MCZB 5DURB 5AQ0A 5JR1L 3EYQC 3AWEA 1GTNA 1NBYB 3LH2L 2EZ0C 2B5IB 3FB6B 4LKCB 4IRJB 4HXBH 1FH5L 5JZ7C 1I8LC 2H3XC 2YAEA 4M7LL 4Y5YB 1KTLB 4PM1A 4UTBH 5KSAA 3I75A 2WJ5A 4L1HA 2E76C 4M48H 3EYFB 4XB7A 1OGSA 5T1KB 1H15B 5FYKL 5CBAB 3BSZH 2ODHA 2VWEE 3ARBA 5BVPH 2CO1A 3Q3GA 4UYPA 4H5SA 5DQJB 4LSPL 4FNQA 2HRHA 4ONOA 4MHHG 4NZRH 1AXSA 1KF9B 2VDKH 4ONGH 2DIAA 4JHBA 4HPYL 3AWFA 4MZ2A 1VFUA 2NY4B 3NCJH 2AABH 5CJBA 3BGMB 3DUSA 2WXHA 3VXTA 4F9PC 1EJOH 1FG2A 3F12A 2JCCB 2VXVL 3WD5H 2XFXA 4HT1H 3ZKMC 1BGXL 3T8MA 4U1GC 3KD4A 3SDXE 2W0LA 3GSUA 3QUZC 3QJUB 5EDSA 1WLHA 1FYHB 3N91A 4WFFE 2Y72A 1C5DB 4KZ0A 5LB1A 2R56L 2LU5A 4X9BA 5HYFA 4HJ1A 3DYMA 4CSSA 4MBOA 3OF6A 5EIIB 4CVWA 1JDCA 3CN2A 4P5RA 4QCIB 2HT4D 3QUXA 2A6JA 3PXHA 3VE0A 3P02A 5AWNH 5LN4A 3QUXB 2J4WH 2Z7ZA 2OBGA 1YPZA 2LHAA 3J07A 4R90L 3RGHA 4C59B 5IQOA 2BDNH 3QJSB 1CQYA 1Q9KA 1U4EA 2A9MH 2QEJA 4LCCB 1G7QA 2IBZY 4MA7H 3L5JA 1GZHA 2HTLC 2BPBA 3UYRH 3IJEA 4H13C 3ZQWA 2BINA 2GTWB 1BBJA 4ORGB 5BV7C 3MRDA 5DZOA 1Y0LA 2EKSB 2ZXDA 4Z0BH 2KMWA 2JB6B 5C9JA 1ACCA 2B59B 4P3DB 4P05A 1YCSA 3TA3C 4G5ZL 3BKMH 1CTMA 4GSXA 1TQSA 4OTXH 3CFJA 4UOZA 1JSYA 4K23L 4ZJ9A 3BMWA 2J25A 1BJ1H 3QA3A 1OAQH 4IS6B 3KPRA 5KWYC 2Y07L 2UVEA 3RGVA 4MAUL 2WLKA 4KVNL 1I8IA 5E8EA 4K4KA 3U0TB 5FS5A 4F37K 4WEBL 4NZUH 2FZ3B 5D4QA 1QFWI 1UHVA 3QJZA 4IGBD 1PZUB 3ARDA 1CE1L 3O11A 3QDHA 4PJCF 3V4VL 5GGVY 2B15A 5FXCH 1XTMA 5E4AA 5FUOL 1U8KA 2VZOA 1IEBA 2OL3A 3S9DB 4M8VA 4XPAH 1KJ2A 35C8L 4X0KA 4N86A 4DAGH 3O3BA 1E4HA 4LEBA 5KVEH 3QORA 1AQKL 1FORL 1UWGH 3O0RH 3MCLH 3OHXC 4NIYE 3ZYOA 4ZXBA 3KM2A 1WK0A 4KK9C 5GGTL 1QP1A 3MZTA 5EOQH 4LRIA 3RNQA 4AQEB 5EZOH 1P1ZB 1U8NB 1JGDA 2JCCE 3CFTA 4CVZB 1IGMH 1CQKA 3VACA 2NDGA 2F18A 4GRMA 4M6OH 4NBZB 4NO3B 4M3HA 1W80A 3DO4A 2W0FA 1HJCA 4NO5A 1QAWA 1CLOL 1N67A 2FO4B 4NZRL 1NH6A 2OCJA 2CRIA 3MFFA 5FF6A 3F5WB 1J5OH 1MJJA 2JI3A 2YN5A 5C2BL 4P2RE 4OKVB 4XHJD 2Z0UA 3CN1A 4NQDD 1TVBA 1NFIA 2CHNA 2YA1A 3DUSB 2PP8A 4UNUA 2CLZA 2YC1B 1EHNA 4UYQA 3M46A 4KXAA 3GSXB 1KGXA 2N3JA 4I8DA 4U7KA 4BINA 5KG9B 3UZVB 4BE5A 1U95B 3N42F 5CKAA 3VU2A 4GAAA 8PAZA 3HZVB 2A73A 1WBYB 1XR8A 3ETSA 5CBAA 4OF8A 3SGDH 2OK0L 2E5EA 2XN9D 5T3ZL 1MCOL 3V5HA 1N9PA 1HILB 1Z7JA 2RD0A 3QHFH 4F9LC 1FZJA 2VDLB 5I1EL 5DLMH 5PCYA 1CIUA 3GFUA 2BNUA 2IQAA 4G3YL 4ODTH 4Y2DD 4U7MA 1Y1UA 4M7LH 2OMTB 4UQIM 3TCLA 1SOXA 3B5GA 3MU3A 5KYXB 1KTRL 4WI5A 3RIAK 3TJHD 5FM4A 1CE6A 4BSWB 3PGCB 5BVJA 4R5VA 4HU2A 5CILL 1NBYA 4G9FD 2XXMB 1RZQA 3AABA 5LGYA 2EC9T 2R0ZL 3U7AA 5AW8B 1Y6NR 4B96A 3APFA 4N3TA 2VR4A 1BHGA 3BXNA 4ONHB 3TFBA 4U3XA 3S34L 1JPFB 2YD2A 4HJGB 4WJG3 1TEFA 4I48A 4ZG1A 4KRMB 1E6JL 2QSVA 3QO1B 4U49A 3D39E 3WFDL 2BP0B 4F37F 4I3GA 1NFDE 5D2LB 1AQDA 1JYXA 2Q7AA 1AXSB 2RMNA 4KU1A 4F2MB 3RPIB 2PW2B 1MCWM 2FNWA 1UYWL 3N04A 5BRZD 4WJ5A 4HSAC 4F2EA 1DQIA 1FNGA 1WFNA 4L1LA 5FYKD 3EXLA 1PG7W 1D5BB 5HDWA 4XMVA 2WNXA 4HPHA 3LCYA 4G1MA 3IVKA 4XP1L 1AKJD 1OZTG 3DROB 3QUYD 5CIPA 4LVOC 3Q8FA 3HNTH 1DQQB 4KK5C 5AVSB 4MAZA 3MRGB 1FDLH 3U4EA 1AI1L 5L6YL 2Q76B 3RP1A 5AENA 2EEDA 3E7JA 3SBWC 2BSCA 3EH4B 4FQ1L 1MNUL 1SY6H 3NZHL 1FCCA 5KZCD 3MOQA 2R4RH 3MV7D 1EZUA 1IBYA 3NACL 1XSKA 5ID1B 1NPNA 4ELMB 2WUCH 1S78C 4QRPA 4BD4A 3LTVA 5J12C 4LSSH 2QQNH 4NQCD 4CKQA 1U92B 3EYVA 4G8GB 2CR0A 1URIA 3EBIA 2BP0A 4JE4B 4JPWH 3UG4A 4FQXB 2ZSVA 3T3MB 2BRRH 2DWDA 3GMNB 4G80A 2CIIB 4FQCL 4HZ1A 2WBJA 3BAYA 4XNZC 5B1AB 5J3HC 3PFUA 1NCWH 5HTSA 3W37A 2PMZA 1H3GA 5IBUG 1JPSH 2J1YA 3GHEH 4IM8A 4F7PA 3D39A 3QWRA 2AXGA 2F6AA 3GNML 1KJMA 3LXBA 4Z3HA 2CIKA 2EVJA 4HS8L 3GTNA 2OMUB 1C12A 1IC1A 4XMLH 3QUZD 5ANHA 3T0EC 4BIKA 4Y5VA 4R4FL 3WUWB 3GBML 1NL0L 1WQVT 1KTCA 3BPCB 3QPQD 3QI9C 3UTPE 3ZU8A 3QJQB 2XVLA 4FYRA 4XVTH 1N59B 4P2OD 5C8JB 1FGVL 3DX8A 3OAWA 3LH2H 4A2GA 1EJ8A 2XWJA 2VR9A 3PYCA 4NZFA 4DK3A 3Q43A 4X2UA 1IBGL 4O51A 4ZAKC 3TP4A 1ZHKA 3MBEA 3HNSH 5F21B 3VTTA 3QJFB 4QYOA 1FCGA 3SDCB 2UXVA 4GKZA 4KZEH 3FONB 2XWBA 4JFDE 1ZS2A 1S3RA 4HX1B 1UD5A 4LLMB 1JHKL 1E42A 1E9OA 3EYSH 4WU5B 3T0EE 2ITFA 2ZWSA 5DSCA 4Y8DC 4DOHB 1SYSA 3MV7E 4O4YH 1NFIB 4B53A 2E75C 1P7HL 3U6XS 1NFDA 3GJFH 2X53A 3MNZA 3X3FH 3FSZA 5KBMA 4XCCL 2BFGA 2RR3A 3IPFA 1E6JH 4IJ3B 4TPRL 4AEIH 5DUMH 3T6XA 4JKLA 1D2PA 2QQKH 3D18A 3EJPA 2E7BA 3IPEA 2KT6A 4JM2F 1WBXB 2EDXA 2KLSA 4GXUM 3WE6A 3LKRB 5D7HA 2CAKA 4ALAH 1TCMA 4GQPH 2DQEH 2YD5A 3QDMD 3NJLA 2W65B 2JELH 4NO0A 5KN5A 3ISYA 4BFOA 4DFIA 1R4XA 3EBGA 1SZNA 3EO1A 1TZ8A 3QHTC 4HC1L 4RGNE 3FXIC 3CX5J 5EN2B 4EN3A 5I8OH 3K71B 3B1TA 7TAAA 1IM9A 4XRCA 4EDWL 3NQKA 3MRLB 4Q9BA 1IE4A 4JFEA 3E6HA 3BKCH 2Y7QB 1N0LB 2CRMA 3K1DA 1L5GA 2B1HH 1XVSA 2ATPB 4OLZL 1MFAL 5FR3A 4X9HA 3H7BB 3ARBC 5FAAA 4NRZA 3VD9A 1R5VB 3PWUB 4QHNA 4BH7B 4X5XA 4UOJA 3OLGA 4JZJB 4APXB 1PVHA 1YDPA 1BDYA 3INOA 4D0CB 3QJHB 3RFZC 3US9A 1EHAA 4UANA 4ZFOB 2B77A 3ZZLA 4BRVA 1WTLA 4R7NA 5L88L 4IEFA 3AREC 4E41B 5SWQB 3SY6A 2QVTA 3W11C 3O6FD 1S8DB 2DQUL 3Q0HA 1I9IL 4B41A 2A9DA 4M1GH 2BP8B 3CFJB 1IGFL 1TT6A 2ZCZA 3CZEA 4QXVA 5KVDE 4RDBA 4OZIE 1MQKL 4PG9A 3QJVB 4D7PA 3KM1A 32C2A 2Q6WA 1AP2A 4M1CC 4Q56A 4JM0A 4TSCH 4CU8A 5B38G 3II2A 3LRKA 2VWEC 1KYOK 2CJUL 1FE8L 1E3XA 1SRDA 1NINA 3THMH 4N68A 1XF2B 4IOIB 4Z7UB 3UBHA 3K80A 4WI0B 4Z7OF 2CLVB 3NZ8B 1CE1H 2WNKA 1CICA 1P6WA 2F53E 3A22A 4JREB 2HP4A 2NQDA 3GJEB 3MBWB 2L7JA 1N0LA 6CGTA 3I9IA 2AQ3A 3F7QA 3KVPA 4X7EC 3MLRH 4S1QL 3RNQB 4EEEA 4U7SA 1Y18A 5HYQB 2F54E 5DS2A 2IGTA 3VRIA 5E8DL 2FEEL 4R26L 3G08A 2IDSA 3DVIA 2XIBA 1KCBA 4MA1C 1UXWA 3FUFA 3M1OA 1LO2L 4G80B 4PUBH 5GS2H 4YSQA 1ZIAA 1UXMA 1IKNC 2GIXA 4Y16C 4YHOL 4J6IA 2IMNA 1JGEB 3JTSB 2B7DT 2XG4A 4NI3A 4Q6YA 3ILDA 1W91A 1AGFB 1MREL 1VGKA 4NJ9L 4H5SB 4IBQA 3GSWB 1PX8A 3CVDA 4RX4D 5HHMB 3QA3B 2ZWZA 4GUPB 5LBSA 3ZHLA 3H9SD 5E5UB 1QR1A 4TULH 4YDMA 2OZ4H 4L4TB 3VXSA 4AMWA 1QO3A 2DDQH 2XT1B 1GW6A 1MCEA 4WJKB 1K4CB 4PYGA 1CGSH 3K4ZA 3MRRA 2MHAA 2DIEA 1JV2A 2BMKA 4LCCC 5EBWA 4GRWF 5FDWB 1WIUA 1RK0B 3OGCA 4PJFE 1FNLA 1QEWA 2P28B 3MRLA 3SDAB 3UPAA 4XNQA 4YSTA 3EDFA 3UTOA 2X42A 1JZ8A 3DXAA 4ICXA 5ID0B 2G5RA 3GBLA 1LILA 1RV6X 3EO1B 4O2EA 3C5SB 2R2HB 1E0OB 3HNSL 1I1AC 4NNPH 5AAWA 1AKJB 3DETC 1KLUA 2XXCB 2G60L 3ME0B 1OCZB 3DTXA 1U3HB 2M83A 4A6YA 1FO0A 5AOZA 3VYNA 5J6HB 5GRYA 3KWXA 5T5FL 3Q44A 2GABA 3IF1A 3T65B 3LKRA 4Z7IA 2HVBA 3FUJA 1NDMA 1IL1B 1MCLA 3QIUA 5D2LE 4I1PA 4BKTC 5CMAB 5L88H 3M88A 2BZDA 2DWYA 3EGDA 4JHAH 4QXGH 5D8JL 1YEIH 4BFFA 4BFIB 5CD5D 2XACC 2XNAB 3Q9QA 2AGJH 3NSYA 2PR9A 1JXFA 1DTUA 5C0DB 3NJXA 4EZKA 3TBBA 2YMOA 4I0PC 4WW2B 5C0IA 1IGJA 1CURA 1RZIA 4G6KH 2YXMA 2BNRE 5HGHA 5KSVA 4XR8C 2UVFA 5JA9A 5HYJE 4MBRA 4WFEE 4AIEA 1GA2A 2G4GA 1DL7L 1FNEB 5D7JB 3GRWA 5GSRA 4M1DH 1YMMA 1MZZA 3B43A 2VDKL 4ONGL 4PJ8D 1OT4A 5ISZE 1YYCA 2WTRA 3MCKB 1BSIA 3B2UC 2HJLA 4YHLL 1PFOA 2F54A 2J88L 4HEPG 3HG0A 4WI8A 4M93B 4H25B 5F7FA 4M02A 1J0ZA 5HJ3B 4ZW7A 4X6DE 2ZX5A 1JF1A 5FHAH 4FXKA 1UXWB 2X4TA 4MJIB 2DQFB 3S36H 3KPQB 5CP7A 3KPOB 1KZYA 2MQCA 3QDJA 3SBPA 2NYYD 5CMAA 4R8WH 5CUSH 2XSKA 2BVOB 4NUQA 3GO1H 1MELA 4XVUD 1CGXA 5SV4A 3VD2A 4GMSH 1E65A 5AW1B 3DX7B 1CJYA 2V3DA 1AFVH 2J6EH 1BV8A 3SPVB 3QUXC 2YLKA 2A4CA 3ESMA 4LLDA 4OZIA 2Y6SD 1ET8A 1KC5H 2J3SA 5CIPH 1RY7B 5I0WA 2V33A 1FE8H 1T0NA 3OGCB 2FX8L 4HCFA 1QSED 4NUGH 4D3CH 3PWLB 1EQWA 3KW8A 2DZEA 2OMVA 3IJYA 5JMRA 1GGTA 1HHGA 2ESVE 3J27A 1FVCA 1LD9A 5EU6D 2OP4L 1DQQA 1RK0A 3N41F 7FABL 4P2CG 3FTZA 1FZJB 1X4YA 4FXTA 3SBWA 1SJEB 3W9DB 4HKBB 4YDLC 2WXPA 2COQA 4PV8A 3LKQA 3ILPB 3FU9A 4R2GD 2A73B 3ZY7A 1KY7A 3HPLA 4BXSV 4ONFL 2PTTA 3FPXA 4JRXB 2W60B 3WMPA 4IGBB 2Z8VC 3U9PH 5KVEE 1YN7B 4JG0H 1WIOA 3UTTB 3KCPB 4K94C 1RSYA 2D4FA 3DOSA 3D3VB 5E8OA 1F90L 4ZMPA 3UTSD 1SN2A 3HRPA 2A9NL 5HPMA 2WYZA 4GMTL 1WAAF 3WEXA 1JNHB 1VACB 2HJFB 3OKMB 1RZ7L 4QHKI 2H3NA 2DWXA 5F7HA 2UZYB 1E28A 1XL6A 3IJEB 2L04A 4ZSOB 5H4YA 3CFKB 3TM6A 4XZUB 3FSAA 4F7TB 4LSRL 4YDIH 5FUZL 2AKRA 1ZT1B 2X4RA 2ZSWA 3OHXA 5AZEL 4ZXBC 3VW3L 3KYOA 3IDXH 3BAKA 4M7LT 2NDFA 1KLUB 4P57B 1F4WL 2EDNA 1KGCD 4PRID 4F57H 4DGVH 5DUBA 3LD8B 2Q8AL 5DMIL 4ZNEE 2EVGA 4PJCB 1ONQB 2NR6A 4DQAA 5I71B 3LHPL 1JK9A 5C92A 3F64A 2AQ1A 1QBAA 2YFOA 2MJWA 5DWPA 5IW6B 3GUTA 2WXIA 4MXWL 5AB9A 1IM9D 1T1YB 4JRXE 4FLSA 4XTRC 2E7MA 2YJQA 4GAGL 4HWBL 4Z0BL 4UV7H 1DBKL 1INDH 2AQPA 3M17A 5D72H 1FYTE 4WW1B 2DQCL 1NLBL 1G43A 1TTRA 4RISL 4FABH 4MMXB 3S7GA 1C7SA 4HZAA 5D55A 4NNYB 5JNYB 1OTUD 2CXGA 4YZFE 4O2CB 2F74B 5F88A 4ZFOA 4FHJA 1I1AA 5AAWC 2WN3A 1GAFH 1LWJA 4XWGH 3M7FB 4ZTOH 3CFEA 3RGBA 5IJDC 3V0HA 3NCWA 3G5ZA 5F89B 3LB6D 3PXJA 1WZLA 2XTLA 3H7LA 4RGMB 1A6UH 4KAQL 3V52L 5DJ8B 2CIKB 5KYUB 5SWSA 3ARDD 1VHPA 1XGPA 1FAIH 1EO7A 3O3BB 3VA2C 4X7DC 5L4MA 4AEHL 1UT2A 3V0GA 4DK6A 1OPGH 1YNLH 3HBQA 1X7SA 2KDGA 3VXOA 3IJSA 1DJSA 1FL5A 3CXDH 5GGSA 5FYJL 5I0VA 1YYLH 3IDIB 4WTQA 1E90A 5DFWH 2ZYIA 1E5YA 1Q9WA 1R3HA 4S1QH 4P59H 4UCFA 1LE5B 2V2TB 5IKCB 5AW3B 1BM7A 1Z1WA 3HG3A 1MHEB 1Z5YD 1QLEB 2NYKA 3NJIA 1VB9A 5E1GA 2E7LC 1T5WB 4UILL 5HHXL 4TLSA 2DJUA 4ONFH 3HLAA 4Y1AB 1HCYA 1WBZA 3MGOA 3SO3B 4JGMA 4YLBA 3D4ZA 4JO2L 4MXQD 5SWZA 4E0RA 2JKSA 1TCRB 3LZNA 5ICUA 4NQSA 5I6MA 4Z9KB 1E5ZA 1R47A 3V95A 4CC1A 2Z31C 3HPLB 1MAMH 2F53A 2I85A 4V11A 5HJ3A 3ZKXB 1JFQH 2YQ3A 1QSFB 2BS8A 3RUGB 4EBQH 3I50L 1A9BB 1B0IA 2Z6FA 1FNFA 3V8OA 3VCLA 4TUOA 4Y2NA 5D7EA 4JG5A 5E9DA 5K9KA 4RZCB 4YDKH 3ZDZF 3B6SB 3MROA 2HT4C 4PEEA 3WFZA 3DTUB 3ALXA 1V10A 2NLJA 3I6LD 2L7EA 2WLNA 1ZDSA 3GINA 2UX6A 3LDBB 2WQVA 3LKNB 3H3PH 4KJYA 4MB4A 4IJ3C 5GS0L 4QI3A 4KXBA 1TQCC 5BNXD 4ZT1A 4FXGA 2Z93A 3EDDA 5I75C 4PGEA 4X9IA 2P1YA 1VJSA 1MHHA 3ETTA 2V7NB 2PW1A 4FFYA 4I87A 4K0OA 1IKOP 2VL5A 4I18A 5I6KA 3GIZH 1IM3A 5IROA 4HUUA 5AKTA 3HJEA 3OKMA 4L9LA 5HDQL 3RAJL 3UTSB 1VA9A 3BN9D 4YHKH 1XR9B 4TL4A 5TFSL 2Z64C 3UTTD 1V27A 3AS0A 1IIIA 5CHNA 1BQUA 3SCMB 4UTBA 4KTDH 1CE6B 4GRLD 4LSVH 1EXUA 1XGQB 1ZTXH 1SHXA 3NEXA 3E9TA 2AXFB 3ZHDA 1LXMA 3KLAB 4HFUL 3AG4B 3VGFA 2E46A 2PR4L 4MS8C 3DHMA 4XX5A 2QQLL 2XPGB 3V5KA 2VC2L 3INUL 2OKMA 3BFOA 3MUGB 4FMKA 4E68A 3L3DA 4WIQA 3A5VA 4I1NB 4XCFH 3B6SA 3MROB 3DRQB 5B1JC 4YDLB 2ROXA 1QSEA 1EH9A 1NDGB 3Q2WA 4ZAKA 5KSUB 1QSEB 3D39D 1OY3B 5M7QA 1OXYA 1DCEA 3MRGA 3Q6FB 5K1NA 1FFOB 1QX1A 5FHBL 5I71C 1JYVA 5J9PA 3LEXB 4WUKL 5E2TH 2OX5B 3MLXH 5CFAA 3UAJC 2XKNA 1EBAA 2F58L 2JJWA 1PNDA 3NZSA 5CEZD 3CIAA 3OZKA 1CDUA 4GG6E 2JKTM 3U6RB 1GGCL 2ZCHL 4BDVB 1QLFA 3S36X 3FCSB 1EDYA 5KUMA 4FA7B 1BVNP 2AZAA 4UILH 4TVPH 4K3EH 4Y8AA 3LEYH 5EF2A 5DYOB 4RMQA 2ZD0A 3QIUC 5FM5M 1RZJL 4WSKA 3GEFA 3TCXA 4OM0L 3ALWA 3NIDF 3QJRB 3B2XA 3QO0A 2WWMD 1S5HA 1YEEH 5BS0B 2FVNA 3D52A 3VI4A 3CUPB 4DGYH 2ID5A 1WZKA 2ZSVB 4UINH 1UB6B 4FQCH 5DU7A 4EN3C 2ENQA 5I8CB 3FYIB 1TZAA 5FYJE 5I26A 2Q8BL 1YEHH 2NY3C 3CC1A 4PJ8B 4RRPA 4Q2ZA 1KN4L 2MNJB 1MFUA 3VDAA 5L6YH 3S4SA 2J56A 3RJOA 3W57A 2ZICA 3K2MC 4YHZL 1KCRH 4JY5H 1GSMA 4KDWA 2H26B 5DEZA 2PTUA 4Y4HB 3BUTA 2VITB 1KBGH 1XB3A 5FV2A 4BWTA 2WLZA 1FFPB 3I3EA 4LNRB 4YBHA 3RVWC 3WLBB 3M86A 3L4CA 4YHOH 1PDKB 3QULB 4J8QA 1G9HA 3O6LH 3PWPB 3QI9B 1CD9B 5TE7H 3EYOB 5JPNC 3RFZA 3MRJB 3AM8A 2DI7A 2BRQA 5IK3B 2VMEA 1AAJA 5F44A 4FXKC 3MRBB 2ICEC 2WV3A 4FLRA 5CSBA 3NJFA 2P5EA 3L8QA 4IEFB 3UOAB 1DVFA 2BC4A 2OR9H 1PLGH 4GAJH 3QQ9C 2XDHA 4OZGB 3VDCA 2Y25A 1UEMA 5CZVH 3IE4A 3MOBH 3N55A 1RK1A 3P0YL 4S11A 5HDRA 2OYPA 4I1RA 3ZN6A 3LAFA 4AVKA 1WP6A 2NY2B 1J12A 5IZ7A 4NRXB 1DJZA 4RWYL 4FG2A 1CDJA 2AQTA 4HXAL 1IBFA 3UIYA 2O72A 3HS8A 2B9AA 3CFUA 1RH8A 5JW4M 4ZZKA 2H0PA 4NHCL 1M71A 2OL3B 4OFYD 1LO2H 4EN3B 2EIDA 4PG2C 2R1XA 2XFXB 3O11B 3WN5C 4FN0A 1UQSB 4P2QA 3MA9H 4L4TE 3FN3A 3P73A 3RWIA 1WZAA 2IV8A 5DEGA 2AEOA 2P5WA 4RGMC 3MTXA 5HHNB 5IBLC 3BPLB 1VDGA 4LSUH 4N1CA 2W81C 5KS9A 3IN2A 4ODHH 1W0WB 5LCVL 1U0QA 4NXSA 5JPMB 4WHCA 4X9YA 1CTNA 5E9AA 4IGBA 4PJXA 4GFXA 1B9KA 3RVVD 1PZBA 1R3LB 2R0WH 3LXAA 4JRXA 4OLXL 3T0DA 2BP3A 2IH8A 1I1YA 2LU7A 5IBTL 4APXA 4P4KC 4H8QA 3O0LA 2K6YA 3RKDD 3STBA 2C3HA 2BY2A 4F7CA 2HB0A 4NENB 3CC5A 1OEZW 1IAOA 4XP6H 4E5XA 1ICTA 1MOEA 2MQ3A 5BO1L 3K81A 1TJHH 4LCWB 1MVUB 3MJ7A 4BCZA 4PS4L 4PW3A 3ABMB 5B21A 5T3ZD 1A7QL 1BBJB 4ORGA 5FF6B 5ES4B 3FQYA 4GKSB 3ZE0F 4X6BA 3BVDB 4LBAA 2AEWA 4P4RB 3BDXA 1EEZA 1FFPA 1I1RA 2ADJB 4IKKA 4EUPB 2LTQC 3FQ1A 2ZX9A 3IETA 1XCWA 2BLFA 4F1SA 1KENH 4BCXA 1T1WB 2D9CA 5BVPL 2BVYA 1L9OA 1ZT1A 2X4RB 4LL4A 1VF5C 4QUOA 1UVQA 3L3GA 1WS8A 3HTLX 1UUNA 2MOQA 1REIA 4MA8H 5CEYA 4LZKA 2FK9A 5DD1H 5HHOD 3SEPA 3TVMB 1BD2A 1O5PA 1T6WA 3NK3A 3A4DA 4K23H 5MP6L 1T5KA 2VABA 3WKMH 2E3VA 2QKSA 1TZOA 3PP3H 4U3CA 4UQDA 5AVYB 1O9WA 4N2KA 4KC3B 2FIKB 2DL9A 5DQDL 4E41D 5FHBH 2O6EA 1KJ3H 4BYHA 5GXBB 1YC8A 5F1SA 4O58H 4JFXA 2OI9B 1BVNT 2EIZA 4FQQB 5EZLA 3W9EA 3HN5A 2QDVA 3MBXL 4KMLB 4KNTA 1SXZA 3RLSA 1NEPA 3PUUA 2N1KA 1WO2A 1VERA 2V0AA 3APCA 3ECUA 1L9TA 2NY2D 2W60A 1RCYA 3CZJA 1ORQA 1F2XK 4JPQA 4KKBC 4AW4A 1N5YL 5C3LD 2DM7A 3BZEA 1YN7A 1M56B 1I75A 5AWNL 2WBKA 3RU8H 4G7RB 4HA1A 3UH8A 5G4NA 3TEUA 1YEHL 3TNNA 4LB8A 3ARFC 1G87A 3CVHA 4OVUA 5FO9B 4ANWA 4AQ1B 5DHXB 1A65A 3OX8A 5HVGB 2VLLB 2BFVH 1T2JA 1KYDA 4Q0XL 4WTZA 2LE9A 4LSTL 1J5DA 3FO1B 3X13B 4F5CE 4KI5D 5E8PB 2YPKA 2OSLB 3BP4A 2HX9A 1IGML 3EBHA 4J12A 1GS6X 1U3YA 2OLDA 3TT1L 3L4WA 2R2BA 2FL5A 5F0MB 3ROOB 4NXKA 4R2GC 1QSVA 3N40P 2XIIA 4QCIA 3VXRD 1LO0L 3OKEA 2GHZA 4JDZB 3T65A 4L4VB 3DPBB 3QPXH 3WKPA 5ETUB 3O45B 2K3HA 2ZNXA 2F5AL 3ARFB 4GIAA 5FUCC 2K8QA 5CN1A 2XQBL 3OKLA 2R23A 5GISH 1CFQA 1WZ1H 1DANT 3FTYA 4TVPD 1RUKL 1NDTA 4GLRI 1N8OE 1RJYA 4LLYA 4FG0A 5TDPB 1I7UA 5IFAH 4N2MA 4OUUB 1F4YL 5HHPB 2DDQL 3DX4A 3FT2A 1KCSL 3T2OA 2C3GA 4OQTL 4LOUD 5CU9A 3ZVVA 2NX5E 3G6AB 4HV8A 1DDHB 4NFBA 3MDJA 2OMYA 3C6LD 3AMLA 1YYML 1A7QH 1F13A 2ZXAA 1UA3A 25C8H 2FO8A 5JW4R 2VM4A 2VC2H 1E3ZA 1XDTT 1EFXB 3BC9A 1G9MC 5HVHB 1MN4A 2H1XA 5F9JB 2BIMA 2HLFD 2NNAB 1TSHA 1R19A 1UJ3B 1Q72L 3UTQB 1YMMB 3WDJA 4OD3H 1N59A 1XD1A 1UFUA 2AI0H 5C0CB 4KK8C 2QPFA 4WW2A 3RYMA 1SN5A 3KPNA 1TZIB 5DHYB 1H3PL 5KSVB 4FF9A 1IX2A 3DV4A 4IOFD 4G43B 3WFDH 3D39B 2JCCF 1JXJA 4LSUL 4PRBB 2CKBB 5F72S 4FQXD 4JDEA 2FT6A 4ALAL 1MJ8H 1IC4L 1U8HA 3KGSA 4X8JB 4R4BA 4PJIE 5BJTB 2H0FA 3QDJE 5CCJA 3O8XC 3ENEA 4OLVL 1KN2L 2LAAA 2WXKA 5A7BA 1KGYE 1PYWB 3MO1B 4PTUB 3GMQB 3OAUL 3BWZA 4OLEA 4CC4A 1BWMA 2VDKB 5DJZB 5A6MA 4KX7A 1BZ9A 4UQEA 2NUTA 4OUOA 3VD1A 3B8YA 1QYGH 1XH3B 2YLHA 1E9QB 2ITDA 3OJDA 1SVBA 4OZFB 2K6WA 2ZP9A 1S9VA 3VD7A 5KS9F 5KSBF 1I85C 2GBUA 2EE0A 2X4UB 4PHXA 2LV4A 1LNUA 1SFDA 4NX0A 4PP1C 3ML9A 3ARDC 1KJ2B 1K72A 3BPLC 4HIIA 5JIIA 1JI1A 3OTTA 1BEYH 4M5SA 2JSFA 3HC3H 1UATA 1NDGA 4XN5A 4IU2B 2JJTA 3TT3L 5DRNB 5HI3D 1QOKA 5AOIA 2FE0A 1U2YA 4IBUA 3IMSA 1AE6H 1BYPA 4NJAL 4QHPA 2EO7A 4QY8A 5EOTA 1S9YA 2FX7L 2YEQA 4DTGH 4M5ZL 4QTFA 3H0TB 1U8CA 3TO4A 1A0QL 2WBXA 1BFOA 1KJ2H 3FQ2A 3IT8D 5HSFA 3IRCA 2YIHA 4XP4H 4TM9A 5INCA 1URZA 3A3YB 3LKSA 4AKOA 3M17B 3QDGD 1NBVL 3HE7B 3VFPA 4K8RL 4JZJC 4KI1A 1GPOL 1FZOB 4YDKL 1QSFE 3VQ1C 4PGJA 4UM9B 4HWNA 4M8QB 1CU4H 5FGCB 2IVFC 3OXRB 1HXMA 1NL0H 1AO7B 1BQHB 1BQLL 2HFGL 5EA0H 1IC7H 5E5MB 2ARJA 2VW6A 4JFQB 3K8MA 4WU7A 1BPVA 3L5XH 3L6FA 2E27L 3LXUX 2BOLA 2XX0A 2XN9B 3CCHA 3LNDA 4PMFA 1FH5H 4Y1AD 4H8PA 1S7SA 3GMMB 1WV7T 1GJWA 3H6AA 3HZKA 4P2OA 4ZUVA 3QIWA 1V05A 2B3RA 2P80D 1F6FB 1Y6KR 2ZSWB 3BRDA 1HU8A 3SCMC 4N3UA 5A6LA 4KKAD 1IEAB 3H2WA 3TF7C 5MENE 1OQOA 3V0IA 1MIEL 3GPEA 4OIFA 4D9QD 3SBQA 1ZSDA 3KDMA 3OPZL 4FFYL 4NJ9H 4CW1B 2VSDA 3MV9B 1FNSH 2ICEA 4HFUH 4PCKA 2KHAA 1A14L 3OVUB 4IOSA 3UJIL 4LOFA 1O6SA 2WYHA 5IY5B 1QABA 2F9BT 4QJ5B 1RUAL 4UT7H 5CJXC 4YAQB 5K33A 1VGEL 2IPTH 4BE6A 2G75A 4GXVL 5AVZB 1ZA3A 4NQEA 2W0FB 4A63A 3Q9PA 3TPUB 4YGVA 2WPGA 4PGDB 3QB7C 4XVTL 5ERWB 1IFHH 2Y2WA 1BLIA 3L1FA 3H9SA 3DARA 1OSZA 1MCBA 4XC3H 1W72B 1KIQB 1IAKB 1U4FA 2AJVH 2MQGA 3I75B 4YHIA 5E6IB 3ZPDA 1E2ZA 5I18H 2PXYD 1T3FA 2E6QA 3KXFA 2W94A 4POUB 5IW1A 1LEKB 5DS1A 4HULB 1BXAA 4ZRGA 3P30H 3ARWA 1JCVA 4GAYB 1U33A 4MCZA 1WPCA 3FN0L 2WXOA 3WN5A 4TVPL 4IBYA 1M71B 4PP2B 1SQ2N 1AZNA 3CFDB 2FJFB 1P0SE 3APNA 1YNKH 4PJ5D 4GP4B 3QDGB 2YAQA 1CXFA 3NPSC 4PRDB 3PWJA 4HH9A 2AGJL 2W8CA 2DQUH 2VDQB 5ICXB 3ZDXF 1GYUA 5HYIA 5LNEA 1HHIA 1JVLA 4J3SA 1A0QH 4FQHA 4LIQH 4TUKL 3ZBMA 1U3HC 2OJ1A 1W16A 2VQTA 3MNZB 3L16A 3P77A 2W9LA 2A6IA 4U0RC 1T83C 2BY1A 4MXVE 2BWIA 1U8LB 2WWMC 2VKXA 4WU5A 1KELH 1MCPL 1OM9A 4I5BA 1FVDA 3U36A 5I1DA 1T1ZB 1CF8L 1ZT4B 1KTLA 3I6GB 3U7YH 5KSAB 2FECI 3P2TA 4KXCA 4DEUA 3FQUA 4F7EB 4L2LA 3TCTA 5MENB 5I6NA 4XMPH 4JGUA 4PI0A 1FN4B 4TVSa 4ZPVB 4XNMB 5D1ZI 3BIBX 4H8WL 4JKKA 5GZND 3SDCC 2I24N 4KPHL 1JJUA 2DJSA 3O8XA 2Y1VA 1TMQA 4MYPA 4PY7A 5FYJH 1J5CA 3I6KA 5HDBE 2C9VA 3MJGX 5JDJA 5DDHA 4Y7OC 4AENA 2HG5B 3BPCA 4XOBA 4HPOL 3OL2A 2Y3NA 4IQHA 3U82B 2PW2A 3BQUD 1QQDB 1D5XB 1VFBA 2A6JB 1IBDA 4LHQB 3VE0B 3KYOB 3HC3L 5DHEA 2C4FU 5EIIA 4OQ1A 4Y19D 2AKRB 4MQTB 2CO4A 3OQ3B 4L0ZA 4DETA 1ZEAH 3VSUA 4ADGA 1PLGL 4FCAA 5IROD 5C0DA 4HJEA 2NTSP 4DH2A 3O6ML 5DZLA 3DRTA 4W4OA 4XO3A 1JPST 4CN6A 2XRAL 5I8EB 4NEHB 3TO2A 1YEDB 2NY4D 1QLRA 3Q2CA 4MJ5A 3ZTNH 5IR1A 4IIQB 3LIZA 4PWIA 1CLCA 4J3OH 4ZYKB 3EZJB 3O2DL 5L8JB 2X88A 3BP6B 3KCPA 3QC6X 5ID1A 2PPCA 1IB5A 5H37G 5ICZA 4HZLB 4QRPB 4PLJC 4OBRA 3BVNA 2IH3B 3KHOA 1DO6A 5MERA 3VFMB 4Z5RB 4RMSA 5FO2A 3WJMB 5JXEC 4DZBA 1M1XA 4L48A 3JQOB 2Q87A 2WVTA 1FSKB 5DURD 1JZ4A 3B3BA 3FULA 3VU1A 4GW1A 1HINH 3FOMB 1Q90A 2MOVA 1BFVL 1GH7A 1OPOA 1S7VB 4FDWA 3OJMB 1DQLL 4IKLA 4K8RD 2X4OB 1VPOH 3UYPA 2ADGB 2KKQA 1OK8A 2QPEB 2P24A 4YVNA 4BA0A 4PV9B 1MG2C 1PJ9A 2KYIA 1KNOB 2WGXA 2ZKMX 4FX5A 2ZOOA 3UO1H 3VXRA 1C8PA 4L8CB 2LU4A 1NIAA 4KHXL 4WNQB 3UROR 4K3DL 2DQHH 4BZ2A 4JMXA 1NQBA 1MEXH 5TQ0H 2MTPA 3F7PC 4YSSA 3OKDA 3AW5A 3DPBA 1S7WB 4TKWA 1D5MB 3OKEB 4K3EL 2ALAA 4KY2A 1TLKA 4KFZC 1WGOA 3IEAA 5T1MB 1G1KA 2A6DB 4HJGA 5IQMA 4OV6F 2DL2A 1HQ4A 2JK5B 2PYED 3VXUD 2V9RA 3KPPB 2OXHA 3KYMA 5FA3B 2HA1A 5IM7B 2IWEA 5CGMA 2O93L 3SGKC 1IFHL 5IJCC 4DPRA 3G6JA 3T6VA 5LWYH 1ZLWK 1DZBA 4JMNA 4LMQI 4JCWA 3GSNL 4KK6C 5DUPH 5JLZB 5EEXA 5BZXA 3MVSA 2ZAIA 5EEVA 1A3ZA 3HZVA 2BIHA 2BDNL 1U95A 1QBLH 1MG3C 3FU5A 4NAJA 5DWUH 4I3RH 2CO6B 3M8OL 4HUMB 5AOMA 3IFNL 1NIDA 4B7LA 2G5BA 5JHLL 2DKUA 3KS0J 3QIBC 4FRWA 2CLZB 3SD5A 1I7RB 5ANMB 2Z65C 4F33B 3HEIB 3O6MH 3DOHA 3FT0A 1GGIL 3HBPA 5B1BB 4ZTOL 1NLDH 2NTFB 2YEZB 4JHZA 4NKIL 4WTWA 3VXMA 2ZJSH 1FV1A 2P5WD 4GY4A 4KJQD 3GI8H 3MNVB 2XVGA 1A6VH 4E9VA 5GRJL 4LDLB 5HHMD 3HW7A 5ITBL 5DUBB 1OAXH 4Y16A 4TTDC 3N9GL 2AANA 1YQVL 1QKZH 3HKFA 2X2UA 3N6YA 4FTDA 5ELIA 3PPSA 3KWTA 4U1LA 5FA4A 2R0LH 1QG3A 2WBJD 2JQMA 3A21A 2CWRA 3P77B 3QGVA 5EU3B 2E9GA 3ESVF 3K2IA 4LSQH 1L0XA 1UC6A 5F7DA 1E4WH 1G7JB 4JFQA 1PPIA 2FGWH 3L5HA 2J1ZA 2HFEB 4NQVA 1LQSR 3T2NL 3CH8A 3ZE1F 5E99L 4ABUA 3NIFF 1HXYB 2X87A 5DHVH 4GB9A 1K85A 1RULH 1AP2B 4KKLC 3WJJC 2CLRB 3S36L 1IAIM 3X1NA 1T7VA 3ELAT 4K5OA 2WP3T 1WISA 4PIBA 1F2QA 5E7FA 1S7QB 4U6XA 2K8MA 3AITA 3VFWA 4GIOA 3FFCB 1X5LA 4IU3A 1LMKA 3QG6B 4Y5XB 5G4OA 3MXWH 1KIPA 5HGBB 4OF3A 5EB9A 1IVTA 3BGAA 2BRRL 3UJTL 3IRZA 1R3LA 4PJAB 3BDYH 1CN4A 1V3LA 5B3SB 3DSNB 5KJ7E 2NQCA 3GPSA 4B27A 4LPTA 3SKOB 1GXEA 2DQJL 4PJAF 4U1JA 4KQ3L 2JI2A 1N7MH 4Z1PA 1OM3L 4FS0A 4AQ8A 1G7IA 1PQZB 4TRPL 2P5WB 4OFIA 1B4RA 4Y5YA 4EN3D 2YPLA 2PCPB 4QRQA 1ZHBB 5ITFA 3NJGA 2GCYB 3O6FB 1U8OA 5KTEL 4YXKL 1Y0LB 3IYLW 5MHSD 1WAEA 2JFCA 3GUTB 3OKNA 3J8F7 4K94H 4HW6A 5EEYA 2APSA 1RUML 1D6VL 4UAOB 3ZMNA 2CXKA 2YD0A 3MQIA 4R4NC 2FQGA 4NLAA 1JZDC 4S1SH 5KBDA 4Y4KA 1JV5A 1ASPA 4I0CC 4O2FA 1MFAH 1Q9LA 3WDIA 5ISZB 3DX7A 4EZJA 1CB4A 1C12B 5CU5A 2DQTL 4N4YB 1QR4A 2G3XA 2VLJE 4DN4L 4MZ3A 4B9PA 5E2WH 3A6BH 2R0KH 4F91B 4L5FE 5EC1A 5EF3A 4UV7L 1RMFL 1V3KA 1V7NH 1QHPA 3BO8A 4QOKE 1NAMB 2B4CL 1X9LA 1YNKL 3D0VB 3OG4B 4JVUA 5DD1L 1KZQA 4MQXC 3DV6B 2DQCH 3I85A 1JGVL 2JNZA 1BZEA 1GGIH 1FF5A 1IMHC 1GTFA 2GJJA 5ACMA 3MOAL 5IP4A 1OVZA 4XX1E 4AL8L 1W9XA 3QFJA 5TQ2L 2DMGA 4FNPA 3O8XD 5TK4A 5CNHA 2WTRB 4UZSA 3G5YA 3HZYA 5DZAA 5EZJA 3ZKXC 3FS9A 3O9WA 4X7SL 3L9RB 3BP7B 5CEXA 5AL0A 1YY9C 4I3SH 2VISA 1DLHA 4MA7L 4PJCE 4CN1A 4EZLA 3JYBA 3ZKND 4ZTPL 4XBEH 1IAIL 3G6DH 1JRHH 1FWXA 1ZV2A 3S35H 2R4SH 4XP9H 3BPOB 4HWEL 1A25A 1CK0L 5EOCJ 1H3VA 5M95B 4K3JH 2MCPL 3WTTA 4ZMXA 3ULVL 2YRLA 4OZHB 1Y07A 3LEYL 4AVJA 3O3AA 4JBSA 3MUY1 3JYCA 4Y5XA 3QUHA 1KTJA 3EXJA 4GXUN 2BIOA 2EDBA 2WUBH 5CO1A 3T4YA 4PUBL 4O9HH 2VN4A 3ALPA 4C54A 1X5AA 3O45A 3N2JA 1KLGB 4NC2B 4GT7A 4QHUA 2H0JA 2W59A 3GBNH 1T4WA 3E2HC 4L4VA 2F7QA 3MACH 1BQSA 3MXWL 1HXYA 1P4IH 1DLFH 1HHKA 3MUHL 2EUWA 1B2WH 3KJ6L 3WV0A 5DD0L 3LQZB 4WGKA 4PTTA 2X09A 2LLGA 3K0WA 5I5RA 5G55A 1LEGB 2EAEA 3X14A 5FFOA 5FV1L 1YEKH 2CALA 1OGTB 1JNLH 2VAAB 4AM0Q 4ZDHA 1XH3A 4FXKB 4RSVA 4B9GA 1JF5A 1U3JA 3I3BA 4LLUA 2HXAA 1LYQA 4PV1C 3IFOB 4RA0C 5BRZA 1XSIA 3F01A 1JXDA 2OCFD 4Y2OA 3RWDB 1ZANL 2H6UA 2UXTA 2UXFA 2F19L 3SO5A 3QEQE 3L5WA 1Z0NA 1H6TA 3EOAB 1Z2KA 5IMMA 4LDEB 4NFCA 5IQNA 5JOFA 4B9YA 5KZCB 2DQIH 2GI0A 4FLQA 5A7EA 3D69A 3GIZL 3NTCH 3TO4C 3UBXA 1QRND 2EDEA 4P2AA 2WSKA 2XG4B 2FHFA 1MAKA 4DJMA 4AUYA 2IBGA 2Q7YA 2XWXA 3G04B 3QZPA 3VQ2C 1IO4C 1B4JL 1Q1JH 1W0VA 2NR6C 1A1OB 2G2PA 2G0LA 1JHTB 4M00A 2B4CC 4XXDA 5KSAD 3GM0A 4LEOA 5H8DA 1YY8B 3QBTB 2DLFL 4MWFB 1YEDA 4PCTA 4CJ1A 3G08B 1IU1A 4GI8A 3TVMA 1L3NA 3C6LA 2QZ5A 3HRZB 3H2QA 4J4PD 4H20H 3VMOA 4TMPA 1MCHA 5I66B 3F62A 4I2XE 4TV3A 1H9DA 2WNWA 1U93A 3ATBA 5I1JH 1F42A 1FBIH 3QZOA 2GITA 1TF4A 3EJYC 4MMYB 4OGAD 4PRPD 3NFPA 4CVZA 1IRAY 4HK0B 3BWAA 5GGRB 4HC1H 5I8KL 3O3EA 1LE9B 2UWEB 1RJYB 4LLYB 2BVTA 2H32H 1A47A 2YD6A 1BBDH 2V2WB 4FHBD 2E7HA 4UUJB 5DRWA 2YD3A 2PCYA 2ADFH 4N28A 9CGTA 1YC7A 4HVBA 1A9EA 4PJIF 5IVXF 4A37A 5J13B 1UGNA 1TTBA 4JM4L 4A7UA 4G6FB 4LKXA 3RJDA 5L4IA 5LO7A 3FO0H 2PLTA 4ELME 1USQA 1SVCP 1F6AB 2EYTB 3ECBB 5CIPB 5IBTH 4XN4A 4ZZFA 4XXWA 4Z95H 3O3AB 1GL4B 3IJ8A 4HIEA 2KZ1B 3ZT6A 1F5WA 1TVBB 5KS9E 1FNGB 5CJXA 3IXTB 3TJHC 4WCYL 1E9PA 1LQBC 3RWHB 5JHLH 1NSNH 2IH1A 2UZXA 4BH8A 4XMKH 1ET5A 3V0EA 5ACLA 5ALCH 1MFMA 1UT9A 1B0GA 1DLFL 1R3JA 2X4QB 2XYCA 4QR7A 2YPLE 5CJ8A 3LH8A 5TQ2H 4AZ8A 1PZSA 4ZFFA 1T89C 2CDEB 1N64H 4BFRA 4OGYH 5DI8B 5BXFA 4KDTC 4IMKA 2W1NA 3LH9A 2DBLL 4OGXH 3ATDA 2RB8A 4Z8FH 2G30A 3L7FB 1KCRL 1UACH 2Y2YA 3U1QA 3B34A 2VR6A 3M6DA 3BH8A 3RIFK 2QSCL 1UADC 5ICZB 4JY6A 1ORSA 4RAVA 2IIJA 2Z1PA 2UWEE 4K5NA 1NCAL 1VCAA 2DLGA 3HFML 3LMJH 4WAFA 5HY9B 4XBEL 4RIRA 4YX2H 1TQUA 4UQBA 5IMOB 2H2PD 3RVXD 4B0MB 2HLEB 3CZKA 4LESA 3FUKA 4LLQB 2ED7A 1NCJA 3K4DA 1NMBH 2J2ZB 4H88L 3KVQA 2FZ3A 2J88H 3CVIL 4FQLH 4LASL 4MD0B 2ARWA 3MR9A 4HDIA 5BS0E 3CU7A 2WIIB 1RZPA 4P5SA 5B39G 2ZPKH 3ZYIA 3GSUB 3RJQB 4ABQA 4QTHA 4XMTA 4XN2A 1KPUA 2VERN 3VGAB 4FXGC 4F15C 3EJTA 1PIGA 1P7KB 3AFLA 4L4JA 3GTTA 1UD2A 3GTVA 1OTTD 4L8BA 3EDEA 3W3BA 4OAWA 5FUOH 5L8KB 2ICEB 1TYJA 2OFQA 4PGCB 4RQQA 1SDAB 5EO1B 1XHHA 3O6FA 5D2NB 3PWNB 3VXRE 3L4VA 3QCUH 1A6PA 1F41A 4LHUA 1EZSA 3PREA 4X5XB 1PQZA 4AGNA 3Q2LA 3REVA 1HCZA 4GO6B 2KDYA 1JGDB 1T4KB 3WTWA 4FAAB 3WI9A 4PVBA 4NT6A 4Z7QF 3LNFA 3I74A 2V37A 3WIIH 4D9LH 4EJ1C 5A3ID 1MDAA 3EGXB 2AXGB 5I17A 2SODB 1XSOA 3GZKA 4WU7B 4MSWA 2J2ZA 3ZGIA 5ENWB 3E2HB 4BK4A 2R1WA 1TJIH 4RNRB 5D5ME 5DUJA 1FHNA 2DYPD 2JJSC 2NZ9D 1I3VA 4NNPL 3S0PA 3VTMA 3W39A 2ENJA 4X99A 2YK1L 1SXNA 5FYLE 2GI7A 2YA0A 2HTLD 5CSGA 5C0BA 3VFOB 4ES9A 1VFMA 1T6VN 2R0WL 3CFMA 5IB2B 4B9IA 3B7YA 3CFDA 4L29B 2H8PB 5D1XD 2AP2A 1C16B 3FCSA 1T7ZA 4JRXD 5GGTA 2YSSB 3N41B 1NSNL 2C34A 5CXPA 2GUYA 2EXYC 3TA3D 4D0BB 3U1SH 3BPOC 5JDSA 2FBOJ 4OY9A 1YEFH 4W1TA 5F7LB 4OZHE 4FKHA 5FM8A 3QHFL 2PXYA 1SEQH 3MRKB 2OMWA 1QLEH 5EU6B 3S6CA 1ADWA 1A6UL 1ZIBA 4DIXA 2KQNA 2XV3A 1INQA 2AI0L 1U58A 1AHWB 2EH8H 1NM9A 5KJRH 1ZA3B 4I3RL 3BKJL 3GXMA 2C9RA 1BBDL 2BM3A 3STZB 1HYSC 2J71A 4U1KB 4WGWB 5C0CD 4X6FA 2E9WA 2YA2A 1K8IA 3ZUNC 2IDQA 3CPUA 1A4KA 4GO9A 2FRGP 4XO8A 3EG9A 1NGXB 4JFPB 3R1GL 1EA9C 4NDMB 3N85H 1MWAB 2CBMA 2H9GB 5CM1A 4N0RA 4MJID 3QO1A 3W2DL 1A2YB 2VW4A 1NAKL 3QHZL 4WO0A 3NOIA 5A16B 1H8SA 3FRUA 3ZL2A 5IJVA 5LHDA 2OPCA 2YRBA 5I5JA 2EVIA 5EPMB 1G1CA 4NWTH 4AW7A 2JKXA 2D2OA 1K5NB 3JUZA 4CBZA 3MRHB 1A6WH 4Z7WB 2HFFA 2HJLB 1MWAH 4ZPTA 2DQDH 3STLB 4U05A 5L7XH 4APQA 3CFQA 1T7XA 1L9PA 2Y5TB 1EUTA 1YAIA 3KYKH 4L4VD 3EKCA 4XWOD 5DQJA 4G8AC 2QSCH 4FFVD 4K5MA 4HK3N 4GS7B 1RAMA 4AIZB 4TQPA 2X12A 1NCAH 2CDFA 1E6OH 3OKDB 4KKCC 1ZJBA 3MGTA 3H54A 4QRRE 5AUMA 1S46A 3FUNA 1EEUA 3QR1A 1MRDH 5JIDA 2HKHL 4Z7OE 2FYVA 3EDJA 3P0GB 3Q1SH 2I25N 4KMQA 3QIBA 3K6IA 4I2XB 4AMXA 4KV5E 2CHWA 4MYWB 4RFEB 4HBCL 3LJ3A 1NZRA 2AEIT 4K8RH 3QZMA 4GG8A 2PCFB 4KRPC 4P5TC 4HBQA 5BZZA 4JO2H 2X4OA 1R33A 1J86A 4MRCA 1WZ1L 4JKPL 1JDAA 5GS1C 4X9FA 4M6MH 4Z3TA 1Z5LB 4HC1A 1UZ8A 5L2KE 1WD8A 1T2QH 5J13C 3CLEH 4DUVA 3UO1L 3B7SA 4A7GA 4XMLL 4ZO9A 2PYFB 2JJVA 1GC1C 2RHEA 2DQHL 3L7EA 3T71A 1NPUA 5IHZA 1SXBA 1TTAA 1D5ZB 3GM8A 3AADB 1J0JA 1TZGL 4HKZB 3GXFA 3QG7H 1P1VA 3RKPA 4U3HA 2VERA 3SDAD 3AUWB 4DP9X 2E9JA 4XO9A 1KBWA 1I9RH 2V7HA 1S9VB 5K1VA 4LSTH 3KPMB 2ED8A 1M6OB 3QNXB 5EORL 3IDJA 4JGJA 1T0OA 3W56A 5FGBC 4ZO8A 4X5LA 4DO5A 4TVUA 3AUVA 1MQ8A 5CR8A 2XXGA 3O2WL 3VX0A 3DX6B 2HJKB 4GQRA 4ZUTB 4PVLA 1EBPA 4GT0A 4PJGE 4X50A 2DTMH 2WLIB 2AABL 3P4MA 1T22A 3WFHA 2V3FA 4RFEA 2ZUYA 1IC4H 1V55B 5IQLA 4Z7WE 1JWUA 3BW9B 1X3DA 3HA0A 4GLRH 4YHKL 1Q0XL 4G42A 4TRPH 2CHZA 3R4RA 4LHUG 1P5VA 4FC3E 4PLKD 3X1GA 4WHYH 1BLNB 1S78D 4NHUA 2J8UA 5FO8B 4BEIA 3QPKA 5HGAA 1QACA 2AAVA 4O02A 2VXUL 3LZFL 1I3RA 1HKLL 1QBMH 4TS6A 1UB5A 3HUJE 5F9OL 5D7SL 1T03L 3T3MF 3AU1B 5IF0A 1U58B 4L3EA 4XWGL 4FQ2L 4LDCA 4JG9A 1IQWL 1NGWB 5F7NC 4PS3A 2MCAA 3RX5A 4RMBA 5C09A 3VFGH 5HXMA 2PO6D 5LLIC 2G3MA 3OLDA 3FN0H 3EYUH 3QK0A 4N87A 2FDBP 2ESVB 5AEAA 2RACA 2ZXWB 3QZNA 3BUYB 4U1HB 4ZX6A 5IWLC 4L37B 3MJ9H 1P9MC 2OMNA 5LGHL 3T0ED 1EDQA 4P06A 2HRPH 3ZE2B 4HFWA 2W07A 2Y2TA 1NIEA 4UOW0 5DD5H 5FLUA 5LDSA 2YD1A 4Z77B 1WIPA 4LAQL 3MJ7B 5I1AB 4X5RA 2BS9A 4FEIA 1NOAA 3UTTE 1B2WL 3KJ6H 5C2BH 1BA9A 1UUSA 2XWDA 2NY3B 2OA9A 4PJ8C 4P9HL 5C0RL 5T3XE 3DETD 5I0DA 5CSZA 4GAYA 5SWQA 3JWNE 4TQEH 2DLEA 2CJUH 3EH3B 1G7HB 4XH2A 2Z8RA 4YSEA 3KXFB 1G0XA 2H2SD 3BI9X 5DJDA 3LKQB 3WTSA 2GIYA 1PLCA 3TJEL 4NN6B 4QHNB 1O7VA 1DYZA 4A2LA 2BNQB 2EDHA 2CDEA 2XA3A 4LEXH 5G2NA 3SKOA 3QUMB 4J3XA 4YGVB 2EXWC 2DMHA 4YXLL 1L5GB 2XJKA 1M05B 3CHSA 3PABB 4M7ZB 4Q74A 5JORB 1KBGL 4PWEA 4D8PA 1G7QB 4WW2F 2QR0B 4HLZH 3L3OC 4UBDD 5DVPA 5C6TH 1HHJA 3FQXB 3LS5L 1TTUA 2C7FA 4P23B 3U9WA 1J05A 4WNJA 4OKDA 3DDFA 1RHHB 3FC8A 2D3LA 4PSPA 3I6SA 3UZQB 2KERA 4OFVA 3EOBA 2QLYA 4WO4A 4FA8A 3DJ9A 2P7TB 2XWTA 4MD0A 2QVMA 3RHWK 4WO4B 2YXWA 1GPOH 3D2UA 1PIFA 1ADQL 1F11A 4O02H 2R0KL 1ETJA 1S7RA 2WXRA 4JM2B 5F7BA 3X12B 2FX8H 4NUGL 4MNQA 2RALA 3GJFK 2B4CH 2VDMB 5ISZA 2WC7A 3IDXL 1HS6A 1NGWA 4KOCA 3RZCA 4M43L 2P4AB 3NA9H 1TEYA 3ROLB 4QT5A 4I0KA 2GSIA 3B9VA 1D6VH 3ARZA 5AAMA 5AW2B 4HS6A 4P5TA 1HINL 3PHOA 4F3FA 2XWJB 2DM2A 1MW3A 1MFBL 1JNHA 2XUWA 1I3RB 2R9HD 3JWNC 4AIXA 3GJFA 5D7JC 5I16B 1XEDA 4A7GF 5IOPA 5GZOA 4TSBL 3UBXI 1T20B 3KNBA 1F90H 4LGRB 5KJRL 4E9LA 5JIMA 4D9RE 4AUJA 3KLQA 2XTJD 5IIEB 1EJ6A 4XHQA 3S3JA 1FC1A 1OP3K 2MCPH 3U0PB 5CSZB 2NY0D 4Y4FD 1NFKA 3QNZA 3IGAA 4ATTA 3QZWB 1ZGLM 1C9SA 2NUPA 3W0WE 1A3RH 4OLXH 2W9DL 3LPPA 4EIUA 4NM4H 5BQDA 1LMIA 4GI9A 1EO5A 4ANXA