1DSWA

The solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGKIGKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE (CU-ZN)
publication title The solution structure of a monomeric, reduced form of human copper,zinc superoxide dismutase bearing the same charge as the native protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1dswA00
1E9QB 4FF9A 1COBA 4A7SA 1IBDA 1JK9A 2WZ5A 3KH3A 3CQPA 5KBKA 4U4IA 3GZOA 3PU7A 3S0PA 1Z9NA 1SXCA 2GBUA 4OH2A 1B4LA 4BD4A 4A7UA 2WKOA 3GTVA 3HW7A 1XTLA 1PZSA 1L3NA 3KM1A 2C9VA 1IB5A 3KM2A 2VR6A 1F1AA 2WYTA 1SXAA 1OZTG 2Z7WA 2AQSA 3QQDB 1E9OB 1IBHA 3H2QA 1BZOA 2C9UA 1SRDA 1BA9A 2NNXA 2WWNA 3CE1A 1OAJA 3T5WA 2K4WA 1Q0EA 1XSOA 3GTTA 4A7QA 4A7TA 1TO4A 3L9EA 2ZKYA 1SXNA 4BCZA 2AEOA 4MCNA 3GZQA 1N19A 1YSOA 1E9PA 1UXLA 3F7KA 1SXZA 1YAIA 2AQQA 2Z7ZA 1OALA 1OEZW 2GBTA 1MFMA 2LU5A 2AQTA 2AQPA 1FUNA 5KBLA 1KMGA 2XJLA 1XTMA 2SODB 1DO5A 3ECWA 4N3UA 1RK7A 2Z7YA 1SPDA 1JK9B 1QUPA 2V0AA 4N3TA 1B4TA 3MKGA 2AF2A 2AQNA 1E9QA 2C9SA 1UXMA 1EQWA 4OJAA 3H2PA 2E47A 2WZ0A 4A7VA 1SOSA 4A7GA 1N18A 1IBFA 2R27A 2WYZA 3HOGA 1U3NA 3KH4A 3LTVA 1PU0A 1SXBA 1CB4A 2Q2LA 2Z7UA 2JCWA 3KBFA 2ZOWA 4BCYA 2WKOF 5CU9A 3ECVA 1YAZA 2ZKWA 2VR8A 3GZPA 1ESOA 3RE0A 1P1VA 1SDYA 1SXSA 2AQRA 3CQQA 1F1DA 2WZ6A 1F1GA 3QQDA 1E9OA 1SDAB 3F7LA 5KBMA 1IBBA 2ZKXA 3KBEA 4MCMA 2APSA 1EJ8A 3K91A 1JCVA 4B3EA 1E9PB 3L9YA 1OZUA 3ECUA 4A7GF 4L05A 3MNDA 2WWOA 3SODB 1HL5A 1CBJA 1F18A 1PTZA 1AZVA 1HL4A 2GBVA 3HFFA 1S4IA 2VR7A 1TO5A 3GQFA 1DSWA 2JLPA 1Z9PA 2XJKA 2E46A
chains in the Genus database with same CATH superfamily
4PGZA 5KSBA 3AREC 3P1VA 4MQSB 4BSWA 2XVBA 1D7CA 1B2WH 3RDJA 5IB5B 1P84J 3LAFA 5CMAA 2UWEB 4KMTH 5ISZA 2A3TA 3LEVL 5I9QB 1VKXB 3I84A 1L9RA 1OGTA 3RY5A 2NX5A 3N06B 3GGWA 1FAIH 1KWGA 3WIFA 1A6VH 4AL8H 2NOYA 4IU2A 4KI5C 4JRXB 4UM8B 2X6AA 1F4AA 4Z0XA 3BCFA 2AXHA 1SF3A 1INEL 4V2CB 4E42B 3ALWA 2VZ1A 1R47A 4NFCA 4YDIL 3EYOB 5BO1L 5IW6A 5EOCH 2ARWA 2AEPH 1G94A 5B7EA 4GAYB 1CQYA 1U8CA 2B1HL 4JM4L 1Q0EA 2VN4A 4FULA 4HFWB 5L4FA 2JJTA 1OQXA 3HPLA 4G8FA 3U25A 1WBXB 5HBBA 5L4JA 4O02L 1AKJB 3LZFH 4KQ3L 1EBPA 4CBPA 3GMOA 4KNUA 4CDGC 4WWPA 1QR1B 2Z7ZA 3IMWA 3N85H 4U6XA 2MKWA 3T2NH 4LAJH 4FHJA 4HKBA 4R4FH 3VWKC 4ZOCA 2ED6A 3TEXA 2J12B 1CLOH 4F7CB 1RUQL 3RNQA 3F64A 1BBDH 4KX7A 4NNXB 2V0AA 2ATKB 1PG7X 4PJEE 3KPQA 4XMLH 1KGCE 3T4AB 4NZUL 2IOMA 3MGOA 5JIDA 1MXDA 2GSGB 1TF4A 2R27A 2FB4H 1CU4L 5EV7A 1SUHA 3ZR6A 4ZG1A 1KENH 4QAWA 4IGBC 3BAJA 3IFNH 1S5HA 1HOCB 2X3BA 4MKMA 3HAEA 4L29A 1UWEL 4HHWA 1KDJA 1DSFH 3FF8A 4M5SA 1H15B 1T1WA 4FS0A 3L4YA 4PJFA 1KNOB 4GT7A 4BFGA 2Q3XA 1TVBA 4JQXA 5D2LA 4MB3A 4Z3EA 5IW3A 3K91A 5FYJH 4APQD 3S3CB 3FQRB 4BHUA 2I07B 2B0SH 5D4QA 3VM7A 3SYAA 3CJJA 4AYEC 3AUVA 1JVOA 3IDYB 3QUZD 4NP4L 3ET9F 4HC1H 5L9DH 3D2UB 5DJ6B 5IBLC 5IB4B 3G5VA 4QHMA 2CLRA 5IT2L 4OTXL 4ANWA 4YSOA 3WKQA 5I1EH 1BQLH 2DAVA 4OAWA 1XL6A 2JELL 3B9KC 1MNNA 5DD1H 5DSCA 4B7IA 4LEOB 3GLDA 1M71A 3LRGA 2J4WH 2YEQA 3QWNA 1FDLH 1ADWA 2Z31D 3F05A 4AMKL 1OTSD 2X6CA 2JTDA 1OPGH 4YHLL 2BSSA 3MGTB 4ZO7A 1IEAB 1LNUB 1ZK9A 4KUZL 3BKJL 5AB1A 3SGJA 3SYPA 2E9GA 3R0NA 1FE8H 2QPDB 4KMQA 2AVFA 1OD7A 4G70B 5CIPA 5I2IA 4EN3A 2JKIS 2B1AL 1CN4A 2CJSA 2ZIDA 3H2WA 3INUH 4JJ5A 4WV1A 4HCFA 3RIFF 5T1MB 1ZANL 3UTZA 4BE5A 2ZUVA 1JHKH 3K6FA 3T2QA 4A1RA 1M7XA 1IGYB 3NSFA 1CD0A 1X6NA 1F8TH 4JN1L 1B6UA 1CL7L 4TNVF 4Z3HA 2J55A 3IBEA 1KB5H 2VQ1A 3GMRB 3LN9A 3H1ZA 1NAKH 3GXPA 2CR6A 4U3SB 1OGAB 3ML8A 3B9AA 3BQUB 3QS3A 2DICA 4NQCE 1YECL 5IVZA 4Y4FD 3ZZLA 4CVUA 4LHUB 3NCXA 1M2VA 1DQTA 1MRDL 3BD3A 3PAUA 4RWYH 4D9QD 1FO0L 2PPEA 4MBOA 2Z93B 3IMVA 4LFHG 4QLRA 5TE4L 3KPSD 3EBHA 5LDUA 2VNCA 5G4NA 1T03H 4P2QD 3PV7A 4BQ6A 5L88H 1FN4A 2XVKA 2J1KA 1U92B 3AQZA 2Z8RA 2CHWA 3QDME 3VH8G 2F7RA 4A7GA 3GEFA 4W68A 3WE1A 1HK6A 1PU0A 1BHGA 2BNRD 3F8UB 5GRXG 1EEYA 1U8LB 5I1DB 4UQ2A 4ALAL 4L0YA 1GIGH 1H5BA 4R7NA 1ZV9A 1VEMA 5AVSB 3MRDB 1U3ZA 2JCCB 4M5ZL 1F02I 1SN0A 1N7ML 1XEDA 1QR4A 3A4FA 1FZOA 4OJFH 2FHBA 5C0DB 4DUXA 5F1IB 5F2FA 1CFSB 2DWYA 4FZ8H 4WSGA 3TBTA 4PJEF 4YFDB 4XXCC 2R0LH 3STBA 5KANI 5E23A 1I1AA 5J8OA 1EJ8A 3VA2C 2P9RA 4N22A 3UGEA 1G7JA 3E8UL 5CBAB 3KWVA 1OZUA 1AXTL 1LILA 2H1XA 5F9WB 3SGDI 5EZPA 2ESVA 5LBSA 3ARGD 5EUOB 1AO7E 2I9LA 4MD5B 5BS0E 3L3OB 4WHDA 1ZS2A 2A4CA 2YMXL 4QRSB 3MRKA 2GJ6B 3AMLA 3JSSA 3ULUE 3OKMB 4HUVA 3U9WA 1Z0NA 3VFRA 1WFNA 4DVBA 1KCWA 3QZWG 4KQ0A 5KTEH 4E41B 5C09E 1A66A 1UC6A 3GI8H 3PDGA 2R0WH 2R59A 2CRZA 4NPKA 5F7YC 5GRJL 4HIPA 4X0NA 2R8SL 4RAVA 4KROD 1HL9A 5ID1A 3IXTA 4OCYL 3RDTA 2HX9A 3Q8BA 1IGTB 3B7RL 3BEWB 4JO5A 3V0IA 1FQ9C 4QTFA 4ORGA 3FFCD 1EXUA 3FQWB 3MRHB 4GJTB 4JJHA 3ZSSA 2A1WL 2AXFB 2FZ3B 2G75B 5TDNB 2VERA 3VFVB 1QD0A 4HV8A 4YAQB 4XAWL 2RCSL 3KG5A 2ZQKA 3RWFA 1E3XA 2EC8A 4FQJL 2AV1B 1VFOA 2XTSA 3FT3B 5I30H 3ZMNA 1FIEA 3BXNA 2YBRA 3RHWF 4RGNB 3D25B 3MRJA 3P0GB 4PR5B 5CP3A 3NUKA 3WENA 1U36A 5GGVL 3EYQC 4XRCA 1ZT1B 2MPVA 3KVQA 4YHZH 3ULSA 3OAYK 2BNQD 4QHUA 1WFMA 3PUUA 2EUWA 4YFLF 3VRIA 4AQEA 1V10A 3JYBA 4LBEA 3H9SD 4LOUC 2E8ZA 5C86A 4TQEH 43C9B 3FH5A 4IBLT 3BHBB 2ZOLB 3N43B 1J0IA 1JSYA 2E27L 3TYGH 4NM8L 1R33A 3SCMB 2ZSVB 3DROA 1RIUH 5CSZA 5JIHA 4ZUVA 5H8DA 3T08A 1XX9C 5IR1B 4RH4A 3GLZA 3TJHC 3N42F 4AEFA 3ZSTA 4POZD 1CDHA 3KBFA 3ARQA 3PG2A 2GKIA 3C2AH 4BKLB 1BVLA 2ZKWA 2MQ0A 3D34A 3PP3K 4KJWD 4X8JB 5FC9A 3TO4D 3FUHA 3RE0A 3BEVB 4N2BA 1H0DA 3CQQA 2ZX9A 4BK5A 1NBYA 4U0RC 1Y6MR 4FQXC 4PS4H 1TOXA 3QUZA 4X4ZA 4KNSA 1A4BA 4LDLB 3NESA 5I26A 2OK0L 4O51B 3UTTD 2BNUA 1SY6H 3AGVA 2YD1A 3NFPB 4GUOA 4U1JB 1G87A 1ZLUH 1MHHA 3LKSA 4ISVA 3OLEA 4XOCA 4NKQB 4E9WA 4R8WL 4XMVA 3PWVB 1RZKH 1DCEA 1FVCA 2VO8A 5E08H 3KXFB 3D05A 3QUYA 3HS0B 4UF7C 4EQ3A 2RQEA 5C6WH 2XA3A 3SDCB 4KK9C 4KITB 1XGTB 2NW2A 4P5KB 1SQMA 3RWHB 2R4SL 3HI5L 3IRZA 3AWGA 1HX0A 2G3ZA 4CNIA 3U2SB 2B14A 3PLYA 2YQ2A 4XWGL 4Z7VB 4RNRB 1L5GA 1WS7A 3N40P 4P46C 3VA6A 5HGHB 1YNTA 4Z3JA 3IDMB 4J28A 5IOKA 3ZKNC 1AE6L 5DVPA 2WXGA 1QVOB 4HULB 3TTSA 1IUZA 3E9TA 5IUSA 3F6JA 3GMMB 3ML9A 4HKZA 1OM3L 3RA7L 3DBXB 3GKZA 3GXUB 3MC0A 3MRPB 4KU1A 5FGCE 1RUKH 3ULUF 3IKCB 4WDIB 4Z3GA 4NP9A 2VDRB 3CDGA 1OAQH 3NRFA 4R3SA 4NNYA 3GM0A 1NFDB 4OIAA 4R26H 1CXEA 5HPMA 2X88A 4Y4FA 1IGJA 1NDGB 1YEHL 2BOCA 3D3VE 1A5FH 3MRNA 1LQSR 3QULA 3UPRA 3WLBA 3EH4B 2YGPA 2QVTA 2F8IA 3KPSA 5DGQA 2DI7A 5JMOC 3MLSH 1TPXB 1MJ7H 4U2ZA 5HHMB 4P2QA 1I8KB 2OMNA 3L3HA 1AC6A 4YSDA 4PY8J 3I50H 4TUOA 4HUUB 2W0PA 3TL5A 4NCDA 1FC1A 1MF2L 2BNRA 2MKLC 4AL8C 4Y1AA 4ODTH 4M6NL 1TYJA 3GK8H 2NUPA 3MKGA 3O4OC 3DV4B 5AB9A 1Z32X 1EFXD 5AENA 4JY4B 3FUNA 4GRMA 1LE5A 3CCHB 3EOBB 4E9SA 2NY0B 3FQ1A 1T7WA 4YHPB 5CD3A 3CPLB 2OMZB 2Z7UA 5C6PB 3LZLA 1R3JB 4AV4A 4OI7A 1F3JA 3LKNA 4FG2A 3NFSL 4PJ5E 4M1CD 4NN5C 5DO8A 1EZUA 1K3ZA 5MERB 1CYWA 2A6DB 4PWFA 3U7AA 4Q6IB 3MKKA 4QO1B 1LK2A 2A6KA 4KTGA 4YMPA 2MCAA 1DDTA 2H6PB 4BXSV 4EUPG 1E5AA 2CRYA 2QQKL 4M93B 1VGKB 1WWWX 1JF5A 3OWRA 2E9JA 4J6IA 5T5FH 1W6LA 3D4CA 4QRFA 2EO7A 4FQIH 1FL3B 1PG7W 4HP5A 4UZUA 5AAWC 1QHQA 1G5AA 1OT2A 3WE6A 5D1XB 2QHLA 4C56A 1JNHA 1BOGA 3DOIA 1C5DA 2BO0A 3NRPA 1F18A 4TLKA 1JNLH 1R3HA 1JF1B 3QO1B 4IDLA 1CLVA 4M5TA 1OPOA 2F08A 2EACA 3FUFA 2F74B 1N0LB 1T5WB 3H6JA 4NKDB 5CLXA 3OLIA 3DTDA 5E94A 1QBBA 1E9QB 1L0PA 2YAEA 1QI3A 1J87A 4YHIB 2JKJA 5A1AA 3OPZH 4UT7H 4W1TA 1O9ZA 3DURA 5JIPA 3GSRB 3VNZA 4ODHH 2YFOA 4H5SA 4QJ5B 2WXPA 2Y7MA 4PRAA 2UY6A 2SEBB 3SPCA 3AT0A 4X6BB 5D70H 1LGVA 3RGVB 1XFPA 3FTUA 3VXMD 3V6OE 3L7EB 2EEFA 4X2UA 5SWZB 4BZYA 2Z7WA 3PNRB 1LDSA 4JRWA 3WV0A 4KOBA 4PM1A 2JKTM 2A38A 1WAEA 2Q8BL 4WI0A 4XODA 1X7QB 5IG7A 2K6YA 3VE0B 4HT1H 4G82A 2PR4L 1ZSHA 3NCJH 1TSRA 2BNQA 1PIFA 1XSOA 2LU3A 4GYBA 4A7QA 4LARL 3H9SA 4MJIB 1MCWM 3MUGB 2VLJE 4HZLA 5AB0A 3SKOB 4PLJC 4TRPH 2PP7A 3MMEA 3VRLE 1DEEA 5KYWB 5FYJU 1A9EB 1X5YA 5CHNB 2RB8A 3SZKC 2WNXA 3BKYH 1KBGL 4W9GC 3GUTA 1FZMA 2R4RH 4HUCA 1YNKH 4GOSA 4NO3B 3K1KC 4RZKA 4YSRA 1R4XA 1BD2B 2GAZA 2WO4A 3B6SA 3TO4A 2O5NA 5C0EB 2QGCA 3X3GL 1SOSA 3D6GA 5CFAA 4HJJL 4KBPA 3T1FB 4D9RE 3QUHA 2XNAA 2XX1A 1FL5B 1UZ6F 3PDDA 1MCHA 1Q9KA 4ATWA 3WY3A 2JJSA 1DVUA 2YA1A 4P2OD 2FRGP 4RSYA 1FCGA 1SDYA 5D1ZI 1CFQB 3SPHA 3UTTA 1UA6H 2G9HA 3AACA 3BP7A 5CJXA 1IX2A 1NC2D 2X1XR 1CDCA 1NWPA 4OF0A 5DLML 2ISDA 4X42A 2OR7A 4D3CL 4DF9A 4O2EB 3F6LA 3F58H 5TE7L 1HI6B 1JJUA 4GSRA 1HKFA 4F33B 4D0BB 1KXQE 1U8KB 3LH9A 5GIRB 3FQXA 3LOWA 2X87A 3WL9A 3KL0A 3ZHLA 4FI7A 5MHSE 2YXMA 1KF9B 4X6EB 2GEQA 4Y4HD 2YPLE 2VKWA 1CIDA 4PG9B 2XQBH 5CJOL 2ZYSA 1NMBH 2EVHA 1BWWA 4WO4A 1IAII 1BIIA 1XCXA 5E9NA 5GRUL 1SEBA 3VFUB 3I2CL 3C5ZC 5EO1A 1FV1B 3IWUA 5IM7B 1K4CB 3TA4D 1FF5A 4NNPL 2WK2A 5ES4B 2BRRL 5HYSB 4XN1A 3FQNA 2XN9B 4UILH 1X5XA 4P9MH 1AYOA 2L7QA 3AY4A 4WGWB 1LWHA 1S8DA 3BIAX 4Q4IA 2EQDA 5CEZL 1QRNB 3HC2A 2FX8L 3PIQA 1IE4A 4BWTA 1PSKH 2IAAC 1B0WA 3GINA 1WGVA 5LGHL 3D0VB 4H8VA 5IKCB 1HDMA 3D0LA 1AJ7H 1Y07A 1AD0B 4KTEL 2VDNL 2CJUL 4HU2A 2AERT 3TPKA 3VD3A 1KY6A 3I9GL 4MAUH 4QXUH 4P5MB 1XR8B 4NKMA 1UXSB 1MY7A 1U8JB 3V6ZB 2D7MA 4PP1C 3E9UA 3TX4A 3D2TA 4FTDA 1ITBB 5KZCB 4PQXA 2ZXAA 4H2CA 1CICB 3BWUC 3QQ3A 5CEYB 1I8MA 1E27A 4W4OA 3NZUA 4ZZKA 1E4JA 5DJZA 3FRPA 1GJUA 3QAZC 1YQVH 4JO2H 4G7VL 2XU9A 4A2GA 3KMDA 3HC4H 4IGBB 2HH0L 1IM3B 2XTJC 4NQED 3QRGH 1TVDA 2ZAHA 1C7SA 2YD0A 1Q38A 3EGDA 3KLHD 5F1SA 4XC1L 3NK4A 4DQOH 4FFWC 2CRIA 3IDJA 3DK0A 4N2EA 3CXHK 5KJRH 4NWTH 2ZUTA 3MYZA 3DPBB 1MPAH 2WBJD 4M6ML 3K2IA 3P4MB 4PUBL 5DO2D 5CCKH 5GS0D 1TCRB 2MSPA 4J12A 5ICXA 3AITA 4M61B 1EVTC 2WKOF 4EIZC 1A6UH 4JO4L 1ETZB 1D5BA 5IBTH 3HS9A 1NCDH 4HGWB 1HVXA 1FL6A 4NO2A 2X4UB 4OD2B 4NX0A 1BVOA 1KIQB 5J1TC 1KJVA 1TQCC 2VR3A 3HLAA 2CIIA 4Y2LA 5I71C 1KN4H 4M29A 2LOEA 4YDJB 2VM4A 2CDFB 1Y18B 3QRFM 2XZCL 4OJYA 4RDBA 2WZPD 1I7UA 1SM3L 1V3KA 4R4NC 4FQHB 2WOBA 2Y6SC 3EO1A 3GI9L 3DO7B 2J1YA 4I18B 3DI3B 3L81A 1ECYA 1P6WA 1QFWL 2X4QB 3D9AL 3QNXA 1BFVL 3MV8B 3GXIA 2CDEA 4AQ1A 4FFZH 1L4IA 2G60H 1U4EA 4L9LC 1UG9A 4QGYA 1UZGA 3VH8B 4MSWA 2FYVA 4PWJA 3BAYA 3GQFA 1NFIA 4KKCD 4O5LL 5IHWA 2CZNA 2EC9T 3B3BA 4ZNCD 2CBQA 3TO2A 4NRZB 2P7TA 3VXMA 3SIKA 3CDZA 2WJ5A 4F5CE 5E5LA 4S0SD 3FO1B 5JHLA 5B39G 3ZU8A 1JGIA 3HFML 4OH2A 4XZ4A 1MCCA 3UDWA 1FNEA 3I3BA 4PJGE 4MRCA 5IQ9B 2GVYA 2A77H 4NXKA 4JVUA 5L7XL 3L6FA 1XD1A 1IE5A 4HEPA 4D8PA 1URLA 4FXKA 2CGZA 1U9KA 1C16B 2ZWZA 4ZTPL 3CLEL 2A83A 5J13B 4TPRL 4B9KC 4NJAL 4JKPH 1IC4L 4H0GA 4YR6A 3U1SH 1RZKC 1JHLH 2R1XA 1UD3A 3HG1D 3KNBA 1ZTMA 2A7BA 2QGBA 2F58L 3QZWB 5LBSL 4JY6B 3KW7A 4PRPD 4DEPB 5E5MB 1RZIB 4M5YL 3QCUH 1VPOH 2WUCH 2JIXA 4H13C 4QOKE 1WZ1H 2FSDA 5H2BA 2UXFA 2ITDB 4ELMB 3JV6B 2OP4H 2WNWA 2VQ4A 3HBPA 4GRLD 2YS4A 5CS7A 5JNYA 4Q0XL 1W2KT 1DLHA 5A2KH 2GCYB 4YBQD 4ODVH 1A7OL 5CEXB 3HE7B 4P4KD 3I02A 3G6DH 5F71A 4AI7A 4GXFA 4PFEA 1BQHG 2XXMB 3X1GA 5I15H 4GBXD 3TN0C 3UYPB 1S7WB 2NTSP 2P49B 5HY9B 4PRID 4WK2B 1X5AA 1BQUA 1DE4B 3O4LE 1JAEA 4WU5B 3IMBA 3ZIYA 2X9ZA 3NQKA 1N0XH 2F19L 3UPAA 1KTDB 1MHCB 3WIIL 4O4YH 2Q8AH 1U8MB 3FDWA 4W9IC 4I3RL 5DQJB 4Y4HA 5DRZA 4W9LC 4V2BA 3QEQB 2H1PL 4B41A 32C2A 5E2UL 2DQCH 2PETA 4HJ0D 2NSXA 2EDRA 1MVYA 2HFTA 3IB4A 5LGJB 5EZJB 4WK4B 5LGYA 3MA7B 5KVDH 3FU8A 3QORB 3BZEA 4UTBA 1T4WA 3Q05A 3CK0H 3N9GH 2XXFA 1KYOJ 5IOPA 4G6MH 5DMGD 1R5VA 3B2UC 1OD9A 3CFEA 5C07B 1BF5A 3ESPA 4PJIF 1OGPA 5EU4B 4KRPC 3QW9A 1HHIA 5F0MB 5HGAA 3H9ZA 2Z35B 4OZGF 1J48A 4GO6B 1JV5A 5LB1A 3MOBH 2NR6D 1A9VA 4H8QA 1AQ8A 4OCXL 5T1DH 3QARA 3WXWH 1E0OB 1JPEA 3RGBA 4TULH 5ALBH 3RL1A 2ORBL 3CSBA 4OKVA 2ZICA 2CH8A 4OZ4B 5EOCJ 4X5XA 1XZ0A 1CFVH 2DYPD 2O4EA 2VQTA 1JUFA 2G9KA 5K9KB 2C1OA 3JVGA 5CR1A 1DTUA 4HS6B 1VSCA 1TTAA 3P9MB 3S37H 4FE9A 1DHKA 5D1ZB 3GIZL 3DX9A 4L4VD 4QIRA 1YEDA 5HGGS 3TLRA 4KZDL 4TSAH 4P5SA 4HS3B 5D93B 3K74B 2YOAA 4IKKA 3TEZA 4KDVA 3WEOA 1IC7H 1V7NL 1JFQL 1KLGA 1IBGH 2ZUUA 5E2TL 1JHTB 3QAQA 1OAKL 3V7MA 3BSZA 5HHOE 4HK3J 4XCCL 1HSAA 1HKLH 2H26A 4XMZA 5D6CA 2H5UA 4L4TB 4Y2OA 2XJLA 3DK2A 3BIKB 3K3QA 2GEEA 1WA2X 3IDGA 2IOOA 2Y22A 3F04A 1WP6A 1V27A 2VO5A 3BAEL 3QFGA 4QHKI 1EIBA 3T65A 3LSOB 2WIMA 3PXJA 4XP9L 3OX8A 4AC4A 4QRPB 1CYGA 3A0OA 1CTNA 1MLBB 4EZKA 1OCWH 1RULH 1IAKB 4U0RB 1JDDA 3O41B 2YRZA 3OKDB 1CGUA 2YUZA 4B27A 1MCIA 3IXAA 3ZYIA 3EUDA 1MFAL 1WISA 2HCZX 3KLAA 1EO8L 2HSIA 1MW3A 4IIQA 1MSPA 3VFWB 5CJ8A 2WZPA 2JKXA 1YEJH 4EBQL 2L0DA 3FT4A 1JI2A 1JP5A 3GMLB 5DI8B 3MLTB 2G0KA 5EZOH 1EAJA 4PW3A 4X4XA 2YD2A 4RGOH 5DUML 5LCVA 3ARFD 1PLGL 5EPMA 3SDDC 5JOPD 2X7LB 4E9XA 3VFTA 2ODIA 3PL6C 4HJSA 3AG1B 1KYAA 1OP4A 5JPMC 3U4EB 3X13A 1RPUA 4M62L 4ELKA 4AENA 2EDTA 1HC1A 4P07A 2ZCLL 4XOAA 3WTYA 5JZ7C 3DHJA 1Y6KR 4QY8A 3SZ6A 4JM2F 4G8EA 2DQUL 1TO5A 2WWKO 3OSKA 1AKJD 5AYQA 2JF1A 4JDTH 4KKPA 1Q9WA 3ILQC 3VWJB 2WZ5A 4Z7WE 3VGFA 1G9HA 4G1MA 4GMTH 4XP1L 5IEKA 1A3RH 5KN5A 4EUPB 5J06A 2ID5A 1AQKL 2BSRA 4OY9A 3Q6GH 3MRBA 1CYXA 1MWAL 2FQFA 2IH1A 3VUAA 4POUB 5C0CE 4PJHE 1KBWA 1ZIBA 3EYFB 4MFHA 4DW2L 3RJOA 3BC9A 4PGBB 1WBZB 2ENQA 4YWGL 2VKXA 4RAUB 5HVFB 3QHTC 4LBAA 4KK8C 2IFFH 1X3DA 2Y36H 1FGVH 3TJPA 1TEFA 2W9EL 4D8OA 2IANB 4Z77A 2D2CC 1A4KB 3L1OH 4C4UA 2APTA 3NEOA 2I85A 2EDKA 4H25A 1E9PA 1WSST 1AIZA 2H47C 3IRCA 4GRLA 5ABDE 1WK0A 4NYLA 2GUOA 1MEXH 2VAJA 2R83A 2GITB 5I75C 4WSJA 4YL9A 2FNWA 5CP7A 5AZ2H 3QUMA 2YMTA 4X6DE 4OLVH 4GBXA 4HWEH 2FEEI 3NA9H 1UOVA 3C60A 1J9RA 1UYWH 3D85B 3ARBD 1QBAA 2FDBP 3H54A 3WGUB 1CBVL 2H8PA 2PKDA 2BVYA 2WTRB 1VB9A 4IDJL 4FQLH 2X4PA 2NZ1A 3KAAA 4F7KA 3D2UD 1OSPL 1P6FA 2HKFL 2PP9A 3ARDA 4LLAA 4BSVA 5LWYL 1I8IB 5F96L 4L3CB 4EN2A 2DWDA 2FX9L 4QLWA 4JS7A 2DOCA 1QPPA 3EZJB 5EN2A 2QQLL 2YAMA 4XO4A 4ZXBC 4DZBA 1EA9C 4PTTB 4YK4B 3MJ9H 1I4FA 2EXYC 4PLKD 1E4WL 1F11B 4RISH 4X6FA 3SOBH 1E9OA 1W0VB 2GTZB 1I9RL 4FXGA 3RAJL 3VG0L 3TPUB 2ATPB 4YDVA 3MRGB 1CT8B 3BMVA 2VERN 4DGYH 3JT2A 3QPXH 3UTSE 1MHPL 2QZQA 3L9YA 2OL3A 3RY6C 4XP5H 4J3OC 1OL0A 2DLFL 2VDML 4L05A 4P59H 4H1LH 1F4HA 3B5TA 1XF3B 3FFDA 2B39A 1HCVA 4UWQB 2NR6A 3EXLA 2RMNA 4FNRA 4I9XA 4JQVC 4AYFB 1UJ3B 1XIWA 1VZHA 1GXEA 1RU9H 3FO2A 5C0GB 1ILSA 4G7RB 4TSCH 3MLXH 2V2WB 4P2RD 5KVFL 5A3IC 2ED9A 2X70B 5C70A 3RZCD 3V4VH 4J8QA 2YKLH 3KH3A 2DYPA 1CF8L 4Z8FL 1XBDA 4KXCA 3ME0B 4FG6D 5F93C 2BFGA 2ZXGA 2AAAA 3PHAA 3BUYA 4HIXH 4F3FA 1GS6X 1WUZA 4LHUD 4PY7B 2X3CA 4YHKH 5I0WA 1QMUA 1R9FA 1Z9SB 1KLFA 4PEEA 1F1AA 1Q1JL 4LB8A 1J5DA 1LD9B 3GXFA 4OD3H 1MRFH 2BRQA 1BA9A 1BF2A 5I6LA 3SJVE 3ZKSD 4RRPA 3W56A 2QPEB 4KO7A 3LXBA 1RIVH 3K2KA 5KSBE 1CMOA 3HN5A 2E7CA 2PPDA 3EJCA 1DBAL 1SJXA 1QFUH 4NQCB 3BW9A 3VTTA 2AEOA 2Y7QB 5ISZE 3S36X 2UYLB 3TH2T 4IRSB 2EE6A 4F2MB 3RBGA 3RFZB 2NX5E 1OALA 5L2KB 3V5HA 4F8NA 3ARYA 2R0KH 3P73A 3PAYA 3OR6B 3UBXA 1ZT4A 2EP6A 4OCLC 4ZD3L 4UQ3B 5F6IB 5IHLB 1IEBA 4HUKB 2G5UA 3ARZA 4HPYH 1VADA 1D9KA 2I7SA 5TGBA 5DURD 2JJUA 4ETQA 2UWEA 2NY7L 3BP5B 5JW3L 4XO5A 1VKXA 2FTAA 4EI5B 4OCMC 3S7GA 1FHNA 3X3FL 3QNZA 4BWWA 2XWJB 1GTNA 4BFBD 3ARFA 2ZONA 4TUKL 3L5XL 4E41D 1LP9B 2MQ3A 4JRXA 4UM8A 4X99B 2GPZA 3ZZQA 2YBGA 1N5YH 2WZ6A 1F1GA 3EYOA 3GBMH 2VXQH 4LAQH 4B53A 5KBMA 1F3DH 2CIKB 1OT4A 4GAYA 4XHQA 4JO3L 1BZ8A 1AHWC 2CHZA 5ADPH 1IGCL 1ACZA 4R7DB 3NMEA 1WBXA 3GIVB 4GRWB 4AG4H 4EJ1C 1AKJA 3ZE2B 3B2MA 4C4KO 2UX6A 1KIPB 2DPKA 4QT5B 3S48A 4Y4KB 2W80C 2CDGB 2RBLA 1QR1A 4KDWA 5HDBE 4LLUB 5C09B 4XVJH 3ETBJ 4AZUA 5CEZE 2BVOB 1B2YA 3P0VH 4RGND 4F7CA 1F4YH 3FN9A 2D03L 1JZ4A 1TZHB 1JWUB 1B3IA 2V2XB 4I0CC 4NNXA 4RQQB 2ATKA 2HVKA 5BZXA 3TFKC 1SY6A 3HRZC 4NWUL 3UZEC 5D2LE 3T4AA 1OOAA 4D9LL 1KYUA 4QEGA 1J8HB 5TJWK 2GSGA 3K6OA 5EBLB 1ZLDA 1JWSB 3CN1A 1S7SB 2EUZA 4FXTA 5A43C 4W9EC 1HOCA 4O00A 4HWBH 5D8JH 3O2WL 4P5RA 1YEKH 4B9JA 5I5JA 4JL1A 2AJXL 2J44A 4ZW3A 4X83A 5D72H 4CAGA 3SCMD 7CGTA 1H15A 1CGXA 4WJKB 5DR5L 3ROOB 4L0PB 2YC1B 5DUBA 1KNOA 3S88L 1Y0LA 4OT1L 2WMPB 2W95A 4BZ1A 1YLBB 1DP0A 3TZVC 4N9OB 1T66D 5C3IA 2X2UA 5AVUB 1BG9A 1DQKA 2V7NB 2EXWD 4MCNA 4FABL 2X2HA 1YZZA 2NY4C 3FQRA 3G9VA 3BUIA 4WHYG 5HJ3B 2I07A 2A9BA 5I17B 3NP3A 3G04B 4PJDF 3BZ5A 1YCSA 1WWBX 4HETA 2WVSA 3VXUB 5B39B 3QC5X 2MHAB 3D2UA 2X1OA 5DJ6A 3WG7B 4MXQC 1QABA 1HH6B 2R56L 2WAHA 3FPYA 5IB4A 4L37B 5AG9A 4YQXL 4MWFA 1YJDL 4XCYB 2AK4B 5K9JL 5IF0B 1GY1A 1NC4D 3OLDA 4XMXA 5KSBF 4LEOA 5TE6H 1EO7A 3R1GL 2ZUWA 1UT1A 2B59B 1T80A 4XB3A 3MGTA 1IEAA 1LNUA 4JB9L 1X44A 1M7IB 1IQDB 3IAPA 3BLPX 1HE7A 1CE1L 4MJ2A 2J88H 1WS8A 4M1GH 2XZAL 1HOEA 2OPCA 1QBMH 5T1MA 1G6VK 3K2UH 5I1JH 4WUKL 4LMQE 3U4AA 4AQ8A 1IGYA 4YSUA 2Y2YA 2LFGA 3PABB 2HJFB 1ZK5A 4K3DH 4TTGA 5IK3A 2FR4A 2IXQB 2IALB 4PGEB 3FKUS 2IGTA 5ANMB 3K8KA 3RI5K 3GMRA 2DTML 3OAUH 3AABA 4NEHB 1JV2B 4U3SA 1OGAA 3VMPA 3IPFA 3BQUA 2GBVA 2W0FB 5I6PA 2VZVA 5DJAB 2VR7A 1BQHB 1R3LB 1GR7A 4CC1A 1JZFA 4LHUA 4EDXB 2Z93A 3BMWA 3FU0A 3OXRB 1H3GA 1ZMYA 1WRFA 4Y5XC 1JPST 2WXIA 4LCCC 2FWSA 3QGVA 5BMFH 3WLWC 2YEZB 1UT9A 1B88A 1U92A 2FATL 4FJZA 5GHWH 2VW6A 2ICEB 3B1TA 3DVIA 3QWRD 3MBEC 4NO5B 1R0AH 5D1QD 3MLRL 3HJ0A 1T21B 3OZKA 2J8HA 3FRUB 1MCJA 2GJJA 1SDDB 5I1DA 1U8LA 4XNYH 4JDZB 1KFAH 1RUPL 1ZEAH 1FRGL 4YUEL 2CR0A 3MRDA 1HT6A 2JCCA 4UTCA 3WJJC 3DJ9A 2E7MA 4PJFF 5AZEL 1G43A 3QZNA 5I24A 5C0DA 5FUOH 1A7NH 5F1IA 4OFDA 5FK9B 4CU7A 1BG1A 1CFSA 4U33A 5CZXC 4YS4A 2NXZC 5J4MA 4FRWA 4F92B 4L2LA 4R2GB 5E99H 3TV3L 4H20H 5CBAA 2YGNA 4UTBL 5FF6A 3GSOB 3ISRA 2R29A 4ZPTA 4DGWC 4OJDH 3LNDA 4R7XA 4WKXA 2ILLA 4YPGB 5AVRB 1R5WB 3AXLB 3JTBA 4WW2B 1YC7A 4JFHD 3RILA 2JNZA 2OTUB 5EUOA 3V52H 4GXVL 1OXYA 2HMID 1AYRA 4MD5A 2BZDA 3L3OA 4QRSA 3FT0A 4GI9A 2GJ6A 4YLCA 4D0CB 4XNQB 1GCYA 3OKMA 3DSFH 5D1XD 3O8XB 1K2DB 3QDJD 4E41A 3AY2A 2A0LD 2BY2A 2Y7OA 3AQDA 2XIIA 2D4FA 3LS4L 4MA3B 3WO4C 5BUPA 1OT1A 3PF2A 1CB4A 3V6BR 3VG9B 1JGLH 4Z7NF 4HD9A 3N91A 4N1EA 2OI9C 2K9FB 1IFHL 3IWVA 1J0HA 4ZAKC 1IGTA 4LSUH 2QLYA 3BEWA 4B5ZA 4NM4L 3WCYA 3FQWA 3MRHA 1E4HA 3SE4A 5K9OA 3IJSB 2AXFA 2FZ3A 1E7UA 3RKDC 5ERWB 2G75A 5TDNA 5TPWH 4UQBA 3VFVA 3RWDB 4YAQA 5K59E 1VGEH 4Q58C 3IDXL 2AV1A 4L1TA 3VAEA 3UAFA 4PH8A 3RGVD 2QADB 3FT3A 5SWZD 3K8LA 3HR6A 3D25A 3QJZA 1JGUH 5J6SA 5T1KB 4KI1A 4NDMB 4GAGH 5C0ND 4F7MB 3BSZL 5EEXA 5E5UB 5E2JA 3INOA 2A74C 2APXA 2TSBA 2OYPA 5GS0L 3T0ED 2ZWLT 4KKQA 1T1ZB 43C9A 4K7FB 4QI3A 3WY2A 2WO2B 3BHBA 1G9NH 1YNLH 2ZOLA 4HGKC 4M7JH 4U4IA 4P5TC 3SCMA 1OTTD 2ZSVA 3T2NL 5J1SC 2Q7YB 1NEUA 2B2XH 1NKGA 2YD4A 4R4FL 2X05A 5IR1A 3F85A 5TDPB 2E4TA 2EKSA 2WQUA 4XT1C 1BBDL 3D4YA 1EJOL 1D6VH 4E9TA 1YY9C 1GJWA 2UZIL 2Z64C 4BKLA 4YHOH 3KCPB 4X8JA 2IWGA 2XCMC 3FN0H 4QRUB 3ULUH 3BEVA 2W60B 3ATAA 5EHFA 5BQ7B 3GPEA 3APNA 5ALCH 3NCYP 5E7BA 5LCVL 1NBCA 4KUCF 5AKRA 3FQUB 1PNDA 5ESVB 1B0IA 5BQDA 2E9IA 1DSFL 1MVFA 3KCWA 3VXPB 3QPQC 4WFED 5AVVB 1L0XA 1KXTB 3MJ6A 3NFPA 1OVZA 2HLFC 4U1JA 3N1QC 2AKRB 3ZDZF 2D3LA 3RVWC 2FJSA 1UA3A 3LIZH 3PWVA 4LVOB 4NZRH 3KXFA 2KT6A 1CTOA 2WXKA 3HS0A 3U36B 4KKBC 1SMDA 1CWVA 3DUUB 2AEQH 3ARED 2JB6A 3IGFA 4LO9A 3SDCA 1XGTA 4P5KA 1P9MA 3OGOE 3RWHA 2K8MA 4XWOD 3CFKA 1CIUA 5I1IL 3U2SA 3GBNH 1N18A 1QATA 1IFRA 4HC1L 3CDFA 3SBWA 4QRBA 4RZCB 1A7QH 2CKBB 4QTIL 3L1GA 2FT6A 2PTTB 4KI5D 1NAMB 1Z9LA 5I1EL 3KPSE 2KC0A 1BQLL 3NJIA 5F6HI 4AM0A 4GLRH 1LL1A 5A2BA 3NZ8B 3AC0A 4U7KA 2YA2A 1QVOA 4P2QE 5E70A 3GMMA 5FHAH 2XN9D 4N8VG 1FDLL 3DBXA 2WLMA 3QG7L 3MRPA 2EUXA 3RVTD 3F7LA 3IKCA 4KQ4L 4WDIA 5JW5B 1E6JH 1OPGL 2BNRE 4Q74A 8FABB 4L18A 4Y1AE 1QRND 1MFNA 1WE5A 1RSFA 3Q5TA 3JXAA 4HIEA 4WNSA 2YPLB 1NFDA 2NW3B 4I2XB 2KPNA 2P44B 3UXFA 3EJJX 1FE8L 1NDGA 2YLKA 2AJUL 3MNMA 1DCLA 2CWRA 4WF7A 3BZ4B 3GRWH 1XGUB 4OF5A 2ROYA 3ZRCC 3QIBC 4J27A 4XPFL 1NH6A 1OE2A 2QFRA 4LKXB 3BO8B 3E2HB 3QUML 4M1DH 3RIKA 1LJMA 3N2JA 1NCOA 3QWRA 1VZIA 2XJKA 1SF5A 1Z9PA 3OKEA 1ZLVK 4HUUA 1KJ2B 2W5PA 5EF2A 4NZTH 5KZCD 1MCQA 1XWVA 3QNFA 4M7LL 1COBA 1MZYA 1XVSA 3KPLB 1IGIL 4GG8B 2G5BB 2W8CA 3HI1A 1NAKL 3MTXA 5G55A 3GZOA 5F3HA 5JORB 2J5WA 1BVNP 3DV4A 4TSBH 4HF5L 1KXVC 4JPKH 3ZMRA 3L5JA 4IGBD 3CCHA 1IM3D 1F4XH 3EOBA 4LPWA 4OIIL 4YHPA 2OMZA 1R3JA 1TLMA 1AR1B 5MERA 3QRBA 4JHWL 2A6DA 3VX1A 5L88L 4Q6IA 2XLLA 3OKYA 7TAAA 4J3BA 1MAJA 4QO1A 3HCVB 3VD5A 1TZAA 3UC0L 2H6PA 3BZFB 4PN6A 5DVOA 4PWIA 5I75B 4UIMA 4PJAF 1VGKA 1Q9OB 4HUWB 4JGNA 2OL3L 1GIGL 1HN1A 4ZODA 3FFCE 1IGFL 3IETB 4AEIL 1HXKA 1X9RA 5D1XA 1T4KB 3NG5A 1A1NB 1U95B 3QHZL 2YQGA 5IBLD 4V1DB 4LVHC 1A6WL 1JF1A 3AU0A 5L6YH 1AFVH 3QO1A 4J1UB 2IJ0C 4O2CB 4G42B 1T0NB 3RWJB 4DKTA 2F74A 2XQ0A 3QDHA 1N0LA 4ZUWB 5IWLA 1ZGLM 4LFHD 4NKDA 4LNVA 3B9KD 4HJGB 3T6WA 1MFUA 1I8AA 1WHOA 4GAAA 1E9QA 3F00A 2VW4A 2V3EA 4BA0A 1IKFL 3MV8D 4WGVB 2BNQE 1RUMH 4YHIA 4Y5VC 2YUWA 3H9SE 3GSRA 1GOGA 2OMXB 3LD8C 4GKZB 1DANU 2ZJSH 1DBML 1QKZL 3HB3C 4G6AD 2R2HB 3NJKA 3H42L 2YARA 3C6LC 3GBLA 4X6BA 2DBLL 4J3UA 4M4RB 5T3XD 3RGVA 1KBPA 3B8YA 3KWTA 2K7QA 5SWZA 2NY1B 1JBJA 2H6OA 3BVUA 5AOIA 1M6OB 2QHRL 3RTQC 4ONGH 4X98B 1X7QA 3S3PA 3VE0A 4PWEA 4FX5A 3QEGH 4X50A 2HG0A 4N0UB 4A68A 1JCVA 3O6ML 1TDQA 4OCSH 1HTYA 4DFIA 4MJIA 5C6TH 4EMZA 3GMQB 3STZB 1NLBH 3TEWA 1HESA 4A39A 3SKOA 2G4GA 3AXHA 4AY0A 5C2BH 5B7MA 3A67H 4WI3A 4B95C 5KYWA 1HU8A 1KUMA 1A9EA 1MY5A 4W6YB 4PJXB 4RWHA 5CHNA 4QWWD 1DSWA 5F6HJ 2TRYA 3UTTE 1TJIH 5IQNA 1IBYA 2E5EA 2X2YA 5C0AB 1PG7H 4HAGA 4NO3A 2VGLM 3KJ4B 5A2LH 3S0PA 5T33H 4MMZA 1BD2A 3CFDA 3LS5L 1CXFA 4BIKA 5C0EA 1N5AB 1OE1A 4WWKC 4TF4A 2WXFA 4YEEA 3F7RA 3EBAA 3HRPA 4UCFA 5BNXD 1K85A 3D48R 3T1FA 4MJ6B 2WYTA 1FL5A 4OZIB 1FNFA 2VN6A 3QO0B 2BP5M 2AQSA 4IMLB 1RIUL 1AXIB 4NLAA 1XCWA 2F8XC 4DHLA 3ZMEA 3JWDH 1JTPA 4O2EA 2QSCH 2D7QA 1PF3A 2OSXA 3Q8EA 1GZPB 1HI6A 3HN3A 4UDTB 4F33A 3C2AL 4ZT1A 3CU7A 3QCVL 4D0BA 3PFQA 1ZGLP 1K5WA 4OFVA 1ZE3C 5GIRA 1PLCA 4QOKB 5C0RH 2QBWA 3VXRB 3DX0A 4XVTL 1WO2A 1N59B 2BM3A 5EZIH 1FIGH 3QQXA 3KPNA 1T0OA 4KC3B 4X6EA 4YIQA 5AOMA 1W91A 2AEIT 2P26A 4ZQTA 4A2LA 5IY5B 4PG9A 3M86A 3QEQD 4JFZL 2FBOJ 4QCIB 5IROC 4N0YH 1EEUA 2ZOOA 3Q3GB 1C5CH 4EQ2A 3VFUA 2QELA 1SY6L 3O0RH 5EU5B 3VSVA 1FV1A 1FNGA 1K4CA 3VD1A 2C9RA 1WIOA 2XV0A 3O4LB 4NERA 5TF0A 4H0IA 2XN9A 2VZUA 3S34L 5E08L 1P4IH 3O2VH 2RTTA 2HFFB 5I5MA 2OR9H 1WLHA 3WJLC 2LVCA 1QRNA 3I9IA 2XWCA 1A3LH 4U49A 3TYFB 3HUJB 1BYOA 2E9WA 3Q2CA 3D0VA 4PI0A 2PCXA 2B3IA 5DFVC 4BZ1L 2QSVA 2XVGA 4WTZG 1B9KA 3TT1H 3I9PA 3OB8A 3HG5A 3UO1L 5KYUB 1JRHH 3TF4A 1XR8A 1DQIA 1EGJA 3CLFL 1UXSA 4JG9A 4KY1H 1U8JA 4JR9H 5FKPB 3V6ZA 3JWOC 1PDKB 3O3UN 3EFDL 4OGYH 4KK5C 3OMAB 2ZD0A 3EYQD 1VEOA 3LIUA 1RH8A 5CEYA 5CXPA 1LDPH 3DIFB 5HI3C 1ZPUA 2F54B 4NHCL 4EKXA 4LOUD 4AYGA 3ZKXB 3ZDXE 2Q7NA 2KQMA 2AK1H 1NAMH 4IGBA 1IM3A 1A5FL 1TMCB 3WD5H 4A67A 1LWJA 2OXGB 1SJVA 1HHHB 1HQRB 3MACH 5D5MB 1G9MC 3STLB 3R19A 2XPZA 25C8L 2DWTA 5H94B 3TJHD 4DN3L 3DPBA 1EHKB 3FTWA 3VI4E 1CTMA 3P4MA 2Y5QA 3SKMB 4D2NA 1ACYH 3C9NB 3LEVH 1E4XI 1HXYB 1TCRA 4JZJC 5MEQB 5H35B 1WV7T 2CR3A 3EGSB 1ETZA 3FSWA 4FLHA 4TTDC 4Y8AA 3U82B 3S3DB 4OF7A 2HAZA 3VXNB 4GW5A 1ZXKA 2X4UA 2YN5A 4OD2A 1EZLA 3ILPB 1INEH 3IFPB 4MTMA 2BHFA 1KIQA 4FQXD 4YDIH 5BO1H 2K9UA 4I77H 5A7EA 3W2DL 1U3HC 5D71L 2IPUK 4YDJA 2B1HH 3VXME 2CDFA 1Y18A 2QQNL 1WC7B 2Z1KA 3JTTB 3QZOA 2VDOB 2R2CA 4FQHA 4O02H 1G9NC 4KQ3H 2LR4A 4DESA 5PCYA 1RZGB 4PRHB 2X4QA 3MV8A 1G1YA 4X8GA 4Z7OE 3BH8B 5CGMA 4H4NA 2K45A 3U6XS 4IBVA 1PZ2A 3X2QB 3ARWA 4HISA 4G7QB 3BZDA 3BPOC 5E2VL 1UVQA 3WDJA 1MCOL 2DY2A 4NRZA 4W93A 5CWSB 2GIMA 3ULUC 2NY6B 4L3EB 5I73B 1EDQA 2K7PA 4ONOA 3ZKND 4P4RB 1GS7A 2J5LB 4KVPA 1CU4H 3P4NB 3FK3A 5INDB 2F2HA 3VWJD 1E65A 1JPGB 3MBWB 4FFYA 3SDYL 1W8NA 3OV6A 1VESA 4IRJC 1ZD6A 4LCIL 2XT1B 4Z5RB 2IGLA 1IQWH 1UWEH 2O5XL 2X4OB 3OPZL 4PSPA 1AAJA 4G1EB 1DQLL 4LCYB 4MDJA 4ODHL 3UCRA 1CDYA 4X4MA 5EDSA 2XG5A 4OFYA 1DDHB 1NTDA 3QR1A 3RVVD 1RZFL 5D70L 4PB9L 4TVUA 1KWKA 2R29L 2FCBA 4XNMB 3VGDA 2NMSA 2IDTA 4CMHB 2DIJA 3O6KL 1XL4A 1FFNA 5CO1A 3QZWA 5D7JC 1I53A 4HT1L 1RK1B 4KKNA 3H55A 1RVFH 1RZIA 1T3FB 4RDQF 5E5MA 3IVKB 4Z7WB 2V5YA 3KHOA 4WO0A 2VYRE 1DFXA 2BIMA 2QGEA 4Z7AA 3SBRA 2GIXA 3S3JA 1RSYA 2ITDA 4ELMA 3UMNA 3NIGF 1R3KB 4ZMOA 5IT2H 4BINA 4TRPL 4AV5A 2RAMA 4W9KC 4WEUD 4FZEL 2GCYA 3T3PE 2JELH 1VFMA 1JZIA 4IRZA 5CEXA 3HE7A 5H4ZA 3ZQXA 4PJHB 2V33A 1YEEL 4LMQI 4XXCA 5A7BA 2NXZB 3UYPA 1S7WA 1H19A 2IH3B 4NRXA 1DE4A 3LRKA 1JVLA 4U1GC 3QC6X 4WU5A 3TASA 2JLLA 3ZDXF 3BKJH 1J18A 2DQEL 3FSOA 1KTDA 1MHCA 4NAJA 1U8MA 2IMMA 1NGYB 2B1AH 5DQJA 1I1FB 2Q1EA 3S35L 1ZANH 1EMTL 3PGFH 1W6WA 3PXLA 1T83A 3QEQA 5JO5A 2YGOA 3MUY1 4F58H 5LGJA 4JN1H 1LLAA 1ML0A 4X6DB 1J1PL 5CNHA 1CL7H 3MA7A 3QUXC 3QORA 4BA8A 1SBSL 4OCRH 4YHYC 1E43A 2C4XA 2ADJB 1F86A 2WNKA 5FUCC 2EILB 1ZLVH 1A14L 4BKSC 1OO2A 2OI9B 3K7UA 4N5EC 5EU4A 3V0JA 2IOIA 5HVHC 3A6BH 2Z35A 1DVFC 2LAAA 1MRDH 5KSAC 1FO0H 4LHJB 5TE4H 5LNEA 4XVUD 3L3DA 1BQ5A 5LGKA 4ENEC 3I6GB 2W9DL 3Q1SH 2IH9A 3V8OA 1EAQA 1NMCC 2QV4A 4LEXL 5LAXB 5IQOA 2Z8WC 3EDDA 4OB5H 4U3CA 3ZR5A 1F3DJ 4OLYL 5CAYB 4MD0B 4ALAH 1U91B 3V6FA 5K9KA 4P9ML 2I7OA 1MH5B 3P3TA 4IKIA 4NBXB 4M5ZH 4HS6A 2WD0A 1N7MH 3P9MA 1H3VA 4ZOEA 5FWRA 2VR4A 2X53A 5LNDA 1L9TA 1UT2A 1WZKA 5D1ZA 2OYKA 1ID5I 4HMDA 1QLFB 4HS3A 1MJJA 3ECUA 4MLIA 4AXWB 4BXVA 3IGAB 5FO7B 3UADA 1YMMB 3C8KB 2IDQA 2WLNA 3E8UH 4I0PC 1DBJH 5GGUB 1H3XA 3MRMA 1AXTH 4MAUL 3CHOA 3H7BB 3BVVA 3BKML 1JHTA 2XKNB 4KXDA 4FADA 2H32B 5ITFB 3GF8A 3BIKA 4YDMA 3UEZA 3OXSB 1UFGA 3NJNA 3GZKA 4FF9A 4AWJC 2YMXH 4JAMB 2W81C 3RRQA 2WTOA 1I1YB 1T04B 1F6FB 4YFLI 1CR9L 3AU1B 2AJZB 3UBGA 1JGEB 1RHFA 1SYVB 3LSOA 1YEIH 3MRRB 4N8VB 4JZNB 4QRPA 3FU9A 4NENA 3DV6B 4A7UA 3RL2B 3GTVA 1MLBA 1WH0A 1UENA 3LRSB 3TESA 1JYVA 3O41A 5GRJH 5KAQF 3OKDA 3VFPA 5I28A 2R8SH 3KDPB 4YC2C 1HSBB 5E1QA 5F0LB 1ZAGA 2XICA 1PY0A 3S9DB 5DD3L 1A1OB 4OCYH 1C08B 5EDXA 5EFIA 4ABQA 4GFXA 1M9SA 2VCOA 1KBKA 5EU6B 2EDJA 1ZT7B 1FAKT 3T09A 4PRNB 2NXYC 4UUJB 5J9PB 2VDRL 3C75A 5EZLB 3GMLA 2A1WH 3ES6B 4FKKA 1XCQB 5CCKL 5ISZB 1RUAL 2KLSA 3MLTA 4D7PA 4XAWH 2RCSH 1MKFA 4DKAA 4FQJH 2X7LA 3RX8A 3WIFB 5D4IA 4IU2B 1NCDL 2J1XA 4JDVB 1SVCP 2ARJQ 1M57B 3DUHA 3U4EA 1B0RA 5DHVB 5I1CH 1X4YA 4BK4A 4X9IA 3S2CA 2FH8A 4ANXA 1D5IH 2MCPL 3LQMA 4M9PA 5SV3A 1KN4L 2R7EB 3MYJA 3C5ZD 4N3UA 3FMGL 4MMXC 4AKQA 3P3RA 5FW6A 4K5LA 1B4TA 1WFIA 2D9QB 2W9LA 2WLHA 2X41A 4K71B 3VWJA 4PRPE 3WAJA 1D5ZB 2EDOA 2YJLA 5DRNA 2A2QT 2E27H 2F7IA 4XOBA 3EFOB 3LTVA 4NM8H 5F89B 4K8RD 1S3KL 1H6FA 1UEMA 4K9EC 4EUPA 3JWDC 2HJLA 1PFOA 1S9WB 5FHBL 1R24B 1JZ7A 3E8VA 2BY1A 4N2LA 1OK0A 4PV9B 5AD0B 4K73A 3BGMB 4F2EA 4LKCB 4PGBA 1WBZA 1R0AL 3H0TB 3QA3B 4JG1H 5DJ2A 2ZX8A 4RAUA 3V6OC 3DMMB 4TVPD 4PP1D 4RMWA 5KVEL 4PRIE 4GUCA 3AB0C 3S35X 2MOGA 5HDBB 2IANA 4QRQB 2BIIA 1TQBB 3CN3A 1A4KA 4AVKA 2OK0H 1NMAH 5IJVB 1B3JA 5AQ0A 3B83A 4UV7L 3LDBC 5DHYB 4IBTA 4YVNA 4FNUA 3WIHA 1I75A 1TJGL 5C9JB 4Q4EA 5I6XC 2XTJD 2GITA 2V7HB 2E6PA 3A3YB 1XGYL 3E3QE 3LVTA 5F7LB 5BCAA 2P5EB 2DQ6A 4NKOA 4R8WH 1ETJA 1I7ZB 4FFWD 1LK3L 4OIBA 5HI5C 3SDAB 3T8XB 1JIBA 1DVQA 4OLEA 3D85A 5AW3B 3QCUL 4AIOA 2QLVB 2R4SH 2WUCL 2WTRA 3HI5H 4F37K 3VXUD 4KXZH 3KVDD 2BWQA 2V5MA 4TVSa 4XWGH 1PZSA 3PPSA 5IFHL 1I8IA 4L3CA 4F9LC 2AK4D 2GSMB 4X6CB 1KJ3L 4NC0B 1MIML 3TVMB 2DM3A 3EBIA 5AAWA 1UEYA 1AE6H 4PTTA 1TQUA 5JDSB 3WEXB 1UASA 4LDCA 2VIRB 2VXTL 3TBSB 3G6DL 1OM3H 1RI8A 5LXVA 1F11A 1H6TA 3RA7H 1W0VA 4KKAD 2GTZA 3MROB 2G2NA 3A5VA 3TPUA 2ATPA 4Z78B 3KGUA 4MQ7B 3MRGA 1CT8A 4JL2A 4R4ND 3HNVL 1FNLA 2Y6SD 1QSZA 4EXKA 1YEHH 2Q8AL 2X4TB 4QXVA 4C83B 2B16A 4HSCX 5KG9B 1XF3A 3EXJA 1EXHA 2VJ8A 3OAZH 3COOA 3LD8B 4AGMA 4ENZA 4AYFA 1UJ3A 4NC1E 5C0GA 1A3ZA 5KUMA 1DVXA 1KGXA 1MF2H 2X70A 1DBKL 1JZGA 3IJYB 4Y9BA 4CU6A 1J5OL 3CK0L 1I8LA 4N8UA 2VQ1B 4M6NH 4F8LA 3ME0A 1ZVYA 1GH7A 3BYTA 3RU8L 4WK0B 3MRLB 5IVZB 4PY7A 4L4JA 1DYZA 4EXPX 1Z9SA 1NANH 3KS0H 1M2VB 4WWID 4FP8L 4KZ0A 5ICYB 3PWUB 4K5OA 3UTQA 1N4XL 5HDOA 4A38A 4G80A 3NFSH 2PO6B 1WIUA 1LD9A 1BXAA 4WFFD 1K8DB 4ATTA 1LO5B 3WTXA 1G9EA 1MIEL 4P2YA 2Y06L 2ZKXA 4NPYB 3K5RA 4J3XA 4RMBA 3HNSH 5HGBB 5ALBL 5MEND 3WNKA 3IE4A 2EIEA 4F7PB 2DH3A 4NQCA 1TNMA 1H5BB 1DJGA 5E1IA 2Y7QA 2UWEE 2BFVL 1T1XB 4IRSA 4R96B 2HPOA 3MRIB 4F2MA 3RFZA 5L2KA 3P9WB 2CBPA 4FYQA 2VDLB 2J71A 2C7FA 3ZTDC 3GSXA 5JOPE 2KKQA 1MLCB 3OR6A 3CPUA 4UQ3A 3AM8C 2MJWA 3DIDA 5JYMA 4E9LA 4XVOA 2XN0A 3IPBA 1X9LA 1VEPA 1QLEB 5D6DA 1T7YA 2APVA 2X6UA 5BZWB 4NCC1 5IIEA 2OSWA 4KKRA 1GSKA 3FUJA 4NZDA 3MLUH 1DQML 4EI5A 2J2ZB 5DJDB 4JZOA 3MRKB 3SGEH 2E7LC 2WLLB 4BFKA 3JV5A 1LP9A 4U1NB 4X99A 4PP2B 3SOTA 2V4LA 4GQRA 4IHOB 1OAUL 2PPFA 2X6VA 1G7MA 5BOJA 1VFAB 1KACB 3SYOA 2CIKA 1R75A 5TK2A 2PR4H 5IHBA 5HP5A 2KHAA 4R7DA 3GIVA 3U0WH 4KK6C 4LARH 1YEJL 3WS6A 4B7LA 5CM1A 4QT5A 2E7BA 4QR7A 4GS7B 2WSDA 3B2UD 5C8JB 4Y4KA 1EFQA 3OKLB 2CDGA 4MNQD 3KLQA 5CZRA 4KRPD 4LLUA 2BVOA 1TZGH 4OFQA 5F0JB 1SYSA 2UXTA 3VMOA 4DEWA 4J5VA 5T1KD 1TZHA 1JWUA 1ODUA 2V2XA 1KBGH 4QRTB 4RQQA 4TXVB 4Z95H 1Y1DA 2YD3A 3UAJC 3Q0HA 5DRXA 1OLZA 2Z0BA 1O0VA 4OVVA 5JHAA 4DKEL 1J8HA 4AQEB 2AJYL 2HT4C 2XPGB 4LE8A 5EBLA 1JWSA 4HJJH 1S7SA 2ZE0A 5I66B 5F88B 1TQSA 1D5XB 4GMTL 2J8UA 2YWZA 3BWUF 5CLTA 4XR8C 1QSFB 2YC1A 3CN4A 5AOJA 5EA0L 4XN2A 5FDYA 2WMPA 5DYOB 3ZUCA 5L0QC 2EAEA 3LB6C 5I6NA 5DLMH 5ITBL 4D3CH 1A8JH 4HALA 4HXBL 1CDIA 5TE7H 2WGXA 2ZOKB 2AITA 2V7NA 4RAHA 4YXHL 3TV8A 4ZSOE 1TEGA 1DQDL 4GG6A 4APQB 3MJGX 3IS1X 5HJ3A 1JDAA 1WAAA 5FA4B 4Q6KA 3ZE0B 1HL4A 5I0XA 5I17A 3G04A 2ZT9C 3HS8A 1ET8A 3KPMB 3IJ7A 3VXUA 2VUYA 5B39A 2MHAA 3BAIA 4ZTOL 1HH6A 3LKPA 4Y5YC 1E90A 4L37A 2Q20A 5GRUH 4XCYA 2WV3A 3MLWH 2AK4A 3DX7B 3SKUD 2XIDA 1PEZA 1W72B 5IF0A 1UGNA 1I85C 4ALAC 4NNPH 3K4AA 3LNEA 3O0LA 2BRRH 4OLWH 2UWEF 2Z31B 3QI9C 2B59A 4GO8A 1KB9J 3V0GA 2F61A 3DIVA 1ET5A 3HAEH 3NA9L 4FFYL 5A2AA 5CEZH 1Z66A 1M7IA 4WTXA 1UYWL 1IQDA 2FX8H 3OKKB 1OP5K 2X4NB 3HNTH 1OGAE 4LPTA 3ZTNH 4DOHB 4PVNA 3TA3C 3KL3A 1NGZB 2K4WA 4FGMA 4KTEH 2LGNA 3PAVA 1GYVA 1Z0MA 1P5UC 2CJUH 1U8QB 2CO7B 2VDNH 2X0UA 3ASOB 4JM2C 3LJ3A 4L9LA 3SDDD 3PL6D 4R90H 2WC7A 5IHZB 3FO9B 2DJUA 4GKSB 4UAOC 2EO1A 4L5FL 4Z7QF 3PABA 1QRKA 2IXQA 2MNJB 4FTVD 4PGEA 4Z76A 5JHLL 3SOBL 5CJQH 5ANMA 1PEWA 2HKAA 3BVDB 4IOSD 3SE9H 5JZ7D 3FHAA 1JV2A 1S9VB 4HLEA 3OG6B 4HH8A 3C6SB 5FECB 2CBTA 4NNYB 1WWAX 1T6WA 5DJAA 1BQHA 5DJ8B 1JK9B 4G7VH 1KEGL 5KYNA 1S78C 3B43A 4Y4FB 5HPMB 3DHPA 2HH0H 2JCCE 5GJTH 4E5XG 4Q6YA 4EDXA 4YJZL 3OXRA 4IRZL 3QDAA 1RZJC 4XC1H 4ZMPA 4F7EB 5D7EA 2XBDA 2YA0A 4P2QB 2YEZA 1O9WA 2ICEA 3QB7C 4RFNB 4S1DC 4R5TA 4FA6A 2D73A 3RNKB 5LBVA 4J4PC 4GH7B 3HKFA 1U8HA 4M6MH 4ZX3A 1T21A 4NZJA 1RPKA 4IJ3C 1MFDL 2YKLL 4JDZA 3VB8A 4DSYA 4JO4H 2WAQA 5CIPH 5D7JB 3D69B 4HIXL 4KK8D 2PXYC 4YHKL 5FK9A 4Q9RH 3K8MA 5ANHA 3SD2A 4E41E 1PS3A 1TENA 3OSVA 2QTVA 1ORQB 1CFNA 2ARJB 1MRFL 3V5DB 2XZCH 1PX8A 3GSOA 1SM3H 1PZCA 1R5WA 3AXLA 3GI9H 4WW2A 3ELAT 4PD4J 2ZG3A 3B2VL 1L9MA 2OTUA 4ZOBA 3ZZSA 1QFWH 3P30L 4P2CG 3D9AH 1B90A 1BFVH 3ARGB 3FNKA 1JTOA 4XPAH 4DN4H 2J72A 5CF3A 3TH4T 2ED8A 2CO6B 4D0CA 4XNQA 1UWGH 3CQPA 4O5LH 2UUDK 3O8XA 3DC0A 1K2DA 2ITEA 5C0FB 4V1DD 4UQAA 3T04D 1ODAA 4MA3A 4TLUA 2LTQC 1N67A 4QHNB 3VQ1C 3ZDYB 4RGNE 3HFMH 4KROB 1V54B 3C6EA 3QVAA 2BXYA 5E94B 5E8PB 2EXYD 2B5IB 3NPSC 5L7XH 3IJSA 2D9CA 3FFCB 1KC5L 5ERWA 2VWEE 1FVEB 3RWDA 3B1UA 3CLEH 4Y19D 3BVXA 2P5PA 5K93A 4TPRH 3T9WA 1IC4H 1M05B 2WBXA 1DVFB 2BHYA 4J3OD 4M48H 2DRUA 2WB1A 3HE6C 3WHE1 1KTLB 3ZL4H 4CILA 2QKSA 5T1KA 1SJMA 3GBML 4K3JL 4NDMA 4RLDA 2OA9A 4F7MA 2YGVA 1G7PB 2OMWB 2F58H 5LBSH 4XCNB 5DS2A 4WCYL 4CUCA 4M5YH 2J6EA 5IHUL 1TTFA 2BLFA 5A3ID 1PZAA 5J0BA 4MCYA 1T1ZA 1IAIL 4MAZA 3H9SB 4K7FA 2J8OA 1FNHA 2G2PA 1O5DT 4BFOA 1ONQB 4WW1B 2FQGA 5D9SB 3FSZA 4FFTA 4RSVA 2DH2A 4Q0XH 3RPIB 3ATEA 4BV1A 5FYKD 4WHTA 4MJJA 2Q7YA 1EUUA 1CK0H 1MFEH 1A22B 1OTUC 1UB5B 2DMGA 1F4YL 2I69A 4XXWC 5TDPA 5C0JB 4UMGA 5C0AD 2NT1A 3V10A 5E9AA 5KWYC 3I6LE 3GUTB 2DJSA 3L4CA 4JCWA 2E59A 4FN0A 5GZNA 3KCPA 4JY5H 2BW5A 4QRUA 5HHQB 5F7DB 2F19H 2W60A 3WIIH 2JCCF 5SWQB 2PYEB 5CBEB 5F7EL 3LXUX 2JKWA 3EUUA 3FQUA 2CJ3A 3GSVB 4I3RH 5ESVA 4X9HA 2VJXA 1G6RB 1M4KA 6TAAA 1LEKB 1T0MB 2H1PH 4CSPA 5CP3H 2WXNA 1JYWA 3VXPA 3GSWB 2I5YL 4E0RB 1KXTA 4ABVA 2OQJB 5FEBA 3H6AA 3BP7B 3DWTA 5GGVY 2AKRA 4XN8A 4AMWA 4RX4D 5EUOF 1FVDB 1LXMA 4YGVB 3U36A 1UOKA 1QFPA 1CFTA 2YPKB 3DUUA 3VXRD 4UQIM 1XSJA 3QJTB 1SJEB 4AYDC 5AWNL 1GTFA 4ANKA 1NEZG 3V0FA 1HCFX 4UOQA 1NFDE 4OCXH 4ZO6A 5FOBB 4RZCA 2CKBA 2B1OA 3KM2A 4CA4A 2PTTA 1EDHA 5EO1B 4F15B 1A2YB 3PL6A 3NZ8A 2F6AA 2C9UA 2O61A 2BIHA 2FT7A 4YL4A 4AGQA 4PBDA 2GTQA 3ELQA 5K9QG 3IN0A 1SN5A 4PSRA 5D1QE 1LWRA 5JW5A 4XI5D 4IOSA 8FABA 5CKAA 2A9MH 2YPLA 1Q9LB 3GIZH 4I2XA 2NW3A 3VXSD 4KZDH 3D4ZA 1JFHA 2XYCA 4H0LC 2ZOUA 2ITCB 5JMRA 3S8FB 3BZ4A 1GYWA 1XGUA 5EF0A 1HNFA 3WIHL 1AGBB 4PVLA 1N6VA 1QBML 2C3VB 1FWXA 1V7NH 1JFQH 4XBEL 4LKXA 3BO8A 5E2TH 3ECWA 1OAKH 2Y9RT 5FM5M 4XCCH 1ZDSA 4K3DL 1KJ2A 4LL4A 3TFKD 3TBCA 1UXMA 4H8WL 4KX8A 3KPLA 5J11C 3BAEH 4GG8A 3B7UX 5JORA 4JHAL 2ATAA 1E27B 3HOGA 4JFHE 4MX7B 3IDUA 3EO9L 4XP9H 3HVDA 1X5ZA 3LZNA 5KVEE 1EFXB 4LSPL 2FHCA 2FIKB 3GEWB 4M43L 2CD0A 4UQDA 4KPHL 1NM4A 2EJ1A 4S2SA 1ETA1 2YGQA 3M88A 5D1XE 3QDJE 1SXSA 2NY5L 5F72S 4U1SB 2WTPA 1EO8H 4PJBF 2OMUB 1E8XA 1MW0A 3QSKB 5JIIA 3GMNB 3HCVA 5GHWL 3TCXA 4LP4A 4L1DA 4IBQA 3VGEA 4EBQH 3BZFA 3TZVD 2EDHA 2VDKB 3WFBL 4LASL 1Q9OA 4HUWA 1JPTL 2NY4D 3MUHL 5DUJA 1KFAL 2GB2A 2P8MB 3ETSA 2WWOA 3S36H 5I19L 3IETA 4P9HL 3RKPA 3B4NA 3TT3L 1XH2A 4QRRB 2X38A 3REWB 4AJVA 5FUOL 1T4KA 4M62H 2H3XC 4XOEA 1A1NA 1U95A 2JJWA 4MXQD 4V1DA 2ZCLH 1QTYT 1LO2H 4J1UA 3CDYA 4P23C 2EH8H 4O2CA 4G42A 3WNIA 1T0NA 3RWJA 4EVNA 5SWZE 4ZUWA 3WN5C 2DQUH 4ICWA 3VI4B 1XAKA 4HJGA 5DFTA 1S9YB 1R3IL 1LYQA 2VSKB 2ZWYA 2Z0UA 4AQAB 1MW1A 3NN8B 1YVLA 3MRFA 3V52L 1E30A 1OV8A 4XPTL 1JTTA 4Z7VF 3T0EE 4XP1H 3NIFB 4YEFA 2OMXA 3ASWA 4FLOA 5IMLB 3MZGB 4Y19A 3TIEB 1NFIB 3ZW3A 9PCYA 1AQKH 2GI0A 2R2HA 3CC1A 1WDAA 2OKMA 3CN2A 4XMPL 1CDBA 4M4RA 1N12A 2YD6A 3BX7C 3P11L 2JI1A 1NA8A 4XP6L 4L3ED 4R6UA 4DW2H 1BJ8A 1M6OA 5AYUL 3BUBA 2EVIA 3EAKA 1JGLL 2HTLC 2VLLB 4TYUA 4YWGH 1EHNA 5E6IC 4N0UA 4BCZA 3GHBL 5IJKA 4LSUL 3GZQA 5GS2D 4Z7OB 3KR3H 4FCAA 2W9EH 1RERA 5F8RC 4JN2B 3GMQA 3STZA 3FYEB 1Z3GL 3EDKA 2DL9A 4XO3A 1CCZA 2A83B 2FUTA 3QHFL 4C57C 2BHUA 4GEIA 5GJSH 1DO5A 5IMOB 4PJXA 4F5CA 4BQ8A 5I5IA 1KZQA 3BN9C 2QTEA 1A7RL 1MAKA 4WFEE 1OM9A 5C0AA 3A21A 4UIKL 3IMTA 2Y5TB 1CBVH 1HZLA 5CINL 1N5AA 4IDJH 2WQ8A 2AXGA 4G8GB 1CGVA 4JQXC 3L2NA 1WZMA 4DPBX 1OSPH 3B7YA 3V9CA 3ZOAA 5LWYH 5F96H 1EJFA 2FX9H 1YNLL 4MJ6A 1QHPA 1CVRA 4M7JL 1OP5H 2Y24A 3X12B 3VDBA 1HIML 3UAAA 4OZIA 4G9FD 5T3ZD 4XX1G 3ZUNC 2QQLH 4IMLA 1OGSA 3FTYA 4RA0C 1QW8A 4BEIA 4P2OB 2ADYA 4Y88A 5CZXD 2DQJL 1E4WH 2NXZD 1NC2B 3WNNA 4X8CA 4RX4A 1GZPA 1QSEB 2I25N 5FAAA 5BUAA 4R0LC 2NY3C 1C7TA 2XDHA 3D50A 2OV0A 4UDTA 3RAJH 1WD8A 3FSVA 3VG0H 5F1NA 5GS1C 2B7DT 2XN9E 4QOKA 1MHPH 3VXRA 3MXVH 4CN6A 1AZVA 1N59A 1UB6B 2VLKD 5SX5K 1OE3A 2AP2A 2DLFH 2VDMH 4FQ2H 3N04A 4K8RL 4HWZB 1QRNE 4Y4HB 5HYQB 4YLBA 3DHUA 3K80A 3UTPE 3V0HA 1ZS8B 4OBSA 2ZUQC 3Q3GA 1E5CA 4MB4A 8PAZA 1IC1A 3SGJC 5EU5A 2VITB 4WEMB 3ULAB 5K9QI 5KVFH 2F53B 3D39B 2DQHL 4K7PL 4EN3C 2OMVA 1ULVA 4WV1C 1CF8H 2VSCA 4ABWA 2W92A 4HEMA 4NZRL 1ITCA 1CD9B 3KD4A 4FXLA 3UCQA 1ZLWK 2AJVL 4ACTA 2EINB 4G8IB 4ZAKD 2HFFA 1HHIB 4OZGB 3QWOB 3I3DA 4XMKL 1X4XA 3QQDB 3TYFA 3HUJA 3M1OA 1ZVHA 3RKDD 4IOFC 5FO8B 3EH1A 5DMJB 5EORL 1S7UB 4FLRA 1ZWIB 5AOLA 5KYUA 3PHQB 3L4WA 1NIFA 4ZUTB 1A65A 2AZAA 5FKPA 3HC3L 1NBQA 1PDKA 1G7HB 1L6PA 2X6MA 3QP3A 1NBZB 5D96B 1FFTB 3B9DA 1GL4B 1DBAH 4LLMB 4FMFA 5T5NF 2PR9A 1D7BA 3UZEA 4ONHB 2C1OB 3ZTJG 3DIFA 5IB1B 5GGTA 2F54A 4DGIH 5EF3A 4MA1B 1X9UA 1UURA 3NABL 3C08H 3ZGHA 3RTLA 4WUUD 1YMMD 4NQEB 4YZFF 5I8CA 2OXGA 4UNVA 2CM5A 5CN1A 4P5TD 1HHHA 5EG6C 1ASOA 3UYRL 3T6QC 5DJ0B 1HQRA 4GUQA 5D5MA 1SLUA 3KH4A 1PLAA 4X7TB 3STLA 1ZVSB 1SXBA 3MV9D 1YEGH 1GZHA 4M1DL 4UNTA 2ZWKA 3PJSB 2H26B 5CU9A 3W0WD 2NY7H 4JHUA 3SKMA 5BV7B 2WBJB 3C9NA 4QXGL 3JBG7 3HMWH 5HYIA 1YY9D 2NYKA 5MEQA 5H35A 3X3FH 1JE6A 3EGSA 2IPTH 3L9RB 3MV8E 5IFAL 3G6AB 4TUKH 3L5XH 3VXNA 2ZXQA 4LT7A 3HC0B 2V9TA 4JPKL 3IFPA 4G59C 3BD5A 3PWJB 2GK2A 2BZ7A 3EADA 1BGXH 3BQVA 2DQGL 2ZP9A 3QQ9D 4X5QA 5E1HB 3QPQD 4JO3H 5EU6D 1NIEA 4IIQB 1WC7A 3EHBC 1OW0A 3JTTA 4E5XB 1IGCH 3CX5J 1KY7A 2HLFD 3M8OL 1BJ1H 4GKNB 4YSSA 1B4JL 4DO6A 3WFEL 3SPJA 3QYMA 4PRHA 1D5MB 6PAZA 1NLDL 1F2QA 2R1YB 3QI9B 2DWXA 4KKBD 2IPKB 4QNPE 3RDTC 4WU7B 4DGVL 1KELL 4ANUA 4FJYA 5B22A 3WDHA 4U6YB 2D03H 3CWGA 2CGYA 2FEEL 2K6ZA 4X4ME 4ELKB 5AUMB 1HJCA 2X1PA 2HTKC 4ZS7L 5CWSA 3CZGA 4NWUH 5ESAA 4I88A 5L6YL 5K5YA 1L3NA 4L3EA 4YLQT 3V8CA 1VHPA 3LNIA 3LN4B 2VM9A 2HT2C 4P4RA 1SXAA 4L5FE 3P4NA 1FLTX 4BFRA 5INDA 4ELDA 1NCTA 3VGAB 4N0RA 1JPGA 2V3DA 3O2WH 3MBWA 3QJSB 4G1MB 1CXKA 4A66A 2WO3B 1UOWA 4Z5RA 2OR8A 2X4OA 2MRYA 3O3EB 4G1EA 5DR5H 3MOAL 4ELME 5KN5B 4FHKA 4LHQB 2ZJSL 3S88H 4DP9X 4OT1H 4YDKH 5ELIA 1ID2A 1DDHA 2K70A 3ZYJA 3SE3A 3QIBD 4U1KB 4XNMA 1ETB1 2AQ3A 5GZOA 1FYHB 4ZW8A 3VB9A 3OGCB 3VI3F 4FABH 1G84A 5GRWA 2BDNL 1NCWL 2PMZA 3HG1B 4S11A 5EF1A 4LCCA 1NGWB 1RK1A 2EADA 1T3FA 3IVKA 3QEGL 4PRPB 1TETH 4Z7WA 2A73B 5CFHA 1QFWM 4WQOA 4FYTA 2NZIA 2XKUA 5I6MA 3BI9X 1THCA 2R56H 2LVEA 3ZHDA 1R3KA 4YQXH 4FLQA 1YJDH 3L3KB 1I9EA 4GRLB 1A4JB 3KS0J 3WJJA 3QEQE 3T6ZA 1XSIA 5DMYA 3WTTA 4MXWL 1RURH 4PJHA 2P5ED 4P4KB 5B8CB 2PP8A 3QUZC 2I27N 4GBXB 3U7YH 1W16A 5CUSH 4PRIB 15C8L 2YXFA 3NJLA 4G43B 2BINA 2LT9A 4JB9H 3FQYA 2CK2A 1HH9A 1LE9B 3POCA 5J6HB 3BGFB 2MOVA 2WYIA 4I87A 3ZHFA 5B3JF 2P43B 2XZAH 4AEHH 1FH5L 1AGCB 3E1F1 4R5XA 2NDFA 4FMKA 1NGYA 1XQ4A 4XVSH 1I1FA 3RUGB 5DZVA 2CE6A 5I74C 2AABL 2R2BB 2P1YA 3QUYC 1OTSC 4W9FC 4L3FA 2R23B 3DUSB 2XG4B 2WZAA 1JDCA 1PQZA 4DZBB 4HXAL 5JIMA 4X6DA 3Q7JA 1KPUB 3P4LA 3LXCA 2J6EL 4ADIA 2DI8A 1K72A 2HG5B 5CGBA 5H4YA 2DTMH 2ADJA 2KLRA 2CALA 4N20A 4U1MB 3VSUA 3X1EA 2R2EB 3FB5B 2XBZA 5FWQA 1ZV5A 2V17L 2F5AL 1G0XA 1NL0H 3BUDA 4B0MB 3WSQL 2XY1A 3I6GA 4FEMA 4FJ6A 4N0YL 3O2DA 2FATH 6FABH 3HB3D 3I9AA 1XT5A 1RIHL 3FB6B 3FO2B 3JT0A 5LAXA 2RR3A 3BLKA 5FKAB 1A47A 4KRMB 4ETYA 1M3IA 4X9BA 1MJUH 1P6AB 2YK1L 4P3DB 1MNUL 3CD4A 5FUZL 2CNZA 1D2PA 1NCBH 1MWOA 4MD0A 4QAMB 4AIZB 1U91A 3WJMB 5JHDD 2WGNB 4JUTA 3ZYZA 4YUEH 5EO0B 1MH5A 2E7DA 3LEYL 2A5UA 4HX1B 4PMEA 1HQ4B 3BUYB 4F3FB 2W65B 2EEAA 4ZMTA 1BMZA 4N2FA 4Q9BA 3I6KB 1JXGA 2DKUA 1Q0YL 2IBGA 4L4VB 2OAAA 1QLFA 2RFXB 4AXWA 1YA5A 4PYHA 2WQXA 3BISA 3H9HB 3IGAA 3NSYA 5FO7A 5JXED 4WUUA 1YMMA 3C8KA 2DLTA 2EE9A 3TV3H 5HXMA 4U05A 4UTBH 5GGUA 2CHDA 4P5TA 1A6PA 1EBAA 3H7BA 3S8GB 3ABKB 4M3HA 5GGRY 4AV0A 2XKNA 1E8YA 2HRGA 3AWEA 2H32A 1VFBB 3UG5A 1BVNT 4GXVH 5ITFA 3W0WA 1CF1A 3OXSA 1J8SA 3BW9B 4ELMF 1Q1PA 4JAMA 4XP4L 2KDGA 3WY4A 4YXLL 2LE9A 1I1YA 3ZO9A 2G4EA 1L3WA 3CZEA 3AU1A 2AJZA 2VXSH 3FB8B 1JGEA 1BVZA 1SYVA 3MRRA 4WWKD 1VLXA 4N8VA 2CKBL 2LLNA 4JZNA 3T77B 3DV6A 3RL2A 1NAML 1NCNA 3LRSA 1HJBC 3LS4H 4LCUB 3L4UA 2PTUA 3SYCA 3WD5L 3OTTA 1ESOA 1ZGLA 2VC2B 1C08A 1VADB 1IFHH 1YEWA 3C5XA 5EU6A 1WCQA 3MCKB 1ZT7A 5AYTA 4F20A 2ZPKL 4NM4H 4PRNA 4UUJA 5J9PA 1T1YB 4ETQB 3RX9A 5EZLA 3ES6A 1LO4L 2JQMA 1XCQA 4KV5F 5FV2A 1MQ8A 3L54A 4K23L 1ACYL 2X4SB 3DX3A 2F8OA 3P0YL 3NSXA 1T89A 2HLEB 1MCWW 3QNZB 1E5ZA 3MJWA 3IDXH 3ARFB 4IBZA 4HLZG 1P84K 3PGDB 4JDVA 4CGTA 5JQ6L 5DHVA 4R97C 1EWHA 3D30A 2YKKA 5IROD 3BSZH 1R1CA 2AVGA 3APFA 4I77L 3CFQA 4FL4C 4LZKA 5EU7E 2R7EA 4E9YA 1KJ2L 1ADQA 4TNGA 2YAQA 3CBJB 5FB8B 5GS0H 2VTFA 3O3AA 1G4RA 3TNMB 4I1RA 4MDRA 5BW7A 1OB1B 1MI5B 3IFLH 3Q2NA 3PXHA 2E56A 3GMPB 2L3BA 2CPUA 3B7SA 3JWNG 1KEML 2B77A 5F8QC 2IGFH 5KYYB 1D5ZA 1S7VB 2CCWA 4RCAA 3EFOA 3FOLB 1CS6A 5F89A 2EYTB 3EO0B 2B20A 2IANE 4HBCL 3CSFA 2ZG2A 2BW4A 4LVNC 1S9WA 4G6KH 1N64L 2GY7B 3S4SG 1R24A 3B56A 1EJOH 2HVKB 5B38G 5TTRA 4PV9A 3G5WA 1OAJA 2QMJA 2UZIH 3T5WA 5AD0A 3EOAB 3BGMA 4FLSA 4LKCA 4ZYKB 3H0TA 3QA3A 1CGYA 1S7XB 2FEDD 2QV2A 2DQFB 3GPSA 5DWUL 3DMMA 2V2TB 5LCVH 1M6UA 1XGZA 4UOW0 1A6TB 4KK5D 4G9DB 5CLZA 2KYIA 4QRQA 2H1LM 4POZC 2BVPB 1IQWL 1QSFD 2KS0A 5HI3D 2EXTA 5SX5H 2VB5A 5IJVA 1JYXA 5DHYA 2AQPA 5DUBB 2EDYA 4KJWC 4LQ1A 1Y0LB 5IFJA 1MCSA 3D33A 2X3AA 5C9JA 5I82A 1M2OA 2SODB 3A23A 3VCLB 2V7HA 1MCKA 2P5EA 1YO4A 4FI6A 2R69A 1FC2D 2AF2A 1I7ZA 4X7CC 1KG0B 2VW7A 2Z8SA 3SDAA 1V05A 3T8XA 2NY2C 1S9XB 3IGKA 2H0EA 2JJSC 1RVFL 4PJDB 4UTAA 1J5HA 5CJXC 3ARBB 4J3SA 2Q2LA 3PS6A 5I1IH 4HUNB 3G08B 1ZLWH 5MI0C 3N0AA 1UKSA 3V7AG 3QEUB 4PVBA 3GUFA 2EVFA 1TCMA 4QTIH 3FT2B 2WXMA 1Q4NX 3DSNB 4MWFB 4TTDD 4UB0H 4X6CA 2HFGL 3LNHA 4XNUL 3TVMA 5L8JB 3IRPX 4NT6B 5D7HA 4EI6B 4W9JC 3VVVA 5JDSA 2AQ2A 3TBSA 3WEXA 2VIRA 4ZSOB 4R84A 5IHHA 1ZJAA 3QG7H 5E1AA 3OHMB 1U3HD 4WI9A 1V5JA 3MROA 4KQ4H 4WO4C 5GQBA 3RWGB 2VL5B 3OKNB 3WN5B 4Z78A 4MQ7A 1KGIA 1CE6B 3U2JA 2Y23A 1JN6B 3N44F 1QO3B 2AJUH 5I0VA 2X4TA 2ZG1A 4HIJB 4C83A 5KG9A 4BH7A 4XPFH 5FYKL 4ZQKB 1K5NB 3M7FB 4Y5VA 3PGFL 2E46A 2FO8A 3GJEB 2WXLA 3WUZA 2IV9A 3QUMH 1AO7D 2JSFA 4OSUL 4F58L 5FA3B 2KPWA 1JZDC 3NCMA 3IDNA 5IK3B 2FR4B 2EC9U 4P2RB 4M7LH 1J9CT 3IJYA 4OCRL 4KKLC 4ZUUB 4FCHA 1AR2A 3RZCB 1IGIH 5JHDA 4JREB 4PJ9C 5FCUL 3CNKA 4OQ1A 3UJJL 2DQIL 4HF5H 2AS5M 3MRLA 5E6IB 3A6BL 4OIIH 5ICYA 2GIYA 3PWUA 4FC3E 4IRJD 4F2ME 1FG9C 5L2KE 2PO6A 2EIZB 1K8DA 2F1BA 5AVQB 3LVEA 1AQHA 4JHWH 5JXEA 3Q01A 3Q1SL 1LO5A 1VZGA 3NACL 4QJ3B 3EF7A 2ZKYA 4NPYA 4E68A 5CGYC 2H2SC 3UC0H