1DSWA

The solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGKIGKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE (CU-ZN)
publication title The solution structure of a monomeric, reduced form of human copper,zinc superoxide dismutase bearing the same charge as the native protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1dswA00
1SRDA 1XTLA 1CBJA 4BCYA 2C9SA 2VR8A 1Q0EA 1YAIA 3KM2A 2WWNA 2WWOA 3KH3A 4A7GA 3CQPA 1UXLA 3CQQA 2VR6A 3HFFA 1OEZW 3L9EA 2AF2A 2LU5A 1OZTG 1RK7A 1COBA 1YAZA 1YSOA 1JCVA 2AQPA 2V0AA 1SXZA 4OH2A 2XJKA 1PZSA 3KBEA 3GTTA 4N3UA 1OALA 2WYZA 1PTZA 1ESOA 4OJAA 3LTVA 4A7GF 3H2PA 1E9QB 3PU7A 3GZPA 3KM1A 1AZVA 3GZOA 1U3NA 1Z9NA 2XJLA 4A7QA 2AQQA 2AQTA 4A7VA 1SXAA 4MCNA 1E9OA 1IBHA 1HL4A 2GBVA 2ZKWA 1TO5A 2GBUA 1E9OB 4FF9A 5KBLA 1N19A 1BZOA 1CB4A 1KMGA 4A7TA 3GTVA 5CU9A 4L05A 1SXBA 1EQWA 3F7KA 1DSWA 1SXSA 1Z9PA 5KBKA 1OAJA 3T5WA 1JK9B 3QQDB 4A7SA 1E9QA 1F1AA 2C9UA 3HOGA 4A7UA 2E46A 1FUNA 1N18A 1PU0A 2Z7ZA 5KBMA 1SDAB 2JCWA 1XTMA 1F1DA 2NNXA 3KH4A 3ECWA 1B4LA 3HW7A 2AQRA 2WZ0A 1HL5A 1E9PA 2WZ5A 2JLPA 3L9YA 2K4WA 1XSOA 2Z7WA 3RE0A 1E9PB 2AQSA 3SODB 1L3NA 2ZOWA 4N3TA 1JK9A 1BA9A 1F1GA 3QQDA 2AEOA 2VR7A 2Z7UA 1SDYA 4BD4A 1IBFA 1B4TA 2GBTA 4U4IA 1IBDA 1OZUA 1IB5A 1UXMA 2WYTA 3F7LA 3GQFA 2WKOA 1MFMA 3K91A 2Q2LA 1IBBA 1SOSA 3MKGA 2E47A 2AQNA 1F18A 2APSA 4MCMA 1TO4A 4BCZA 1QUPA 3H2QA 3KBFA 1S4IA 2SODB 1SPDA 3ECUA 3GZQA 3CE1A 2ZKXA 1DO5A 3MNDA 4B3EA 3S0PA 1SXNA 1SXCA 1P1VA 1EJ8A 2WKOF 2ZKYA 3ECVA 2R27A 2C9VA 2Z7YA 2WZ6A
chains in the Genus database with same CATH superfamily
1E6OL 5FYJD 3QGVA 4QRUB 4YK4C 1AY1H 3RDTD 5I76A 2AV7B 1TITA 4K9EH 3KVPA 1MDTA 4HCRH 4I77L 3SPVA 3L13A 5ACZB 1FC1A 2XYCA 3LZNA 4HU8A 4L9DA 4MD4B 4TVPD 1BQ5A 2EIEA 5DS1A 4KI5F 2LQRA 4IDJH 5FGBA 1NIDA 3MA9H 3RURA 3QIWD 4WUUB 4BFJA 5BNXD 4Q9RH 4ZMOA 1IEHA 1PZBA 2OBGA 1A6TB 3IFOB 3ELQA 4GJTB 4WDIB 5E9DD 1WFOA 1HI6B 5L9DL 4OH2A 3TN0C 1A5FH 3ZTNH 4PJIE 4B7LA 4UT6H 2RJMA 5K59E 4PVNA 4YLQT 2WCGA 1N67A 3ARDB 1BXAA 3CVHB 3ZMRA 5AZUA 4LSVL 2A99A 1N2RB 3OJ2C 4M6AA 3HE7D 3K7UA 1A21A 1FZKA 2LLNA 1FF5A 4FQJL 3REVA 3VO0A 3HS0C 1QR1A 5JPMB 4L9LB 3A0OA 4R96A 4ZX6A 2PXYC 3ME0B 4ZMYA 5IW6B 1DLFL 4ONFH 4WDIA 3IFOA 2EYTA 4FA7B 1ZE3C 5DURB 3T4YA 4PRAB 4LCWD 2JKJA 3MXVL 1N10A 3VD9A 2RACA 1FCCA 2VDOL 4K7PL 1IKNA 3A6CL 3B7UX 3CVHA 4WJG3 1A64A 1DVTA 4JFDE 4JKPL 4UQAA 2VERA 3HG5A 1AC6A 4GKNA 1YMMD 3EF4A 4KXZI 3QE5A 1NAMB 4JQIA 2DJMA 1NCWH 4Q0XH 3SY0A 4ELME 4WTQA 4UQEA 3QH3B 3HBGA 2BNUB 1Q9LB 3CBJB 4W9IC 4LVOB 4WWNA 5JPMA 1DZ0A 1MKFA 3QWOB 1NJ9B 2HRPL 1J1XL 3ME0A 5EULV 3UG4A 4YHKH 1FRGL 4P04A 1J0JA 2ZYSA 2IFFL 5C0NC 4Z8FH 1CVRA 1J10A 5EPMB 1H3PH 4PJAB 4IRSA 4ZSOE 1HH6B 2AS5M 4AEHL 4XXDA 3ZDYB 4B95C 2YJQA 4DTGL 2A6KB 2QGEA 5GS0D 2BNUA 1Q9LA 2ZAGA 3SDAB 3KLHC 2VISB 1W6WA 4O2EB 2A9MH 4IHOB 3DO7B 4UOW1 3JVGA 2ITFA 3ZDZB 5D7JC 3ULUF 4PJGA 2OYMA 1ACYH 1XF3B 2Z35A 3O3BA 2GHWB 4ATTA 1IC5H 2VC2B 3T0BA 4R2GB 4MAYD 4UQCA 1KFAL 4TSCH 2BNQD 4PJAA 1J5OH 1HH6A 5FC9A 4CU7A 3WG7B 1JXGA 2HX7A 3NESA 3OMNB 4KITB 3SDCA 3SDAA 1A6PA 3SQOL 4FI7A 4EDWH 1UA7A 4IHOA 4M6ML 4PR5B 2YWZA 4TS6A 3NEEA 4FTDA 1D5MB 3BH9B 3M7FB 3HMXL 3MRHB 1R47A 4XXCA 4DP8X 4K3DL 1KGWA 1ZLDA 1DBMH 4JRYE 4PS8A 2R0LL 4JO3H 3AAZB 4GI6A 5MERA 1A9EA 1QRKA 2BOLA 2Y2WA 2NXYD 4F27A 2EDLA 2PKDA 2YN3A 3QUYA 3MCKB 2E7LC 1KTCA 5CLWA 2DQTL 2IF7A 4WV1C 1CXEA 5CSZA 2OJEA 2D9CA 1QRND 1GIGL 1NGYA 2APXA 1SYSB 3QIUC 4HIPA 5DZVA 3MGAA 3D4YA 3QYCA 4LEXH 4BFRA 2IOOA 3SZ6A 5CIPB 1N19A 1BBJA 4GW1B 5DR5H 1P7QD 5EIIG 4XN2A 2C3HA 1ZIAA 3P30L 4W9GC 3W5MA 4F93B 1A7RH 4JO8A 3KHQA 3BEWB 4R97C 5HXMA 1X3DA 1VHPA 2WBWB 2VOTA 3CVHL 3MCKA 4KK5C 3DIFA 4G6MH 1XIWD 4P59H 4C56B 1LEKA 4PJFF 2OZ4L 4I0CC 1XMEB 4JFQB 1G9ML 3QUZC 2OTUB 4IRJB 2VXVL 5AL8A 1L7IH 2XOTA 3MKKA 3PL6B 2R39A 5A2LH 2EDDA 2MSPA 1CBVL 1BZ9B 2PPFA 5B39B 2ED8A 3ZL1A 4GW1A 3WLWC 5BZXA 4NO3B 5FA4A 4NN5C 1OTUD 5EZJA 2O1AA 3MLVL 3MROA 4NRXB 4FFVC 3MOQA 1B3JA 4M7ZB 1DBBH 3TL5A 2EH8H 1AFVH 4EI5A 2MCMA 1NAML 4YBLC 5FWRA 4JFQA 3MRMA 2GBTA 2OTUA 3ZL4L 5D7IF 2CIKB 3BESR 2VLKE 2N59A 2ALWA 2X10A 1P4UA 3PL6A 4H1LG 2CO2A 2Y36L 1X5ZA 3QQ9D 2FNBA 2QR0B 1WZAA 3GJEB 2J21A 1BZ9A 3AUWB 3EO0B 5I1DB 5FUOL 2CDEA 5FUCE 4YHNA 1DBAL 2P26A 5B39A 4P9MH 2HJKB 3LRSA 1SJVA 3L2NA 1MHHA 3HC3H 4NO3A 1NMCC 3LN4B 3D39D 4JMXA 2F19H 2MWCA 2QSCH 1EZVY 2OR8A 5DRWA 4O9HH 5D93B 1IGML 2EXYC 3CN3A 5F9JB 3DTDA 1U91B 1CJYA 1N4XL 2ADGB 2X4NA 3IJ7A 3N55A 1P6AB 2OMNA 3M07A 3VXQA 4GBXA 4JM2B 4F8OA 2GHZA 1CBJA 2EXWD 4TTGA 2EVGA 4JPVH 1VFBB 3MACH 4BFNA 4JLRB 1G7IA 3KLDA 3TBWB 3CSGA 1IFHH 2A77H 2UY7A 3IS0X 5D72L 5J13B 1R5VB 3CN4A 3KLKA 4XPAH 2VC2L 4JFYB 2IDQA 1RK7A 1R3JB 3GXUB 4IOFD 2H3KA 4ZUTA 4OF6A 5BXFA 5TE7L 4M3JA 3ESVF 1PG7X 2ADGA 2Y6SC 4O4YL 2R7EA 3U7YH 4JREC 4LE8A 5I82A 4Y1AE 4NC1C 5DD3H 3TT3H 4OZIE 4Z7QE 2WYZA 2CG9X 1RJYA 1ICTA 4Z9KB 3HVDA 2J7LA 4KOBA 3Q2CA 2XVKA 5E8EA 3PU7A 1YY9D 4X6CF 1TNNA 5DVKA 4JLRA 1A7BA 2CM5A 2XVBA 1PCXA 1FPTL 3STLB 3IFLL 1H6FA 5JNYB 1R5VA 3LZQA 4Y8AA 4OLXL 1NC2D 1P9MC 4IKLA 3OMZA 3FC8A 1RIHH 5FIEA 5C8JB 2Y0SA 2EDYA 3PDGA 3WNLA 3KWWB 5ESVA 1OP5H 3FOMA 3PUCA 3TZVD 1BOGA 1S9YB 2AXWA 3PGCB 3LKNA 2JCCB 2CK0L 2AJZB 1OE1A 3FAXA 1M6OB 1R0AH 4L2LA 2QGDA 4JGUA 3STLA 4DP9X 3AB0C 2BSEA 4IS6B 3O11B 1ES0A 4U31A 4XPFL 3MC0A 2OYLA 5CGBA 4Y2OB 3LHPH 3TCLA 5I24A 1HESA 4Q6IB 3AT8A 3UAAA 1QVOB 1UEMA 3PWJB 1BEXA 3BP5B 2LTQC 2R2CA 4Q52A 3MRNA 4Q58C 3DOSB 2XBDA 3WMQA 1XQ4A 5KSBE 4HAKA 2JKWA 4OGAD 1GC1H 3LD8B 3FB8B 3S5LB 4I0PC 2DM7A 1MQ8A 3RWJB 4DGUA 1TZIA 3GUFA 1IBBA 1FNEA 1QSFD 1EEZB 2E47A 3H54A 3QWQB 3IRCA 4KRNA 5DO2D 2J5LC 4N68A 4H25B 5C2BH 1IEAA 4BE5A 4KVNL 1MJ7H 2BOCA 3RNKB 2VXSH 1TSRA 3PGFH 3DHUA 4CAGA 2EH7H 1M9WA 3PWJA 5CEXB 2YD8A 4Z7VF 1KG0B 1UWXH 4PJ8D 5L4IA 5T1KB 2GUOA 1A3QA 1GZHC 1HKLH 3IDXH 3OHXB 5AOZA 3SCMA 1WEJL 1F42A 5C1MB 2N7SA 1OSZA 3ZVVA 4YSPA 1YEHH 4UIKL 3W3BA 1TLKA 2XV6B 4K3HA 2H1XA 2EVIA 1EEZA 5BQ7A 4Z7OF 1TQVA 1AZNA 3FHAA 4MCYB 3GI9L 4ODXA 4N6QA 3F58L 3RNKA 2XFGB 5IB2A 4YSUA 1AAJA 4OF8A 2GJ6B 1I9JL 3QNXA 4Q6YA 5CEXA 4HT1L 2XBTA 4DERA 1TMQA 4MJID 4QJ5B 1BIIB 2O5NA 1R5IB 5DF0A 1A6UH 2ID5A 1RZJH 4JFEB 2NY2D 3U25A 3PFUA 4WHYH 1BVNT 3P0YH 3WNJA 2XWRA 1S7XB 5CZRA 4IHBA 4NZJA 4MCYA 4JCWA 2AK4B 5D2LF 2VL5A 3APCA 1AZCA 5KS9E 5BZZA 1HL4A 1U8JB 3F7QA 3QZBA 3FQ1A 2GJ6A 2R2HB 1FVEB 3B2DC 1XBRA 2OCCB 4JHZA 4NP4H 1CLZH 32C2B 1CB4A 1I8UA 4EIZC 1MCFA 3N50A 3MI6A 3VMOA 3X12B 1Q9WB 3RLSA 1R5IA 2X40A 4NIYE 5HI3C 5A3IC 2CKNA 1WISA 4UAOC 5TDPA 4ZAKD 1Q9OA 5GZNC 5A6LA 3ILEA 3UGEA 3ARBD 3V4UL 2BVYA 2X09A 2EDXA 2Y24A 1BQLH 1IT9H 4L8BA 2AK4A 1HOEA 1I8IB 4X8CA 3D07A 5HYJE 43C9B 1P4LA 4LFHG 3HNVL 4XVOA 1U8JA 4KDWA 1YEWA 1FVEA 1FV1B 4NQCA 4OCMC 2UUDH 3W2DL 4C47A 3NH7H 5GGQH 5AB2A 1I9RL 1KTDA 1U3JA 2X4UB 3O0RH 3QEGL 4OJFH 5L2KD 4YSEA 4QO1B 3BJ91 4AQ1C 1RJZA 3CIQA 4JO1H 4X8JA 2CLZB 5INCA 4PVMA 1FIGH 3P9MA 4U1KB 5I5MA 3SQRA 5DHDA 1I1FB 1W8OA 1MRCH 5LBVA 4KUZL 1JF5A 3V0WH 43C9A 4A39A 1ZSDB 3AUVA 1HXYB 3ZXAC 5GGVH 3OR6A 4XPHH 4ZW5A 3S6CA 2EUZA 2OR9H 2APBA 3SOBH 4KXBA 4G8IA 1DEDA 1CFBA 1J87A 1ZTXL 4FZEL 4IBVA 5IWLC 3QJZA 2UVFA 5MEPA 2GPZA 3H53A 4XN7A 3D4ZA 5BRZE 1QQDA 2YUVA 1OGAB 4X8GA 2J1KA 2R2BB 3MX0B 1HXYA 4XNUH 2HLFC 4GI8A 2BVPB 4PVLA 3SE8L 2PCPB 2PYEB 5F7NC 5C0FB 1FIEA 1TZOA 2VSCA 2DLEA 2IMNA 5ANMB 1DJZA 5JHLH 3KYMB 1KELL 2V37A 4POYA 1OEZW 2WXPA 3C8KA 1COBA 1T80A 2DQHL 5EORH 1N8OE 2EINB 3WUZA 4QHMB 3VFOB 3TJHD 2HRHA 5JW4Q 5FUZH 1JPSH 2VN6A 4P9HC 5A2CA 3H3PH 4AMKL 4KI1A 1CGUA 1U8PB 1QEWA 1U3YA 4R7DB 3MX0A 4Y19A 2XA8H 3K74B 2BVPA 2BNRE 3ISWA 5C0FA 4M9OA 1GGIH 2PXYD 2NR6D 3E6FA 2P1YA 3VVVA 3KYMA 5D1XB 5IF0A 2J1YA 3AQZA 5EZPA 4GFTB 1ZV2A 4QNPF 2CJUL 4QHMA 5JQIB 4DVBA 4DUWA 3A4DA 5CSBA 1FNSH 1SLUA 3PWPB 3Q2WA 3ROOB 5FW6A 3SE6A 1DJYA 1FO0B 3F8UB 1Z9SB 3BN9D 3JWOH 3QCTL 4G9FD 1AR2A 3KLAA 4QYOB 5BXFB 3WTXA 3CZLA 2YEVB 3GIZL 1NMAH 3ZKXC 3IEAA 1QAWA 2XN0A 1TT6A 2OV0A 2PCXA 3IGAA 4U3XA 3ECWA 1G4MA 4NO5A 1XGUA 3M86A 3PV6A 3FFCE 2WZ0A 3DI2B 1NCNA 3ESNA 4GO9A 4Z3JA 3CZGA 3VACA 3BVWA 3O6ML 2PR4L 2J1XA 5AWNH 1Z9SA 4PP2B 1BA9A 1ET8A 1SOXA 2DM4A 5IQOA 5HGBA 4RVBA 5DJ2B 2VQUA 4F33A 2A73A 3GKWL 1WK0A 3S4SG 1KEML 4LCCA 1MEXL 1WGVA 2D7OA 4WI0B 4HOZA 2DWSA 3SKMB 1OARH 5CR1A 5D7JD 1O7SA 3JUYA 1T83A 3T3MB 4NQEB 5EBLA 1L5GB 1K5NB 1JXKA 3BSZH 1WPCA 3QYMA 1HX0A 4LBEB 3L2LA 2CKBB 2PPCA 4N5EC 4XHQA 5DQ9B 2W65B 3G7TA 2H9GA 4QXUL 1BWMA 3FZUC 2CJTA 4L1LA 3WEXB 1O9VA 2XQYA 3NCXA 2JB6B 3NA9L 1A4JB 1E28A 4M61B 2BHYA 5EMYA 4TLSA 1YPZF 1R9FA 4WI0A 1JGVL 4WW1A 1HHJA 1FH2A 1MCJA 2N3JA 4MXVF 3SKMA 1M3JA 2WXMA 4D0CB 3KBPA 4MZIA 2AQ1A 4RFEB 3QUHA 3ZDXF 4UT9H 1L5GA 2A4CA 5IP4A 3K2UH 3OXRB 5JO5A 4P23C 3QEHB 4KJYB 2PNDA 4LBEA 3ARYA 4YGAB 5E0QA 2R83A 1CUOA 3O2VL 2CKBA 2E4TA 1K3ZA 1ZGLP 4UDUB 3AZUA 1PVHA 3U79A 4YDNA 1BXXA 2FBOJ 3NCMA 2JFCA 1VZHA 3B7TA 1FI8C 4H0GA 3GIVB 1HWWA 1NGZA 1LDPH 3EBGA 1KIQB 2DLFH 1BAFH 4OZFH 1Z7JA 2G2NA 2GJZB 3MBXL 4MVBC 4J3TA 4Z76A 1UD5A 4RSVA 5D7LD 3QISA 3ZRCC 4C4KT 3WKYA 2Y5EA 4Z7WE 3MYJB 2EICA 3QEHA 4HHAB 4AQEB 2V5TA 2FLRT 1UZ6F 3ZE1F 1T0OA 3M46A 4K94L 3C5JB 4Z7AA 1TQTA 2UZPA 4RDBA 3OPZH 3ASNB 1LO5A 5DS8B 5FUCC 1IGTA 3KWUA 5CLYA 1PNDA 3ZHLA 3GIVA 5CN3A 1SXBA 1J1PL 4Q14A 5FWQA 2V7HA 5F6IB 2GJZA 1EIBA 4TULL 3MV11 2M26A 4P4KC 2V6HA 2BJML 3E1ZA 3V0AC 2F54E 4XCFH 5E4AA 4QRSA 2NNAB 1IM3B 1BQUA 2HFGL 4AQEA 2WB7A 2CRIA 1F3JB 3F6JA 3DSFH 4PTUB 4G80A 1QATA 2Y07H 3HR5A 3NJFA 1VFAB 4XNBA 2TRHA 4KV5F 4IIQA 1KWKA 4UAHA 1O6SB 2Z7WA 1FO0L 4N2KA 3SGJC 4BZ2H 4UT7H 3GGWA 1PBYA 2W0LA 1F1GA 3P3TA 5I2IB 4TQ8A 1T1XA 4PJDE 4V1DA 3BVXA 2A4ZA 5F70A 1XL6A 4X4ME 3W39A 4XI5C 5FHBL 2NNAA 3EOTH 5DYFA 5DC4B 1IM3A 4I5BB 2WQXA 1YEFL 3GM0A 1PZAA 2F53D 3JT2A 1WAEA 5IIEB 3BQUD 2PYFA 4NHUA 4HPYH 3J07A 1VFAA 2ROXA 3C8HA 2JNZA 3CLFH 2EXYD 5EZIL 1GY1A 4F7TA 4HXBL 2L7QA 1KEGL 3D06A 4P2QA 4Y5VB 3VFTB 5SWZE 3VGFA 2GI7A 1VGEL 2D31B 1M9SA 1OT2A 3MR9A 5DD6B 4U4BA 2X70A 3QJUB 2W94A 3B1TA 4I18A 1BJ1H 1P84J 3O3EB 3TWCH 1AQ8A 1X9QA 4JZJB 4LOUD 1ZXKA 4FABH 3RJQB 4FQXB 3IMUA 1KTLA 4LXFA 2YA2A 1PLGL 4IYKA 1FGVH 1E5AA 1TZGH 3IDMA 5JR1L 3TFBA 3GXPA 2CKBL 4PHXA 3I3DA 4U6TA 4PJFB 1ERNA 2NMSA 1QYGL 1RUPH 5KJ7E 4WWKB 1CVSC 5D9SA 3VFTA 2O26U 2BP0B 3I2CL 2VDRB 4DKFH 4N4YB 2QBWA 2RR3A 3FCTA 1LEIB 4UTBA 3L3HA 1PSKL 3MRLB 4YQXL 3ILQC 1RPQA 4XNZC 1PTZA 4LZKA 5KW9L 3BZFB 3V4PH 3B7YA 3MLYL 4RMBA 2FBJH 3FF8A 4H0HB 3BFWA 4O51A 4AKOA 1HVXA 4L8DA 3VWJB 1OGTB 3TO4D 4PJFA 4GXVH 3RUGE 2ZE0A 2I24N 3T3PE 4CC4C 2I32A 4PGCA 1LEIA 3NN8B 2X28A 4MZRA 1AGBA 4KFMA 5B3SB 4KZDH 4YFDB 4X98B 2XQBL 3OAZH 4JFWA 1S9XB 3HNTL 5I5IA 3B3IB 2WINB 4BK8A 1G43A 2JSFA 2YBRA 4MLSA 5AG9A 1FL5A 3B34A 5E2TH 3RWGB 3FRPB 1YEEH 1ZVHA 4Q9BA 4XB7A 3U4BL 1GCFA 1HZKA 3VWJA 3MV9B 1QI4A 2JCWA 4MDJB 4BQBA 1YZZA 3WS3A 1I7RB 2EIBA 3HI5L 1UZ8B 2BP8B 1L6XA 2FYYB 3O4OB 3VFRA 4XCYB 2AQSA 4K8RD 1SOKA 1U93A 2W95A 1ZLUH 1UM5H 2JKRM 1TCMA 4XP9L 1BV8A 1XCWA 3B3IA 2WINA 3IDYB 3UTZB 2DZEA 3TT1L 5I0YA 3MTXA 5E94B 5IFHH 3RNQB 3WO3B 1WTLA 4AVIA 1CURA 1D5XB 1S7RA 1MAMH 3MV9A 7FABH 3LEVL 4MDJA 1KY7A 2C3WA 3QORB 2C9RA 3KJ4C 4PRPD 2PTVA 3T2LA 3LZOA 2HFTA 4GAJH 1UZ8A 3X2QB 3CX5K 4GUPB 3M45A 3X1EA 4XCYA 4CMMA 4X6CB 2EO9A 2ICWJ 3QG6A 1LK2A 2NT0A 4ZRGA 4JQXC 4WNQA 3BIAX 5IJVA 1E6OH 3FSVA 5F97E 1B3IA 3EDDA 2JH2A 4HC1L 4LPTA 4AT6B 3D0VA 4PSRA 5E94A 3BH8B 2OCFD 2LABA 4M4PA 4I77H 1M3IA 2XTJE 4OD3H 5C0BE 2X6UA 1CPUA 2CDGA 3AG2B 3MLSL 3ZPDA 2K6ZA 3CH1B 1TVDA 3WY2A 2FEDD 5EEXA 4LVHC 4OSUL 2H2PC 4HKBB 4X6CA 5E56A 3UABA 3ZYOA 4AK1A 5J1SC 4UTBL 4WI2A 2YPKB 4LSVH 2BFGA 4AENA 5H94B 2O6EA 1I8MA 2W07B 4FC3E 5B8CB 1LMKA 5JDJA 1F5WA 4D9RD 1DUZA 4PJ7F 1MAKA 1QSEB 2OMXB 3BH8A 4B9CA 1YMHA 4FQJH 1BFVL 3Q0HA 3T8XB 5DFTA 1FZMA 4NM8L 3R8BB 2MHAB 5E5MA 4KXCA 1TF4A 2I7SA 2B15A 1CLVA 5I19L 1DLFH 3FQWA 3L5WB 3O6KL 1BAWA 3QB7C 4MNQD 5H4YA 1N0LB 3UJJL 3MXVH 4PJ9D 3UTPE 1E9OB 4OLEA 4R7NB 5HI3D 4K7PH 2VDRL 2FIKA 4A2MA 3A6CH 4XCNA 5GZND 2YPKA 2YAOA 2WLIA 4YLBA 4JKPH 1AIFA 5B8CA 2R29A 1W2KT 1J8HE 2X1XR 1DE4A 5FM4A 3ZKQD 5C07E 2XCMC 2Z1PA 4XMWA 4AEEA 3IBEA 2NY0C 5K33A 4PRHB 5F9WB 1SNRA 3LKOB 1AQKL 1DJGA 2VN7A 4MS8C 2UXVA 1AGCA 2HRPH 2DWDB 1BD2A 4AYMC 4P2RA 1WWWX 3WTYA 1FRGH 2E6PA 1FZOB 3FMGL 2A74A 3AMKA 3ISRA 3T0EE 3L5HA 1HHGB 2IFFH 2FHFA 5I6LA 3CCHB 1DCEA 4JFHD 4RDQF 3QEQE 3UFIA 4AEHH 1MCQA 3WTSA 2Y3NA 3FCBA 4YE0A 4A1RA 4DTGH 1B2YA 4MS6A 2VKXA 1D9KC 4JG0L 5J7CC 3VXOA 3BIKB 1S7QA 4PRHA 2DOCA 4LLWB 4LFHD 4LASL 5F3HB 1MFAL 2DWDA 4HX1A 1GS7A 4NNXB 2EACA 4FMKA 1HHKB 4DUXA 4NQUA 4AV4A 1HXKA 3AY4C 1KFAH 1XSKA 1XSJA 4BH8B 4WFHD 43CAB 3CHXA 2YFNA 2YFOA 2JWYA 3SQOH 1S7VA 4M6MH 3D18B 4LLWA 5D55A 2HLFD 3FB7A 2WM0A 1LP9F 3DX9B 3HMXH 4K3DH 3Q9QA 4NNXA 4MA1B 2R0LH 4E0RB 4N1EA 5BRPA 2FJFA 4RGNB 4KHTL 4NAMA 1I7TB 1THCA 3OGOE 4FMVA 1GC1C 4UZGA 3TNMB 1AGEB 1J48A 3D30A 3DTUB 3MRKA 3QUXC 3TOPA 1QFPA 3GJFA 5C08A 43CAA 4U1SB 3ZDWA 1IBZA 2AMGA 1UWYA 2D7QA 5EG6C 2DQTH 5D2LA 4TNWK 1DSFL 4FA8A 4ZMLA 5C7XH 5CEZD 3SE4C 5C9JB 1JK8B 3JV5A 1GIGH 4Z7UE 3QI9D 1BQHG 4IBSA 2HT3C 2QMKA 4NBZB 4G42B 4JPIA 3F04A 1AXSA 4E0RA 1XWVA 3INUL 4JW3A 4NZRL 1Z9NA 4KO7A 4PLKD 4WHYG 3T09A 3L3KA 1SXAA 3P30H 5B4MC 2K70A 4MNHB 4L48A 4MD0A 3TBCA 4NJ9H 1U8NB 4F9PA 5IR1B 4FG4A 4A7TA 4ANVA 3CPLB 5I1HL 4PG9A 2OZ4H 1N5YH 1G9MH 4Q7DA 2F0CA 2FT7A 4G7SB 2CO7B 2WK2A 2WIIB 5E4IA 1TJIH 2UZXB 1CBVH 2IDSA 1MLBB 1OSEA 2O6FA 2IANA 3GTNA 3IJYA 4YVUA 4N20A 1MW2A 1RZJC 2WO2B 4Y5XA 3C6LA 1A1NB 3X14A 3TASA 3EAKA 4XO9A 5AVUB 1VERA 3P0VL 4MNHA 3HB3D 4ZFFB 1UG9A 1INDL 5E5UB 2DMKA 3MLVH 3OKNB 3F7YB 3VRLE 5IR1A 4XMKL 4JRYD 4F58L 1NH6A 1M2OA 4M5SA 3EFOB 2EDHA 1HCYA 2RMNA 3CPLA 3LKSB 4FFYL 3IJSB 4BWUA 1NAMH 3GDBA 2A0LD 4HWUA 3H9SB 4IK7A 1CS6A 1C8QA 2VH5H 2J3SA 1LWHA 2CO7A 5I1CL 2IH9A 1UQSB 2W9EL 2Y36H 4PJ5E 4AL8H 5EO0A 1QR4A 1ETA1 5FUOH 1DBAH 1TU2B 3HI6L 3S3PA 4UQ2A 1OV8A 5G55A 1NDGB 2X44D 3JTSB 4UNVA 3M7OA 1KV7A 3OZLA 3MRGB 3OKNA 3P4NB 4DEUA 4EI6A 1IGMH 3ZTJH 2WXKA 3FZUD 2IOIA 1N4XH 1DO5A 5BUPA 2VQ1B 1H19A 1SHWA 5ERWA 1IZKA 3H9SA 1UADC 4WHDA 1VADB 1HAUA 4L3ED 3U46B 4RRPA 5A43C 5JIDA 2WSKA 2CLRA 3I6LE 5C3IA 4N2NA 1X5IA 4IKIA 4Z7IA 4NUGL 3TGXA 5D72H 4XVTL 2RFXB 4GY4A 5EO1B 2EDEA 4K71C 2DJ4A 1A66A 5TE7H 5K39B 4O4YH 3TEWA 3T2NH 1ZHBB 4L4VE 3G08B 4JHBA 5F9AC 1LO0L 2DMCA 3AGWA 3HC0A 2D3NA 2V0AA 3DV4A 5AW1B 1G0XA 4L3CB 3ATDA 1FPTH 3VXRD 5JW4M 2MMXA 1S7TB 4Z7NE 2VLKD 2RFXA 3CH8A 3B9KD 5E6YA 5EO1A 5LCVA 4OLXH 2XWBB 3CHRA 1T1ZA 1NQBA 5IUSA 3ATAA 2XY2A 2R2EA 2EQDA 1URLA 2IFGA 3CK0L 4XGZA 1GL4B 1EVTC 3GSXA 4HPOL 4FF9A 4YDKL 4XO8A 4GXUN 4G6AC 3RDTB 5HGAB 5CJXC 5IROC 4LEEA 2CK0H 2E5EA 4P4KD 4Z0XB 1Z5LA 1A2YA 3V8OA 5ID1B 3D34A 4Y2NA 4W70A 3QIWB 3MRJB 1UOKA 5SWSD 4L4TE 5E9DB 4UQ3B 2QKSA 3UAFA 5CIPH 4XAKD 1CCZA 1BXVA 1S9VA 1HOCA 3QJHB 4NQDA 1BZEA 1G7PA 4DGYL 1VGKB 5FFOA 3RTQC 4G1MB 4NRZB 3RGVA 3QFDB 3HE7B 3RDTA 1KCRL 4GRLD 1YPZB 4H26B 5AAPA 1HS6A 4H8UA 2CUIA 2P5ED 3EH3B 1IU1A 2ED9A 2I7OA 1N0XL 1KXHA 3V8CA 3QIWA 4UOW0 2PCFB 1E65A 1ECYA 2BRQA 4XPBL 1C08B 4OJDH 5F0JB 3ARFA 4Y4FC 1YRKA 3VDAA 3D6GA 3B2PA 4P5KA 3BDXA 5HVGB 2FH6A 5LG6A 3JWOC 4KVNH 5PAZA 1Y0LB 5I5RA 2Z1KA 2OMVA 1YMMB 3HE7A 4IGBA 4AQ8C 3P4LA 1YPZA 2F1AA 3CSBA 4X7FC 4DPRA 3Q01A 2KQMA 3OKOA 3ZJAA 5IBTL 5IW1A 1PLCA 1WEJH 1JP5A 3FQNB 3K8LA 3WI9A 3I02A 1KTKE 3QC5X 4UIKH 5IW3A 1FVDB 3NIFB 4XBPB 4CC1A 4PGEA 3MBED 2EE2A 2WXRA 3HZVA 1C08A 2ZXDA 4LCWA 2Z64C 3F64A 4ZUVB 5KBPA 3BYTA 1E30A 1KJ3L 5ESAA 1NFDB 2IH8A 3T6QC 3F58H 4U1GC 1Y0LA 4AUUA 1I9JH 4QHUB 3H4FA 4WUUE 3MFGB 4HT1H 1QZ1A 5HD8D 2NNCA 1X5GA 4S0TD 4XR8C 4ZMAT 2OAAA 1JGDB 3WXWL 2FR4B 2I69A 3UZVA 3IK2A 1G5GA 4IU2A 5AUMA 5C0GA 5DMKA 2Z34A 2ZOOA 5FA3B 2ZAHA 2H3NB 2BIHA 4WI4A 1NFDA 5LCVL 5B38G 2BNQB 4GMTL 3CHSA 2X9ZA 5JW4R 2J8UF 3DMMA 5C0CA 3F62A 4ZMVA 2FX7L 5D1ZI 2DQEL 5AAWA 5CZXD 1TDQA 1Z66A 5FO8A 1JGDA 1U42A 2ARJA 2KPWA 5JOFB 2WYIA 2FR4A 3MV8A 4G8FB 5F7YC 3WJLC 3V4UH 5DLMH 3SJVA 2EKSA 5FA3A 3CDGB 4TYUA 1JZ4A 2H3NA 4MZ3A 1VLXA 1CXIA 3DBXA 4MAYA 3HNVH 1PZ5A 1XSIA 3ABGA 2FL5B 2BNQA 4AOFA 1DQJB 2HFEA 5AB0A 1W0WA 5KVEL 3D0AA 1UB5B 1NMBL 2NXYB 3W2DH 2PMZA 3GINA 1IBGL 4ZNEA 1OLZA 4KK8C 2XTJC 2QJDA 4ODHL 5T1JA 3VD2A 1I9RH 2ZOKB 5AVXB 3QEGH 4X9IA 5DHVA 3SO3B 2X4TA 2WVSA 5JOFA 1QRNB 2GSMB 3EJTA 4M1GL 3ZDYE 4U6YB 3U9UA 4TVPL 3H3BC 4KUZH 5MP6H 2WXNA 5DJYA 2XKNA 4UYPA 5D1QD 2FL5A 3MLZL 1JJUA 4UOZA 3EDKA 4GRMB 4BKLB 3ZDZE 3HRZB 5MEQB 4XMUA 5C3LD 3GM8A 3JWDL 3OKDB 4JAMA 4RCAA 4OI7A 4K5PA 1TQCC 1ZTXH 4FZEH 2Y1ZA 4CDGC 3PREA 1BM3L 3LDBB 2YD7A 5FKPB 2IWFA 1QRNA 3GS0A 3K2IA 1OP5K 1RD6A 4GAFB 4MMYB 4U6YA 1UTDA 2HP4A 2WNGA 3ARUA 4MFHA 3ZBMA 1EEUA 3HZKB 5L8JB 4IOIA 3PABB 3K0WA 4ZS6D 5B1CA 1P7QA 4NZUL 4ZOBA 3EOAB 4CBPA 1QWUA 3CXHK 3SE8H 1AH1A 2K0RA 4GRMA 1EO8L 4BKLA 1NL0L 1XEUA 1HC1A 3LKRB 1KELH 3CSTA 1XIWA 5EZLA 3PFQA 2ZT9C 5DMGC 1B0WA 3MJ8B 2EADA 1HEHC 2DQHH 4FJZA 1EDQA 3V7AE 1JPTL 2C1OA 5C7ZA 3CD4A 4YBQC 4BIKA 3MCG1 5DK0B 4E42B 4MMYA 1ID2A 4AC2A 4AMKH 3T0EC 1T1WB 2DD8L 1V3JA 4HD5A 3EOAA 1XR8B 2VW6A 3D39B 5I66B 3SPCA 1Z9LA 1A7PL 2EILB 2FBRA 1HYSC 3CNKA 2B0SL 4WGVB 3PY9A 2L04A 1ROWA 3UL4A 1T04B 2A4EA 5KN5A 4PV1C 5I8CB 5H4ZA 5HDQL 4RZCB 1MCPH 5EF3A 3IYLW 1SM3L 1S9WB 5GS0L 2Z93A 3HUJE 4KTEH 2IOMA 3ZE2B 1P5UB 3VI4B 3WFZA 4E42A 5AZEL 2HXAA 4HP5A 1T1WA 3VD5A 4C56E 3QCTH 4MA3B 1UWXK 2ADJB 3TVMC 4IOSD 3WKML 3JV6B 4NZ8A 3BPOC 3QULB 2NY0D 2UXGA 2W9DH 2C1PB 3GIZH 4OCRL 4NERA 5F7MC 5I66A 3GD1C 3SGDH 2XZZA 4A2LA 4EN3C 2MIZA 5BRZD 4ZMZA 2BHUA 4NC2B 3U9WA 1RUML 4HGWB 2WP3O 5J8OA 1S3KH 4RZCA 3MUHL 1HN1A 5FFLA 4Y4HC 1S9WA 3O45A 5EN3A 1P2CB 3T1FB 2CXKA 3CBRA 1FFPB 4WUKL 1PZ3A 4EE2A 3O6MH 2PR4H 3ELAT 3IDNB 4MA3A 4N0YH 2ADJA 4JHAL 2V9UA 3U4EB 2VN5A 3JV6A 2FB4L 1OAKH 3LS4L 3F05A 1MCOL 3FTVA 5F8RC 3SODB 1MEXH 3I9PA 3SYCA 1M05A 2OX5B 2H0JA 1NC2B 5FCUL 3T6ZA 5CSGA 1GW6A 1KXVC 4XTRC 5ALBL 4XBMA 4XNQA 3UGXA 3V6FA 4J6RL 4PJEB 4NKDA 5K93A 3HG4A 3IKCA 5I74B 5LBSL 2WGNB 3T1FA 1P2CA 2BNRD 3TZVB 1MFMA 4GKZB 3VFWB 3STZA 1FFPA 2OMUB 2JKNA 4Y4KD 3QJOA 4RLDA 4QXUH 5AD0A 3ZL2A 3U4EA 3NZ8B 2BIPA 3NA9H 4R7XA 3TTYA 2B5IB 4RA0C 3KVDD 1ZWIB 1NC2A 1JGVH 1MFCL 4UANA 2DEWX 4FP8L 3OBAA 3ZUCA 3IMBA 1CD1B 3ZK0A 4PGJA 1BP3B 4MJ5A 4C59B 5C2UB 1MW3A 2VXQL 2HFFA 3WEOA 2ZUYA 4K73A 3VH8G 5KJ4A 2E7BA 4GKZA 2MEJB 5CUSL 4HUXA 5K9KB 3O2VH 3QUMA 5T5NG 1XF4A 4PJ7A 2WO4A 3L4YA 3PNRB 1OP4A 2UUDK 3N43F 5KAQG 1JSYA 1DVUA 4Z18A 3NZ8A 4C55A 3L9EA 2HTLC 3FTUA 1QSFB 5MEND 4X7CC 4HISA 1KYOK 5SX4H 4PJBF 3MBXH 4ONGH 1EANA 1SHSA 1CD1A 2R4SL 5IT2L 5C0EA 2IGFH 2OSLB 1BMWA 1VENA 5FO2A 1RJLB 2V2XB 5HJDA 2NY6D 4U1LA 2A6JB 5B4MD 4K94H 4PJ8B 5CD3A 5F7EL 4N2BA 2AJUL 2J12B 4B5EA 2H2SC 1J1PH 3GI8L 3APMA 4TULH 2JCCE 4ZUUB 4PJIF 5K59F 3ES6A 2BJMH 4WGWB 1BVKB 4PCKA 4GG6B 4P46D 4RGMC 5HHQB 4ISVA 4OQ1A 2HFGH 3QQDB 4KQ3L 4OT1L 5B1JC 2LOEA 5JHBA 4ZODA 2A6JA 2NW3B 1EV2E 4MJIB 1EA9C 1Y18B 1PMYA 3QQ4B 2BOBB 3AGVA 2DKUA 3PJSA 1U8MA 4H40A 5CCGE 2NY2B 4YC2B 4XWGL 5C09D 1SMOA 3FK3A 4AIXA 1ZTXE 1FFRA 1Z1WA 1FO0H 5DVMA 4LSTH 3HG3A 1O9WA 4ZUUA 4WI7A 5DQDL 4PH8A 4B50A 5FHBH 3DX8A 3EO1B 3EJZC 2B1AL 3QS2A 1L3NA 1UGNA 2D0FA 4HLEA 1YEFH 3QQDA 2WXLA 2OQJB 4TLKA 2X0WA 4ELMF 1MG2C 5F3BB 2FUQA 1Y18A 2CSPA 5C0AD 4GI9A 4P2OC 3VTTA 4DGWC 4PUBL 1E42A 4I0KA 5EZIH 1ZVSA 5E2UL 4EDXA 1KIUA 4HXBH 1KEGH 1ET5A 1HHIA 1NANH 3FT0A 3UBFA 1JERA 1N26A 4G5AA 3ARBB 3KW8A 1MCLA 5E8PA 3R06B 4QJ3B 1LP9A 1VGEH 2JK5A 5IQNA 4YPJA 3LPFA 4N2GA 3MHZA 4MX7B 2VTFA 3VJ6B 1D5RA 3EO1A 4WU7A 4TVUA 5GSVA 3D87B 4RFOH 2R15A 1PKQA 4CVXB 2WSPA 3R7QA 4YXLL 4FFZA 7PCYA 5ICUA 5CBAB 5E4OA 1HHHB 5L2KB 4ZAKA 4RAHA 3FS9A 2GJ6E 4NNPH 5CBEB 3ARBA 3QXVA 3V6ZB 4DHLA 4XB3A 3BXNA 2X7LA 3I2CH 1OPGL 2HJFB 2EEFA 3C5XA 1BFSA 1PSKH 4LT7A 5EC1A 3TIDB 4MX7A 4KNQA 3A6BL 4JFEE 4YQXH 5CJBA 3G5XB 1OCZB 5KW9H 3IMTA 1QTPA 2IQ9L 1UZGA 2KT6A 3FFOA 1O9ZA 1IKFL 1QSVA 3BUTA 3MLYH 1JZDC 4N8VG 2A9NH 2H47C 4GRWH 3DPBA 3NJXA 5D1ZC 5E1QA 4W6YB 3S2AA 4DW2L 4X4XB 3UCQA 1QWNA 1JXDA 2HYMA 1CLOL 8CGTA 3L08A 2EDOA 3TNNB 3TH2T 1ACCA 2WOYA 2HJFA 1THAA 3KPNB 1CD9B 2NSMA 4FQPA 3DX0A 3TBBA 4KKLD 3HJ0A 1X4ZA 4BBWA 2XQBH 3DOIA 5DEGB 2QQLL 3APDA 3HNTH 3QZLA 3WAKA 3M1OA 2ZX7A 2VZUA 3K72A 3FUFA 4PWEA 3WFEL 1NC4B 4F7PA 3N42B 3U4BH 2QKIA 1IGYB 4X4XA 3RTQD 3M17B 4XMXA 1T6VN 3VQLA 4AE0A 1Z5HA 5K9QI 2PW1B 4CMHB 4OM1L 3KPNA 4ZS7L 4JBSA 1N3NA 4HIQA 2Q8AL 1EZVX 1WH0A 3D33A 4L23A 3RHWK 2ZCKL 4I87A 3LXCA 2MCG1 3QR0A 2DWXA 5E2VL 4HS8L 2D73A 3RVXC 3TC9A 1L9TA 3GC3A 1ACXA 3GSUB 4L29B 4XP9H 4XE0A 5D7EA 1FBIH 4CW1B 3TT1H 1MW0A 2KBGA 5BZDB 2HH0L 1LO3H 3TN0A 1IKNC 2DIAA 3QJVB 4Y4FD 1H8OA 1C16A 2W0FB 3ARDC 3V9FA 4N2EA 2VLJD 2Z7UA 3LEVH 4KWUA 5DZNA 1K4CA 2NYYD 2WC7A 1YYCA 2W0KA 1G9MC 4JL1A 2H41A 3EJYD 5DJXB 1L0QA 5F0MB 2D0HA 5JPMC 3MV7B 1KB5A 4L9LC 4KNSA 1NGWA 3HS0A 4A2EA 3ASOB 4LPCA 5C0JB 4B3VA 3PNWA 4TTDD 2PXYA 3SGDI 4AKQA 1PKOA 1V7NL 2F18A 1OGAE 4HC1H 4HZLA 5EU6D 3CFMA 3ZTJG 4DH2A 3BAKA 3BUYB 5DFVC 1JWMB 3Q1EA 2Q20A 2PYEE 4LHQB 3MLSH 4KO6A 2A6DA 3D2UD 5ANME 3LZPA 4JO2H 4G9FA 2Q7NA 1X7TA 4LVOC 3TV3L 1LLAA 4OSUH 3VFMB 2VZ3A 3H85A 5SWQA 2GEQA 5C0JA 1XX9C 3FT2B 2YQBA 4UTBH 2AXJA 3BUIA 3C9NB 1N6UA 1VCBC 3Q5OA 4U1IB 5T5FL 2M1KA 4KKPA 5D7JB 5L88H 3IDUA 1X5KA 1YEDA 4PVBA 1INQB 1R4XA 5K69A 4YZWA 3HMWL 1KLFB 3LH9A 3DYOA 1BFVH 1ZS2A 1JF1A 1H9VA 4U0RB 3UIYA 3BUYA 4NM8H 3VA6A 4P5MB 1VACA 1JWMA 1MN4A 2CNYA 4FEIA 4I89A 5ISZA 4DT2A 2WANA 2Q76A 3LMJL 4DPCX 4HG4J 5I19H 3O6KH 3QJQB 3UJJH 5D1XE 2BSSB 5IZ7A 3B8YA 3SDAC 4J23A 5IG7B 1LQBC 3ABMB 5HY9B 4FI6A 1BMGA 5LGJB 2IIJA 2VDRH 5F89B 3FT2A 3GRGA 4TVSa 3C9NA 4U1IA 3ULVD 1U3HD 3PWPE 5D7JA 3VCLA 1INQA 1KLFA 4R2GC 2KDGA 1FFNB 4PCYA 1ZJBA 2ZUXA 3SQBB 2R9HC 4OZIF 4M5TA 4Z7QF 5SX5H 1BBDH 2UY6A 3K6DA 1W72A 3BVVA 3KPSA 1GKOA 4FYTA 4AMXA 3FMGH 2XWCA 4KK8D 1L9NA 4RRPM 5F89A 3UJIH 5GGTL 3UG5A 1LJMA 4CVZB 5SX4I 2DF3A 2YUXA 4BQ6A 1QO3B 1PEWA 4JG0H 5D6CB 3BWSA 3SQBA 3QHFL 3LIZL 4UZUA 4BJLA 2AXGB 1CLCA 4CU8A 2P42B 5EU5B 1QBBA 4LASH 4XMTA 1MFAH 3ARXA 4KJWC 4QXWA 3T3ME 4NQEE 1I85C 1IBFA 1QWHA 4Y9FA 5E6ID 3BI9X 5ITFA 1FFTB 1S7SB 4ZJ9A 2GJJA 4JVPA 1AQMA 5ALCL 5E2JA 1TTFA 1VA9A 1FCGA 1KJVB 3QIUA 2QDVA 4LVNB 3O41B 4TV3A 5D7LA 3D0LB 1A6ZA 2ZWNA 1WWBX 5D6CA 1MRDL 4OGXL 2FSDA 5JHAA 3QDGD 5EIIB 4D8OA 2OPCA 4E9TA 3GSRA 1J8HD 5KSBF 4BXVA 3L95A 2VSMB 2FVNA 5DJ0A 1IAIL 3DXAA 4J3BA 1A7OL 4KHTH 5DMGD 4GRWE 4IRJC 3FO2A 2WZ6A 4BGLA 1RMFH 3PL6C 4LCUA 4PLJC 2PWFA 1FHNA 1Q8MA 1KC5L 2FHBA 2RQ8A 2ICWI 3FAWA 3HI1B 5I1LB 3HHRB 2DYSB 5IHBA 3UXFA 1ZHLA 1TEGA 2ATPB 2FYVA 1TR7A 4JPSA 4P05A 3LRLA 3BQUB 1ZLUK 3MNVB 2J8UA 2WBKA 4M7ZC 1GS8A 4XNXH 1G4RA 2N1KA 5CN1A 3KBEA 4LOEA 3INUH 4NZRH 2OP4L 2VRAA 4LMQE 1NEZG 1NANI 3NOIA 3NFNA 1KNOA 5E00B 4HK0B 2W60A 5IB5A 4M7LL 2OCJA 3LXAA 1BSIA 1WD8A 4H1LB 5I1LA 1UOWA 5FF6B 1JE6A 5GGSY 4OZHB 5KYYB 5I1HH 2H8PA 4KKCD 2ATPA 3ZHKA 2KUTA 2F53A 5L6YL 1WUZA 3TEXA 5EOTB 5D93C 4X5QA 2R69A 4KAQL 3GRWA 3QUGA 4KROD 4EBQL 3MJWA 2KHAA 1RZKL 5CJ8A 3NRFA 1ACZA 2IVFC 4FLHA 4JM2C 3CZEA 3V5DB 3KPMB 5E00A 4HK0A 4ABUA 1INDH 1MCIA 4DK5A 2KPNA 1WDAA 3S7GA 1E0OB 5ANHA 4H1LA 4XMKH 2XLLA 4F58H 4I9XA 3UACA 5KS9F 2EO7A 1CGWA 4FFYH 3I9AA 5J13C 1AHMA 4YDMA 4EXKA 4HA1A 4XP5L 2VZTA 1ZGLA 1MW1A 2B3IA 3AFLA 3WMSA 5EOTA 4IQHA 5I1CH 1MJJA 2G5BA 5KYUA 2W9EH 3DUUA 4E9WA 3VRIB 3QA3B 3G6AA 5KVDH 4W9EC 2ZKHL 1F90L 3TO4B 1H0DB 2Y69B 1JV5B 3HI6H 1EXUB 4ZFQA 3NZUA 3VX0A 1BZDA 1CR9L 1XB3A 3FQUB 3HE6D 4P2CG 1DANT 3RIFK 3DO3A 2J57A 5TK4A 2AJ3B 2X9WA 1X44A 5GGUA 4OIFA 3ARVA 3Q8CA 1V05A 4J3XA 2Z31B 1S8DA 4CNIA 5EU4A 2BCKB 2J4WL 3BO8B 1P9MA 5H2BB 1BF5A 4FHKA 3QA3A 4LMQI 1CQYA 3O3UN 2XZAL 5F21B 3TO4A 1EXUA 3VE0B 1J8RA 4PV8A 1W0VB 3ETBJ 4NUGH 5DWPA 3OTTA 4PW4A 2HCZX 4AG4L 4C4BA 3S5LG 3GSWB 4TUOB 4AZ8B 3Q8FA 5JMOC 2AJ3A 3BGMB 4LSUL 3ROLB 2XV2A 3ZHFA 5EN2B 4G1EA 2HTLD 3FU7B 2XV0A 1M7DA 4PI2A 2LVCA 1LO0H 3MRBA 4DQAA 1ODUA 3LKPB 5H2BA 5J6GA 5ACMA 4Q6IC 1G1OA 5T3ZH 3GHBL 4S1SH 3VMNA 4ZX3A 5IHWA 5FW8A 4BH7B 1W0VA 4PRPB 4LHUG 4YXHL 5K9QG 4NENA 1FL3B 3FFDA 3K81A 4HWBA 2VLME 4AZ8A 5BO0D 4KZEL 1JVOA 2P24B 3LD8C 2F74B 3BGMA 2NUTA 4AV0A 2ENPA 2GIXA 1TNMA 4HPOH 4YDKH 2NNRA 4XOAA 1V3KA 4W9LC 4WWOA 2Z92B 3LKPA 3FN9A 4A68A 4YS4A 1GGUA 3CDZA 1L6PA 4AYEC 5F44A 1DEEB 2R69L 3FU3A 3GRWL 3FL7A 3IXAB 3QDMD 1I31A 3Q2VA 4UM9D 3NQKA 4ELKB 3BZ4B 2FJHB 3OHXC 3TBVA 3QJFA 4PN6A 3P9LB 1LNUB 1GZHA 1T0MB 2F74A 2ZYRA 4DGYH 3LV3B 4ZMTA 2NW2B 4WHTA 1TFHA 2YK1L 4DKEL 4U1MB 4G7QB 4QRQB 1ZA6B 4UTAL 3AS1A 1J1OL 2ZJSL 2YJLA 2HMID 2GY5A 1DEEA 1WBYA 3EJZD 1HAWA 3G9AB 3IXAA 4XN4A 3WKQA 4HEMA 4L4VD 3OV6A 3JYCA 5TDOB 4MNQB 4XPBH 4ELKA 1LE9A 3CFDB 2X38A 3P9LA 4PJ9B 1CI3M 1K4DA 3RBSA 5J6SA 4ODUB 2R8SL 3OB0H 4JDVB 3DI3B 4QRQA 3WHXA 4QT5B 1NKGA 1WZKA 1JWSA 1TJGL 5AQ0A 5AEAA 2VAAA 4JANA 4YDLB 4EJ1C 3EGXB 5IBTH 1CF8L 2AAAA 2WQWA 1KB9J 1LO2H 1MHCB 1X5LA 4GAYB 2PF6A 5GJTL 5JW5A 4F7EA 3FT4A 4MNQA 4JGMA 1NCDL 4LL1A 3RVVC 3CFDA 3QXAB 4NO0D 4PJ9A 4QF1B 3PP3H 4LP8A 1KJ3H 5GZNA 2ZUUA 5J9PB 4GYBA 3QRBA 4AQ1B 4D0BB 3EYOB 4JDVA 4L4TD 3KE0A 1E2WA 4QT5A 3MRDB 4PJBA 3DWTA 2EE0A 5DQJA 4CKVX 2HSIA 3FONB 2XPGA 3GMNA 5IVNA 2ODHA 1Q0EA 1AHWB 4CJ1A 2OXGB 2D4FA 4KOCA 3TEZA 4FQQA 4BZ1H 1CTNA 4GW5B 4BELD 3BRGC 4MCZA 3ARTA 1QSEE 5IESH 3ZKNC 4GS7B 4BFKA 4YEFA 3PQYD 4K5NA 1M71B 3P54A 1S2EA 3L1EA 5LCVH 2XJKA 1OE3A 2ZCHL 4GMTH 1E8ZA 2Y7SA 3EYOA 1RFDL 3NPSB 4AQ1A 4K8RL 4D0BA 3LPWA 5J1TC 3EYFA 3VFGL 1G87A 2FX7H 4N2AA 4PJIA 3DKHA 3FQ4A 5TDNA 4W4OC 3A4AA 4KK6C 1T66C 4U3SB 2Q7YB 2WXJA 4GW5A 3ARSA 2GBVA 2B20A 1MFDL 4XPGL 5HJBA 3QRLA 3HFML 4EOWL 1KY6A 3Q48A 3BIBX 1PEZA 2R4RL 2D03L 4PRHE 5IWLA 3C60D 4N6RA 2YQ3A 1RZFL 4XH2A 4QGYA 4HK3N 3W9DB 5KVEH 2DIJA 1RZGB 3W11C 5K9JL 1CDCA 1KULA 4ODHH 1M2VB 4Z7WF 1N6QL 1Z2KA 3EYUL 3QAQA 2VDLB 3QYNA 4JFDA 4PGBB 1SLVA 3VFNA 3GFUA 4BUQA 5K5YA 2G2RB 4M1GH 3KBHE 3RVUC 2NY5L 3QI9B 1OLLA 5JQ6L 1PPIA 5FLVA 4K94C 2DQCH 1S78D 2EE9A 1JD7A 3HPJB 2GABA 3CTTA 3MLZH 4TL5A 1EHNA 2XUWA 4Y9GA 3QRGL 4ZQKA 3EKCA 4LPYA 3ESUF 2RCSL 1CD8A 4LO9A 2DEXX 3HZYB 4R5TA 2C34A 3JWDH 4KVCL 3LKQA 1WA0X 2X4QB 5DJDA 5CM1A 4M1CC 2KKQA 2J71A 5A7BA 1BM3H 3ZKXB 4PGBA 1MUJB 3V9EA 1MCCA 4NPKA 1YYLL 3T1WA 5ES4B 2G2RA 5D1XC 3BP4B 4P0DA 4X9GA 4U49A 5E70A 1CICD 1JZ8A 2ZWSA 4AJWA 4H4NA 4QDGA 5GPRA 5T3ZE 4YPGA 3HB3B 4IMLA 1EO8H 4PJDF 4X9YA 5JW3L 3ZO9A 4JRYB 1T0NA 1CXLA 2WBJD 3FUMA 1G1KA 1LYQA 4NQTA 4X80L 3B9AA 4L18A 4RGNE 3HPLB 1DQQB 1JPTH 1P6FA 4Q8BA 3X13B 3GMOA 1MUJA 1OSPL 3QIBB 3MNZB 2X4SB 2FATL 4K9JA 2WN3A 1AZUA 1SJHB 3NTCL 3G5YB 2QADC 3S3CB 2DD8H 4OF5A 5FDWA 1FLRL 4QLRA 5DHMC 2FD6L 2NYZA 1NSNL 3ZSSA 4D3CH 2BZDA 1TKWB 2GI0A 3EXLA 2VE6B 4JHWL 3RL2B 4G43B 3HC4L 3SGEI 3EH5B 3JZ7A 1A7PH 1L0PA 3LEXA 3N1FC 4K3JH 2J5WA 2B0SH 5D4QA 4Z0BL 1A9BB 1KGUA 4JRYA 1A25A 4FG6C 4RETB 5HDQH 3BD5A 3HPLA 5C86A 3L4VA 1DQQA 1SM3H 3TA3D 4TQEL 3X13A 3F2LA 2ZOLB 5GS0H 1E8XA 2DDQL 4L3EB 1ID5I 3VI3B 5F1KC 2XACC 1SJHA 3BPNB 3KM1A 4P2AA 1U58A 5AZEH 5GZOC 2DKSA 2ZF8A 5IMOB 1CFSB 3WKMH 4LNRB 4TLUA 2IV8A 5HHOD 4OCRH 1QA9A 4PRBB 2VDQB 3ESMA 1VCAA 3OX8A 3Q9PA 2OMWA 5BZWB 3ZU8A 5JTWA 4KJPC 2BVUA 5KBDA 4YDJA 4K0OA 2QPDB 5HHXL 2IGTA 1KPUB 4NZTL 3FT3B 4WUKH 2F8XC 3S4SA 4AH2B 3MMEB 3EJPA 5IMOA 1CFSA 1N18A 4DF9A 3TP4A 5JUEL 4DN4H 3LQMA 5DJCB 3BPLB 2FB4H 3LS4H 4LNRA 3RUGF 5KBMA 1KJ2B 1MCOH 3NABL 3T3PF 3VXRB 3WD5L 3H9SE 4WJ5A 5FKAB 5TE4L 4AM0B 5TE6L 3B9KB 1T4KB 1JUFB 5FCUH 4PCTA 4I1PA 4KJWD 3HN3A 5DDHB 1A7QH 5ALBH 5BZWA 3SDYL 4C4KO 4YZFE 4N8CL 1XSOA 3COOA 2YLHA 4J6RH 4Y2LA 2VSDA 2GK2A 2IPKA 1HT6A 5LBSH 4HU2A 2HUEA 1QPKA 1W9XA 4HHWA 3U36B 1L9SA 2VDLL 4P4KB 5CEZL 3QO0B 2XG4A 5L7XL 3SKOA 5CGTA 3VXRA 5FKAA 5SWSB 3TH4T 1ZVYA 2VLKA 4YE4H 4AM0A 4P3DA 2KDYA 1CGSL 2EUXA 1MFCH 1S4IA 1JV2B 5F9OL 4FP8H 2O5ZL 3MNDA 1C5DA 3HLAA 1UUNA 2OL3B 2W88A 3MRRB 1ASOA 1E27A 5BS0D 4HCRA 1V7ML 4FNQA 4HOMA 2VXQH 3QAZC 5DJAB 1TTBA 5BO1L 3T2QA 1WSST 2P7TB 1RZ7L 3HBPA 4GRLB 1ADQL 2E9BA 2YWYA 4LGSB 4TRPL 5F6IC 2M2DA 2MCAA 2DIEA 4MTMA 4PLJD 4P4KA 5IEKB 2P5EB 1B6DA 2E4FA 3ARGC 4FQIL 3W81A 4HKXB 4WFEE 4WW2B 3RVWC 2EUVA 3WJMA 3AJ7A 4UINL 3BVTA 4UT6A 4OZIB 1R75A 3ASWA 5SWSA 2HKAA 6PCYA 3QZWG 3OKLB 1RIUL 1S7UA 1DFXA 2OL3A 2H0FA 2R4SH 4FQCL 4KUCD 1CGXA 2VRKA 3LSOB 4PFEA 5IT2H 5JMRA 1Z6JT 5LAXA 3SGJA 3TX4A 5KG9B 3BUBA 2J1WA 2YRBA 1SLWA 2EEXA 4XBGA 5ESQA 3GMLB 1JFQL 3DHJA 5F7EH 5KVEE 1CDYA 3NCBB 2AJUH 1QFUL 3ZHDA 4HKXA 2QHRL 3M88A 4Y1AA 4OZIA 5AKRA 3MBEB 4R6UA 3BLPX 3UTTD 3V0EA 2WMPA 4MA7L 3WYRA 3GI8H 2B1HH 3MDJA 3OKLA 3B9VA 4N2DA 4I2XE 5C6TL 2A9CA 5IK3B 4C58B 3VSUA 4Y5VC 4FXKC 1R3HA 3APFA 2QVMA 3US9A 3CFCL 5KG9A 4KQ3H 1J0KA 4OT1H 2YD5A 5E9DE 2VSKB 3F7RA 4N22A 4AJ0A 1BVLA 4ECNA 1D7DA 4Z23A 4YDZA 3ULSB 4JZJC 3LPGA 1XFPA 4XWGH 4OTXL 4FQXC 3FF7A 2E46A 3MBEA 4F15B 1YPZE 4F37K 4YHML 3OKYA 4BA8A 5F7AA 1FUNA 1X7QA 1HXMB 2Y5TA 2RGSA 2WWKT 5ICZB 1JHTA 2B3RA 3TONA 3U2SB 1IAIM 5DQDH 4WI9A 2VDQL 4OBSA 4KH9A 4WWKC 5ADOL 2B1AH 1WBXA 4HS6B 5CCJA 4KPHH 5KANG 2C3GA 3B9DA 4ODVL 4XN9A 3VXPA 3US1A 2Z0BA 2E7MA 1J86A 2JKTM 1AXIB 2OMTA 2WPGA 4PUBH 5T33L 3GUTB 1D6EB 4BDVA 5E2UH 3NFSL 1KDIA 4ZMXA 4YIQA 1YMME 1DJHA 3EG9A 3OD3A 1DVFD 3EO9L 1BX2B 3GB7A 4N1CA 1YHPA 5KSBA 1KJ2L 4M8UA 4F3FB 3VWJC 4FLSA 2YZ1A 1HKFA 1XH0A 1KOAA 4IRZL 4GQZA 3NIFE 1R46A 3EFFA 4HS6A 2J6EH 2IH3B 4K9EL 4CC4A 1TJXA 2EIJB 4HJJL 3OSKA 1SHMA 4N0CC 5IBLD 4YXLH 2B16A 4E9RA 4KMTL 4OGYH 4KDTC 5JHDD 2WKOF 2VDNB 3N5AA 1VDGA 1NFDE 3CHPA 4KY2A 1TTRA 2K9FB 3QJXA 4XP1L 5AVWB 1N59B 1S5HB 2AXFB 5ICXA 4PY7A 1DZBA 4BKSC 4GINA 5J1AA 5JLZB 3NK3A 2FGZA 1AS6A 4EKXA 4NQXB 4F3FA 2LE9A 5F1IB 4JFTA 2QL1A 3A6BH 5GSRA 5D1QB 2VZSA 5D70L 1U8KA 3UADA 2WWNA 1BCIA 4Q56A 2BZCA 3LRGA 1GR7A 2OL3L 2IQ9H 1JPGA 3O4OC 4X6FB 5F0PB 3S48A 4E68A 2D7TL 3DETC 1IC7L 3RKDC 7CGTA 1GZQA 1P4BL 2DM2A 5MI0B 1ED3A 4R3SB 2AQPA 1P84K 2BNQE 4DW2H 4ENEC 2BHZA 2X1WL 1D2PA 1CLOH 2AXFA 3IDYC 1IO4C 2ZX6A 2O61B 2EIKB 2ITEA 4QTHB 3MPCA 3CQFA 3PHSA 3QZMA 4HFWB 1E9QB 1VFMA 3CX2A 1VJSA 5TPWL 3QORC 4E2OA 4A7QA 5DHYB 1XB6A 3D3VB 3KPPB 1WFTA 2QQLH 4CVWA 2WOBA 3GMQA 4UDTB 5BRQA 1QBLL 2ZX5A 4LHUD 1QLFA 4BFGA 3UPAA 3IDIA 3VAEA 1I7ZB 3WFEH 5KS9A 3HKZA 1ZTMA 4KZ0A 4R3SA 2EEAA 4KKAC 3TYGL 3D12B 4QXTB 2X05A 4JQXA 2BVOA 4Z7UF 4LLMB 2ENQA 3V0GA 3QUKB 4OM1H 4UM8B 4HFWA 4ZS7H 1E9QA 2WXHA 1S7WB 2Q8AH 2MTAA 4A6YB 3SD5A 3QZOA 5E2VH 2CXGA 4HS8H 1QRNE 3JSSA 5I6PA 4UDTA 5D5ME 2NYKA 2NLJB 2W0PA 3DJTA 3VGHA 4P8QA 2HH0H 4MQXC 5HYJA 3MLPA 1NDTA 3PYCA 4NP9A 3H9YA 4JFED 4ZW3A 5G5DA 1SFHA 3HHSA 5B8CC 4LLMA 1ORQA 3T0WA 2HLEB 1QI5A 1F4YL 1HIML 1ZKAA 4F9LC 1ET7A 1BYPA 1S7WA 1MVFA 3QVAA 4ETQA 2LU4A 3NCYS 2H1PL 4EO5A 1CGTA 4DZBA 5BRZB 1V7NH 3BJLA 3T65B 5DCCA 2NLJA 3VRLF 4HWNA 3L4CA 4ZO7A 3RPIA 1G7MB 2CO6B 4PWFA 2WAQA 1CLYL 3RVVD 3OG6B 2E8YA 8FABB 1JWUB 3IJ9A 3IAPA 5EOQL 1R3KA 2XFXA 3LPOA 5AL0A 1QP1A 2QV4A 2YO3A 5T1DL 2XIDA 2DWTA 4RMSA 3RG1C 5HI5C 4XCEA 3DGGB 2DTSA 4JO3L 3P02A 5IB4A 3MJ7A 3O9WD 3S96A 1JXJA 5F9WC 4GMSL 1BM7A 4M48L 5KAQF 4QMEA 1L9QA 2YXFA 4N25A 3UAJD 1SBSL 1J05A 5T5FH 3CUPB 2CO4A 4KX7A 6TAAA 1GKEA 5BRZA 1QG3A 3MRFA 2CO6A 1U4EA 3HMWH 4ZUWB 3TPUB 2ZUQB 2BM3A 2BNRB 3D39E 3V9CA 3S2CA 3LMJH 2H7WA 1AC0A 1T7ZA 2VDNL 4GIAA 4Y4KB 1Q1PA 1N70A 4FTVE 2QPEB 3QPKA 4R4FL 4RISL 1D9KA 3V4LA 5I8EB 5DD5L 4U1NA 1F97A 4FRWA 4KK6D 1HU8A 1CZ8L 3DROA 3CUPA 3RIFF 3ZE2E 1EFQA 4NQVA 3VI4E 3E8VA 2DLHA 2XPYA 1JMXA 5H37H 4YNYB 1Q94B 4BQ9A 3DX2A 5JDSA 1OGPA 2CA4A 4GW4A 1EFXB 2CR6A 3X17A 3AY4A 2BNRA 4DQOH 1TO5A 3RL1A 6FABL 4N9OB 4AEIH 3DX1A 5GIRB 4FEMA 2A9BA 4JM4L 2AI0L 3MJGX 5IOPA 2FEEL 5I8EA 5GGTH 2WLNA 4Z7NF 5MENB 3QBTB 2YEZB 3VFVA 5EF1A 2Z3FA 3K0YA 3GMPB 1ZMYA 1FYTD 3CXDL 4MA1C 4A37A 4WIQA 2BP5M 3S35H 1Y6KR 5ID0B 1Q94A 2QQKL 4RGNC 3N1MC 2HTKC 1IJNA 1FNGB 2K4AA 4MB3A 2Y7LA 3QHFH 1OCWL 3LIZH 5ICYA 2BSTB 2NY6B 1R1CA 3VTAA 3B83A 4F1ZA 4F9PC 4X5WB 3OGCB 3KL0A 3MLUH 1QMUA 1FVCA 3IU3B 5GIRA 4PWJA 3DRQA 4XOBA 4P9ML 3U1SL 3AVEA 4PJEE 4ZMQA 3FFCA 1OF2A 5MENA 2YEZA 2IAAC 4M8RA 3SE4A 4O9HL 4A6YL 2I27N 2N7AA 4PMEA 5D1XD 2Q8BH 4OJCA 3P3RA 4HOWA 2WY3B 4P46B 1E4HA 1BQHB 1MRDH 4BV1A 2OMYB 2C9QA 1NEPA 2UYLB 4QRBA 5D8JL 5IM7B 4A66A 4L0PB 2Q87A 1YNKL 2ZQKA 4OB5L 3KEHA 1U8QA 2PETA 3IU3A 4CN4A 3MACL 2C26A 5C09B 1IAIH 4HV8A 3UC0L 3AQDA 2ZOUA 3UTQB 5DC2A 1HSAA 3L3OB 3GS7A 4NXKA 5IGXL 1E50A 3K8MA 1KC5H 3U7YL 2HLAB 2K45A 1BQHA 2D7PA 2QADD 4TMPA 1BQSA 3U83A 1OTTC 3W82A 4EQ2A 3BMVA 5IM7A 2KC0A 1QSFE 4I85A 5EO9A 1G6VK 3DDGA 3BUQA 3EYVB 1QX1A 1MFUA 5C0AB 4GSDL 4M43L 1XR9A 1MFVA 2BY1A 2XN9D 5F7BA 4HBCL 5C09A 1DQLL 1H3XA 3EXJA 4A2HA 4NS0A 4IJ3B 1RZIA 2CCVA 2OP4H 3OMAB 2WIMA 1XT5A 4TN9A 4M7LH 1RIHL 5KVFL 4Y7OC 2KYIA 5LO7A 4E41D 1KPVB 1DVXA 2EDTA 4HCIA 5GZOD 1RK0A 5AKVA 1CYGA 1F11B 1MCDA 1O0VA 5L6YH 4JK0D 5FYKU 4FHBD 3L7EB 4S0SD 1RERA 2QPUA 4KAQH 3WEAA 4EBQH 3AWEA 1QBML 2G75B 3EYQD 3R0NA 4GG6E 1RZKH 1R0AL 4NT6B 4Z7WA 4HUVB 4X0KB 4GQQA 1FJ1B 1LE5B 1L9RA 1WHOA 3FSWA 4ZD3L 2PW2B 4URTB 5I73B 4MB4A 4MJIE 1SUHA 4RAUA 3LB6D 2PPAA 1NWOA 2B9BA 3DA0A 2AVGA 3TF4A 1RAMA 3G5VB 3W0WB 4M8QA 4P5TD 4ADJA 4GUOA 1W6LA 1BZ7B 1R3LB 4XP5H 3S37X 3IJHA 3NP4A 5SV3A 3L7EA 1IQDA 2R1YB 4ONHB 1YN7B 1OANA 3V6BR 2F54A 1YY8A 4MXQC 2G75A 1GYCA 4NT6A 1F90H 2V9RA 1F2XK 2DQFB 1R17A 2XWJA 4X0KA 1FJ1A 2VUOA 2Q3XA 4O00A 3MRCB 5CMAA 1CR9H 2PW2A 2IG2H 3Q7JA 3OB8A 3F5WA 4CSZA 4HIEB 3MGTA 4PY8J 3C5SB 3RWEB 1I1AD 2VXSL 3GBLA 2ESVD 4ICWA 1PQZB 4PP1C 3T08A 1KWGA 4POZD 5CD5C 1R3LA 3KWXA 1B4TA 3KPRE 5GGRA 5FM5O 4F91B 4PJDA 1D5BB 2J4WH 3IDXL 2APFA 4X4MA 3K5SA 4E9YA 3VD1A 2XZAH 3NFPB 5E99H 2DQFA 1DDHA 3DHMA 2VITB 3MOBH 4WEUD 3RDTC 3RTQB 1DBJH 3A24A 2E75C 2KLSA 5EF0A 4MNGE 1FWXA 3ZDYF 3O4LD 4K07A 5CJXA 2GQHA 5IROA 4AG4H 1T03L 4HIEA 4F7CA 2MQ3A 3DGCR 3L5JA 5L2KE 5KYXA 3ARGD 5DSCB 5L0QB 1SF3A 2HT2D 3QFJB 3QIWC 4J8RB 5KWYC 2VABB 5SWZA 4U6XA 3ZDZF 3C6SA 4BFIA 4AMWA 3KDMB 3RA7L 4Y4FB 4AYBA 3BQVA 4HIIA 3JWDC 2FLBT 3GHBH 3NFPA 2VLJB 3WFDL 3RTQA 2NSQA 2VITA 4BXSV 4UU9A 1F0LA 4YXHH 1IM9A 1OCOB 2ZWKA 4ES9A 4LLUA 4AUYA 2XWZA 3GHEL 5FM8A 4PLNC 4KZEH 1E4KA 4R0LB 2HUHA 1K5WA 1EERB 1MREL 3LEYL 1FAKT 1OD9A 4HUKB 4QWWD 4J8RA 1NTDA 4LNVA 4M03A 4KDVA 3D08A 3DURB 5ELIA 3T77B 5EU6B 5F7DB 1TG8A 4Y4FA 5IMKB 4YGVB 5GISL 3DTXB 4G3YH 2R69H 1XD1A 4WFGD 3D2UB 4AQ8A 3IDJA 3AMLA 4PJCB 4W9CC 3ZQ9A 4NC0B 4IEFA 4G8EB 4NYLB 1CT8A 3B2XA 4R0LA 3DK0A 4OCXL 2GEEA 1OD7A 4AYFA 1DQVA 2VLLB 4R7LA 2NXZD 5FYKD 5BVPL 3PHOA 1X9LA 2YK1H 4DKEH 4AVKA 2OJ1A 2DYPD 4ZO9A 1MXGA 5F7DA 4UTAH 2ED7A 1ILSA 4EUPG 4APXB 1ZHNA 1J1OH 1F1AA 3H9HA 1WO2A 1UWEL 1DVSA 1PZ2A 3I6SA 5E08L 1XEDA 3HUJF 2BSBA 5E2WL 2NY4D 4ZMNA 1FIGL 3KGRA 1S3RA 2OFQA 1CXFA 5GS0C 4X7DC 3O8XB 2P49B 4G8EA 4ZX5A 3P77A 1F1DA 5FOBB 3BDBA 1M7IB 4APQD 2VLLA 4CSTA 3MYZA 3IKKA 3RGHA 2R8SH 1I8LC 5D4HA 3UG3A 5DZAA 3SKNB 2CPCA 3BSZA 1U3HB 4M3KB 2VZVA 3BC9A 3MV7E 1TJGH 5I1JL 2CQVA 5IQ7H 4B9IA 4GSRA 5ABZA 5F2FA 4YHIB 1D7CA 3C5ZC 5GJTH 2Z65C 5D71L 5B38B 1A3LL 3ABLB 4DVRL 5FYLL 3R4RA 3L6FB 3QDJE 3ZZSA 4KUCF 2H6OA 1UCTA 4UT9A 4PREA 1YN6B 3FQTB 4QRFA 1CIDA 3LH2L 5LGKA 1QNZL 1B0GA 1DL7L 2A2QT 2MH4A 4MJ4A 3SO5A 3HC2A 3IVKB 1X4YA 3X11A 4L1TA 2JQAA 5I15L 3GWJA 4GKSB 5HJ3B 1ZLVH 2WV3A 3REWB 5E24E 1J5CA 1WV7T 4YO0B 4YHIA 2XHNA 2NXYC 1MZYA 5B38A 3N41B 4OD2B 1M1SA 4MQ7A 3MODH 1YDPA 3L6FA 4Z3GA 3DETD 3KM2A 3MLTA 5E6IB 4Z3HA 1T5XA 2X6CA 1MI5D 3CQPA 2FDBP 1NCUA 1U95A 4JM2F 1XGQB 1GGIL 3BP7B 4ENED 3FQTA 4RZKA 2ZCHH 1IC0A 4HQQL 1RFDH 1UA3A 3ZT7A 4K8RH 4NIKB 2FX9H 4HSQA 3SE3C 3VG9B 4LLVB 5FB8A 1G7QB 5CCHE 3IVKA 1MIEL 5FX3A 1CD0A 1G9HA 5TFSL 4YDVA 4GKSA 1KJMA 3REWA 4PWHA 3CFNA 3CFIC 3QDGB 1XGRB 5FK9B 4YWGL 3UZQB 3HRZC 1FNSL 1NFIB 3MUJA 2E6QA 1J8HB 1MFDH 4XPGH 3HFMH 4H8VA 4EOWH 3NBNA 2FSEB 2R4RH 4UIMB 5DFWH 2D03H 4GP4B 4PBWD 1IAII 5I0VA 3H7BB 1XGQA 1RZFH 3BP7A 5LGHL 1JYWA 3NRPA 2WQSA 4MMZB 4LLVA 1BXUA 5K9JH 1E5CA 5T1LD 4EMZA 3DVGA 4KKBC 4HMCA 3A5VA 5CCKL 3V4VB 1N6QH 3GBEA 2ZSWA 3EYUH 1OTUC 2JB5H 3HCVB 2ATKA 3QPQD 2E6JA 2CUMA 4JY6B 2F58L 1NFIA 2CZNA 4FYQA 1J8HA 2NY5H 4BZ2A 2Q7AA 5C07A 5JQ6H 3QSKB 1MELA 4XC1L 4Z1PA 1KT2B 2FSEA 4MYWB 4UIMA 1JPFB 1FFOA 3QNYA 4U33A 3KLSA 4M93B 2DI8A 3H7BA 3ZHNA 4AGLA 3N06B 3QRGH 4PHZA 3QQ9C 2RCSH 2JCCF 5BOJA 5ECGA 4NKMB 4QRPD 4KVCH 3T0EA 1EVUA 4WF7A 3BSZL 3BFQG 2KZKA 4UUJB 3V4VA 2ICES 5E4EB 5HPMA 1AE6L 1P7KB 2W1NA 4QRTB 5DVNA 3ZRSA 1YYLH 4L37A 2GTZB 4KROB 2GTWB 3DX7B 4Q9QL 3FNKA 5EDXA 1KT2A 1ODAA 1RURH 4YAQB 3UBXB 2WKOA 4YEEA 2GT9A 2Q2LA 4YSDA 2WNWA 3LN9A 1P5UC 4Y16C 4RQQB 1XZ0B 1WZMA 4HSAC 5TQ2L 4OUUA 5JW3H 4NKMA 4X80H 3ULVL 3VFUB 3S8WA 2MKWA 3QR2A 2HG5B 5IKCA 3QQNA 1OSPH 4JG5A 3V5HB 4EN3A 3B3BA 3NTCH 4U1JA 3GBDA 3O2DA 4X7TA 4YAQA 4E9LA 1FLRH 2AABL 3DV6B 2FD6H 1DLHB 1NSNH 3PP4L 3CN2A 3HE6B 4FXTA 4Y4HA 4JHWH 4AE1A 4F37F 3HC4H 3SN6N 1YY9C 4Z0BH 4CADA 1L3WA 3M1CA 4LSPL 1NGPL 1MF2L 1XF2B 2X89A 4JDEB 3VFUA 5I1AA 5I17B 2EYSA 2ZICA 4TQEH 1OTSD 3DARA 1KLUB 2DDQH 3O6FD 3OPZL 4AQAB 5AG8A 1OSYA 2G3MA 1KXVA 5JW4N 1U92B 4OZHE 1AP2B 4O2CA 1T20B 2D4DA 3IMVA 4N87A 5I74C 2APTA 3TZVC 2FQFA 1MH5A 4KRPB 4NPYA 3BUDA 1OO2A 2QGCA 1EDHA 4Z7UA 1ZA3B 3B4NA 3GS4A 1IEBA 1LXMA 4HKZB 2FIRT 4R9HA 4Z3EA 1E4JA 3WU1A 1XF2A 3BEVA 5HHXH 2B5IC 2F8VA 5AB1A 3DSFL 5T3ZD 4NZTH 4XB8A 1EO5A 2IH1B 3CC5B 3FOLA 2X42A 1K72A 3BVNB 4GOSA 4HJ0D 1JGLH 1PLBA 1V3LA 3AU0A 4NFBA 1U92A 4FQHB 4H8PA 4QHLA 5DA0B 3HS8A 1T20A 3N40P 5JUEH 2ZKMX 3WD5H 2N4IA 3NABH 2YIHA 4KH2A 2I9TB 3AXLB 5TE4H 2L7EA 1WD9A 5TE6H 4OGAC 1F8TL 1XBDA 3QNZB 3OSVA 3SDYH 1U8LB 1IIKA 4N8CH 4X7EC 5HGHA 2X53A 5F71A 4ZOAA 4AJVA 2ZX9A 2K8QA 3JTTB 1YQVL 2DH2A 2F08A 2DQ6A 3V4VL 2R23A 3RAJL 2VDLH 4DFIA 5CEZH 3WHE0 3H3KA 5L7XH 4G5ZL 3U7WL 4NGHL 2XIBA 4R90H 3QDMB 4PJ8C 1GCYA 3UAEA 4UM9B 3VH8A 1CGSH 4PJ5A 3PPEA 4OFKA 2YSSB 5F9OH 3QNZA 3D2TA 2O5ZH 1IAOB 2WXGA 2WLZA 4PYGA 4HLJA 4EVNB 3G6JB 1VESA 4XNAA 2XXCB 2OS7A 4NDMA 5BO1H 4DKDC 2XC8A 2X4RB 1RZ7H 3JTTA 1ADQH 4TRPH 5DMJB 4BRJA 3TJEL 4F20A 2G3ZA 1MJUL 4FULA 5DK3A 3CDCA 4FQIH 1BLNB 1RUPL 1TCRA 4KU1A 1NM9A 4UINH 4E9SA 4L4VB 2P80D 3FO9A 1NCOA 5B1JA 2AV1B 4DKFL 3O2DL 1HDMA 4BSWB 3TURA 1ZCRA 4HUUB 3T9WA 3C12A 4D8PB 4ZMWA 3VXSD 1RIUH 2NY2C 4KFZC 1KIPB 4YC2C 2DMHA 4KBPA 3N0PB 4KXDA 4FQCH 3G6JA 4U6VH 2Z8SA 2LFEA 2IXQA 3KS0J 1MJ8L 4BGDA 4PRPE 5IJDC 2PUQT 4Z7NB 4M4RA 5LDSA 1F58L 3F83A 5IMLA 1JFQH 3QARA 3KAAA 5AW7B 1KLGB 1QFUH 4H2CA 2QHRH 1OAQL 4FHJA 5I1KL 4L4VA 1INEL 2AV1A 1JPST 4PQXA 3D25B 4WU5A 4I7ZC 4JB9L 4MA7H 2CLVA 1UKSA 4NO0B 5LHDA 3PHQA 2D3LA 4DO6A 2BWIA 2GJRA 3LHAA 4OZGB 4WK2B 4X2UA 5AVSB 3ARBC 3HG1D 1JHLL 3BX7C 2VO5A 1LO4L 3KYNA 3CFCH 4HF5L 1JGIA 4J12A 5AYTA 1PYWB 3TBSB 1OQXA 4DSYA 4YHZL 5KJRL 4YN3A 5A2FA 3A47A 1H5BB 3VFSB 1MCKA 5EHFA 2JJSA 3LJ3A 3U6RA 3IXTB 2JXMB 2IWKA 2I07A 2HB0A 1RXLA 2OXHB 1SHXA 4Y8DC 5F96L 4OTXH 3UYOD 3ZTCC 4MD5B 4YHMH 3MJ6A 1J7VR 3FKUS 4FD0A 4NO0A 2ADIA 3BZ5A 4CILA 5I6OA 3PQYB 4MXQD 3TBYB 2VDQH 4GIOA 3EF7A 2W81C 5ADOH 1TEYA 4LLQB 4EIUA 4MJ6B 5FOJA 4L4TA 2RHEA 5E5RB 1L9MA 3WFHA 4HUWB 1WRFA 2NY1C 5T33H 1PIFA 4K23L 5TH2B 2JXMA 1B0RB 3A22A 4UQDA 3WY4A 4LVEA 1HL5A 2OXHA 3QXUA 4NO2A 5F1SA 5I26A 4X9BA 4GAJL 3RE0A 1JVKA 3V0DA 3IF1A 3EO9H 1UENA 2PLTA 1KJ2H 2AGJH 3WDHA 3TBYA 3BKJL 2OULB 3EOBA 3KPOB 2BX5A 3C60B 4N8VB 2XWTB 5D1ZA 4AI7A 5E5LA 4IRZH 2C3XA 3P73B 4HJJH 4HUWA 1M56B 4QIRA 2AKRB 1QI3A 2NZ9D 4OD3L 3HMXA 2ZXCA 3E2HB 3HR6A 4KMTH 2GG1A 5TH2A 4C57C 2OW6A 1E5UI 2V2WB 1PZUB 2J8HA 4JFHE 3ZTDC 1GTFA 1B88A 4PCSA 5MEOB 4FXGB 4XP1H 4PBDA 1WS8A 1FDLL 1K8DB 2FECI 3EW3B 4G2AA 3PWNA 3RKPA 2K7PA 3T3MF 3ECVA 4AGNA 1PY4A 2RALA 3GMMB 2Z91A 3KPOA 4N8VA 3TJHC 5D70H 3PHAA 4QRUA 2OW7A 1CFNB 2AV7A 4CMHC 2OL3H 3P73A 1NCIA 2D7TH 4G7YL 1IC7H 4RA3A 3DC0A 4UQIM 3MVSA 1P4BH 5ACZA 1FH5H 3V5KB 2WKLA 1SJEB 4MD4A 2V2WA 5HGDB 1RH8A 4FXGA 2NR6C 4WUUA 4XOCA 1K8DA 5MEOA 3BD3A 3C6EA 2YD6A 4ODTH 1A6TA 4G7VL 4WFHE 3BRDA 1MHEB 1HI6A 2J88L 1I3VA 2AXHA 3HJEA 1CICB 3NG5A 4M56A 1RJCA 3I85A 4GRWF 3ARDA 1KTJA 4RNRB 5TPWH 3NIDB 3RU8L 1N2RA 4A7GF 4UI2A 2ZXWB 2YOCA 2OZ4A 3BN9C 2Y7QB 1QBLH 1HILB 3WMPA 2WXOA 2WBJB 4PD4K 4OU3A 5GRJH 2QLVB 2NTFB 4L9LA 4FYSA 3SB3A 1SJEA 2N0MA 4BSJA 4JKKA 3TYGH 1D7BA 4FG0A 4JUSA 3KEDA 2FH8A 4HFUL 5IW6A 3U0TB 5JQHC 4PRAA 3WEMA 4GSXA 1CICA 2VO8A 3FUJA 4WEBL 1IV8A 4L05A 4V2CB 4HBQA 1RSFA 3AQXA 3FULA 5CEZE 3CMGA 2WCPA 3CBKB 3NAAL 1XXDC 3NMEA 1YA5A 4LF3B 1NAMA 2UX7A 3QG7L 4HJ1A 1EPFA 3HZMB 1HILA 3QH3A 3KXFD 1EMTL 4ZW7A 2L7UA 3TA3B 3QWOA 4MMXB 1EZLA 1OE2A 1NJ9A 4YL9A 2CO3A 2KS0A 5CEYB 5GRUL 4QAMB 2P8PB 4YSTA 3BE1L 1F4YH 3RWCB 3QHZL 3BCDA 1HIMH 2IDTA 2XN1A 4U0RC 1EXGA 2NX5D 3OG4B 2CR0A 4H0IA 3FTZA 2ICEB 4MXWL 5EPMA 1RZKC 5HHOB 1PJWA 2H1PH 3WE6B 4HCFA 3GZKA 4LF3A 3C5ZD 4M3HA 3VYNA 1I7UB 1G0DA 2E9JA 5JOPE 2A6KA 2VCOA 2VISA 2EDQA 1CLYH 2Q5BA 4O2EA 3DO7A 5KVMC 1GVIA 5EOQH 2F5BH 5T1DH 4XT1C 1X9RA 3V0FA 2APWA 2P8PA 1XF3A 1HCVA 1PW3A 2G4EA 4IU3B 5AOKA 3V52H 1NOLA 4HEPG 4ZG1A 1TTGA 2Y72A 4RESB 1SUJA 4GMSH 4M48H 5HHOA 1WFMA 1R3IH 1QUNB 3FTWA 2G60L