1DSWA

The solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGKIGKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE (CU-ZN)
publication title The solution structure of a monomeric, reduced form of human copper,zinc superoxide dismutase bearing the same charge as the native protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1dswA00
3QQDB 3GZQA 3RE0A 2GBUA 5CU9A 1AZVA 1QUPA 1EJ8A 5KBKA 3GZPA 2APSA 4BCZA 2C9SA 3MKGA 2AQQA 1HL5A 1E9PB 1OALA 1HL4A 2XJKA 3GTVA 2ZKYA 3KM2A 2ZKWA 1OAJA 1SOSA 2AQRA 1S4IA 1DSWA 2V0AA 1BA9A 1F18A 4A7SA 4A7TA 3KBFA 2ZKXA 1Z9PA 2XJLA 1COBA 1SRDA 3CE1A 1SXSA 1XTMA 3LTVA 1EQWA 1TO4A 2JLPA 2GBTA 2ZOWA 4L05A 1MFMA 1SDAB 3SODB 1OZTG 2NNXA 1ESOA 4BD4A 2C9UA 1IBHA 2AF2A 1Q0EA 4MCNA 1OEZW 1OZUA 2AQNA 4A7GA 2AQPA 3K91A 1DO5A 5KBLA 1F1DA 2WKOA 3ECWA 1F1GA 1P1VA 3GQFA 3H2QA 2JCWA 2WWNA 1SDYA 2WYZA 1U3NA 3HOGA 1JCVA 3ECUA 1E9QA 4A7UA 3HW7A 4A7VA 1CBJA 1SXAA 4N3TA 4OH2A 2R27A 4A7GF 3KBEA 1SXNA 1KMGA 1YAZA 3KH3A 2Z7ZA 2WWOA 1N19A 2GBVA 2Z7WA 4U4IA 1PZSA 1UXMA 1RK7A 5KBMA 4MCMA 1E9OA 1BZOA 1IBFA 1L3NA 2C9VA 1YAIA 2WZ6A 3KM1A 3MNDA 4B3EA 4BCYA 1JK9A 2WZ0A 3CQQA 3KH4A 3HFFA 2VR6A 2AEOA 3F7LA 2E47A 1N18A 1E9QB 3PU7A 2LU5A 1FUNA 1SXBA 2SODB 1PTZA 1IB5A 2VR8A 2WYTA 3T5WA 1TO5A 1SXZA 2AQSA 3QQDA 2Z7YA 1B4TA 3CQPA 2AQTA 2K4WA 4OJAA 1SXCA 2WKOF 2VR7A 1XSOA 3GZOA 1E9OB 2E46A 1E9PA 3GTTA 4N3UA 1XTLA 1IBBA 3L9EA 3ECVA 1F1AA 3H2PA 4A7QA 1JK9B 3F7KA 2Z7UA 1B4LA 2WZ5A 3L9YA 1YSOA 1SPDA 1PU0A 2Q2LA 1Z9NA 4FF9A 1CB4A 1UXLA 3S0PA 1IBDA
chains in the Genus database with same CATH superfamily
5MEPA 3EGSA 5MEOB 4O2EB 3L5JA 1NIFA 1WITA 1MCJA 4LPXA 5E4EB 3NZ8A 2WGNB 3WNJA 4M7LH 5J6HA 3FT3B 4XB8A 5C0IA 1HL4A 2YPLB 3F83A 1AD0A 2GITB 4JFFD 3FB6B 4OD2B 4HLEA 1L9SA 1WD8A 4XVUC 3N06B 4C55A 1JZ3A 3WS3B 5KYXB 3GO1H 5K33A 3WAJA 2DBLH 2H2PC 3S4SG 2KLTA 4JM2B 4M6NH 1MEXL 2UZIL 1IMHC 1ANUA 1EUTA 1IBGH 3WXWH 4GAYB 5F7UA 3O6FB 4XNUL 1H15A 5JZ7C 4M48H 5DHVA 2WXGA 1L7IH 1NPUA 3SDXA 5TDNA 4KUZL 3CHRA 5D2LE 4JHWL 1TTRA 3B34A 5F96H 4F7EB 1G1OA 2FJFB 3GQFA 4A6YH 4WQOA 5CUSL 3J07A 5LGHH 3CBJB 2O93L 3QEQD 4Z7QE 1JXDA 2VWEC 1T89C 4JK0D 2EYRA 4HBCL 4LL9A 2EXTA 3TBYA 4NZRL 2VMFA 2HN7B 4YDKL 3R06A 1YC7A 3KGSA 5C0AD 1AH1A 3ESUF 1G9ML 2AP2A 1TJHH 1EAQA 5CR1A 3L54A 4N0UB 5IREA 1U3HA 5AUMB 5AVXB 2EH7H 3MCLL 1OF2B 5GS0D 2BFVL 4MJIA 2WSPA 5E4EC 5A3IC 2EE6A 3BEVA 5CN1A 2IWKA 2HVBA 3PQYA 1R0AH 3MRFA 4IKNA 1ZGLP 4B5ZA 4K7FB 1O5PA 1DN0B 4L3CA 3QCVH 4MD5A 1J8HA 4RQQA 2GIMA 5B4MD 3FRUA 5LBGA 1DJZA 1NFDE 2CCVA 3L5HA 5GS1A 2D9CA 1FH5H 1VEPA 1UH4A 3U1SL 5I0DA 4N5ED 5AOMA 4NOFA 4JM2C 3NSYA 1O7VA 4Y16A 3CMGA 3MOQA 3ZW3A 1QWHA 5E8OA 2VL5A 4TLTA 4BUQA 3O6FC 4TTGA 1MCPH 3TWCH 4CDGC 3L5XH 3KWVA 4MTMA 4TRPL 5J3HD 3F7KA 3P4MB 3L4UA 1T89A 2PP8A 3GMRB 4P2AA 3HE7B 2GSGA 3HBQA 3KXFE 4OD1H 2NW3B 3T8MA 3U0WH 3TJPA 4JREB 3RPBA 4LHUB 2WXQA 4E0RB 1RKRA 4JKKA 4X6CA 1ADQA 2DI8A 2XUWA 1WCBA 3OKMB 5D1ZA 5MEOA 4S1QH 4YEFA 1MY5A 4Q74A 1L5GB 3UEZA 1CGXA 2TSAA 2VO5A 4I8DA 5F1IB 5BRZE 2P49B 4W70A 1CXEA 4Z5RB 4LCIH 2PTTB 1M71A 3F58H 1Q0XL 3E9UA 1CE1L 5C0CE 3FN9A 1IL1B 2GBTA 2J2ZB 3BZ5A 2PYEE 1UENA 4FC3E 3A6BH 1Q9KA 1EZLA 2MNUA 2XXGA 1JRHH 2ITEA 4LBEA 4NENA 5GRVK 2QZ5A 5DEGB 4J8RA 1JWSA 2D0HA 3O6FA 3S98A 5JUEL 3K8KA 3QBTB 5IJVB 3INUH 3IS1X 3N9GH 5T1LB 1BXXA 5T5FL 4LZKA 3RGVA 4D9LL 4F7EA 1PAZA 3AT0A 4ZAKB 4M03A 1TTFA 2YPVH 4PJCE 3MU3A 1NAMH 3UBXI 1UA6H 4PB9L 1A8ZA 1DL7L 1DJXA 1YMHA 4Y2DD 1T04B 5JW5A 3LB6C 1WAEA 2EE3A 3U79A 3IMBA 2AEQH 3FUFA 3ZUCA 5FHBL 3X14B 3I2CH 3OSKA 4JREC 1V5JA 5KZCB 5EO0B 1HWHB 1MRFH 2ZIDA 4C56E 1J05B 3INOA 1OF2A 5D2LB 3B6SB 3CZSA 4R97B 1YAIA 5J1AB 1JPEA 2OXGA 1KGUA 1QOKA 4Z7QB 4G7YL 4R7DB 1TSHA 2C1PB 4M8QB 3SQOH 4F9LA 5GZOD 3UTQA 1E4WL 1FN4A 4K7FA 3QPXL 5H4YA 3HR6A 1GJIA 1CFNA 1TZ8A 4OCWL 1ZLEA 2UY6A 3SDDB 2F74B 4G9FB 4HUXB 1L9NA 3GM8A 3VXUA 3LRMA 2A77L 3MLTA 5FYJL 1A6ZB 2X4NA 2PPAA 2K3TA 4KGJA 4ZMYA 2CBOA 4PJCF 35C8L 3JXAA 1HTYA 2DMCA 1NFDB 2NQDA 3G6DL 1DSFH 5D9SB 4RSYA 3OGCB 3LNDA 3TEUA 4U1LB 4R5VA 4Z7WE 4ZAKC 3W3BA 1WFNA 1PU0A 3GMRA 3QI9B 3WV0A 4RWYL 4XO8A 2ZOKB 3BXNA 4OU3A 1RIVL 2IQ9H 4A6YA 2E74C 5B38G 4E0RA 2APXA 3MBWB 1NAMB 4X9FA 1BEYH 3HBPA 1W15A 2J6EL 4HOZA 3WUWG 4ODWB 3P73B 2COVD 2NNAB 1WA1X 4U7KA 2MOGA 4L1BA 5C0EB 3OR7B 4R97C 4QHNB 3G6AA 1XEDA 3QORD 3G5XA 4TUOA 5E1GA 4WFGD 3VFNB 1GPOL 4DKEL 5I8KL 1RVFH 1OAKH 3KXFB 2I60L 3FTWA 3OQRA 1JGDA 1TFPA 2CUIA 3PV7A 4CKQA 2EVIA 2OSWA 4PB0L 3BZDA 2B1HL 4HVBA 5EU3A 5DRNA 2MCG1 3F7PC 1FFOB 1SDAB 4BDVA 1N3NA 4Y8DC 3SDDC 4TM9A 1F3DH 1NGQL 1RZIB 1VCBC 3QE5A 3SJVD 3UBHA 2B59B 2BX5A 3QDGA 2X7LB 1F3RB 2CGYA 5KW9L 1AO7D 5DEGA 1KV3A 5BRZB 4X7DC 1QI5A 3RB7A 1AG6A 4OI8A 1JVLA 1NFIA 1R1CA 2OP4H 3KR3H 5ESVA 4ZOAA 4AMKL 1UD5A 4Z7WF 1YY8B 4Z77A 4PEEA 5IJVA 5T1LA 5DMYA 5I19L 2BJML 5C0CB 3AY4A 1BPVA 4AJWA 1EBPA 2CMRL 1UADC 2YWYA 1NJ9B 2ZWNA 4ZAKA 3D50A 5DRWA 4ZS7L 5C0NC 2PYEB 5C70A 4LSVL 1ROWA 5A43C 4LDLB 3LN9A 2ZKHH 2ADFH 5AALA 4Q9CA 7PCYA 3MODL 3QPQD 1PQZA 2Z7ZA 4XCYB 3MRKB 4HGWB 5IJKC 4R8WL 1XCXA 3FO9B 3IDYB 3TV8A 1N59B 5K9JL 1KB5B 1QW8A 2YUVA 4PCSA 1FG2A 1L6PA 4PJDE 2ZX6A 1N6VA 4IBQA 4LU5H 4O58L 1SYSB 3R1GL 4A2FA 4PJCB 2JF1A 1HSBB 1SFHA 4HJSA 4AIZB 2ZYRA 1RLWA 2WYHA 3BQUD 3FU7B 3IFLH 4D2NA 1JD7A 4DCQB 4QKXB 3KLQA 4XHJD 5DVMA 1FZJA 5EOCH 4W9HC 5GGRA 2KPWA 3L8QA 5HTSA 4C56B 2FSEB 4O2FB 3IJHA 1D5BB 1A4AA 4G9FA 4HUXA 5TE7L 5FUZL 3LIUA 3QUYA 1TZGH 4QJ3B 2AI0L 2GKIA 2JI2A 2G2RB 1A6ZA 5I1HH 4HDIA 1VHPA 1U93B 3EGDB 3ARDC 2KL6A 1GY1A 2EYTA 4PJFF 2ZPKH 2ZP0T 4OZHF 3SKJH 3IRZA 4N86A 3D25B 4AQ1C 5I75B 1N2RB 7CGTA 1GGUA 2YEVB 4N9OB 5HHOE 2R1XA 3OGCA 5K69A 2XFXA 1I8AA 1RZFL 3RKPA 3F05A 1OVZA 2LFEA 2AK1H 1KC5H 2E6JA 2YPVA 3KPRD 4PJDF 2LU4A 4X99B 1NAMA 1AY1L 1EZVX 1CLCA 1MG3C 3LJ3A 2FD6H 4OGAD 2AXWA 2CR6A 5CZKA 4JFFE 1M42A 3IDYC 3QSKB 3BHBA 3KWXA 1F4XH 3GIZL 1IEBB 2ZYHA 3X1BA 2WBKA 3T1FA 4OCXL 4AG4H 2CBPA 1BQHG 4H88H 1WS8A 1JGEA 5ECGA 2X09A 3UDWC 2HVKB 1YO4A 4A2DA 4Z7WB 4N87A 3VFNA 5BOZG 4HWUA 2XZAH 3BE1H 3V0AC 2ZOLB 5AL0A 1R19A 1QSZA 1B9ZA 1SZNA 3GBML 4PJ7E 5ALBL 5GPRA 5IHUH 3E3QE 3VVVA 4PP2B 4NBYB 3RPIA 2P7TB 3ZO9A 4GRWE 1FFOA 3IETB 3DUUA 5IFHH 4CVUA 2EUVA 4I1NB 2B59A 1AGBA 1ETJA 1ZLDA 2J57A 4IGBD 3MHZA 3VXTB 2X7LA 1YPZA 3W56A 2BXYA 1T80A 2VB5A 3ARDA 3O3EB 3ULUD 1M6UA 3FB5A 4S0HA 3QEQE 1JGUL 1SLVA 3HI1B 3KDMB 3COOA 3EJRA 4M6AA 5DJ0B 4DP9X 1CYGA 4ZXBB 4AQ1A 4XMLL 4ZD3H 1OB1B 1T2JA 5IHZB 1R5WB 1OAXL 5I75C 1UYWH 3Q05A 5K93A 3A6CL 5GRWA 3RIAK 4UMSA 1KEGL 4ZUWB 3OB0H 1B90A 4HKBB 4RMRA 4HZLA 1KY6A 1MCCA 3VMNA 5GXBB 2EP6A 3MRKA 3T3MF 5KSUB 2R23B 4ENEC 4HUUB 3HPJB 1N59A 3P2BA 4OFYD 1U8QB 1CI5A 3P0GB 4PS3A 4AIEA 1NWPA 5BUAA 2D2CC 1IQWL 3FFOA 2GQHA 2Z93B 1A0QH 4TXVB 4PJ7F 3RA7H 4AIZA 1N12A 3GXPA 3HFFA 3PNWB 1HHIA 4OZIE 2E47A 2ZXGA 3AGWA 4DCQA 5EA0H 1SEBB 2XG5B 3VXOB 4Z78B 3O0LA 2MPAL 3LPFA 1JMZA 1MF2H 2PWGA 2FSEA 3CVIH 4IW4C 2DEYX 4JFTA 4X8GA 2R29L 5ECJE 4PJDB 4GI6A 2DLHA 3AABA 1N5YH 1AJ7H 3U7WH 4DGWC 5DUJA 3EGDA 2YD0A 2XN0A 3C6LA 3K8MA 4QRTB 1IEAA 2BS71 5I5RA 1KN2H 5IUSA 4UM9D 3WFDL 4OZFH 5C6PB 4ZXBC 4X9HA 4GO9A 1FO0H 4DKFL 4HJ0C 4OAWB 5ERWB 4F57H 3LIZL 2FX9H 2PCYA 1QFHA 2E9IA 5HYIA 3ZTJH 4FHJA 1HSAA 4FEIA 3WNKA 1IM9A 4BCXA 5GGSB 1ZJAA 2VJ0A 4DHLA 4KTGA 4YHMH 5CEZD 4TVSa 2YA2A 1IEBA 3LRSB 3SIKA 3EXJA 5HHOB 2NNRA 4JANA 5F7FA 4Z7WA 1LO3L 3C5ZD 5GRVL 3SZKC 3X13B 1V7NL 4K94L 2XFGB 4J3XA 4J12A 1Q94B 1DQLL 4I1PA 3L5IA 1IAIH 2OMYA 1DO6A 3F00A 2F58L 2PCFB 4JFFB 3TBTB 1QRKA 3GMQA 4UB0L 1ZLSL 3JV6B 5CCKH 2F2HA 1Y6NR 4RISH 4U1IB 4ATTA 2XLLA 2W88A 3FMGH 1AZUA 4B96A 5J57B 4TSBL 5HJ3B 3WKNA 3O3EA 2LVCA 1KY7A 4UIKH 5EIVA 1J1PL 4BFGA 1LK2A 3KDMA 1NAKL 4Z76B 5DJ0A 2AHIA 4PJ7B 4ZXBA 3MVSA 1D9KD 1M1SA 2Y72A 5IBUG 4GRWB 5IHZA 1HIML 2HG5B 2MPVA 5DJYB 1CE6B 4NRYB 2NT0A 3LZQA 4PBDA 1SXAA 2ZUXA 4HIJA 4Q8BA 4G3YL 2DIJA 4IMLA 4DN3L 4ZUWA 2H2SC 2JB5L 2G75A 1FCGA 4L8BB 1QFPA 1KUMA 3BP4A 5JXAL 4P46D 3TYFA 5KBMA 5KSUA 3QEQB 3DSFL 3SKMB 3QYMA 2HJKB 3RBGA 3HPJA 1FORH 3U7YL 3DROA 4U4BA 2H8PB 3DETD 3MRJA 1BFOB 1MZZA 2IH3A 5F0LB 5C0AB 3GEFA 4YJZL 4PJFA 2QJDA 4Z8FH 3F7RA 2AEOA 4OZHA 3WIFB 1ZXQA 1MZYA 1KBGH 3LXUX 1MW2A 1SEBA 5BCAA 2SODB 3BUYA 1SBSL 3IGAA 1AE6H 2WWKT 2ZWSA 4LKXB 4A38A 5ICZB 2CLRA 5FGBC 1YEFL 4Y5VB 1I3GL 1Q90A 2IADA 3L1OL 1R3KA 2VDMB 1MH5A 4X4XA 4JFEA 4QGYA 5FECB 4OV5A 1KCWA 4LVNB 4IOIA 4OZIB 5L2JB 2OXHA 4A7QA 1BBDL 5SX5H 5L0QC 1FVCA 2NY2C 4HK0B 2GUOB 2Q7YB 4YVUA 2GY7B 4MJJA 2NNCA 1XMWA 4D0BB 4EIZC 5HI5D 3UJTH 4L8SB 2ZG3A 2X6VA 3BUPA 4H8WH 3QJTB 1M57B 5C08A 1J88A 4KI5D 4O5LL 3IVKA 1QYGH 2IF7A 3TASA 3GTVA 4WFGE 3GXMA 4ZMTA 1G9NL 4K3HA 3OAYK 1ZRUA 4RZCB 3FQWB 4POUB 4G6JL 1FG9C 4U3HA 3GSUA 5F93C 3ZMNA 2FE0A 2MKWA 2X89A 1XTMA 5K39A 3SJVE 5CIPB 3KPMA 3RU8L 3WHXB 4TVPH 5GS0C 1K5WA 4AITA 1WLHA 4N8UA 1AO7E 3G9VA 5FGBA 1XBRA 3GJEB 3TBTA 1AXTL 4FZEL 4U1IA 4Y5VC 3TZVD 3IGLA 1I9RH 3O0RL 3BWAA 3O6KL 4OF5A 3D87B 5HJ3A 3P9MA 4GQ9H 5E94A 1G7LA 3WUZA 5I1JL 4AZ8B 5BRPA 4KOBA 4N5EC 2HG0A 4MBRA 5I2IA 4WI0B 1SDDB 4Y4HD 2B2XL 1NCAH 4RGMB 1S7SA 4LRNH 5I6OA 1A3ZA 4JDZA 4HUVA 5SV3A 1AGFA 1SXNA 4OZFA 1B0GB 1RUAL 3QQ9D 3CIQA 1FO0A 1VADB 3DX9B 4U4IA 4WRLA 5IVZA 1S9WB 3O3BB 4ODVL 5J3HC 3VXME 4ABWA 4Y89A 4AK1A 5J7CC 1DQML 1WFUA 3QEQA 4BFEA 2WOBA 1PAMA 3ZYZA 2I9TA 2IPTL 1E40A 3U4EA 5EH1A 4LDCA 2JB6B 5ETUB 4LT7A 4N2IA 1U8KA 3DVIA 5C0AA 3EGXA 4DP7X 5DJDA 1E9QB 3VYPA 3Q06A 4Q7DA 3WIFA 2YN5A 2XWRA 1QBML 1XGUB 2JQMA 1KTDA 3M7FB 4KY1H 5D6CB 3RZWA 1M2OA 3EH3B 2YKLH 4HKZB 2B0SH 3FB7B 3IJEB 3U48A 4AYFA 2ADYA 4LLDA 1XV8A 3DO3A 4Z7UF 4X83A 3MX0B 5FECA 2FJGA 3DX8A 3BVVA 4WUKL 4URKA 1IZKA 1VCAA 4LAQH 4M8RA 4EUPH 5KVFE 3CFIC 4PRHD 3UTZA 4CNIB 3LHPH 3QZOA 1R34A 4XTRD 1Z9NA 4HALA 4WI9A 3H3KA 3TGXA 2EUZA 3KPRE 3V5DA 1IT9L 2BHYA 2CHXA 3E2HB 4JG0L 1RURH 4N2MA 1L7TH 4RGMC 4YSDA 4MYWB 3UJIH 1KLUB 3QULA 4DGIL 4BCZA 3BZ4A 3ECBA 3RB5A 4IRSD 4TOYL 4J1UA 4KRPD 1AQDB 4NIYE 3NTCH 3PGCB 4E9RA 3T0BA 4Y2DC 4RZCA 3NSXA 1WQVT 3FQWA 5BOPA 4UIMB 2IDCA 4GAJL 5K9QG 1NIBA 4UZGA 2BS8A 2EE2A 3WFEH 1YEDB 3VB8A 1AR1D 4BSJA 3PREA 1DP0A 1ETA1 3NIGE 4ZUSA 3HZMB 4JY6A 5IB4A 4NKIH 3DO7B 3QORB 4MNGA 5AZUA 1IQDA 5D72L 4OBRA 3ULUE 4DVRH 3QARA 4ODTH 5GZOC 3SYPA 4FOMA 3OLGA 1OXYA 5IT2H 3E8UL 3VXRD 3IAPA 3FN3A 1KCSL 5T33H 4CSSA 2BXZA 2RBLA 2LFGA 3MNZB 4CW1A 3V0HA 3SJVB 3B3IB 1BREA 2Y5EA 2ED7A 4QRPA 3O8XD 1X5IA 4W9ZA 4KKPA 1AO7B 3IAQA 3MJ8A 4HXAL 4OIBA 1U58B 4O02L 2P42B 3E2HC 1KPUA 3J7HA 1I1CA 2APFA 4LB8A 3S34H 1OE3A 4DO6A 2VMCA 1GGCH 4D0DA 4MA3B 2YQ2A 1IC0A 3I9GL 1IM3A 1OCRB 1Q9LA 2VZ1A 2CQVA 4LSDA 2EIJB 4RDQG 4Y2DA 3DPDA 3FDWA 4BFJA 4PCYA 2B77A 3S3JA 3GMPB 3S2AA 3VACA 3EDJA 1D5IH 5LLIC 2YUWA 5FGSA 3JZ7A 3NIGF 5ETUA 3B9VA 4PJ9D 4FI8A 4KMTL 3WDHA 4AL8H 1HQRA 1NL0L 5DEZA 3MBEC 4UQ3B 1IFHL 2ICWI 5ID1B 4L3AA 3ULUF 3NA4A 2B8OT 1QFOA 3LSOB 1ZS8B 3PJSB 2DD8H 3QORC 1VKXB 3BQUB 4BHUI 5C1MB 4Q0XL 3UJJL 4AE0A 3IJEA 2A1WL 2BY3A 4JY4A 1JNJA 3AU0A 1MCSA 2OFQA 3B9EA 4MDRA 1D2OA 1EFXD 4GQPH 2P44B 1DQIA 1UGNA 1U8NA 4E9XA 1WZAA 4I0CC 1XD0A 3D2TA 4L0ZA 1SQ2N 4HK3N 4XMWA 5JIKA 3FH8A 3RTLA 5C0FA 2VLKD 2TRHA 4CNIA 4F27A 4K73A 4X9BA 3QIWD 2E7MA 4FRWA 1Q72H 4B50A 1X6NA 5ILTH 3R7RA 3S35H 3MYZA 2BIIA 1CWVA 4JPIB 1TLKA 1PG7W 5CEZE 4FLHA 1ZVHA 1BQHB 2XQBL 3VW3L 5D93B 1ZPLA 3MTXA 4XCFH 3O2VL 3VM5A 5I6MA 3V4PL 3SDCC 1AQDA 1G7QB 4RSVA 2C9AA 5FCUL 1DQDH 2E9BA 4CUCA 2VLJD 2A6DB 3D0VB 4Y19D 1WAAE 2VABA 4AQEB 4QRQB 1IC7H 3KPRB 4UIMA 3OKLB 3QPQC 3HJ0A 1SRDA 3CNKA 3MBEA 4OV6F 1OK8A 1XR8B 4DGYH 2JLLA 1HYRC 4EXPX 3PRZA 3LNFA 3OAUH 5F6HJ 1F3JB 5IIEA 4ORZC 2RGSA 3MO1B 4PRPD 5CEXA 2RQ8A 4X7SH 3SGJC 1KENH 1YZZA 2QGDA 2UZYA 2KH2B 3UXFA 2ITCA 3K4ZA 3RJOA 4P04A 1NDMA 3FZUD 5E8PB 3BQUC 4XHJC 2O5NA 3OJDB 3QC5X 2W9EL 4XMVA 1KCBA 3L3IA 3S88L 1VEMA 2DYPD 3KGRA 1LE5B 1XBDA 3QH3B 3IBEA 3B3IA 4KJQD 3NIGB 2D8KA 3KL0A 2IBZY 4IGBB 4ABUA 4FKEA 2A3TA 3WAKA 4AT6B 4EUPA 4XCCL 4NGHH 4PBXA 4XE5B 1RJYB 5KJRH 1FNAA 3MRLB 3BVNA 3RWHA 4OF3A 4P23A 2WUBL 2YUXA 1ID2A 1MHCB 5LGYA 4HOMA 1WAAF 2A73A 4XAKD 4UNUA 1JZJA 3SDCA 2JKJA 4B7LA 4MXVE 3CG8A 3DX1A 1EAOA 1ZD6A 1XL4A 4Z7UA 3IAGC 4P59H 3SBRA 2EDRA 3BLPX 1H5BB 4XOCA 2D3NA 2N56A 5FW7A 3OXRA 4ODXA 4AW7A 1P4LA 5FFOA 4ODHH 4OGAC 4XVSH 4W9GC 4KFZC 4CRPA 1B4RA 4KO7A 5I1LA 2DWTA 4BQ8A 5AW6B 1SOXA 3LZPA 1HAWA 1HVXA 5KVEH 4AL8C 4FTVD 2XN2A 3L5WA 3T0XA 4PJAE 4HMEA 4KQ3H 4K5PA 1A6VH 3WO3B 4UTBL 3T71A 2OBGA 4WWNA 4RX4D 5FA4B 3U30B 2IJ0C 4ZX4A 4ZBJA 2VXUL 4OZGA 4P57A 4PVLA 5IOPA 2WVSA 3VH8B 2Q76B 2VDQH 1PY9A 2WINB 4KJWD 4AEEA 3ROOA 3G08A 2EVFA 1L9RA 4KI5E 4XPFH 4V1DD 3T8VA 3BVTA 4QEGA 4XBGB 3ULUC 2M2DA 5CSZA 3TH2T 3HS8A 4P3CH 4EVNA 4MXVF 2E4FA 3WNLA 3Q1SH 4L3ED 3UADA 4UM9B 2ALAA 2ZKYA 2NW2A 1MCWM 2ICWB 3HFMH 5E7BA 2VN6A 4L4TA 4YE4L 2G0LA 4YHLH 5EF0A 5JW4Q 2BNRD 5F1NB 5EEXA 3FTGA 1FC2D 4HAGA 5T1MB 4AQEA 1H5BC 1JF1A 3OKLA 5DJZB 3HC3H 3DX3A 2X4UB 2Y36L 1GGIH 2PTUA 4EN3D 3GMOB 3KPSD 1TETL 3D85A 3D1MC 2CUHA 4F7PA 2XIDA 1MFAL 1CF8L 4PJAF 2VQUA 1OSZA 2F7QA 3C5ZB 5HDLA 2E27H 3NESA 1MWOA 4LF3B 1U0QA 3T08A 4JN1H 1FPTL 1GC1H 4OLVL 4D3CH 5E8PA 2PWFA 3LPGA 3B2VH 1DVQA 1ZAGA 2Y07L 2P45B 1XGRA 2R0ZL 3MRGA 5HI3D 2JI3A 1YY9D 3BVXA 4IJTA 2NPLX 2QPUA 5J1SC 1LE5A 1DJGA 4KI5F 2GI7A 2VL4A 4Y9FA 5IMKB 4FFYL 3T4AA 1LDSA 1T6BX 4AT6A 5KJ7E 5EEVA 2CE6A 2VTFA 1O6VA 3X11A 5KUKA 1RJYA 2DQJH 2DQEL 2VDNH 3BD4A 3MLWH 3GRGA 4WEBL 3V95A 3X1NA 5C0BA 1WCQA 1XGZA 2NXZD 1UFUA 1KBBA 1RIHL 1WWCA 4L18A 1XCQB 3PF2A 1D9KB 3N40F 3RZCD 3JWOC 3NCEB 4NUJB 4PTUA 3FC8A 1UACH 3L08A 4F33B 5JA9A 1U3JA 4LIQL 2AVFA 5FGRA 4YC2B 5D1QD 1P1ZB 3MXWH 5CZRA 4BGDA 1FNEB 4LASH 3DVFA 3SE6A 4K0OA 4POZD 4PLKC 5GRZA 5HVFB 2J73A 4P9MH 5ICXB 3RL2A 4P46B 5K9QI 1DVYA 2YS4A 5DLLA 4MLSA 1CLZH 2QPSA 1GKEA 1ZGLA 3WNIA 2ERJB 2IIJA 1M4KA 4X6BB 2P9RA 5B3JE 3TEXA 3C5ZC 2BP0A 5F9AC 2X1PA 4ZO8A 1D5RA 4K3JH 3ECVA 4PRHE 5E5LA 2L7QA 4H2AA 3UPAA 3GSQB 3PP4L 3SHSA 2GG1A 2BINA 5DJ8B 5I15H 4GP5B 5JMRA 4N2CA 1FQ9C 3QNZA 5CJ8A 5DVKA 4DW2H 3SQBB 1RK0A 4YO0B 4XBGA 3IJSB 5HHNA 4PJAB 3OJVC 5H37G 1YUHA 3VQ1C 1AAJA 1KPRB 4XO9A 3WKPA 3EBAA 4IU2B 1TJXA 1MAML 5HY9A 1D9KC 4U1JA 4PD4J 3BVWA 2E59A 5D1ZI 3LXBA 2PR4L 2B1OA 4LLYA 4OD3H 1F18A 4JE4B 1P5UB 3IFNH 5KVGE 1CFVH 5F3HB 3STZB 2DQHH 4FJYA 3OMNB 1A1OA 1PZAA 1PFOA 1JD9A 4J39A 1FL5A 4P46C 5B3JF 3MLXL 1OPGH 3WTWA 3AM8A 3ZRSA 4YXKL 3L7EA 3N5AA 3ARSA 2EIZB 1L9OA 3GLZA 1JYXA 2C5DC 1EPFA 2ERJC 2VT0A 3DETC 3VXRE 3LN5A 1E6JL 3GK8L 3KG5A 1KB3A 3C5ZA 5L88H 4JDEB 3D48R 1FFRA 2FATL 1T5WB 3BP5A 1R3HA 4GKLA 3I9PA 4AENA 3VFSB 3TBWA 2HRPL 1YQVH 2J1YA 1E4JA 1I31A 4JHAH 4F24A 1CL7I 4HF5H 3FT2A 2C4XA 2B7DT 2F54D 1UHVA 1X5LA 3TZVB 5I1AA 5A16B 3V6FB 3S3BB 4DZ8B 3KLKA 5F7YC 3WTSA 4JFDD 1VZIA 4J3TA 4MWFA 4G6FD 1B2WL 4UOQA 1E5CA 5AOJA 2PLTA 2IG2H 4XP4L 1XCQA 2B4CH 2X2UA 1C7SA 4Y4HB 2OLDA 1SJXA 4Q6KA 4G1EB 5HI5C 3NRPA 3APDA 5ESQB 1ZEAL 2BZDA 4LSUL 1U8OB 3MUUA 4PJIF 1P2CB 3BESR 5AZ2H 3TNNB 3DMMA 5ICXA 4P46A 4KI5C 4LARL 1IV8A 1KWGA 1Y18B 2YXVA 3Q6FB 2R0WH 4RDQF 3ZL4L 1KFAH 4FQPA 3H42H 1ES0B 2F8VA 5DJXA 3QG6B 4K23L 2XZQL 2HXAA 4GIAA 4UUJB 4N2NA 4G8FB 5A2IH 1ADQL 5AFAA 1WTLA 4RRPG 3ALXA 2CK2A 4ZI8A 1YRKA 1UVQA 2VLKE 3H2PA 3TO4A 4BFFA 1CDGA 2BNUA 1R46A 2VKXA 3WIHH 1JI2A 5BVJB 4F5CE 1F42A 4FXKC 5DJ8A 3V4VB 1F4WH 1CB4A 4YHOL 4RGOH 1RUMH 2WLYA 4CU8A 1NKGA 4XB7A 1UM4L 1DJIA 3LKRA 4FNRA 1AP2A 3BAEH 4NRXA 3AG4B 3F6LA 4PRHB 1OT4A 4X4YA 3GF8A 2VLJE 3N1PC 3OZ9L 1ED3B 2CIKB 4OY9A 4Y19E 1QSVA 2OQJA 1MFEH 4HCRL 2XPGB 4K4KA 1N67A 5D7LA 3H0TB 1MW1A 4Y4HC 4P4RA 1MRCL 4NC2B 1LE9A 3UBGA 1U4EA 2VXTH 4UINH 4PGJA 1N70A 1V54B 1PPIA 2M1KA 2NY5C 5INDA 5IHLB 3ZE2E 4PRPE 4TNFA 3NFPA 1L9TA 3HCVB 3QQ9C 3QUMB 4IRSB 4P3DA 2N3JA 3DV4B 4KRPB 5DRZA 3QWQB 5CM1A 2R2BA 1A6AA 3VD7A 4YSPA 2VR5A 2FIKA 3NH7H 2R69H 3LS4L 4HUNB 4F37F 3QO1B 4UOJA 3O3DB 3LS5L 1CF1A 4M5YL 3L13A 5F7LB 4H25B 4JS7A 3U83A 2D4DA 1AR1B 5AOLA 1P1VA 4NIKB 3FT4B 1EIBA 4HHWA 1YCSA 2C7UA 2HB0A 1WFIA 1CR9H 1FGNL 4FQJH 3ROLA 2JKLA 3AMLA 2AS5M 4NI6A 4FXKA 1CFTB 4PJBA 5GRUH 1CXIA 3HVNA 1T3FB 3CBKB 3NK4A 1PKOA 3P02A 5EZIL 4X8XA 3VXRB 3DWTA 1AMYA 4M7LL 4NO5B 5E4OA 2YKKA 4HKXA 2W0FB 1JZ7A 1GGBH 5EO1B 3O8XB 3OKOA 4XC1L 2DQCH 4L8DB 1H8OA 2AJZA 3ZE2F 2CR0A 1S9VB 3BO8B 4FQCH 1NBVH 3Q48A 5LWYH 3GO1L 5FYLD 2L04A 4HG4K 2QHRL 4M6NL 4XXWC 1WGOA 2B4CC 4HLZH 4AC2A 3HC2A 1IBGL 3WXWL 3ARXA 3RKDD 4IRSC 4FTVE 3K5RA 3V0VA 3PXHA 1F2QA 1QNIA 4KRPC 5J9PA 4M48L 2BVPA 3Q6FA 2CLVB 3BAYA 5E6SB 5EOTB 1R47A 2Z91A 1AYOA 1ES0A 3LQMA 5F96L 4OJDH 1P4IL 2Z6FA 2K7PA 4PJ9B 5AWNL 5TF1H 4GBXA 1M7IA 3CXHK 1CFSA 1AR1C 4P2QD 1AXSA 5AVWB 4KQ4H 4DUVA 4DP5X 2B15A 3BQVA 1Z5HA 4M62H 2BP3A 1IFGA 1I1AD 4ISVA 4N2AA 3DIDA 1TJHL 4V1DE 5ADPH 5KYYA 2WMPA 2EH7L 1DEEA 1CCZA 2WBXA 4L3EE 2JKRM 4GKZB 1EFXB 3FO2B 3WJJC 2ZSVA 4UBDD 2XETA 3AG3B 2BVEA 1C5CL 4Y1AA 1QZNA 1BLNB 1BZ9A 4PRNA 2EADA 2VLKB 3QUKA 3C08L 1U8IB 3S3CB 3KS0J 3QCVL 4KNUA 1B6DA 2ZYSA 3QIWB 1XH1A 2BNRE 3O8XC 5IW1B 1VF5C 1KYOK 2CK0L 1OP5H 2SEBA 2VH5L 1ZHLA 4UQEA 1HN1A 3DOSB 1KBPA 1Y07A 4XXWA 5IP4A 3KPSE 4HMCA 4U2ZA 1QATA 1XL6A 3HCVA 2YA1A 4NP9A 2FAUA 2AXGB 3MRQA 1F41A 2UWEE 3IU4L 1FIGH 4MAUL 3KGTA 2VLJB 4Y19B 4XOAA 3SBPA 4WI7A 4PWIA 1MUJA 3TL5A 4J6RL 3ARPA 1C16A 4YXHH 1U8MA 3PWNA 5EBLA 5I1DA 2Z64C 1NUGA 1HNYA 1SEQH 3A4EA 2IQAA 4ZZKA 2X2JA 3ZE2B 2EEDA 2UVFA 3GS7A 4PRPB 3VD3A 1T7WA 5AB2A 4F93B 4TQIA 4M7KH 2WUCL 3FU9A 4PJIA 1QZ1A 4HU8A 1MDTA 1YAZA 3WIHA 3PHOB 4UU9A 5GS2D 5MEQB 3CCHB 2DYPB 4LSTH 1MJJA 2KYIA 2W0FA 2OM5A 3AY2A 4R7XA 5KSAD 5D1QE 2GTWA 4G7VH 1O9WA 3VAEA 3MJ7B 5EO1A 2EEFA 3RIFK 2FGZA 3QIWC 1IGCH 3N42F 5J6GB 3BO8A 2WC7A 1YEHL 2AV7B 3A6BL 4Q2ZA 4OCNC 4ZSOE 2IWFA 1JRHL 1UOLA 2OMUA 1AKPA 1A1MB 1AFVL 1O75A 3IF1A 4D9RD 1C5DB 4DSYA 3RY4A 1GOGA 3IKCA 5I6NA 3N9GL 5AG8A 2WP3O 3BRFA 2C3VB 2OR8A 1CLVA 1PKQA 3WMPA 5IVNA 3O4LA 1NAML 2BERA 1UA6L 1ZWIA 3L4ZA 2R69A 4GI9A 5DJ6B 1G6RA 3MA7B 5KVDE 1S7XA 1MHEB 2AEQL 3FPXA 3IJYA 1WH0A 1C7TA 4FTVB 3LKPB 3ILQC 2ZZUT 4OM0H 2YPKB 1MVUA 5DFTA 4KK6D 3FZUC 4LCWD 4EDWL 4ZS6D 4HIHA 1G87A 3TFBA 1S3KL 2DF3A 1OHQA 3MKGA 2VZ3A 3BP6B 2VCOA 2IFGA 3MC0A 2F1AA 4FQLL 4XZ4A 2ITFA 1SBBA 1BLNA 2I5YL 2B14A 3SQOL 1QUNB 1DQKA 4M1GH 4DP1X 1HEHC 1OAJA 1U8IA 4KJQC 1FYTD 1QD0A 5DTFB 4NPYA 4V1DB 1KJVA 1NBZA 4B9JA 4F5CA 2O5ZH 3UC2A 3DOSA 3L3OA 1BM3L 5IG7A 1TO4A 4L3EB 3VTAA 1LYQA 4KITB 2WXMA 5DD0H 4QNPE 4JRLA 5CZVL 2PP7A 4UTCA 4Y88A 1D6VH 3N44F 5C6TH 1G7MB 4QY8A 5CHNA 4WI4A 3SE4C 1NDTA 3LNEA 5H94A 5K59F 2C1OA 2VLJA 3IDIB 2XN9D 2JKIS 5EU4B 2BNRB 3FF7A 3MNWA 4ZO9A 1SMOA 1IAKA 1F11B 2B08A 4NS0A 4R3SB 3EJTA 1DSFL 1U8CB 5DMJB 3T6ZA 5ACLA 4JNXA 3ESNA 4EN3B 3KPSB 3QEUA 2H9GB 2F54E 3OR6A 3N42B 4KKNA 4BFKA 1KB5L 2LV4A 2Q0ZX 2NDFA 5HYQB 3OF6D 1GY2A 3BH4A 3B7YA 4MASA 1HCZA 5ADOH 1N68A 1MWAB 4JFDE 1MQKL 3LKOA 2EAEA 1AG0A 3BLKA 3D06A 4JG1H 5I1GL 1IC4H 5BUGA 5A2LH 4X6DE 5MEQA 3CCHA 3TH3T 5CZXD 2BRRL 4HOWA 1J8SA 1IGIH 5DD6A 1RVFL 2A9BA 1EHLH 1EJ6A 3D4YA 1A1NA 3QZMA 4KJWC 3T2LA 1J1XH 1ET5A 2UXGA 1S9KC 3BSZL 4LCCB 3QWOA 1MKFA 5J6GA 4MAYD 2EH8H 2WZPD 1JJUA 1R3LB 2NXZB 4HCIA 9PCYA 1X4XA 2VAJA 3TP4A 3RZCB 2FX7L 5DCCA 1X6LA 2WQRA 2P8MA 1IEHA 3KR3L 5D1QB 3QDJD 1FRGH 5JPNA 3WEAA 3VRJA 2XWCA 1EXUB 3JTSA 4JPVH 4XN1A 4AUYA 3L4TA 2C3VA 3AU1B 5JA8B 4HAFA 5GS3A 4JUSA 4KNTA 4OCYL 1E3FA 1CFBA 4QF1B 1PL3A 3T8XA 4EN3C 5DJ6A 4HFUL 2OMZB 2J25A 4ZSOB 3MRNA 1BXUA 3TA3D 5M94B 2VZUA 2QT6A 3C5XA 1PX4A 4ZJ9A 3C12A 3U1PA 2AV1A 3FQNB 2F8IA 3NCBB 4OKVB 3EUUA 1EEUA 1EEZA 1P7KA 1ZV9A 3BIKA 5CINH 3MJ9L 1O7DE 3MV8D 3KD4A 3N44B 4LU5L 4X4KA 2MKLC 2EC9T 4EUPG 1ZVSA 1UB6A 5HI3C 1YY9C 2EKSB 3FSVA 1X9RA 5F9OH 5FM5M 2MIZA 3FBKA 1HOEA 4NHUA 3UZVB 1QUNA 1T4WA 1P69B 4WTZA 4YSQA 5EPMA 2XKUA 4QYOA 4AW4A 5EOCL 2OMWB 3R7QA 4LCCC 2QKIB 3T0WA 3K71A 2NXZC 3A5VA 2PWEA 5I1HL 4OZ4B 3N3EA 1G7MA 4IKKA 1KT2A 3G5ZA 5I0WA 5JPMB 1NIEA 5KBNC 3C2SA 4GKNB 4YDMA 4POZC 3GHBL 1BOGA 1F11A 2JXMA 3LD8B 2GJPA 5E6RB 3CVHH 1O6SA 3KPSA 2H9GA 3L3JB 4XO4A 2AK1L 4ZOEA 3WNMA 1JV5B 1KC5L 4GG8A 4Z7NF 1A4KA 4PV8A 5DS8A 3QDHA 3P2TA 4LNVA 15C8H 4ZX5A 5DK0A 5EIIA 4IBLT 5CLWA 1NKOA 4GS7B 4OTXH 5CLZA 5I17B 2AGJH 1F4XL 5HP5A 2VIRA 4Q58C 2TAAA 4JRXA 3VFWB 4AIOA 4AG4L 1DQQA 5T5NF 2AK4A 3VXQB 4H88L 1JHTA 1VZHA 3T4YB 4DZBA 1WBXB 2EDQA 3SPJA 1U8LB 2F54B 5FYLE 3PXJA 4TYUA 3AGVA 2WZ0A 2CRYA 2YQGA 4WHTB 4N22A 3U6XA 4L8CB 2HKAA 2HT3D 1JZDC 3F7YA 4X7FC 4JFDB 4X5QA 5LNEA 3TTYA 5IFHL 3ZKSD 4QRFA 5L7XH 3QS3A 4G6FB 2QKIC 4PGDA 2HJFA 1TJGH 4UNTA 1OP3H 4Q9QL 1Y7VA 3BFQG 2IBBA 1JMXA 4J27A 4X6DB 5H8DA 3VFRB 1XZ0B 5KVMC 3QIBA 3QWNA 3ZYIA 4TSAL 1ZKAA 3EJSA 1F5WA 5J11B 4PHXA 1GZQA 4P2QE 5JPMC 3ZTCC 4ZD3L 3FB8B 1KB9K 4PREA 3WNNA 1BVOA 1BQLH 2GTZA 3LD8C 4U1GB 4AVIA 4CADA 2E7HA 2EIEA 3N41F 4HIEB 5CJOL 2AXJA 4DUXA 5KSBE 2VOTA 1JERA 5L2KA 3CVHB 4F9PA 3ULVH 1EXGA 1R3IL 2DKMA 4IRJD 4U3SB 1INDH 2WLNA 3WFCL 3E9TA 4QCIA 1U41A 4NKDB 4GS7C 1E6OH 2YAHA 3V6BR 2FLRT 4F1SA 4PJGE 2YRLA 4U1KB 2GVYA 3RA7L 4FABH 2PF6A 4FZ8H 4WTQA 3I3BA 3EO1A 3GI9H 1T0PB 5TDOA 1PZ3A 1R75A 3IJ8A 4PGCA 3NN8A 1TKWB 2HWZH 1HHJB 5CNHA 1FP5A 3EJCA 3NABL 4Z3HA 4DWHA 5IGXL 4G42B 5C09A 1EQWA 3V5HA 2QKIA 1N5AB 2L7EA 4G7RB 4ZFOB 2WQSA 3DJRA 5AW4B 4FYQA 1YEIL 2H6UA 3VWKC 4APXB 3KL3A 3K74B 3AUVA 2JK5B 4QTHA 3ZTNH 1ID5I 3EG9B 4TNWK 4HQQH 4U0RB 2HA1A 3B9AA 3JYBA 1SOQA 1Z0MA 4PSRA 5J11C 2BCMA 5EN2A 1CD0A 3MRRA 4X4ME 1PG7L 4TUJB 5KSBF 3US1A 2DWDA 1FO0L 1M2VA 2GI0A 3JWDH 4H5SB 2CKBB 4RLDA 4P06A 4DGUA 5EBMB 2OAAA 1E4XL 4U1GC 2BC4A 1R9FA 3SCMD 1C12B 4AQ8A 1N8ZB 3KBEA 4PJGF 3CFDB 3M46A 2LTQB 4UT7L 4JVUA 4WIQA 5I17A 4J4PD 4M6OH 5GS0L 2XIBA 2FCBA 2BSTB 5H35A 1YEKL 3T6VA 4LCUB 1D5ZB 3S36X 1CBVH 5DVPA 1V7MH 2F5AL 2HVJA 3IU3A 3MRMB 3QRGH 1CLOH 4PMFA 2VDML 3RQ3A 4FXLA 4RFOL 4YDVB 3D33A 1IAIL 4JZJB 4HPYL 4D9RE 5LB1A 2WYTA 5CCKL 3VWKA 2X6CA 4PG9B 4L4VA 5AKTA 1O7DC 2P80A 3F7VA 5GSVA 1XZ0A 4KK9D 3VG0H 6FABH 2R4SH 1EWHA 3I50H 4NM4H 1BF5A 2C3HA 2Z31D 4B9YA 4U0RC 3TN0D 4KZCA 2AJVL 4KMQA 2I24N 1G1CA 2N7SA 3UGUA 1P6AB 1EEYB 1UG9A 5EBWA 4I48B 4G8GD 4YHNA 3FB8A 3DV6A 3UMTA 2XU9A 2PW1A 1XGTA 2FECL 4OLXH 3ILPA 5IJCC 2EUXA 3ZZSA 4Q52A 5DUPL 1K5NA 4P5SA 4NHCH 3ZDZF 3BSGA 4LCWE 3VI3E 4HIEA 2ICCA 2DM7A 3W39B 1YYMH 1KCRH 3K6IA 1A21A 3N2JA 2WVTA 1QABA 1QUPA 1G4RA 3GXTA 3KPQA 4P2QB 1GS8A 2X10A 2LTQC 4PGBB 3C6SA 2E7LC 2AXFA 4CDHA 3EH1A 1FYTE 3W9EB 5JHLH 5SWQA 1I1AB 2HFFA 1Z3RA 4MX7B 1MCKA 1KYDA 1QR1B 1FJ1A 1BQKA 1WGVA 4Z8FL 2NY4D 1LNUA 1KBGL 2NYYD 4OF0A 5FOBB 5KSBB 5CBEA 5KS9A 4GW1B 3LRHA 1TKWA 2YD6A 3T2NL 5TQ0L 4YLQT 1AE6L 5ISZE 1OD7A 1MREH 1EA9C 3OQ3B 5EC2A 1N5AA 4IBVA 1KIQB 5IQ9B 5E9DA 3O2DL 5DHYB 2XN9E 1K2DA 4JFZH 4A2EA 4PJGB 3TLRA 3VDBA 1OOAA 1DO5A 2JK5A 3S37H 1YA5A 5BVPL 4XXDA 3U4AA 2WXRA 4YHIB 3PDOA 1LO0H 5GGVY 2G9KA 2WD0A 3M17B 4ALAH 2V7HA 3C8KA 4LSRL 3UH8A 5E08H 5PCYA 2X3BA 4HWEH 2ODIA 3WY3A 4YNYB 4F8PA 4I9XA 5DD5H 5A7EA 3VI4A 5I0ZA 4GP8B 2CBQA 2DLIA 3UZQA 5D71L 4GQQA 1TZAA 3P3TA 1MN4A 2ZONA 4WENB 2VDOB 3SE8H 1QYGL 4X5WB 4XNDA 3CFDA 3DI3B 5I73B 2E7LA 1P9MC 4NQEA 3GBEA 3JTTA 3RRQA 3U0PB 3RHWF 4M1DL 4D8PA 2VLLA 3NSFA 5F88B 1H3VA 2PR9A 2CCWA 3A67H 2RACA 4AKPA 4BKSC 1I1AC 1JTPA 2APBA 5DRXB 2FBJL 2X9YA 4XVJL 1X5FA 3UACA 4F7KA 3RWIA 1BBJB 3MRMA 3KHOA 3GMNA 4ZO6A 3B43A 4WVRA 3HG1D 2CO6B 3I6KB 1AQMA 1TDQA 3REWB 4NQTA 4YDVA 3ZDZB 5EFIB 5EU6A 5KSAB 5SX4I 4YLBA 3HHSA 3QDJE 3H85A 1M7DA 1CGSH 3SGKA 2OSYA 1OV8A 1I9RL 5GGQH 1TF4A 5B1CA 1D5XB 2MNJB 2R1WA 4LEOB 3PDGA 3GSRA 2XTLA 1AACA 2XI9A 2O6PA 2JJWA 2B1AH 3BUQA 5JOPD 5T3XD 4QTIL 2ESVA 1NCAL 1TCRB 4U6XB 5F8RC 3NZSA 1H8NA 4ZQKB 2P5ED 3N0AA 3TIEB 4OVVA 1TZIA 4C58B 1F90L 4X7EC 5IW6A 1J7VR 3BH8A 1I1FA 3QDMD 3GLAA 4IS6A 3T6WA 5HHVL 1DFBH 1UM5L 3U0TB 4MQ7A 1YEEH 5SWZA 4YDJA 1P9MA 4QLRA 1ZLUK 3BP7B 5I73C 4PHZA 1E9PB 1MJ7H 5I5MA 3W9EA 1PX3A 3I75B 3IFPB 1GIGL 1I1AA 1OAYH 3K6FA 3VD5A 3IMSA 2ZXWB 3JV4B 1JZFA 4LCWB 3VI3B 1RJLB 1UUNA 2DDQH 5KSBA 3DIFA 5F72S 2YAFA 4OVUA 4KY1L 2R2HB 2OMTA 3NA9H 4E9SA 3QXDA 4PJXA 5EF1A 1I8KB 5EG6C 2YKLL 3EH5B 2B0SL 2ZX8A 5I82A 2ATKB 5IHHA 5KSAC 1PFCA 5FW8A 1FYTB 1QBLH 4AVKA 4L9LB 2AQPA 3ESPA 5G5DA 4N2GA 1KZYA 4N20A 4YHIA 1LMIA 3FULA 1RHHA 1F1GA 4K8RH 2ZUQB 4GSRA 3LHPL 4I4WB 1S7VB 2WYZA 3A3YB 2GABA 1CG9B 4TSCH 3T0ED 3D30A 3DDFA 2ADGA 1OCCB 2XN9B 3HZYA 3LYRA 1T7VA 2VDKH 1JE6A 3QR0A 1UC6A 2CBMA 4JQIH 1CJYA 4JRWA 1JPST 2VN4A 3BN3B 3U0PA 3LEYL 4XNUH 5JHDA 2QVTA 4AYSA 2EEBA 4JFVA 2HT2D 3UYOD 3MNDA 2EYSB 4KUZH 3DRTA 4JHWH 2VSKB 3G7TA 3WFEL 4JJ5A 3IT8D 4CGTA 2WNXA 4GRLD 5CUSH 4KK6C 3D69B 5JHLA 4HBCH 3OHXA 5CEYB 4WFHD 4NC0B 5CD3B 1VFAA 4YDKH 1KDJA 4GW4A 2WIIB 3NJMA 2OTWB 4YFEA 4QHKI 1A9BB 1ZIBA 4DVRL 1G9MH 4KJYA 2H1XA 1XH3B 3ATAA 4OJAA 1JPGB 1QVOB 1DUYB 4JPQA 4E5XB 3ULSB 4EI5A 1AGCA 2XX1A 4YLCA 5IT2L 4TMPA 2NYZA 4LP5A 1T4KB 3U46B 1D5XA 1RZGA 2C8NA 4MAYB 3FCSB 2G9HB 4ACTA 5I6KA 5GRYA 3D2UA 1U8PB 1KTCA 4O00A 4IHBA 5I0VA 3PV6B 2ID5A 2ZUQC 3OX8B 4XVTL 3T6QC 1WWWX 1IAOB 2D7TL 5A2FA 1RCYA 2GB2A 3EZ8A 2G5UA 1DTUA 4UM8B 4BZ1H 3EW3B 5T1JA 3QDJB 5D7JA 2CBTA 4LAJH 1QSEA 4HUWB 4D94A 4MSWA 3U1SH 1T7XA 1A14L 3B7UX 2C9SA 2Q5BA 2J1ZA 1DDHB 4JRYA 4UT9L 1UFGA 1S7QB 5JLZA 1D5IL 3TA3B 3EF7A 5IEHB 3NCFB 2BVQA 1ZA3A 4WZ9A 1QPPA 2X4PA 2GC7C 4YSTA 4AL8L 4TNVK 2VDPH 3JV4A 4YSCA 5GHWL 4YFLF 1TTAA 1ILSA 5E2UH 1NQBA 3MV8B 3IDMB 4NSKB 2X4OA 3QZNA 3SGEH 2F5BH 4HYTB 4J2QA 5F21B 1M05A 5CZXC 4WAFA 3EFOB 1XQ4A 2PPDA 3KEHA 1SHWA 2G4GA 2N0KA 2XNAB 2ATKA 2H41A 3QQ4B 4OIFA 4CILA 1BCIA 3VJ6B 2CA3A 1DZBA 2WKOA 2HTLD 4N8VA 1XO8A 3H9HB 2A6JA 3VD9A 2F53D 4MAYC 3LRKA 4NZ8A 1W8NA 2WLLA 4ZW5A 3ULUL 4IEFB 2JQZA 4AGQA 1S7VA 3RVTD 2ZD0A 1Q0XH 5ILTL 1RULH 4QHUB 2IWEA 4WK4B 4N8CL 3S35L 5BS0D 1CE1H 3STLB 3S5LA 1UWFA 4K8RC 3VSUA 5ID0B 1HHHB 1YJDC 2VXVH 3U1QA 1BZ8A 5GGUB 5MENA 4F8NA 1WC7B 5E6ZA 1U8HB 4D0CA 4WWPA 4FQXC 3L4CA 1DQDL 1I7RB 4XMTA 1DVUA 4KROC 2MNWA 4KPHL 4KBPA 3H54A 5JUEH 4PY7B 3TA3C 3TA4D 3FOMB 1YMMD 1CIUA 2EYSA 3KH4A 4JFHD 1JYVA 4DGYL 4GB9A 1JXFA 2D3JA 4LSQH 4GP4B 1Q1JH 1IE4A 4MDJA 5FKAB 3BKYH 1GGYA 4H8UA 4RAUB 3RWCB 4FA8A 1DL7H 5D5ME 4R84A 1OE2A 1LP9E 4PJEE 2VDPB 5CD3A 5FHBH 2WIIA 1JWUA 2K4WA 3TPUA 3IMVA 2FT7A 2VDLB 3MGOB 4QRRD 4JFOA 5CN2A 5DJAB 3RGHA 3U9UA 4G8GE 3QUXD 2KI6A 5H2BA 4KH9A 3VX1A 3FUMA 4WW1A 1KXTA 2AJXH 2YRPA 5FFLA 1FFNB 1I7UB 1G7IA 2HMID 4ETQB 1U8PA 3GSXB 4K07A 4HLZG 2Y22A 3DHPA 3EJYD 1M3IA 1TPXB 5ACZA 3B2XA 3JWOL 3EOBB 3RVVD 1MELA 4NGHL 4UM8A 5KJRL 1SY6L 1U3YA 3QDJA 1T0MB 1FV1B 3F04A 5IMMB 4HUWA 3KCPA 2IH8A 4P2RD 1NC4A 2A77H 2XVGA 1RSFA 4FLRA 4FQXA 1N6QH 2JVUA 1OQXA 2DQUL 3WLBB 3JVGC 4WKZB 5LGJB 5CEZL 3GKZA 2AQRA 2R8SL 4YS4A 2X28A 35C8H 4IRJB 3VD1A 1BZEA 3OKDA 1HEZA 4GMTL 1ORSB 3D4CA 3LZLA 5EUKB 2W59A 3MJGX 5TDPB 4LCYA 1LP9F 2WP3T 4GAGL 4WKXA 4XVSL 2IV8A 5GZND 1MCEA 4X5XB 3MV8A 2WOYA 2E9JA 2QQLH 3IDMA 5KYWB 3FU8A 2A74B 1EANA 1HDMA 2DIAA 2BNQD 2HZHA 3K2UH 3QQ4A 1A4JA 2A6IB 4KQ3L 5MHSD 1A6VL 1G43A 2J6EH 3ECQA 2J1KA 2HT3C 2NX5A 4BQBA 1LEGB 4GJTB 2BY1A 1WFJA 1UA3A 3CDZB 4HX1B 5I8KH 3KHQA 1A3LH 2I60H 3CFMA 1T20B 3MUJA 4GINA 4QHUA 1Z9LA 3G5WA 2B1HH 2NZ1A 4QHPA 4P3CL 1WBZB 1FBIL 1A64A 2QGEA 2EDNA 1NGQH 4TUUA 2RMNA 5E6IB 2J8OA 4BZ1A 2D7MA 3T9WA 3HFML 4WHYG 5BMFL 1DCLA 5KW9H 5KN5B 1AD9B 2AMGA 4NC1E 4P5TD 1HZLA 4MZ2A 1HCYA 3SCMB 2F9BT 4BFRA 4XZUA 4PIBA 3WJLC 1JK9A 3ZE1E 3HG1E 5I19H 4TPRH 3RX5A 3TO2B 3HC3L 1RP9A 3HUJE 4IRJC 4U7SA 1CT8B 1C9SA 2JFCA 1S7RB 4XNMA 4ZS7H 5B3NA 5FKAA 3RWCA 4A39A 2X41A 3BSHA 3NZHL 1ZMYA 2N7BA 2YAQA 2A74C 2E27L 3MODH 4F7CA 3P4LA 1K85A 4D3CL 2ED6A 4HGKC 3O2WH 5JORB 2PP9A 5K9JH 1EV2E 2HLAB 4ZDHB 4JFXA 5JOPE 5T3XE 5F70A 1QPKA 2CDEB 1XCTB 1FFNA 2YIHA 1A7QL 3R1GH 1GTFA 3GSXA 2AAAA 3HI6L 4EF3A 2P5EE 4NN5B 4B9GA 2GFBB 3RWFB 4BH8B 1R3JB 4X2UA 1LP9B 1RSYA 2Y7MA 3FFDB 3B9KD 3KYOB 3EOBA 3QDME 2Z31B 1XSIA 5FM5O 4HSCX 3WTVA 3TN0B 1CDJA 1U33A 3MLWL 4P99A 3ZE0E 5CGMA 5LN8A 1FV1A 2K4AA 1V10A 4JGUA 2OR9L 4Y4FD 3ZQ9A 1AOZA 5TE7H 4G8GB 4LOUD 5FUZH 1SJVA 3II3A 1CLYH 4A2GA 4GRMB 5LHDA 2ZAHA 2YARA 1A9EA 4NOBA 3ZE1F 2H6PB 1AKJD 3HUJF 4Z3FA 4M4RA 1BIIB 4LASL 5DHMC 4NO3A 1NBQA 4ZFZB 3SCMC 4P9ML 4A7SA 2YD7A 4IRJA 1VLXA 4BFIB 1CLZL 4E41D 4UCFA 4PUBL 4Z3EA 4R7LA 1AZNA 3DGGA 1GCYA 4J4PC 1QI4A 3BFWA 4YUEH 3QFGA 2A74A 1N7MH 4UQ2B 3DHJA 5DC2A 4EDXA 4XP1H 4KHTH 5HGAB 1QFUL 4FLQA 4PLOB 1A47A 2EILB 3HLAB 1TZHA 2ZUSA 2I9LB 3CLEH 4M43H 3GIZH 3PGDB 3T0EE 4OCXH 5AKSA 1EAPA 3UYPA 4Y5YA 3ZE0F 3CDZA 3QJHB 4E9QA 2VZTA 1L6XA 3IK2A 4N6RA 4PBVC 4A7UA 4NN5C 4DW2L 2AZAA 2WBJA 3JBG7 4KK9C 1BFVH 3GBMH 3F84A 4EXKA 4JFPB 1MHHB 3TN0C 2FJHB 2BSRB 2NTFB 4LPVA 4DEPC 2NY5L 1HYSD 1T0NA 4OGQC 2GK0B 4CVWA 1NUFA 2ZG2A 3A4AA 1BZOA 4X5PA 1WHOA 4Z7OE 5F2FA 4HHAB 1G7HA 1OSEA 5FO8A 3IFNL 2KBGA 1CFVL 4JDVB 1T66D 1DVTA 3OPUA 1JGUH 4MQXD 2PYFB 1KEMH 2X4TB 4WFHE 4JL2A 4MA1B 2XQYG 2LHAA 1NUNB 5KBPA 3WFHA 1JPFB 1T1XA 3A6CH 1T6VN 2I25N 3WCYA 4FG0A 4PJHE 1KEGH 2Y2YA 3JQOB 2DJUA 3VFPA 2ENYA 3M07A 2NSXA 4NWTL 5FKPB 3WKQA 4XN5A 1EK3A 2NY4C 4D7PA 2NYYC 3V4VL 4KO5A 2F1EA 1HI6B 1F6AB 3ZE1B 4Z7VE 3HG1B 2Z8WC 1YQVL 2GHWB 2AABL 3GSWB 3TVMD 3HUJB 4JFQA 1P5VA 5IV2B 4HF5L 1T1ZA 3SOBH 1PIFA 1IQWH 2CDEA 4XNQA 5D7SH 3M7OA 1T1WA 3GSVB 4XI5D 2J6EA 3D39A 1I3UA 2YSSB 4D9QD 3GRBA 4BH8A 1PS3A 5LXVA 3IDJB 3RNKA 1HXMA 1JFQL 2FO4A 2GBUA 5CCHE 1NCWH 4Z7OF 2IG2L 2B4CL 4QXTB 2R29H 4PTTB 4U6HA 4DKTA 6PCYA 4OKDA 3QWRD 3QUML 2CJTA 4NFDA 3VFTA 4NCDA 3T3PE 5JOEA 2P5EB 5KYUB 2X1WL 4YPGA 5AZ2L 3NJGA 4XOEA 5GGSY 3QDMB 1XR9A 3EYFB 2E6QA 3ZZQA 4PJHF 3ZE0B 3FTXA 4MA1C 5KVGL 2VLMD 2YBRA 1HZKA 2VXQH 4DKFH 3EH2A 2ROYA 1I8MB 1IAMA 2VR9A 1OW0A 5DUML 4Z7VF 2XYCA 2F53E 5ABDE 4NC1C 1A5FL 1OGSA 2X44D 3E7JA 5HGAA 2C4FT 1BVNT 1RD6A 3HLAA 4JKLA 1WT5C 4M61B 1PZ2A 2OW7A 4NT6B 3WIHL 1HWWA 1R6VA 1RQ5A 2ZOTA 2JCWA 3DX7B 3H6AA 4BZYA 2H3NB 1JK8B 1VACA 5JIIA 1X5XA 3F3HA 3QJHA 1V7NH 3SO5A 4K94H 1AS7A 2GC4C 2GJRA 2Q7NA 4CMMA 1VZGA 3SY0A 3BAEL 4OCRL 2Z92A 1YN7A 3OMIB 4MCZA 2NTFA 4O51B 2FO1A 2F58H 3MPCA 1ZLSH 4APQA 3IDNA 3T3PF 3GFUA 3CZNA 1MFEL 5T3ZE 4IBWA 3KPNA 4MDIB 3UGXA 3T0EB 1ZDSA 1YMME 4JFHE 3V8CA 4TSBH 4UINL 2VXTL 4S11A 3DO4A 2RA1A 2HSIA 4V2CB 3QA3A 2D3VA 2X4TA 3PU7A 4ABVA 5BJTB 1SNRA 1YEWA 4GG6E 4ZPVB 3EFDL 3QCUH 2XA3A 3W81A 2R69L 2A4CA 4QRRE 2J43A 2VSCA 4G3YH 4AUUA 4DESA 3TV3H 3UAJD 5DDHB 3DRQB 1YN6B 3NJIA 4ZPTA 4Z7OB 5HDQH 5FK9B 3NJLA 4GI8A 4DFIA 4CU6A 4HKJA 2DMKA 3AACA 4GRLB 2PW2A 3V6ZA 3U7YH 2A38A 1A9VA 2V8MA 1F6AA 1SN2A 1CR9L 1KCVL 3FYEB 2JTYA 5ESAA 4I87A 1VPOL 5GRUL 3HRZC 1C1EH 3GSVA 4OLEA 2Z8RA 4PJHB 3L16A 2YSSA 3M86A 4OBSA 2PXYA 3OD3A 5DYOB 3QHTC 2B3IA 1OPOA 1SBSH 3FQXB 1QLFA 4TQ8A 2GT9A 1GVIA 3HZVA 1GGBL 5BZZA 1L0YA 4DGVH 3PL6D 1OOWA 1YEFH 4Z7VB 3QFDB 2EDLA 1QO3B 2DQCL 3L1OH 2NR6D 2CO7A 2N1TE 4DIXA 3C5SB 4YZFE 5DK2B 2YOCA 2J7LA 4FQCL 3T0EC 3KYKH 5LWYL 2FLBT 3UFIA 3NEEA 3PIQA 5IFAL 4XWOC 1A6TA 5LBSL 2H32B 2UZXA 2O1AA 4JW3A 4CMHB 2BNQE 2LU7A 4QD2E 5GQBA 6PAZA 5K9KA 4I3SH 2P47B 1BHGA 1MG2C 5MHSE 3DBXB 4WJ5B 2HT2C 4R4ND 3VM7A 5DLML 5FUCE 5FEBA 3T3PB 4O5LH 4Y2LA 1XMEB 4U1NA 3T77B 4GRLC 4HIXL 3GPSA 43C9B 4TQHA 3MR9A 1N64L 3OKKB 3G9AB 5E00A 4NT6A 3BT2L 1DJHA 3WY4A 5ADPL 4G6JH 3K2MC 3ARFD 1JK8A 3HRZA 4HFWB 3QO0A 2CPUA 3CZUB 2Q6WB 1E27B 1X5ZA 3DVGA 4YSOA 1KYFA 2ZF9A 3RU8H 1WWBX 1T1YA 2CLZB 3GIVA 4R4FL 2F53B 1JZ8A 1E42A 2GBVA 1UT9A 4LVOB 4Q9BA 4FZEH 3U2SA 4N1CA 2W8CA 5AW5B 4BSWB 4H40A 4NFCA 1IU1A 3OB0K 3O6KH 2ARJB 4YBLB 5BS0B 2RTTA 4EEEA 3ARTA 3K0YA 1YC8A 1SM3L 3EFFA 2R29A 3KNBA 5I1JH 4S1DD 1OIOA 2VAAA 4HETA 1KV7A 2XY2A 4I0PA 4LSPL 1NUDA 3C2AH 2OMXB 1FIGL 1XSJA 4ZPVA 2B2XH 1XF4B 3X3FL 4CMHC 5IHWA 4X6EA 2GSIA 2EDDA 4W81A 1KJ3H 3DRQA 4U05A 1YMMB 2YC1B 1RUAH 1XSOA 5KUMA 5I8CA 3O6MH 4M56A 4QYAA 3OZKA 2VXQA 5F89A 2CHNA 1SEQL 1BJMA 3K81A 3UIZA 5JIDA 3GXUB 5HYJA 3AQDA 1IE5A 4M7KL 1HESA 1NCJA 2CALA 1HEJC 3AS2A 2IAMD 4GG6B 2LLNA 3UEQA 5D1XA 1OCWL 4QRRB 3CHOA 4P2OA 2P5WA 3FS9A 4B27A 3C9NB 1BG1A 3EAKA 3QUXB 3KYMA 2FK9A 5E8EB 5EZLB 4DT2A 5A40E 2YGPA 4HZ1A 3FQXA 1EJ8A 5KWYC 2DKUA 3MYJB 5D7HA 1OT1A 2IVFC 1REIA 1M56B 2XG4A 4YOKA 5C07D 2XZCH 3VG9C 3BPCA 3MSPA 2DQDH 4ODUA 1QO3A 5A6MA 3EDFA 3KLAA 4ZOCA 1IGCL 1GYAA 3DYPA 4LGRB 3CZKA 3L95A 4GEJA 3RVTC 3C5SA 3SYOA 5DK2A 2CJUL 2AC0A 4YBLC 1MHPL 3AXHA 4WUKH 4E41E 5DFWH 2ZUYA 4PW9A 2L3BA 4KDVA 3L4YA 4G1MB 2VE6B 4P2RB 3TH4T 1PNCA 2RFXA 3U36A 5L8KB 4EBQH 1UURA 3RJDA 2EDWA 1JCKA 2ZJSL 5DJCA 2X4RA 1G7JA 4JG0H 2YAMA 1G7PB 2KQNA 3BKCH 3NCJH 2QMKA 4PS8A 1OO2A 1E0OB 1IC5H 3SKOA 4RA3A 4CBZA 5LJYH 1QFWL 4YHYB 4EQ2A 4Q6IA 4KI1A 4X98A 1HZHL 5D70L 43C9A 1NEZA 2EECA 1NGPL 3BUIA 4AGPA 1NGWA 4LESA 3RIAF 4GXVL 3CGTA 3BGFB 5IF0B 1K8IA 2BNQB 2WN3A 4PR5B 4RNRB 4B7IA 4GAJH 4OM0L 3LVEA 4OF7A 4RIRA 1OTTD 1IBZA 1IGYA 4AYEC 2V5RA 3ARED 5MP6L 3NFNA 3D18B 4LLQA 3QUXC 3RDTC 1MCOH 2FEDD 5C0GB 1EO7A 1LM8V 2HMIC 4WDIB 4BGLA 2YK1H 5D72H 5T1KD 1J12A 2BOCB 1YNKH 2JKXA 1XGPB 4YDLB 1OSPH 1MIEH 3EJYC 2A5UA 5LAXA 4NQVA 5CD5C 5IOKA 1RK1A 4WUUA 4JCMA 1VGKB 3E8UH 5BS0A 4KRNA 4ENZA 1XGQB 2HJLA 3WN5B 1J9TA 2BOBB 3L9RB 4KUCD 3QW9A 5BZDB 5AVUB 1F2XK 1D6VL 2W60A 3HG2A 4WGVB 5IHBA 4P5TB 2D03H 4HXAH 3NP3A 4RMWA 2W07B 4O02H 2AQTA 3DPBA 4OLZL 4ADJA 1TU2A 5F3BA 2WZAA 1QTYT 4HJGB 4JHZA 5AVZB 4EI0A 3SDAD 3IDGA 2L7JA 4ZMQA 1MPAH 3DA0A 1KJMA 4EZJA 2C3GA 3WGVB 3FQRB 3I9GH 2DJMA 5B8CA 3G5VB 4UAOB 2FQEA 3POCA 4RDBA 4UNIA 5GZNC 3H9SD 5I0XA 1DLHB 2ZNXA 4D9QE 1K8DB 4L1SA 5ADOL 3BGFC 1WF5A 3MLVH 3P77A 1S9YA 4CVXA 1DLFH 2NQCA 5HYSG 3VD4A 1E4KC 4DP4X 4DH2A 4MD4B 2EEAA 2ROXA 3D07A 4NAQA 3RPKA 1IC4L 5E8EA 3CU7A 3RDTA 3WJMB 4GSDH 1JNHA 3EF4A 3EO0B 3QJVB 3MYJA 2Z4TA 1KIUB 5F7DB 1J1XL 4Q0XH 2W5PA 2C9XA 2RIKA 1ZS2A 3QG7L 3UJJH 2A1WH 3B9KB 4YDLC 3ZHFA 1ZDQA 3HR5B 2ARJQ 2D7PA 2HRLA 3D05A 3AG2B 1A3QA 3H4HA 2VLME 3CFEB 2WYIA 4Y4FB 4ESKA 3ZSSA 2NMSA 4FKKA 4F8QA 2H7WA 3WN5C 4KV5E 1TEFA 4P2RA 4U31A 4IRZL 4R7NB 1BJ8A 2QELA 3MREB 3B2DC 1AKJB 2V4LA 1X9QA 2YA0A 3F12B 4P5TC 1FRGL 4FFVD 1OT2A 3OKNB 2IPKB 1G7PA 3PWUA 4H0IA 4JPVL 4NQCD 3VW3H 3DHMA 5EC1B 1LVEA 5C3TA 3O2VH 1WG3A 2GJ6D 3SSGA 4E41B 1EHAA 5CJXA 2R1YB 1DVXA 3FF8A 3V4PH 3ZHKA 2JSFA 2XQ0A 3CXFA 1LGVA 4WI3A 3EJUA 3VVWA 4GKOA 5CP3H 3EADA 4RNRA 3L3KB 1LEKB 2V6HA 4R90L 3IB4A 4X5LA 2ICEA 3CDGA 2R27A 1CTOA 2JJVA 4G43A 1KMGA 5DD1H 1NOAA 5KG9A 3PP3K 2Z4QA 4N2LA 2OPCA 3APCA 3D18A 3QZWG 4G59C 7FABH 1XDTT 1CFMA 1XF5B 5F9OL 3SBWA 1OM3L 2Q10A 2EQDA 3DX2A 5IJBC 3ES6A 1J1OL 3IFOB 2KZWA 2JNZA 3WEXB 1XGPA 3A4FA 4EIGB 1ACZA 3KGUA 4HS3A 5GRJL 3SB3A 4KV5F 3G04B 3B9KC 3MRHB 3ZXAC 5AAMC 2W9EH 1G1YA 2GBAA 4YSEA 2VN7A 3SOTA 3S88H 4QPEA 5I8EB 1EO5A 2J4WH 3MRDB 3D4ZA 4LOUC 1QSFD 3V5KA 2FR4A 1DSYA 2Q8BH 1YG9A 3NT0A 3Q01A 2W07A 3O41A 3TESA 5FWQA 1BJ1J 3T1WA 2YMXH 5F0MB 1Y6MR 1NIAA 3H7BB 2WUBH 4GW5B 1DR9A 2OMVA 3CVHL 1T6WA 1TVHB 4D7BA 3ZDWA 12E8H 2NNFA 3FQRA 4X50A 1MW3A 4XX5A 1SVCP 4PLJD 4Z3IA 5IB1A 3MLUL 4CJ0A 4QAWA 4ERSH 4BEIA 4IIQB 2YXWA 1SHXA 2YO3A 4HEPG 3OC5A 1CXLA 2MFNA 5HJDA 3QQDB 3DGCR 3WKMH 1ZXKA 1MLCB 2N7AA 2FH8A 5LDUA 4WWKD 3TVMB 1FVEB 3FL7A 1CC3A 3FUNA 2WAHA 3QXVA 3IWUA 3N1QC 3B4NA 4LLUA 4P5KB 2XHNA 4YHZL 1E28B 2P24A 2XXMB 2V0AA 1JXKA 3MTRA 5L7XL 5LAPA 3HR5A 1M6OA 3D08A 3KBFA 5IB3B 1Y0LB 1RHFA 2H4EA 3LEXA 2JKNA 4MMZB 2PWDA 2VXUH 3VRLE 1RZKC 5JNYA 1UATA 5F97E 3OAYH 3UTTD 1B0IA 3R4DA 2E8YA 2WVVB 4QHLB 3T2OA 1DE4B 4WF7A 2CKBL 1ETZA 2ZSWB 1T66C 1TQWA 4MQXC 2NZ9D 1J5OL 4G11A 4TQEH 5IR1A 1BQLL 4O02A 2E0PA 2YBGA 3LY6A 4HCGA 3I84A 4S1RH 2FEEL 3V0DA 3DX6B 4YE4H 1INDL 2W9LA 4IIQC 3U9WA 2WTPA 3MNVB 1CGTA 2Y1AA 4HA1A 2DQGL 4DTGH 4UTAL 5JW4M 1ICTA 5DWPA 1AGEA 2Y36H 1E6OL 4BIKA 1TETH 2KZBA 2GCYA 5IESL 1UXMA 3TVMC 4J3SA 1VA9A 3HG0A 3CPLB 4FZ8L 2FWLB 3O4OB 3HRPA 4PVMA 1JTOA 2FL5B 1CGWA 1FPTH 4OLVH 3RNQA 2WXOA 2HWZL 1GS6X 1GZPA 3EOAB 4X8JB 3VRLF 4YMPA 2VC2H 1HH9A 3TT1L 2Q2EB 5ITBH 3VD2A 2R0ZH 3AVEA 4M6MH 1IGTA 1IGJB 3NJVA 2K6YA 5FYLL 4NQXA 4NQDD 4PQXA 4MMZC 5DC4B 5I8EA 1YDPB 2Q87A 2XWEA 3RL1B 1TJMA 4ONFL 3ZKND 4HQQL 3Q8BA 3CFKA 3WE6B 5IVXE 4PD4K 4GFTB 4MKTA 4DQOH 4FP8L 4W4OC 4PRBB 2OX5B 3EYQC 3QAZB 1DEDA 1MFCH 4KAQL 3RWJB 5CWSA 4GLRH 5E2TH 2X70A 4QT5B 4WO4D 5IBTH 1KTRL 1OGAD 5E8NA 4BV1A 2Y5TA 4LIQH 1FH2A 4ZUUA 3GI8L 1MIML 3LCYA 3TCLB 2KKQA 2K6ZA 5DUBB 3V4PA 4YHPA 4OLWH 1WUZA 3CH1B 2CHDA 2ZTBA 2UZPA 3I6GA 5C07E 2A6KA 1MLCA 3I02B 5DQ9B 2H0FA 1N4XH 1KIPA 1F00I 4WCYL 2IDSA 2VSMB 4WWID 4X6FB 5FGCE 5L8JB 3EKCA 3CZGA 2R0KL 4J28A 3T0AA 1CZ8H 1F4YL 3BMWA 4QO1B 2EXYD 3HE6D 4P5KA 4FNPA 4PJ8D 1E28A 5DJ2B 5AKVA 2MOQA 1J9CT 5E9AA 4ZQTA 1KOAA 1VFBB 3L2MA 3TJEL 4MJ5B 1Y0LA 4NQUA 2WCGA 5IVXF 3PL6B 3RLSA 3GZKA 1AHWA 2BH0A 2NZIA 3FO1A 5CR8A 5J1TC 2VC2B 1PLCA 2ATPB 1OZTG 3K6DA 4JKMA 4U6YB 2R4SL 3VG0L 3I50L 3FW6A 2OTUA 1FHGA 3CFJA 3CUPA 2RB8A 3CX2A 1VAHA 1ACYH 2X53A 3VFVB 4PS4L 4X0KA 2ZSWA 4FXGB 4M7ZB 4N1EA 5G4NA 3MA9L 4MMYB 3QAZC 3D6GA 3L3GA 1KGXA 4NKOB 4OLXL 2VDOL 3LZNA 2C3XA 3HAEH 4Y7MA 5GGVH 2WWNA 4B9IA 2PNDA 2IAND 1PZ5A 4NHCL 2PR4H 4R83A 2WY3B 2A0LD 4K7PY 3U9PH 3KYAA 2BIOA 3LPPA 2ZAIA 1GW0A 1KCRL 3HMXL 1INQB 1KCKA 1JVKA 5K1JA 4I13B 1HS6A 4IMKA 4N1HB 3CHSA 1QHOA 1B0RB 3MLXH 4BKLB 1U91B 3ENEA 4OF8A 2DICA 2XVLA 3MRCA 2WTRA 3ARFB 3ZQWA 5GIRB 3CPLA 5EZJA 1E6JH 3CN4A 2AAVA 1JS4A 3GK8H 5E0FA 2FL5A 5JQHC 3UBXG 2EIBA 3QNFA 4JZOB 4WW2F 1U8JB 1QQDB 4AXWA 2E5EA 5BXFA 2HRPH 1MREL 1TQUA 2BIPA 4MCYB 3RUGF 3W0WA 4H1LG 1Q9WA 1TJIL 5B22A 1XZWA 1I7TB 1IGJA 1CN4A 2V2TA 1KG0A 1T83C 1QEWB 1YDPA 2XSKA 2IH9A 5E1QA 2NR6C 1WWAX 2GSMB 3S37L 2ZUUA 1LO0L 3G5YB 1JN6B 3GMMA 1PIGA 5HSFA 1L0XA 3H9SE 2W38A 4FXGC 1OCOB 4M7ZC 4F8TA 5E08L 1UXSA 5FDWB 2YEZB 3MV7D 3VXPB 2COQA 5DD5L 4IHOA 4QT5A 5CKAA 5J12B 2R2EA 2X1XR 5CILL 3L9YA 3MRIB 1OK0A 1P7QA 1ZEAH 5EZOH 2UYLB 4QXGL 4G5ZL 4OGYH 3SE8L 4F3FB 5EEWA 4GQRA 2QFRA 5DUBA 4R4NC 5IVXB 1FL6A 2Z35A 3A21A 1ZSDB 3KPPB 5E23A 4KDTA 4NYLB 5EOQH 2C4FU 1H0DA 1ZK5A 5DQ9A 4TS6A 2Y5QA 1CFQA 3A67L 4A66A 2IAMB 4KUCF 3LZOA 4K23H 3ARFC 4QRUB 5D7IE 2IALA 2F0CA 4TKWA 3NPSC 3FUJA 3PWJB 2R56H 3BYTA 4UYQA 5BW7A 5DJ2A 3QRBA 2Y7SA 3IS0X 4NKMA 2EE9A 5C07B 1T83A 2VQ4A 1CGSL 5KANG 1EJFA 5GGQL 3ZYOA 2VLRA 1ZHBA 2NR6A 3GD1C 5IY5B 1NPJA 2Z1KA 4NQCE 5FGCB 1V8HA 4NNYB 2P43B 1X7TA 2W92A 3NCCB 1HK6A 2GJ6E 1I1YA 4MNQD 4K9EH 2ICES 4P05A 1CI3M 5IB2A 2XVKA 4S1DC 4XCEB 4HCRH 3H9ZA 2AANA 5BPPA 1B4JL 3LPOA 4LVHB 2WJ5A 4WW2B 2WPGA 4XAWH 3EO9L 2V2WA 1UD3A 3VCLB 3W11D 3MRBB 3O3AB 3P4OB 4W9KC 2WB1A 3K72A 2BY2A 5MERB 4PV9A 1DFBL 1UWEL 1INQA 2V3DA 5D6DC 1AZCA 1YEEL 1NCTA 2VW6A 4HT1H 3AFLA 4G8AC 3BUDA 5JOFB 2BIHA 1FZKA 2WM0A 4FQQB 4XPBH 5C8JB 5TGBB 4XMPL 3LS4H 3TFKD 4DKAA 2CD0A 2IAMC 4M5YH 4A63A 4MNHA 4G72B 1U8JA 3AREB 2YLHA 5I1KL 1QQDA 1QSFE 4PJ5E 4Y7OC 2C3WA 4G8IA 1FGNH 1BX2A 4FG4A 1ONQA 3HZ3A 3T0VA 1I7TA 3JYCA 5T1KB 1QBLL 4N2OA 1T5XA 4D8OA 4GSQA 4F2ME 1JOIA 5EZIH 4B9KC 1HH6B 5DWUL 3CFBB 1E9OB 4K8RL 4P48A 1KCUL 1J0IA 1KPVA 1YJDL 3K6SB 4NLHA 4NDMA 1BVLA 4XC1H 4TSCL 3VXPA 5C0DA 5HYSB 3D0AA 4PSPA 3MLRL 1RPKA 5EU5B 1FFPA 4GUCA 1KDIA 3BVDB 4TV3A 5I76B 1UKQA 4LVHC 4WW2C 3DVNB 2VDKL 1H6EA 5DSCB 2QHRH 5D6DA 3SDAB 3HAEA 1WIOA 4JLRA 3PFUA 3VE0A 4JQIL 4Q97A 2X1QA 1J18A 1OGTA 1KNOB 2IOIA 1L4IA 3FYIB 3LKQA 4O4YH 3WDIA 1U92A 2X4SB 3FQUA 3GWJA 1WVZA 3H9SB 4FNLH 4N0FB 4PRIA 5E1AB 4KXAA 2A9MH 3QPKA 3MUZ1 1P4IH 1FSKB 5AWNH 4R7VA 5AEAA 4QRUA 1OTTC 4PFEA 4DF9A 4HS8H 2ADJB 4LXFA 2IXQA 4UDUA 1UKSA 3AREC 3UTTE 1FNGB 5BV7B 2FEDC 5C9JB 2VRAA 2BSSB 4LMQI 3HBZA 3L4VA 2TRYA 3L3HA 3S6CA 1JTTA 4LGSB 1V3LA 1MI5A 4U33A 4FFWD 4B5EA 1C5CH 4YN3A 1NGYB 3ML8A 1ZHNB 3C08H 2Q86B 5IEKB 4BZ1L 1A7NL 2ZT9C 3QP3A 1CICD 2CK0H 1X5AA 5I23A 4WW2A 2VH5H 1B9KA 4PIRF 3UERA 4K9EC 3MACH 1JXGA 1AIFB 4HWZA 3RUGA 3QZWB 4NQCB 3PWLB 2XWBB 4NN6B 3SDAC 3TEYA 2GJ6B 3WXVH 5IWLC 3AROA 1I3RA 5D2LF 1BF2A 1KTKE 3ARQA 4MAUH 1MNNA 3IU4H 4NO2A 4YXLH 5E5RB 3UROR 4HIIA 4Z7QF 3TXAA 1K4DA 1S7UA 2ZCLL 1L9PA 4P4KD 1HCVA 4J6RH 4E42B 3KM1A 2VDPL 4AQAB 5E2UL 1Z9SB 1S9XB 4NQDE 1UA7A 2VDLL 3AREA 3KYNA 4LEEA 2F5BL 4WFED 5B39G 1FE8H 1UXWB 3B1UA 3SPVB 1KLFA 3ZSTA 1BWWA 2J8UE 2VR8A 3SPCA 4BWTA 1IVTA 5BV7C 2WUCH 3S3DB 4PYHA 5T1KA 1KTJA 1U3ZA 3KVQA 3CQPA 4O2EA 5CAYB 2OK0L 1J48A 2DS4A 4G6AD 3WKYA 3CFBA 5HYEA 3QFJD 1AZBA 3FT3A 4ZFGL 2YPLA 1OGAE 2GIXA 1NFDF 4F7TB 2GITA 2MQCA 3FB6A 3K6SA 4OD2A 4YBHA 4BZ2L 1QSFB 4BM7A 3UYRL 1RULL 3BDYH 3BZEB 1HQ4B 3GMLB 3QHZH 2QDWA 3GB7B 3WS3A 5KYXA 2VXVL 1YEHH 4F2MB 4NM8H 3DVNA 4JM2A 4HCRA 3SDAA 4GXUM 3ZMRA 5DMGD 5IWLA 2AW2A 4NN6C 2BK8A 5DYFA 1AFVH 1KNOA 3B7TA 4GAYA 4S0SD 2V5SA 1ITCA 2K9FB 3FRPG 1XB3A 3WHE0 3Q2WA 5DMKB 3EYOB 5GSRB 2I7OA 3AMKA 3CDCA 4L1DA 2FJFA 4LSQL 1NCDH 2FJSA 1WFTA 4LVEA 1Q1JL 2J8UF 3BKYL 3PGFH 4DUWA 4AC4A 4OIAA 4WWKB 1NGZB 3HE7C 1OL0A 4XP9H 1ASPA 1SXSA 4AV5A 1G4MA 2HN7A 3SD2A 2MCPL 1AQHA 2K7QA 5C9JA 1U36A 1E2ZA 3WTTA 3ZL2A 4N0UA 4XMXA 2IDQA 3ARBD 1UQSB 5AUMA 3SYQA 4EDWH 4XGZB 5I26A 1WRFA 1Q9OB 1S3KH 1WP6A 2AJXL 1LO2H 3RDJA 5GGRY 4WGKA 2RALA 3TONA 2IANE 1JAEA 1XH0A 3ECWA 4FQLH 3V79C 2I5YH 1SHSA 1DBKL 4PYGA 1DN0A 1RJZB 4LP4A