1DTGA

Human transferrin n-lobe mutant h249e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
331
structure length
331
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSETVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFERRIN
publication title Mutation of the iron ligand His 249 to Glu in the N-lobe of human transferrin abolishes the dilysine "trigger" but does not significantly affect iron release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 106
structure length 331
sequence length 331
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1dtgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1dtgA02
3MZ9A 4LP2B 4IO5A 3K01A 2UYFA 4H65A 4ZZEA 3M3LA 3QK6A 4FEBA 3TEPA 1MH3A 1LFHA 3K1NA 3O6HA 2D3IA 2VOZA 1MH4A 2GFEA 2O7IA 4PP0A 4XIGQ 3PD8A 3N6UA 1UTBA 3OEKA 1JETA 5ICTA 4F1VA 3SEXA 1M5FA 5H8NA 1JNFA 3PPOA 4YB7A 3RTWB 1LB9A 4LONB 4BDRA 3THIA 2XXIA 3KEIA 4ESXA 2RCBA 1MPDA 3OO9A 1UIUA 1OLAA 2RINA 5EHMA 1IQ7A 5DTBA 3TODA 4NWDA 3K6XA 3WAEA 5F1QA 5B70A 2DVCA 3ZKLA 1N3XA 4YAHX 5KCJB 1O7TA 3C4MA 3IO6A 1Y3NA 2W7YA 3T22A 3OSRA 5H8FB 3FJMA 4GLIA 3QAXA 2REGA 1OVTA 3A09A 4GOTA 3SEYA 4NF5A 3G3GA 4U22A 4AQ4A 3QUFA 1BIYA 2Z8DA 4U23A 3Q29A 2XXHA 4RNSA 1N84A 4GL0A 1DSNA 3DM0A 4ZDMA 3PU5A 5J1DA 2X7QA 3K6UA 1OQGA 2F97A 3QUJA 1VSOA 1B3EA 1B3GA 4F39A 5ISUA 2PT1A 3IK6B 1IITA 2XD2A 5TPAB 2LAOA 5I84A 3L6HA 2I48A 4PFTA 2E0SA 1Y9UA 5H8SA 1Y1MA 1URGA 4OHNA 1FTMA 1MY1A 2OK2A 1FTKA 1LAGE 5DVJA 1R1NA 1OVBA 2QRYA 2FYIA 1B46A 1Y20A 3G3IA 5I57A 3RNNA 1AH5A 4Z0IA 3O6IA 3K1MA 3PPPA 3O28A 4G77A 1T0KA 4H8JA 1LBCA 2R6GE 5BUUA 3HCQA 3U93A 2DE2A 1B52A 3FVOA 2Y7WA 1B3LA 1GV8A 2Z8FA 3R7XA 5DVFA 4K3FA 4H1XA 1GVCA 2DXRA 3OOAA 4GF8A 5FTHA 3RT8A 2O1LA 5AE4A 3O2AA 1A99A 4F1UA 4F1YA 1LFIA 4I1DA 3VE1B 1N7WA 2I49A 4H6DA 1OMPA 3GLBA 3V83A 4EQBA 3JZJA 2PMSA 3FGSA 4TQUQ 4ZEDA 5KDTA 1B7UA 4OFOA 4PETA 2DWAA 3EF7A 1UIVA 1IXGA 1XT8A 5CMMA 4G8MA 3IR1A 3ONMA 5KZTA 1MPBA 3HO7A 4F31B 3T66A 4F3PA 2GHAA 4QSCA 2F7CA 1D3KA 5H8HB 4UACA 3TYHA 1WDNA 4MBPA 4JWXA 2V84A 4FEDA 3USDA 3RTFB 3FV1A 2UVIA 4RPOA 5K2YA 1WODA 3K4UA 3BFUA 4YB5A 4KPTA 4OMBA 4OXVA 1Q1KA 4LZ7A 2ALUA 3T9HB 3FXUA 2HZLA 5ELVA 3OENA 1XVYA 2R71A 4XKNA 3TTRA 1L5TA 3TELA 5CC2A 3DP4A 3IOWA 1B2HA 3R6UA 1PBPA 3JV9A 1UTBB 2G29A 2P2AA 4JWYA 2DSFA 3GZGA 3DP6A 1HSJA 1FTJA 3OMBA 4IO7A 1NNPA 5H8NB 4R72A 1B4ZA 4QFPA 4EF2A 3LBSA 2ONSA 1VFDA 2XXUA 3MWBA 4ZEFA 4IY5A 2Q89A 2XX8A 2I0BA 3KZGA 3TTMA 4EUOA 1MY2A 4F3SA 2V3QA 1Y3PA 4BDQA 3MP6A 4BLAA 1M5DA 2Q2CA 4NEDA 2OJTA 2QPQA 4MLVA 4NE4A 1A40A 4DCXA 1B40A 3LR1A 2Y7IA 2THIA 3MQ9A 1SI1A 1NH7A 4YKKA 1H3DA 1QVSA 4F3BA 2O69A 2ABHA 3IO4A 3A3UA 1POTA 2F5XA 3C35A 1B0LA 1YPNA 2F36A 3K02A 4LVQA 1B1XA 3K00A 2RC9A 2XD3A 2HAUA 4C1TA 5I2NB 4LQ2A 3LC8A 1URSA 1URDA 3M8UA 3M3FA 2IEEA 2VGQA 3UGWA 3CFZA 2ZYMA 3FVNA 5ITPA 4PFWA 4F29A 1IUDA 2Y7PA 3G3JA 2I4CA 1BTJA 1WVJA 1JEUA 2OBGA 4P0GA 3OXNA 1MXYA 3TDJA 5AA2A 3MVZA 5CMBA 4R9FA 4JSDA 5I57B 2B65A 3DLNA 3O6GA 1ZBMA 4QF9A 3B6WA 4IO3A 2P0SA 5FTIA 1JW5A 4X9TA 4DXCA 3E3KA 3U94A 3VVFA 4H5FA 4Q8RA 3E13X 1SDXA 1ELJA 4KHZE 1LSTA 3OSQA 5CM6A 3UN6A 3VLVA 1NH8A 4R6HA 2DWHA 3OD7A 2H99A 4RA1A 1MQGA 3TTLA 4Z7EA 3RGYA 1XS5A 4KCCA 4G8NA 1HSEA 1QUKA 5L9SA 3TUSA 2XXXA 5CBSA 3HHFA 4I8CA 3PUZE 1SVXB 5CMKA 2NOOA 4BDLA 2Y7KA 3TQLA 5M2VA 1S7YA 3V8XB 3FZVA 1MDP1 3MVXA 3TTNA 2DS9A 4I9DA 4RPNA 3PMWA 1N0TA 3MW0A 5AA4A 2DQVA 3ILTB 5KDTB 1FTOA 2O51A 1BKAA 3CR9A 4OWDA 4F22A 1OQHA 4KYEA 1PEBA 5HPQA 1B0HA 1DTGA 4EF1A 4HCWA 3CRBA 3RY3A 5EYFA 1D9VA 1MQJA 4YKIA 3TMGA 4OTEA 2FA7A 4MLQA 1SYHA 1TWYA 3FVKA 5TP9A 4FECA 3AXFA 3HSTA 1LB8A 5FHOA 4UA8A 4F18A 3IX1A 1PBQA 1QW0A 1VE4A 4MF3A 3PUVE 2I6EA 2O68A 1P1WA 1YAEA 4HCYA 2OWTA 2H9BA 3C32A 3KOSA 3PMXA 2PYYA 1A55A 3HN0A 2XX9A 4R73A 1FQBA 4H67A 5DT6A 4NTLA 2XX7A 3OO8A 3G3FA 3B6QA 1MG1A 3SEWA 4KQPA 3IOTA 2YLNA 3KOTA 4LA9A 1AIVA 3TTKA 2NWJA 3JYRA 3S2VA 1P1OA 1PC3A 5JEIA 3N6TA 2F6GA 3VFJA 2PT2A 3N5LA 1B9JA 1QUJA 4E0WA 3O9PA 1HSLA 1ZKBA 3IAZA 1P1NA 4ZE9A 2Z22A 1VR5A 1JVXA 4G68C 3O66A 1LAFE 1B3FA 1BP5A 5JTYA 3TCGA 1ZJLA 2AL4A 3U1OA 3RN8A 3FJGA 3FXRA 1B6HA 4OFLA 2QMWA 1BLFA 4QHQA 3SESA 4OQOA 5I56A 3N26A 3CSBA 1USYE 4R2FA 5I2NA 1ZIUA 2V3TA 3SDFA 4R2BA 2PVUA 3K2DA 1FQFA 3IOUA 4QFOA 1NNFA 4NF4A 2XXRA 3VV5A 3FUZA 1Z7ME 4FE8A 3C34A 4TOZA 4QSDA 1PB9A 2VD2A 4PFYA 4F2QA 2OZZA 2ZXTA 3GBBA 3FATA 1N7XA 2RF1A 4RJZA 2UVJA 4YZZA 4THIA 4FATA 3H6WA 1B32A 1US4A 3S9NC 5AA2B 3SKPA 3SEUA 3ZSFA 2XXQA 3A3CA 4X1DA 1D9YA 3F11A 2YJPA 3TPAA 1R9LA 3IOVA 4ZEKA 3C36A 2F6PA 4R75A 4IO4A 1H44A 4WEPA 2CZLA 3O29A 3VVEA 2DWJA 2Q88A 2GH9A 5EHSA 1TFAA 2F8DA 2ZYOA 4OFJA 1SD3A 2RC8A 4DXBA 1P99A 3TFLA 3D4CA 4H5GA 2AYSA 3L6GA 5AA1A 1B3HA 1UQWA 4KI0E 4P11A 1H76A 4XTCQ 1MQDA 2HEUA 3ILUB 2B3BA 5I58B 2DP8A 1FQCA 3MJNA 4JXIA 3LUYA 4NF6B 4IGTA 1Y4CA 5CMCA 3P7IA 1JQFA 4OYVA 1H45A 1ZLQA 1XVXA 1ANFA 3H6TA 3IORA 5AA4B 3S9LC 3FIRA 2HXWA 1MXZA 2I0CA 3FD3A 2XXPA 2XHDA 3G3KA 4TLLB 1XHYA 2Q9TA 4JBZA 1Z7NE 1EZOA 3MPLA 3B6TA 5TP9B 2HFBA 1LAXA 4YKPA 1PB7A 3KN3A 3UA8A 2V3UA 1OLCA 3MP1A 3PV0E 3H7MA 1M5CA 4KYSA 2QJEA 3RUMA 2D21A 3EHSA 2HAVA 4POXA 1IXIA 4GD5A 3PGFA 1IEJA 4EXLA 1R6ZA 4X48A 3CSGA 1QKBA 2GHBA 3U72A 4QSEA 1F9BA 4OERA 3VDFA 1PDAA 4U2RA 2Z23A 1QULA 1QKAA 3MBPA 1QUIA 2R9JA 3H06B 3OEMA 1M5BA 5DEXA 5TU0A 4R9GA 5JTYB 1FQAA 1POY1 2F7BA 3EHTA 4IGRA 1I6AA 2BJJX 1UTHA 3SEVA 3CVGA 4BDMA 2G93A 4JB7A 2H4IA 4O3AA 1IZ1A 4G4PA 4O3CA 5I56B 1MY4A 3EQ1A 4GWOA 1EH3A 1SYIA 3FV2A 1GTKA 4C1UA 1QJMA 1B05A 4NF4B 4R6YA 2I3WA 1SW2A 1EZPA 3HV1A 4WKMA 4GL8A 1Y4TA 4ZEIA 2Y7RA 3FVGA 4N07A 1US5A 4U21A 3H6UA 3I3VA 1J1NA 1SBPA 2I58A 3K6VA 3O97A 3MPKA 3MP8A 2AL5A 4F2OA 3OO7A 3KBRA 3KJ7A 4DCYA 3TCHA 2D5WA 1MQHA 2VHAA 3U8QA 1MXUA 5I2KA 4Q30B 1SW1A 3LSXA 3MZ1A 4Q0CA 4O3BA 3UP9A 2X7PA 1JW1A 4KFQA 4ONYA 1RYOA 4IO2A 4WEDA 2YPNA 1CE2A 1FQDA 3KFMA 3VXCA 1B5HA 3LSWA 2QSXA 5I58A 1MXVA 3VLUA 2AIXA 3KJTA 1MS7A 2REJA 2UVHA 2KLFA 4G8HA 4NF6A 3B7DA 1NNTA 4DLDA 4FIMA 2Z8EA 4IY6A 1B7HA 4OENA 4ELPA 2V93A 4EXKA 4YICA 3MC2A 4EDPA 3PMVA 5CRYA 3CFLA 3C9HA 1ZMGA 1SW4A 2OWSA 4XKQA 4KYDA 2B3FA 4R74A 4JWOA 2Q8JA 1S9TA 5JK4A 1AL3A 4OEVA 3Q25A 4RYAA 4LZ5A 2WKYA 5H8QA 5AA2D 1MRPA 2ESNA 4N6PA 2NUVA 2M8CA 5L9OA 1A7LA 4QFKA 2Q2AA 3TZAA 2DWIA 2F78A 5L8DA 1OIBA 1DOTA 3S9EA 3MUQA 4JSOA 3G7WA 2O7UA 2RCAA 2P1SA 1LFGA 4L17A 2RKMA 1JVYA 1NKXA 4NWCA 4NF8A 2XXVA 1DMBA 3BBRA 3CIJA 4N13A 2QS3A 1S50A 5I59B 3S9MC 4U1OA 4ZECA 4LZ8A 3S4UA 3KSXA 4KD5A 2DVZA 2ZMBA 4YB6A 2O1MA 3IL1B 3EN3A 2O6AA 4G68A 4ELQA 1ZTYA 4KCDA 2ZYKA 3CG1A 3I6VA 4M1VA 3LSFB 4BDOA 3VLWA 4YKJA 3U92A 1LAHE 2HZKA 3IB1A 4U4SA 4ISUA 5BWJA 2XXWA 2PBWA 3R26A 2X26A 4QFNA 5A5XA 3QYTA 3MVYA 3KSJA 3MAMA 4ND9A 1IXHA 4HW8A 3T93B 3IB2A 3QXMA 4RY1A 4Q5TA 4RXLA 5DEXB 3N94A 1SW5A 1XC1A 4U1ZA 1B5IA 1N76A 1MDQA 4GXAA 2DE4A 3H4ZA 4I62A 2F35A 1A8FA 1MQIA 5F7VA 2QS1A 1UTHB 4X1BA 2H98A 1MPCA 2NXOA 3PPNA 1FW0A 1MY3A 3UK4A 1GR2A 1JEVA 4GVOA 4XKRA 1XOCA 4H8IA 1D4NA 1Q35A 5CI5A 3H6VA 4H0WA 1MY0A 1VFEA 4OZ9A 2A5TA 1H43A 3PUYE 4RK9A 3RLFE 1B5JA 4KR5A 1AOVA 2QS2A 4OVJA 4FAJA 1PB8A 2F7AA 2HCAA 3HPIA 5ICQA 4DIGA 4MH5A 1LGBC 4ECFA 5DYHA 4PE5B 2H25A 4ZE8A 1EZ9A 1RKMA 1CB6A 5I2KB 3RPWA 3ZKKA 4POWA 3CFXA 3D4GA 1YCJA 3T9VA 3TQWA 4XKPA 3W15C 3KN7A 2ONRA 4GIZA 2RC7A 4QRZA 3Q27A 3W9WA 4LUBA 4IO6A 1ATGA 3UORA 4DXUA 3VXBA 1SQYA 1LBBA 1P1UA 1DPEA 3QIMA 1B1HA 3K1PA 4JDFA 1B7ZA 3TAJA 3T9XB 1LCFA 1M5EA 2PX1A 1O64A 4FORA 3LSLA 5K2XA 1LCTA 2QS4A 2A5SA 2F34A 4ZZAA 4OESA 3KGCA 1I6QA 3K6WA 5FHMA 4YMBA 3ECRA 3IJXB 1DTZA 2ZNSA 3Q28A 3SERA 2CMOA 5CBRA 4HS7A 2ANJA 1MXWA 4EQ7A 4U4XA 1FCKA 1R9QA 3EHUA 1N3WA 4PQJA 3T96B 1EU8A 1NMUA 1IXCA 2OCUA 3TKDA 4HTGA 1TT1A 3I5OA 4C0RA 1TFDA 3SETA 4YU0A 3RT6B 5H8QB 4QFLA 1JW4A 4E0XA 2I3VA 4M4GA 1O63A 5HM4B 5DVIA 3E9XA 2VP1A 5I59A 3UIFA 3MVWA 3ZS6A 3DELB 4NMYA 2QMXA 3PPQA 4NF8B 2UXAA 1IIWA 2IA4A 1N04A 1FTLA 4BDNA 2QL3A 3OO6A 1NNKA 3FJ7A 1P1QA 3PD9A 3M3KA 2XXTA 3GBAA 1Y3QA 5B7DA 4R6KA 3TCFA 4DZ1A 4G68B 1A54A 1B51A 3E4RA 3IB0A 3K0VA 1I6BA 1FQEA 1I69A 3GXAA 3MZBA 3CG3A 2HQ0A 2DOJA 2ONKE 5KCJA 4GQOA 1KWHA 1MM6A 3H03A 3Q26A 5H8FA 2V25A 2DXYA 1ZU0A 2OLBA 2FNCA 5A5XB 2XXYA 4GXSB 4LATA 4F3GA 3RQTA 4PFUA 4ELOA 4AB6A 3FXQA 1A8EA 1II5A 5FHNA 5L9MA 3V89B 4G2ZA 1B4HA 1TXFA 3QSLA 4OEUA 4P0IA 1MM7A 4NF5B 5IAIA 4OETA 2ZNUA 4GRKA 4ESWA 5TPAA 4TLMB 4FJPA 2UVGA 4ZS9A 1DPPA 3H3GA 1B58A 1MXXA 2ZNTA 3VVDA 4XXUA 4YMAA 1AMFA 2I4BA 3C33A 4ZEBA 2A5TB 3BKIB 2DYXA 3PUXE 4LQ5A 5AA3A 4EQ9A 4GFRA 4RK2A 2VD3A 3BFTA 3HHGA 2E1SA 3KN8A 3FASA 5ITOA 3CI8A 3WAFA 5LOMA 3IJOB 4DE8A 3T9UA 2Y84A 3EPEA 4DDDA 3W9VA 1NL5A 1Y1ZA 2GRVA 3ODBA 2ZYNA 1SI0A 2H5YA 1LLSA 1GGGA 1YTVA 2O84X 4AB5A 3OELA 2UYEA 3DP8A 3KG2A 3PUWE 3PPRA 4IB2A 4WXJA 4MFIA 5IKBA 3C31A 3V5AA 2DE3A 5H8HA 1NFTA 3G3HA 5HBCA 1USYH 4ELRA 2NVUB 4F19A 1RYXA
chains in the Genus database with same CATH superfamily
3MZ9A 4PDHA 4LP2B 1LBXA 4IO5A 3FXBA 3K01A 2UYFA 4H65A 4ZZEA 3M3LA 3QK6A 4FEBA 3TEPA 2FHYA 1MH3A 4GX6A 1G0HA 1LFHA 3K1NA 3IFCA 3O6HA 5LDZA 2D3IA 2VOZA 1MH4A 2GFEA 4HXVA 2O7IA 4PP0A 4XIGQ 3PD8A 3N6UA 1UTBA 3OEKA 1JETA 5ICTA 4F1VA 3SEXA 3GYYA 4UABA 1FTAA 1M5FA 5H8NA 1JNFA 3KBZA 3PPOA 4YB7A 3RTWB 1LB9A 4LONB 4BDRA 3THIA 2XXIA 4NAPA 1LEVA 3KEIA 4ESXA 2RCBA 1MPDA 3MYUA 3OO9A 1KA1A 1UIUA 4N6DA 1OLAA 2RINA 4GWZA 1IQ7A 5EHMA 5DTBA 3TODA 5ET8A 4NWDA 3K6XA 3WAEA 5F1QA 5B70A 4O7IA 2DVCA 3T0JA 3ZKLA 1N3XA 4YAHX 5KCJB 1O7TA 3C4MA 3IO6A 1Y3NA 2W7YA 3T22A 3OSRA 5H8FB 3FJMA 4XFEA 4GLIA 3QAXA 2REGA 1OVTA 3A09A 4GOTA 3SEYA 4NF5A 3G3GA 4U22A 4AQ4A 2L5VA 3QUFA 1BIYA 2Z8DA 4U23A 3Q29A 2XXHA 4RNSA 1N84A 4GL0A 1DSNA 3DM0A 4ZDMA 3PU5A 5J1DA 4MX6A 1LBVA 2X7QA 3K6UA 1OQGA 2F97A 3QUJA 1VSOA 1B3EA 1B3GA 4F39A 5ISUA 2PT1A 3IK6B 1IITA 2XD2A 5TPAB 2LAOA 4GWSA 5I84A 3L6HA 2I48A 4PFTA 2E0SA 1Y9UA 5H8SA 1Y1MA 1URGA 4OHNA 1FTMA 1MY1A 2OK2A 4XEQA 1FTKA 1LAGE 5DVJA 1R1NA 1OVBA 2QRYA 2FYIA 1B46A 1Y20A 3G3IA 5I57A 3RNNA 1AH5A 4Z0IA 3O6IA 5IZ3B 3K1MA 3A29A 3PPPA 3O28A 4G77A 1T0KA 4H8JA 1LBCA 2R6GE 5BUUA 1NV2A 3HCQA 3U93A 2DE2A 2VPNA 1B52A 3FVOA 2Y7WA 1B3LA 1GV8A 2Z8FA 3R7XA 5DVFA 5F24A 4K3FA 4H1XA 1GVCA 2DXRA 3OOAA 4GF8A 5FTHA 3RT8A 2O1LA 5AE4A 3O2AA 1A99A 4F1UA 4P56A 4N4UA 4F1YA 1LFIA 4I1DA 5EQ8A 3VE1B 1N7WA 2I49A 4H6DA 4PAFA 1OMPA 3GLBA 3V83A 4P9KA 4EQBA 1CNQA 3JZJA 2PMSA 3FGSA 4TQUQ 4ZEDA 5KDTA 1B7UA 4OFOA 4PETA 2DWAA 3EF7A 1UIVA 5FBPA 1IXGA 1XT8A 5CMMA 4G8MA 5EYHA 3IR1A 3ONMA 5KZTA 1MPBA 3HO7A 4F31B 3T66A 4F3PA 2GHAA 4QSCA 5ET6A 2F7CA 4PBHA 1D3KA 5H8HB 4UACA 4JVDA 3U65A 3TYHA 1WDNA 2PFZA 4MBPA 4JWXA 2V84A 4FEDA 2DDKA 3USDA 3RTFB 3FV1A 2FVZA 2UVIA 4RPOA 5K2YA 3D1RA 1WODA 3K4UA 3BFUA 4YB5A 4KPTA 4OMBA 4OXVA 1Q1KA 2WYKA 4LZ7A 2ALUA 4O8MA 3T9HB 3FXUA 4MEVA 2HZLA 5ELVA 3OENA 4OVTA 1XVYA 2R71A 4XKNA 3TTRA 1L5TA 3TELA 2P3NA 5CC2A 3DP4A 3IOWA 1B2HA 3R6UA 1PBPA 3JV9A 3RPLA 2XWVA 1UTBB 3FBPA 2G29A 2P2AA 4JWYA 2DSFA 3GZGA 3DP6A 1HSJA 1FTJA 3OMBA 4IO7A 1NNPA 5H8NB 4R72A 1B4ZA 4QFPA 4EF2A 3LBSA 2ONSA 1VFDA 2XXUA 1FPBA 3MWBA 1RDYA 4ZEFA 4IY5A 2Q89A 2XX8A 2I0BA 3KZGA 3TTMA 4EUOA 1MY2A 4F3SA 2V3QA 1Y3PA 4GBWA 4BDQA 1FJ6A 3MP6A 4MCOA 4BLAA 1YYZA 1M5DA 2Q2CA 4NEDA 2OJTA 2QPQA 4MLVA 4NE4A 1A40A 3CHGA 4DCXA 1B40A 3LR1A 2Y7IA 2THIA 3MQ9A 1SI1A 1FBHA 1NH7A 4YKKA 4I3EA 1H3DA 1QVSA 4F3BA 2O69A 2ABHA 3IO4A 3A3UA 1POTA 4PAKA 2F5XA 3C35A 1B0LA 1YPNA 2F36A 3K02A 4LVQA 4X8RA 1B1XA 3K00A 1KZ8A 1DBZA 2RC9A 2XD3A 2HAUA 4C1TA 5I2NB 4LQ2A 3LC8A 1FPKA 1URSA 1URDA 3M8UA 4GWUA 3M3FA 2IEEA 2VGQA 4PGPA 3UGWA 3CFZA 1NI9A 2ZYMA 3FVNA 5ITPA 3SZPA 4PFWA 4F29A 1IUDA 5J16A 2Y7PA 3G3JA 2I4CA 2KQZA 1BTJA 3NOHA 1WVJA 1JEUA 2OBGA 4P0GA 3OXNA 1MXYA 5IZ3A 1Q9DA 3TDJA 5AA2A 5T3JA 1NV5A 3MVZA 5CMBA 5I3SA 4R9FA 4JSDA 5I57B 2B65A 3DLNA 3O6GA 1ZBMA 4QF9A 3B6WA 4IO3A 2P0SA 5FTIA 1JW5A 4X9TA 4DXCA 3E3KA 3U94A 3VVFA 4H5FA 4Q8RA 3E13X 1SDXA 1ELJA 4KHZE 1LSTA 3OSQA 5CM6A 3UN6A 3VLVA 1NV4A 1YXIA 1NH8A 4R6HA 2DWHA 3OD7A 2H99A 4RA1A 1MQGA 3TTLA 4Z7EA 2WEFA 3RGYA 1XS5A 4KCCA 4G8NA 1HSEA 1FBDA 1QUKA 1D9QA 5L9SA 3TUSA 2XXXA 5CBSA 2XXKA 3HHFA 4I8CA 3PUZE 1SVXB 5CMKA 2NOOA 4BDLA 2Y7KA 3TQLA 4QXDA 5M2VA 1S7YA 3V8XB 3FZVA 1K9YA 1MDP1 3MVXA 3TTNA 1NV3A 2DS9A 4I9DA 4RPNA 3PMWA 1N0TA 1NV0A 3MW0A 5AA4A 4NN3A 2DQVA 3ILTB 1FJ9A 1FTOA 5KDTB 2O51A 1BKAA 3CR9A 4OWDA 4F22A 1OQHA 1FPDA 4KYEA 1PEBA 4N8GA 5HPQA 1B0HA 1DTGA 1NUZA 4DI4B 4EF1A 2ZZXA 4HCWA 3CRBA 3RY3A 4GBVA 5EYFA 1FPJA 2B4LA 1D9VA 3RYDA 1MQJA 4YKIA 3TMGA 4OTEA 2HPGA 2FA7A 4MLQA 1SYHA 1TWYA 3FVKA 5TP9A 1IMFA 4FECA 3AXFA 3B8BA 4NX1A 3HSTA 3BIGA 1LB8A 5FHOA 4UA8A 4F18A 3IX1A 1K9ZA 2CEXA 1PBQA 1QW0A 2F3BA 1VE4A 4MF3A 3PUVE 2I6EA 2O68A 1P1WA 1YAEA 4HCYA 1G0IA 2OWTA 2H9BA 3C32A 3KOSA 3PMXA 2PYYA 1A55A 3HN0A 2XX9A 4R73A 1FQBA 4H67A 5DT6A 3RPLB 4NTLA 2XX7A 3OO8A 3G3FA 3B6QA 1MG1A 4H46A 3SEWA 4KQPA 4P1LA 3IOTA 2YLNA 3KOTA 4LA9A 1AIVA 3TTKA 2NWJA 3JYRA 3E79A 3S2VA 1P1OA 4OVQA 1PC3A 5JEIA 4P1EA 3N6TA 2F6GA 3VFJA 2PT2A 3N5LA 2PCRA 1B9JA 1QUJA 4E0WA 3O9PA 1HSLA 1ZKBA 3IAZA 1P1NA 4ZE9A 2Z22A 1VR5A 1JVXA 4G68C 3O66A 1LAFE 1B3FA 1BP5A 5JTYA 5EQAA 1FPLA 3TCGA 1ZJLA 2AL4A 4PGNA 3U1OA 3RN8A 3FJGA 3FXRA 1B6HA 4OFLA 2QMWA 1BLFA 4QHQA 3SESA 4OQOA 4PAIA 4OANA 5I56A 3N26A 3CSBA 1USYE 4R2FA 1NV6A 5I2NA 1ZIUA 1YZ0A 2V3TA 3SDFA 4R2BA 5IM2A 2PVUA 3K2DA 1FQFA 3IOUA 4QFOA 2V4CA 1NNFA 4NF4A 4MIJA 2XXRA 3VV5A 3FUZA 1Z7ME 4FE8A 3C34A 4TOZA 4QSDA 1FBPA 1PB9A 2HHMA 2VD2A 4PFYA 4F2QA 2OZZA 2ZXTA 3GBBA 3FATA 2FIXA 2WX9A 4MNCA 1N7XA 2RF1A 4RJZA 4OVSA 2UVJA 4YZZA 4THIA 4FATA 3H6WA 1B32A 1US4A 4KXPA 3S9NC 5AA2B 3SKPA 3SEUA 3ZSFA 4FBPA 2XXQA 3A3CA 4X1DA 1D9YA 3F11A 2YJPA 3TPAA 1R9LA 3IOVA 4ZEKA 4MMPA 3C36A 2F6PA 4HE1A 4R75A 4XF5A 4IO4A 4P3LA 1H44A 4WEPA 2CZLA 3O29A 2CEYA 3VVEA 2DWJA 2Q88A 1LBWA 2GH9A 5EHSA 1TFAA 2F8DA 2ZYOA 4OFJA 1SD3A 2RC8A 1IMDA 4DXBA 1P99A 3TFLA 3D4CA 4H5GA 2AYSA 3L6GA 5AA1A 1B3HA 1UQWA 4KI0E 4P11A 1H76A 4XTCQ 1MQDA 2HEUA 4N91A 3ILUB 2B3BA 3ISPA 5I58B 2DP8A 1FQCA 3MJNA 2QVUA 2XWKA 4JVCA 4JXIA 3LUYA 4NF6B 1FPFA 4IGTA 1Y4CA 5CMCA 3P7IA 1JQFA 4OYVA 1H45A 1ZLQA 1XVXA 1ANFA 3H6TA 3IORA 5AA4B 3S9LC 1BK4A 4N17A 3FIRA 2HXWA 1MXZA 2I0CA 3FD3A 4PDDA 2XXPA 4NG7A 2XHDA 3G3KA 4TLLB 1XHYA 3QMFA 5IZ1A 2Q9TA 4JBZA 1Z7NE 1EZOA 3MPLA 3B6TA 5TP9B 2HFBA 1LAXA 4PE3A 4YKPA 1PB7A 3EKIA 3KN3A 3UA8A 2V3UA 1OLCA 3MP1A 3PV0E 3H7MA 4GWWA 1M5CA 4KYSA 1RDZA 2QJEA 3RUMA 4P47A 2D21A 3EHSA 2HAVA 1IMCA 4POXA 1IXIA 4N8YA 2WBBA 4GD5A 3PGFA 4PBQA 1IEJA 4EXLA 1R6ZA 4X48A 3CSGA 1QKBA 2GHBA 3U72A 4QSEA 4QBAA 1F9BA 4OERA 3VDFA 1PDAA 4U2RA 2Z23A 1QULA 1QKAA 3MBPA 1INPA 1QUIA 2R9JA 3H06B 3OEMA 1M5BA 1LBZA 4H45A 5DEXA 5TU0A 4R9GA 5JTYB 2JJKA 1FQAA 1POY1 2F7BA 5EQ7A 3EHTA 4IGRA 1I6AA 2BJJX 4OA4A 1FBFA 1UTHA 3SEVA 3CVGA 4BDMA 2G93A 4JB7A 2H4IA 4O3AA 1IZ1A 4P8BA 4G4PA 4O3CA 2XWIA 5I56B 4AS4A 1MY4A 3EQ1A 4OVPA 4GWOA 1EH3A 4N15A 1SYIA 3FV2A 1GTKA 4C1UA 1QJMA 1B05A 4NF4B 4R6YA 2I3WA 1SW2A 1EZPA 3HV1A 4WKMA 4GL8A 1Y4TA 4ZEIA 2Y7RA 3FVGA 2PFYA 4N07A 1IMBA 1US5A 4U21A 3H6UA 3I3VA 1J1NA 1SBPA 2I58A 2Q8MA 3K6VA 3O97A 3MPKA 3MP8A 2AL5A 4F2OA 3OO7A 3KBRA 3KJ7A 4DCYA 3TCHA 2D5WA 1MQHA 4IR8A 2ZZVA 2VHAA 3U8QA 1MXUA 5I2KA 4Q30B 1SW1A 3LSXA 3MZ1A 4Q0CA 4O3BA 3UP9A 1FRPA 2X7PA 1JW1A 4KFQA 3KC0A 4ONYA 4PC9A 1RYOA 4IO2A 2HXRA 4WEDA 2YPNA 1CE2A 5DW8A 4HE2A 1FQDA 3KFMA 3VXCA 1B5HA 3LSWA 3HFUA 2QSXA 5I58A 2R8TA 1MXVA 3VLUA 2AIXA 1EYJA 3KJTA 1MS7A 2REJA 2UVHA 2KLFA 4G8HA 4NF6A 1QGXA 3B7DA 3LUZA 2FBPA 1NNTA 4DLDA 4FIMA 2Z8EA 4IY6A 1FBGA 1B7HA 4OENA 3T1BA 4ELPA 2V93A 4EXKA 4YICA 3MC2A 4EDPA 3PMVA 5CRYA 3CFLA 2OX3A 3C9HA 1ZMGA 1SW4A 4G61A 1IMAA 2OWSA 4XKQA 4KYDA 2B3FA 4R74A 4JWOA 3KC1A 2Q8JA 1FPEA 1S9TA 5JK4A 1AL3A 2KR0A 4OEVA 3Q25A 4RYAA 4LZ5A 2WKYA 5H8QA 5AA2D 1MRPA 2ESNA 4N6PA 1SPIA 2NUVA 3IFAA 2M8CA 5L9OA 1A7LA 4QFKA 2Q2AA 3TZAA 2DWIA 2F78A 5L8DA 1OIBA 1DOTA 4NHBA 4X04A 3S9EA 2QVVA 3MUQA 4JSOA 3G7WA 2O7UA 2RCAA 4NGUA 2P1SA 1LFGA 4L17A 2RKMA 1JVYA 4PFIA 1NKXA 4NWCA 4NF8A 2XXVA 1DMBA 3BBRA 3CIJA 4N13A 2QS3A 1S50A 5I59B 3S9MC 1NUYA 2CZHA 4U1OA 4MNIA 4ZECA 4LZ8A 3S4UA 3KSXA 5ET5A 4GX4A 1NV1A 4KD5A 2DVZA 2ZMBA 4YB6A 2O1MA 3IL1B 3EN3A 2O6AA 4G68A 4MHFA 4ELQA 1ZTYA 4KCDA 4NF0A 2ZYKA 3CG1A 3I6VA 4M1VA 3LSFB 4BDOA 3VLWA 4YKJA 3U92A 4HE0A 1LAHE 5LTCA 2HZKA 3IB1A 4U4SA 4ISUA 5BWJA 2XXWA 4JVIA 2PBWA 4I40A 3R26A 2VT5A 2X26A 2VPOA 4QFNA 5A5XA 1FPGA 3QYTA 3MVYA 3KSJA 3MAMA 4ND9A 1IXHA 4HW8A 3T93B 3IB2A 3QXMA 4RY1A 4Q5TA 4RXLA 5DEXB 5IGAA 3N94A 1SW5A 1XC1A 4U1ZA 1B5IA 1N76A 1MDQA 4GXAA 2DE4A 4AS5A 3H4ZA 4I62A 2F35A 4OVRA 1A8FA 1MQIA 5F7VA 2QS1A 1UTHB 4X1BA 2H98A 4GX3A 1MPCA 2NXOA 2QFLA 3PPNA 1FW0A 1MY3A 3UK4A 1GR2A 1LBYA 1JEVA 4GVOA 1XOCA 4XKRA 4H8IA 1D4NA 2P3VA 1Q35A 5CI5A 3H6VA 4H0WA 5I5PA 1MY0A 1VFEA 4OZ9A 1DCUA 2A5TA 1H43A 1DK4A 2CZIA 3PUYE 4O94A 4RK9A 3RLFE 1B5JA 4KR5A 1AOVA 2QS2A 3E78A 1NUXA 4OVJA 4FAJA 1PB8A 2F7AA 2HCAA 3LV0A 4PF8A 3HPIA 3B50A 5ICQA 4DIGA 4MH5A 1FPIA 1LGBC 4ECFA 5DYHA 2OWZA 4PE5B 2H25A 2Q74A 4ZE8A 1EZ9A 1RKMA 4GWXA 4NQ8A 1CB6A 1AWBA 5I2KB 3RPWA 3ZKKA 4POWA 3CFXA 1NV7A 3D4GA 1YCJA 3T9VA 3TQWA 4XKPA 3W15C 3KN7A 1VDWA 2ONRA 4GIZA 2RC7A 4QRZA 3Q27A 3W9WA 4LUBA 4IO6A 5ET7A 3ROJA 1ATGA 3UORA 4DXUA 3VXBA 1SQYA 1LBBA 1P1UA 1DPEA 3QIMA 1B1HA 3K1PA 4JDFA 2WYPA 1B7ZA 2F3DA 3TAJA 3T9XB 1LCFA 1M5EA 2PX1A 4PFBA 1O64A 4FORA 1FSAA 3LSLA 5K2XA 1LCTA 2QS4A 1NUWA 2A5SA 2F34A 2WBDA 4OESA 4ZZAA 3KGCA 1I6QA 3K6WA 2MKZA 5FHMA 4YMBA 3ECRA 3IJXB 1DTZA 2Y5KA 4PF6A 4PCDA 2ZNSA 3Q28A 3SERA 2CMOA 5CBRA 4HS7A 2ANJA 1MXWA 4EQ7A 4U4XA 1FCKA 1R9QA 3EHUA 1N3WA 4PQJA 3T96B 1EU8A 1NMUA 1IXCA 2B4MA 2OCUA 3TKDA 4HTGA 5I7IA 1TT1A 3I5OA 4C0RA 1TFDA 4MAGA 3SETA 4YU0A 3RT6B 1KA0A 5H8QB 4QFLA 1JP4A 1JW4A 4E0XA 4MNPA 2I3VA 4M4GA 1O63A 5HM4B 5DVIA 3E9XA 2VP1A 5I59A 3UIFA 3MVWA 3ZS6A 5A5LA 4MJOA 3DELB 4NMYA 2QMXA 3PPQA 4NF8B 2UXAA 1IIWA 2IA4A 1N04A 1FTLA 4BDNA 2QL3A 3OO6A 1NNKA 1IMEA 3FJ7A 3MSTA 1P1QA 3PD9A 3M3KA 2XXTA 3GBAA 1Y3QA 5B7DA 1EYKA 4R6KA 3TCFA 4DZ1A 4G68B 4PTKA 1A54A 1B51A 3E4RA 3IB0A 3K0VA 1I6BA 1FQEA 1I69A 3GXAA 2GQ1A 3MZBA 3CG3A 2HQ0A 2DOJA 2ONKE 5KCJA 5ESYA 4GQOA 1FBCA 1KWHA 1MM6A 3H03A 3Q26A 5H8FA 2V25A 4DI3D 2DXYA 1ZU0A 2OLBA 2FNCA 1RDXA 2CZKA 5A5XB 2XXYA 4GXSB 4LATA 4PFRA 4F3GA 3RQTA 4PFUA 4ELOA 4AB6A 3FXQA 1A8EA 1II5A 5FHNA 5L9MA 3V89B 4N6KA 4G2ZA 3PTYA 1B4HA 1TXFA 3QSLA 4OEUA 2XA5A 4P0IA 1MM7A 4NF5B 5IAIA 2BJIA 4OETA 2ZNUA 4GRKA 4ESWA 5TPAA 3BIHA 4TLMB 4FJPA 2UVGA 4N81A 4ZS9A 1DPPA 3H3GA 1B58A 1MXXA 2ZNTA 3VVDA 4XXUA 4YMAA 1AMFA 2I4BA 5IZZA 3C33A 4ZEBA 2A5TB 3BKIB 1FBEA 2DYXA 3PUXE 4LQ5A 5AA3A 4O7MA 4EQ9A 4GFRA 4RK2A 2VD3A 3BFTA 3HHGA 2E1SA 3KN8A 2QVRA 3FASA 5ITOA 3CI8A 3WAFA 5LOMA 3IJOB 4DE8A 3T9UA 4GWYA 2Y84A 3EPEA 4DDDA 3W9VA 1NL5A 1Y1ZA 2GRVA 2ZZWA 3ODBA 4LN5A 2ZYNA 5EYGA 1SI0A 2XWOA 2H5YA 1LLSA 1GGGA 1YTVA 2O84X 4AB5A 1EYIA 3OELA 2UYEA 3DP8A 3KG2A 2FIEA 3PUWE 3PPRA 4IB2A 4I3YA 4WXJA 4MFIA 5EQ9A 5IKBA 3C31A 3V5AA 2Y5LA 2DE3A 5H8HA 1NFTA 3G3HA 5HBCA 1USYH 4ELRA 2NVUB 4F19A 1RYXA 1XI6A
chains in the Genus database with same CATH topology
3MZ9A 4LP2B 4IO5A 3K01A 2UYFA 4H65A 4ZZEA 3M3LA 3QK6A 4FEBA 3TEPA 1MH3A 1LFHA 3K1NA 3O6HA 2D3IA 2VOZA 1MH4A 2GFEA 2O7IA 4PP0A 4XIGQ 3PD8A 3N6UA 1UTBA 3OEKA 1JETA 5ICTA 4F1VA 3SEXA 1M5FA 5H8NA 1JNFA 3PPOA 4YB7A 3RTWB 1LB9A 4LONB 4BDRA 3THIA 2XXIA 3KEIA 4ESXA 2RCBA 1MPDA 3OO9A 1UIUA 1OLAA 2RINA 5EHMA 1IQ7A 5DTBA 3TODA 4NWDA 3K6XA 3WAEA 5F1QA 5B70A 2DVCA 3ZKLA 1N3XA 4YAHX 5KCJB 1O7TA 3C4MA 3IO6A 1Y3NA 2W7YA 3T22A 3OSRA 5H8FB 3FJMA 4GLIA 3QAXA 2REGA 1OVTA 3A09A 4GOTA 3SEYA 4NF5A 3G3GA 4U22A 4AQ4A 3QUFA 1BIYA 2Z8DA 4U23A 3Q29A 2XXHA 4RNSA 1N84A 4GL0A 1DSNA 3DM0A 4ZDMA 3PU5A 5J1DA 2X7QA 3K6UA 1OQGA 2F97A 3QUJA 1VSOA 1B3EA 1B3GA 4F39A 5ISUA 2PT1A 3IK6B 1IITA 2XD2A 5TPAB 2LAOA 5I84A 3L6HA 2I48A 4PFTA 2E0SA 1Y9UA 5H8SA 1Y1MA 1URGA 4OHNA 1FTMA 1MY1A 2OK2A 1FTKA 1LAGE 5DVJA 1R1NA 1OVBA 2QRYA 2FYIA 1B46A 1Y20A 3G3IA 5I57A 3RNNA 1AH5A 4Z0IA 3O6IA 3K1MA 3PPPA 3O28A 4G77A 1T0KA 4H8JA 1LBCA 2R6GE 5BUUA 3HCQA 3U93A 2DE2A 1B52A 3FVOA 2Y7WA 1B3LA 1GV8A 2Z8FA 3R7XA 5DVFA 4K3FA 4H1XA 1GVCA 2DXRA 3OOAA 4GF8A 5FTHA 3RT8A 2O1LA 5AE4A 3O2AA 1A99A 4F1UA 4F1YA 1LFIA 4I1DA 3VE1B 1N7WA 2I49A 4H6DA 1OMPA 3GLBA 3V83A 4EQBA 3JZJA 2PMSA 3FGSA 4TQUQ 4ZEDA 5KDTA 1B7UA 4OFOA 4PETA 2DWAA 3EF7A 1UIVA 1IXGA 1XT8A 5CMMA 4G8MA 3IR1A 3ONMA 5KZTA 1MPBA 3HO7A 4F31B 3T66A 4F3PA 2GHAA 4QSCA 2F7CA 1D3KA 5H8HB 4UACA 3TYHA 1WDNA 4MBPA 4JWXA 2V84A 4FEDA 3USDA 3RTFB 3FV1A 2UVIA 4RPOA 5K2YA 1WODA 3K4UA 3BFUA 4YB5A 4KPTA 4OMBA 4OXVA 1Q1KA 4LZ7A 2ALUA 3T9HB 3FXUA 2HZLA 5ELVA 3OENA 1XVYA 2R71A 4XKNA 3TTRA 1L5TA 3TELA 5CC2A 3DP4A 3IOWA 1B2HA 3R6UA 1PBPA 3JV9A 1UTBB 2G29A 2P2AA 4JWYA 2DSFA 3GZGA 3DP6A 1HSJA 1FTJA 3OMBA 4IO7A 1NNPA 5H8NB 4R72A 1B4ZA 4QFPA 4EF2A 3LBSA 2ONSA 1VFDA 2XXUA 3MWBA 4ZEFA 4IY5A 2Q89A 2XX8A 2I0BA 3KZGA 3TTMA 4EUOA 1MY2A 4F3SA 2V3QA 1Y3PA 4BDQA 3MP6A 4BLAA 1M5DA 2Q2CA 4NEDA 2OJTA 2QPQA 4MLVA 4NE4A 1A40A 4DCXA 1B40A 3LR1A 2Y7IA 2THIA 3MQ9A 1SI1A 1NH7A 4YKKA 1H3DA 1QVSA 4F3BA 2O69A 2ABHA 3IO4A 3A3UA 1POTA 2F5XA 3C35A 1B0LA 1YPNA 2F36A 3K02A 4LVQA 1B1XA 3K00A 2RC9A 2XD3A 2HAUA 4C1TA 5I2NB 4LQ2A 3LC8A 1URSA 1URDA 3M8UA 3M3FA 2IEEA 2VGQA 3UGWA 3CFZA 2ZYMA 3FVNA 5ITPA 4PFWA 4F29A 1IUDA 2Y7PA 3G3JA 2I4CA 1BTJA 1WVJA 1JEUA 2OBGA 4P0GA 3OXNA 1MXYA 3TDJA 5AA2A 3MVZA 5CMBA 4R9FA 4JSDA 5I57B 2B65A 3DLNA 3O6GA 1ZBMA 4QF9A 3B6WA 4IO3A 2P0SA 5FTIA 1JW5A 4X9TA 4DXCA 3E3KA 3U94A 3VVFA 4H5FA 4Q8RA 3E13X 1SDXA 1ELJA 4KHZE 1LSTA 3OSQA 5CM6A 3UN6A 3VLVA 1NH8A 4R6HA 2DWHA 3OD7A 2H99A 4RA1A 1MQGA 3TTLA 4Z7EA 3RGYA 1XS5A 4KCCA 4G8NA 1HSEA 1QUKA 5L9SA 3TUSA 2XXXA 5CBSA 3HHFA 4I8CA 3PUZE 1SVXB 5CMKA 2NOOA 4BDLA 2Y7KA 3TQLA 5M2VA 1S7YA 3V8XB 3FZVA 1MDP1 3MVXA 3TTNA 2DS9A 4I9DA 4RPNA 3PMWA 1N0TA 3MW0A 5AA4A 2DQVA 3ILTB 5KDTB 1FTOA 2O51A 1BKAA 3CR9A 4OWDA 4F22A 1OQHA 4KYEA 1PEBA 5HPQA 1B0HA 1DTGA 4EF1A 4HCWA 3CRBA 3RY3A 5EYFA 1D9VA 1MQJA 4YKIA 3TMGA 4OTEA 2FA7A 4MLQA 1SYHA 1TWYA 3FVKA 5TP9A 4FECA 3AXFA 3HSTA 1LB8A 5FHOA 4UA8A 4F18A 3IX1A 1PBQA 1QW0A 1VE4A 4MF3A 3PUVE 2I6EA 2O68A 1P1WA 1YAEA 4HCYA 2OWTA 2H9BA 3C32A 3KOSA 3PMXA 2PYYA 1A55A 3HN0A 2XX9A 4R73A 1FQBA 4H67A 5DT6A 4NTLA 2XX7A 3OO8A 3G3FA 3B6QA 1MG1A 3SEWA 4KQPA 3IOTA 2YLNA 3KOTA 4LA9A 1AIVA 3TTKA 2NWJA 3JYRA 3S2VA 1P1OA 1PC3A 5JEIA 3N6TA 2F6GA 3VFJA 2PT2A 3N5LA 1B9JA 1QUJA 4E0WA 3O9PA 1HSLA 1ZKBA 3IAZA 1P1NA 4ZE9A 2Z22A 1VR5A 1JVXA 4G68C 3O66A 1LAFE 1B3FA 1BP5A 5JTYA 3TCGA 1ZJLA 2AL4A 3U1OA 3RN8A 3FJGA 3FXRA 1B6HA 4OFLA 2QMWA 1BLFA 4QHQA 3SESA 4OQOA 5I56A 3N26A 3CSBA 1USYE 4R2FA 5I2NA 1ZIUA 2V3TA 3SDFA 4R2BA 2PVUA 3K2DA 1FQFA 3IOUA 4QFOA 1NNFA 4NF4A 2XXRA 3VV5A 3FUZA 1Z7ME 4FE8A 3C34A 4TOZA 4QSDA 1PB9A 2VD2A 4PFYA 4F2QA 2OZZA 2ZXTA 3GBBA 3FATA 1N7XA 2RF1A 4RJZA 2UVJA 4YZZA 4THIA 4FATA 3H6WA 1B32A 1US4A 3S9NC 5AA2B 3SKPA 3SEUA 3ZSFA 2XXQA 3A3CA 4X1DA 1D9YA 3F11A 2YJPA 3TPAA 1R9LA 3IOVA 4ZEKA 3C36A 2F6PA 4R75A 4IO4A 1H44A 4WEPA 2CZLA 3O29A 3VVEA 2DWJA 2Q88A 2GH9A 5EHSA 1TFAA 2F8DA 2ZYOA 4OFJA 1SD3A 2RC8A 4DXBA 1P99A 3TFLA 3D4CA 4H5GA 2AYSA 3L6GA 5AA1A 1B3HA 1UQWA 4KI0E 4P11A 1H76A 4XTCQ 1MQDA 2HEUA 3ILUB 2B3BA 5I58B 2DP8A 1FQCA 3MJNA 4JXIA 3LUYA 4NF6B 4IGTA 1Y4CA 5CMCA 3P7IA 1JQFA 4OYVA 1H45A 1ZLQA 1XVXA 1ANFA 3H6TA 3IORA 5AA4B 3S9LC 3FIRA 2HXWA 1MXZA 2I0CA 3FD3A 2XXPA 2XHDA 3G3KA 4TLLB 1XHYA 2Q9TA 4JBZA 1Z7NE 1EZOA 3MPLA 3B6TA 5TP9B 2HFBA 1LAXA 4YKPA 1PB7A 3KN3A 3UA8A 2V3UA 1OLCA 3MP1A 3PV0E 3H7MA 1M5CA 4KYSA 2QJEA 3RUMA 2D21A 3EHSA 2HAVA 4POXA 1IXIA 4GD5A 3PGFA 1IEJA 4EXLA 1R6ZA 4X48A 3CSGA 1QKBA 2GHBA 3U72A 4QSEA 1F9BA 4OERA 3VDFA 1PDAA 4U2RA 2Z23A 1QULA 1QKAA 3MBPA 1QUIA 2R9JA 3H06B 3OEMA 1M5BA 5DEXA 5TU0A 4R9GA 5JTYB 1FQAA 1POY1 2F7BA 3EHTA 4IGRA 1I6AA 2BJJX 1UTHA 3SEVA 3CVGA 4BDMA 2G93A 4JB7A 2H4IA 4O3AA 1IZ1A 4G4PA 4O3CA 5I56B 1MY4A 3EQ1A 4GWOA 1EH3A 1SYIA 3FV2A 1GTKA 4C1UA 1QJMA 1B05A 4NF4B 4R6YA 2I3WA 1SW2A 1EZPA 3HV1A 4WKMA 4GL8A 1Y4TA 4ZEIA 2Y7RA 3FVGA 4N07A 1US5A 4U21A 3H6UA 3I3VA 1J1NA 1SBPA 2I58A 3K6VA 3O97A 3MPKA 3MP8A 2AL5A 4F2OA 3OO7A 3KBRA 3KJ7A 4DCYA 3TCHA 2D5WA 1MQHA 2VHAA 3U8QA 1MXUA 5I2KA 4Q30B 1SW1A 3LSXA 3MZ1A 4Q0CA 4O3BA 3UP9A 2X7PA 1JW1A 4KFQA 4ONYA 1RYOA 4IO2A 4WEDA 2YPNA 1CE2A 1FQDA 3KFMA 3VXCA 1B5HA 3LSWA 2QSXA 5I58A 1MXVA 3VLUA 2AIXA 3KJTA 1MS7A 2REJA 2UVHA 2KLFA 4G8HA 4NF6A 3B7DA 1NNTA 4DLDA 4FIMA 2Z8EA 4IY6A 1B7HA 4OENA 4ELPA 2V93A 4EXKA 4YICA 3MC2A 4EDPA 3PMVA 5CRYA 3CFLA 3C9HA 1ZMGA 1SW4A 2OWSA 4XKQA 4KYDA 2B3FA 4R74A 4JWOA 2Q8JA 1S9TA 5JK4A 1AL3A 4OEVA 3Q25A 4RYAA 4LZ5A 2WKYA 5H8QA 5AA2D 1MRPA 2ESNA 4N6PA 2NUVA 2M8CA 5L9OA 1A7LA 4QFKA 2Q2AA 3TZAA 2DWIA 2F78A 5L8DA 1OIBA 1DOTA 3S9EA 3MUQA 4JSOA 3G7WA 2O7UA 2RCAA 2P1SA 1LFGA 4L17A 2RKMA 1JVYA 1NKXA 4NWCA 4NF8A 2XXVA 1DMBA 3BBRA 3CIJA 4N13A 2QS3A 1S50A 5I59B 3S9MC 4U1OA 4ZECA 4LZ8A 3S4UA 3KSXA 4KD5A 2DVZA 2ZMBA 4YB6A 2O1MA 3IL1B 3EN3A 2O6AA 4G68A 4ELQA 1ZTYA 4KCDA 2ZYKA 3CG1A 3I6VA 4M1VA 3LSFB 4BDOA 3VLWA 4YKJA 3U92A 1LAHE 2HZKA 3IB1A 4U4SA 4ISUA 5BWJA 2XXWA 2PBWA 3R26A 2X26A 4QFNA 5A5XA 3QYTA 3MVYA 3KSJA 3MAMA 4ND9A 1IXHA 4HW8A 3T93B 3IB2A 3QXMA 4RY1A 4Q5TA 4RXLA 5DEXB 3N94A 1SW5A 1XC1A 4U1ZA 1B5IA 1N76A 1MDQA 4GXAA 2DE4A 3H4ZA 4I62A 2F35A 1A8FA 1MQIA 5F7VA 2QS1A 1UTHB 4X1BA 2H98A 1MPCA 2NXOA 3PPNA 1FW0A 1MY3A 3UK4A 1GR2A 1JEVA 4GVOA 4XKRA 1XOCA 4H8IA 1D4NA 1Q35A 5CI5A 3H6VA 4H0WA 1MY0A 1VFEA 4OZ9A 2A5TA 1H43A 3PUYE 4RK9A 3RLFE 1B5JA 4KR5A 1AOVA 2QS2A 4OVJA 4FAJA 1PB8A 2F7AA 2HCAA 3HPIA 5ICQA 4DIGA 4MH5A 1LGBC 4ECFA 5DYHA 4PE5B 2H25A 4ZE8A 1EZ9A 1RKMA 1CB6A 5I2KB 3RPWA 3ZKKA 4POWA 3CFXA 3D4GA 1YCJA 3T9VA 3TQWA 4XKPA 3W15C 3KN7A 2ONRA 4GIZA 2RC7A 4QRZA 3Q27A 3W9WA 4LUBA 4IO6A 1ATGA 3UORA 4DXUA 3VXBA 1SQYA 1LBBA 1P1UA 1DPEA 3QIMA 1B1HA 3K1PA 4JDFA 1B7ZA 3TAJA 3T9XB 1LCFA 1M5EA 2PX1A 1O64A 4FORA 3LSLA 5K2XA 1LCTA 2QS4A 2A5SA 2F34A 4ZZAA 4OESA 3KGCA 1I6QA 3K6WA 5FHMA 4YMBA 3ECRA 3IJXB 1DTZA 2ZNSA 3Q28A 3SERA 2CMOA 5CBRA 4HS7A 2ANJA 1MXWA 4EQ7A 4U4XA 1FCKA 1R9QA 3EHUA 1N3WA 4PQJA 3T96B 1EU8A 1NMUA 1IXCA 2OCUA 3TKDA 4HTGA 1TT1A 3I5OA 4C0RA 1TFDA 3SETA 4YU0A 3RT6B 5H8QB 4QFLA 1JW4A 4E0XA 2I3VA 4M4GA 1O63A 5HM4B 5DVIA 3E9XA 2VP1A 5I59A 3UIFA 3MVWA 3ZS6A 3DELB 4NMYA 2QMXA 3PPQA 4NF8B 2UXAA 1IIWA 2IA4A 1N04A 1FTLA 4BDNA 2QL3A 3OO6A 1NNKA 3FJ7A 1P1QA 3PD9A 3M3KA 2XXTA 3GBAA 1Y3QA 5B7DA 4R6KA 3TCFA 4DZ1A 4G68B 1A54A 1B51A 3E4RA 3IB0A 3K0VA 1I6BA 1FQEA 1I69A 3GXAA 3MZBA 3CG3A 2HQ0A 2DOJA 2ONKE 5KCJA 4GQOA 1KWHA 1MM6A 3H03A 3Q26A 5H8FA 2V25A 2DXYA 1ZU0A 2OLBA 2FNCA 5A5XB 2XXYA 4GXSB 4LATA 4F3GA 3RQTA 4PFUA 4ELOA 4AB6A 3FXQA 1A8EA 1II5A 5FHNA 5L9MA 3V89B 4G2ZA 1B4HA 1TXFA 3QSLA 4OEUA 4P0IA 1MM7A 4NF5B 5IAIA 4OETA 2ZNUA 4GRKA 4ESWA 5TPAA 4TLMB 4FJPA 2UVGA 4ZS9A 1DPPA 3H3GA 1B58A 1MXXA 2ZNTA 3VVDA 4XXUA 4YMAA 1AMFA 2I4BA 3C33A 4ZEBA 2A5TB 3BKIB 2DYXA 3PUXE 4LQ5A 5AA3A 4EQ9A 4GFRA 4RK2A 2VD3A 3BFTA 3HHGA 2E1SA 3KN8A 3FASA 5ITOA 3CI8A 3WAFA 5LOMA 3IJOB 4DE8A 3T9UA 2Y84A 3EPEA 4DDDA 3W9VA 1NL5A 1Y1ZA 2GRVA 3ODBA 2ZYNA 1SI0A 2H5YA 1LLSA 1GGGA 1YTVA 2O84X 4AB5A 3OELA 2UYEA 3DP8A 3KG2A 3PUWE 3PPRA 4IB2A 4WXJA 4MFIA 5IKBA 3C31A 3V5AA 2DE3A 5H8HA 1NFTA 3G3HA 5HBCA 1USYH 4ELRA 2NVUB 4F19A 1RYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ9 A;  4LP2 B;  4IO5 A;  3K01 A;  2UYF A;  4H65 A;  4ZZE A;  3M3L A;  3QK6 A;  4FEB A;  3TEP A;  1MH3 A;  1LFH A;  3K1N A;  3O6H A;  2D3I A;  2VOZ A;  1MH4 A;  2GFE A;  2O7I A;  4PP0 A;  4XIG Q;  3PD8 A;  3N6U A;  1UTB A;  3OEK A;  1JET A;  5ICT A;  4F1V A;  3SEX A;  1M5F A;  5H8N A;  1JNF A;  3PPO A;  4YB7 A;  3RTW B;  1LB9 A;  4LON B;  4BDR A;  3THI A;  2XXI A;  3KEI A;  4ESX A;  2RCB A;  1MPD A;  3OO9 A;  1UIU A;  1OLA A;  2RIN A;  5EHM A;  1IQ7 A;  5DTB A;  3TOD A;  4NWD A;  3K6X A;  3WAE A;  5F1Q A;  5B70 A;  2DVC A;  3ZKL A;  1N3X A;  4YAH X;  5KCJ B;  1O7T A;  3C4M A;  3IO6 A;  1Y3N A;  2W7Y A;  3T22 A;  3OSR A;  5H8F B;  3FJM A;  4GLI A;  3QAX A;  2REG A;  1OVT A;  3A09 A;  4GOT A;  3SEY A;  4NF5 A;  3G3G A;  4U22 A;  4AQ4 A;  3QUF A;  1BIY A;  2Z8D A;  4U23 A;  3Q29 A;  2XXH A;  4RNS A;  1N84 A;  4GL0 A;  1DSN A;  3DM0 A;  4ZDM A;  3PU5 A;  5J1D A;  2X7Q A;  3K6U A;  1OQG A;  2F97 A;  3QUJ A;  1VSO A;  1B3E A;  1B3G A;  4F39 A;  5ISU A;  2PT1 A;  3IK6 B;  1IIT A;  2XD2 A;  5TPA B;  2LAO A;  5I84 A;  3L6H A;  2I48 A;  4PFT A;  2E0S A;  1Y9U A;  5H8S A;  1Y1M A;  1URG A;  4OHN A;  1FTM A;  1MY1 A;  2OK2 A;  1FTK A;  1LAG E;  5DVJ A;  1R1N A;  1OVB A;  2QRY A;  2FYI A;  1B46 A;  1Y20 A;  3G3I A;  5I57 A;  3RNN A;  1AH5 A;  4Z0I A;  3O6I A;  3K1M A;  3PPP A;  3O28 A;  4G77 A;  1T0K A;  4H8J A;  1LBC A;  2R6G E;  5BUU A;  3HCQ A;  3U93 A;  2DE2 A;  1B52 A;  3FVO A;  2Y7W A;  1B3L A;  1GV8 A;  2Z8F A;  3R7X A;  5DVF A;  4K3F A;  4H1X A;  1GVC A;  2DXR A;  3OOA A;  4GF8 A;  5FTH A;  3RT8 A;  2O1L A;  5AE4 A;  3O2A A;  1A99 A;  4F1U A;  4F1Y A;  1LFI A;  4I1D A;  3VE1 B;  1N7W A;  2I49 A;  4H6D A;  1OMP A;  3GLB A;  3V83 A;  4EQB A;  3JZJ A;  2PMS A;  3FGS A;  4TQU Q;  4ZED A;  5KDT A;  1B7U A;  4OFO A;  4PET A;  2DWA A;  3EF7 A;  1UIV A;  1IXG A;  1XT8 A;  5CMM A;  4G8M A;  3IR1 A;  3ONM A;  5KZT A;  1MPB A;  3HO7 A;  4F31 B;  3T66 A;  4F3P A;  2GHA A;  4QSC A;  2F7C A;  1D3K A;  5H8H B;  4UAC A;  3TYH A;  1WDN A;  4MBP A;  4JWX A;  2V84 A;  4FED A;  3USD A;  3RTF B;  3FV1 A;  2UVI A;  4RPO A;  5K2Y A;  1WOD A;  3K4U A;  3BFU A;  4YB5 A;  4KPT A;  4OMB A;  4OXV A;  1Q1K A;  4LZ7 A;  2ALU A;  3T9H B;  3FXU A;  2HZL A;  5ELV A;  3OEN A;  1XVY A;  2R71 A;  4XKN A;  3TTR A;  1L5T A;  3TEL A;  5CC2 A;  3DP4 A;  3IOW A;  1B2H A;  3R6U A;  1PBP A;  3JV9 A;  1UTB B;  2G29 A;  2P2A A;  4JWY A;  2DSF A;  3GZG A;  3DP6 A;  1HSJ A;  1FTJ A;  3OMB A;  4IO7 A;  1NNP A;  5H8N B;  4R72 A;  1B4Z A;  4QFP A;  4EF2 A;  3LBS A;  2ONS A;  1VFD A;  2XXU A;  3MWB A;  4ZEF A;  4IY5 A;  2Q89 A;  2XX8 A;  2I0B A;  3KZG A;  3TTM A;  4EUO A;  1MY2 A;  4F3S A;  2V3Q A;  1Y3P A;  4BDQ A;  3MP6 A;  4BLA A;  1M5D A;  2Q2C A;  4NED A;  2OJT A;  2QPQ A;  4MLV A;  4NE4 A;  1A40 A;  4DCX A;  1B40 A;  3LR1 A;  2Y7I A;  2THI A;  3MQ9 A;  1SI1 A;  1NH7 A;  4YKK A;  1H3D A;  1QVS A;  4F3B A;  2O69 A;  2ABH A;  3IO4 A;  3A3U A;  1POT A;  2F5X A;  3C35 A;  1B0L A;  1YPN A;  2F36 A;  3K02 A;  4LVQ A;  1B1X A;  3K00 A;  2RC9 A;  2XD3 A;  2HAU A;  4C1T A;  5I2N B;  4LQ2 A;  3LC8 A;  1URS A;  1URD A;  3M8U A;  3M3F A;  2IEE A;  2VGQ A;  3UGW A;  3CFZ A;  2ZYM A;  3FVN A;  5ITP A;  4PFW A;  4F29 A;  1IUD A;  2Y7P A;  3G3J A;  2I4C A;  1BTJ A;  1WVJ A;  1JEU A;  2OBG A;  4P0G A;  3OXN A;  1MXY A;  3TDJ A;  5AA2 A;  3MVZ A;  5CMB A;  4R9F A;  4JSD A;  5I57 B;  2B65 A;  3DLN A;  3O6G A;  1ZBM A;  4QF9 A;  3B6W A;  4IO3 A;  2P0S A;  5FTI A;  1JW5 A;  4X9T A;  4DXC A;  3E3K A;  3U94 A;  3VVF A;  4H5F A;  4Q8R A;  3E13 X;  1SDX A;  1ELJ A;  4KHZ E;  1LST A;  3OSQ A;  5CM6 A;  3UN6 A;  3VLV A;  1NH8 A;  4R6H A;  2DWH A;  3OD7 A;  2H99 A;  4RA1 A;  1MQG A;  3TTL A;  4Z7E A;  3RGY A;  1XS5 A;  4KCC A;  4G8N A;  1HSE A;  1QUK A;  5L9S A;  3TUS A;  2XXX A;  5CBS A;  3HHF A;  4I8C A;  3PUZ E;  1SVX B;  5CMK A;  2NOO A;  4BDL A;  2Y7K A;  3TQL A;  5M2V A;  1S7Y A;  3V8X B;  3FZV A;  1MDP 1;  3MVX A;  3TTN A;  2DS9 A;  4I9D A;  4RPN A;  3PMW A;  1N0T A;  3MW0 A;  5AA4 A;  2DQV A;  3ILT B;  5KDT B;  1FTO A;  2O51 A;  1BKA A;  3CR9 A;  4OWD A;  4F22 A;  1OQH A;  4KYE A;  1PEB A;  5HPQ A;  1B0H A;  1DTG A;  4EF1 A;  4HCW A;  3CRB A;  3RY3 A;  5EYF A;  1D9V A;  1MQJ A;  4YKI A;  3TMG A;  4OTE A;  2FA7 A;  4MLQ A;  1SYH A;  1TWY A;  3FVK A;  5TP9 A;  4FEC A;  3AXF A;  3HST A;  1LB8 A;  5FHO A;  4UA8 A;  4F18 A;  3IX1 A;  1PBQ A;  1QW0 A;  1VE4 A;  4MF3 A;  3PUV E;  2I6E A;  2O68 A;  1P1W A;  1YAE A;  4HCY A;  2OWT A;  2H9B A;  3C32 A;  3KOS A;  3PMX A;  2PYY A;  1A55 A;  3HN0 A;  2XX9 A;  4R73 A;  1FQB A;  4H67 A;  5DT6 A;  4NTL A;  2XX7 A;  3OO8 A;  3G3F A;  3B6Q A;  1MG1 A;  3SEW A;  4KQP A;  3IOT A;  2YLN A;  3KOT A;  4LA9 A;  1AIV A;  3TTK A;  2NWJ A;  3JYR A;  3S2V A;  1P1O A;  1PC3 A;  5JEI A;  3N6T A;  2F6G A;  3VFJ A;  2PT2 A;  3N5L A;  1B9J A;  1QUJ A;  4E0W A;  3O9P A;  1HSL A;  1ZKB A;  3IAZ A;  1P1N A;  4ZE9 A;  2Z22 A;  1VR5 A;  1JVX A;  4G68 C;  3O66 A;  1LAF E;  1B3F A;  1BP5 A;  5JTY A;  3TCG A;  1ZJL A;  2AL4 A;  3U1O A;  3RN8 A;  3FJG A;  3FXR A;  1B6H A;  4OFL A;  2QMW A;  1BLF A;  4QHQ A;  3SES A;  4OQO A;  5I56 A;  3N26 A;  3CSB A;  1USY E;  4R2F A;  5I2N A;  1ZIU A;  2V3T A;  3SDF A;  4R2B A;  2PVU A;  3K2D A;  1FQF A;  3IOU A;  4QFO A;  1NNF A;  4NF4 A;  2XXR A;  3VV5 A;  3FUZ A;  1Z7M E;  4FE8 A;  3C34 A;  4TOZ A;  4QSD A;  1PB9 A;  2VD2 A;  4PFY A;  4F2Q A;  2OZZ A;  2ZXT A;  3GBB A;  3FAT A;  1N7X A;  2RF1 A;  4RJZ A;  2UVJ A;  4YZZ A;  4THI A;  4FAT A;  3H6W A;  1B32 A;  1US4 A;  3S9N C;  5AA2 B;  3SKP A;  3SEU A;  3ZSF A;  2XXQ A;  3A3C A;  4X1D A;  1D9Y A;  3F11 A;  2YJP A;  3TPA A;  1R9L A;  3IOV A;  4ZEK A;  3C36 A;  2F6P A;  4R75 A;  4IO4 A;  1H44 A;  4WEP A;  2CZL A;  3O29 A;  3VVE A;  2DWJ A;  2Q88 A;  2GH9 A;  5EHS A;  1TFA A;  2F8D A;  2ZYO A;  4OFJ A;  1SD3 A;  2RC8 A;  4DXB A;  1P99 A;  3TFL A;  3D4C A;  4H5G A;  2AYS A;  3L6G A;  5AA1 A;  1B3H A;  1UQW A;  4KI0 E;  4P11 A;  1H76 A;  4XTC Q;  1MQD A;  2HEU A;  3ILU B;  2B3B A;  5I58 B;  2DP8 A;  1FQC A;  3MJN A;  4JXI A;  3LUY A;  4NF6 B;  4IGT A;  1Y4C A;  5CMC A;  3P7I A;  1JQF A;  4OYV A;  1H45 A;  1ZLQ A;  1XVX A;  1ANF A;  3H6T A;  3IOR A;  5AA4 B;  3S9L C;  3FIR A;  2HXW A;  1MXZ A;  2I0C A;  3FD3 A;  2XXP A;  2XHD A;  3G3K A;  4TLL B;  1XHY A;  2Q9T A;  4JBZ A;  1Z7N E;  1EZO A;  3MPL A;  3B6T A;  5TP9 B;  2HFB A;  1LAX A;  4YKP A;  1PB7 A;  3KN3 A;  3UA8 A;  2V3U A;  1OLC A;  3MP1 A;  3PV0 E;  3H7M A;  1M5C A;  4KYS A;  2QJE A;  3RUM A;  2D21 A;  3EHS A;  2HAV A;  4POX A;  1IXI A;  4GD5 A;  3PGF A;  1IEJ A;  4EXL A;  1R6Z A;  4X48 A;  3CSG A;  1QKB A;  2GHB A;  3U72 A;  4QSE A;  1F9B A;  4OER A;  3VDF A;  1PDA A;  4U2R A;  2Z23 A;  1QUL A;  1QKA A;  3MBP A;  1QUI A;  2R9J A;  3H06 B;  3OEM A;  1M5B A;  5DEX A;  5TU0 A;  4R9G A;  5JTY B;  1FQA A;  1POY 1;  2F7B A;  3EHT A;  4IGR A;  1I6A A;  2BJJ X;  1UTH A;  3SEV A;  3CVG A;  4BDM A;  2G93 A;  4JB7 A;  2H4I A;  4O3A A;  1IZ1 A;  4G4P A;  4O3C A;  5I56 B;  1MY4 A;  3EQ1 A;  4GWO A;  1EH3 A;  1SYI A;  3FV2 A;  1GTK A;  4C1U A;  1QJM A;  1B05 A;  4NF4 B;  4R6Y A;  2I3W A;  1SW2 A;  1EZP A;  3HV1 A;  4WKM A;  4GL8 A;  1Y4T A;  4ZEI A;  2Y7R A;  3FVG A;  4N07 A;  1US5 A;  4U21 A;  3H6U A;  3I3V A;  1J1N A;  1SBP A;  2I58 A;  3K6V A;  3O97 A;  3MPK A;  3MP8 A;  2AL5 A;  4F2O A;  3OO7 A;  3KBR A;  3KJ7 A;  4DCY A;  3TCH A;  2D5W A;  1MQH A;  2VHA A;  3U8Q A;  1MXU A;  5I2K A;  4Q30 B;  1SW1 A;  3LSX A;  3MZ1 A;  4Q0C A;  4O3B A;  3UP9 A;  2X7P A;  1JW1 A;  4KFQ A;  4ONY A;  1RYO A;  4IO2 A;  4WED A;  2YPN A;  1CE2 A;  1FQD A;  3KFM A;  3VXC A;  1B5H A;  3LSW A;  2QSX A;  5I58 A;  1MXV A;  3VLU A;  2AIX A;  3KJT A;  1MS7 A;  2REJ A;  2UVH A;  2KLF A;  4G8H A;  4NF6 A;  3B7D A;  1NNT A;  4DLD A;  4FIM A;  2Z8E A;  4IY6 A;  1B7H A;  4OEN A;  4ELP A;  2V93 A;  4EXK A;  4YIC A;  3MC2 A;  4EDP A;  3PMV A;  5CRY A;  3CFL A;  3C9H A;  1ZMG A;  1SW4 A;  2OWS A;  4XKQ A;  4KYD A;  2B3F A;  4R74 A;  4JWO A;  2Q8J A;  1S9T A;  5JK4 A;  1AL3 A;  4OEV A;  3Q25 A;  4RYA A;  4LZ5 A;  2WKY A;  5H8Q A;  5AA2 D;  1MRP A;  2ESN A;  4N6P A;  2NUV A;  2M8C A;  5L9O A;  1A7L A;  4QFK A;  2Q2A A;  3TZA A;  2DWI A;  2F78 A;  5L8D A;  1OIB A;  1DOT A;  3S9E A;  3MUQ A;  4JSO A;  3G7W A;  2O7U A;  2RCA A;  2P1S A;  1LFG A;  4L17 A;  2RKM A;  1JVY A;  1NKX A;  4NWC A;  4NF8 A;  2XXV A;  1DMB A;  3BBR A;  3CIJ A;  4N13 A;  2QS3 A;  1S50 A;  5I59 B;  3S9M C;  4U1O A;  4ZEC A;  4LZ8 A;  3S4U A;  3KSX A;  4KD5 A;  2DVZ A;  2ZMB A;  4YB6 A;  2O1M A;  3IL1 B;  3EN3 A;  2O6A A;  4G68 A;  4ELQ A;  1ZTY A;  4KCD A;  2ZYK A;  3CG1 A;  3I6V A;  4M1V A;  3LSF B;  4BDO A;  3VLW A;  4YKJ A;  3U92 A;  1LAH E;  2HZK A;  3IB1 A;  4U4S A;  4ISU A;  5BWJ A;  2XXW A;  2PBW A;  3R26 A;  2X26 A;  4QFN A;  5A5X A;  3QYT A;  3MVY A;  3KSJ A;  3MAM A;  4ND9 A;  1IXH A;  4HW8 A;  3T93 B;  3IB2 A;  3QXM A;  4RY1 A;  4Q5T A;  4RXL A;  5DEX B;  3N94 A;  1SW5 A;  1XC1 A;  4U1Z A;  1B5I A;  1N76 A;  1MDQ A;  4GXA A;  2DE4 A;  3H4Z A;  4I62 A;  2F35 A;  1A8F A;  1MQI A;  5F7V A;  2QS1 A;  1UTH B;  4X1B A;  2H98 A;  1MPC A;  2NXO A;  3PPN A;  1FW0 A;  1MY3 A;  3UK4 A;  1GR2 A;  1JEV A;  4GVO A;  4XKR A;  1XOC A;  4H8I A;  1D4N A;  1Q35 A;  5CI5 A;  3H6V A;  4H0W A;  1MY0 A;  1VFE A;  4OZ9 A;  2A5T A;  1H43 A;  3PUY E;  4RK9 A;  3RLF E;  1B5J A;  4KR5 A;  1AOV A;  2QS2 A;  4OVJ A;  4FAJ A;  1PB8 A;  2F7A A;  2HCA A;  3HPI A;  5ICQ A;  4DIG A;  4MH5 A;  1LGB C;  4ECF A;  5DYH A;  4PE5 B;  2H25 A;  4ZE8 A;  1EZ9 A;  1RKM A;  1CB6 A;  5I2K B;  3RPW A;  3ZKK A;  4POW A;  3CFX A;  3D4G A;  1YCJ A;  3T9V A;  3TQW A;  4XKP A;  3W15 C;  3KN7 A;  2ONR A;  4GIZ A;  2RC7 A;  4QRZ A;  3Q27 A;  3W9W A;  4LUB A;  4IO6 A;  1ATG A;  3UOR A;  4DXU A;  3VXB A;  1SQY A;  1LBB A;  1P1U A;  1DPE A;  3QIM A;  1B1H A;  3K1P A;  4JDF A;  1B7Z A;  3TAJ A;  3T9X B;  1LCF A;  1M5E A;  2PX1 A;  1O64 A;  4FOR A;  3LSL A;  5K2X A;  1LCT A;  2QS4 A;  2A5S A;  2F34 A;  4ZZA A;  4OES A;  3KGC A;  1I6Q A;  3K6W A;  5FHM A;  4YMB A;  3ECR A;  3IJX B;  1DTZ A;  2ZNS A;  3Q28 A;  3SER A;  2CMO A;  5CBR A;  4HS7 A;  2ANJ A;  1MXW A;  4EQ7 A;  4U4X A;  1FCK A;  1R9Q A;  3EHU A;  1N3W A;  4PQJ A;  3T96 B;  1EU8 A;  1NMU A;  1IXC A;  2OCU A;  3TKD A;  4HTG A;  1TT1 A;  3I5O A;  4C0R A;  1TFD A;  3SET A;  4YU0 A;  3RT6 B;  5H8Q B;  4QFL A;  1JW4 A;  4E0X A;  2I3V A;  4M4G A;  1O63 A;  5HM4 B;  5DVI A;  3E9X A;  2VP1 A;  5I59 A;  3UIF A;  3MVW A;  3ZS6 A;  3DEL B;  4NMY A;  2QMX A;  3PPQ A;  4NF8 B;  2UXA A;  1IIW A;  2IA4 A;  1N04 A;  1FTL A;  4BDN A;  2QL3 A;  3OO6 A;  1NNK A;  3FJ7 A;  1P1Q A;  3PD9 A;  3M3K A;  2XXT A;  3GBA A;  1Y3Q A;  5B7D A;  4R6K A;  3TCF A;  4DZ1 A;  4G68 B;  1A54 A;  1B51 A;  3E4R A;  3IB0 A;  3K0V A;  1I6B A;  1FQE A;  1I69 A;  3GXA A;  3MZB A;  3CG3 A;  2HQ0 A;  2DOJ A;  2ONK E;  5KCJ A;  4GQO A;  1KWH A;  1MM6 A;  3H03 A;  3Q26 A;  5H8F A;  2V25 A;  2DXY A;  1ZU0 A;  2OLB A;  2FNC A;  5A5X B;  2XXY A;  4GXS B;  4LAT A;  4F3G A;  3RQT A;  4PFU A;  4ELO A;  4AB6 A;  3FXQ A;  1A8E A;  1II5 A;  5FHN A;  5L9M A;  3V89 B;  4G2Z A;  1B4H A;  1TXF A;  3QSL A;  4OEU A;  4P0I A;  1MM7 A;  4NF5 B;  5IAI A;  4OET A;  2ZNU A;  4GRK A;  4ESW A;  5TPA A;  4TLM B;  4FJP A;  2UVG A;  4ZS9 A;  1DPP A;  3H3G A;  1B58 A;  1MXX A;  2ZNT A;  3VVD A;  4XXU A;  4YMA A;  1AMF A;  2I4B A;  3C33 A;  4ZEB A;  2A5T B;  3BKI B;  2DYX A;  3PUX E;  4LQ5 A;  5AA3 A;  4EQ9 A;  4GFR A;  4RK2 A;  2VD3 A;  3BFT A;  3HHG A;  2E1S A;  3KN8 A;  3FAS A;  5ITO A;  3CI8 A;  3WAF A;  5LOM A;  3IJO B;  4DE8 A;  3T9U A;  2Y84 A;  3EPE A;  4DDD A;  3W9V A;  1NL5 A;  1Y1Z A;  2GRV A;  3ODB A;  2ZYN A;  1SI0 A;  2H5Y A;  1LLS A;  1GGG A;  1YTV A;  2O84 X;  4AB5 A;  3OEL A;  2UYE A;  3DP8 A;  3KG2 A;  3PUW E;  3PPR A;  4IB2 A;  4WXJ A;  4MFI A;  5IKB A;  3C31 A;  3V5A A;  2DE3 A;  5H8H A;  1NFT A;  3G3H A;  5HBC A;  1USY H;  4ELR A;  2NVU B;  4F19 A;  1RYX A; 
#chains in the Genus database with same CATH topology
 3MZ9 A;  4PDH A;  4LP2 B;  1LBX A;  4IO5 A;  3FXB A;  3K01 A;  2UYF A;  4H65 A;  4ZZE A;  3M3L A;  3QK6 A;  4FEB A;  3TEP A;  2FHY A;  1MH3 A;  4GX6 A;  1G0H A;  1LFH A;  3K1N A;  3IFC A;  3O6H A;  5LDZ A;  2D3I A;  2VOZ A;  1MH4 A;  2GFE A;  4HXV A;  2O7I A;  4PP0 A;  4XIG Q;  3PD8 A;  3N6U A;  1UTB A;  3OEK A;  1JET A;  5ICT A;  4F1V A;  3SEX A;  3GYY A;  4UAB A;  1FTA A;  1M5F A;  5H8N A;  1JNF A;  3KBZ A;  3PPO A;  4YB7 A;  3RTW B;  1LB9 A;  4LON B;  4BDR A;  3THI A;  2XXI A;  4NAP A;  1LEV A;  3KEI A;  4ESX A;  2RCB A;  1MPD A;  3MYU A;  3OO9 A;  1KA1 A;  1UIU A;  4N6D A;  1OLA A;  2RIN A;  4GWZ A;  1IQ7 A;  5EHM A;  5DTB A;  3TOD A;  5ET8 A;  4NWD A;  3K6X A;  3WAE A;  5F1Q A;  5B70 A;  4O7I A;  2DVC A;  3T0J A;  3ZKL A;  1N3X A;  4YAH X;  5KCJ B;  1O7T A;  3C4M A;  3IO6 A;  1Y3N A;  2W7Y A;  3T22 A;  3OSR A;  5H8F B;  3FJM A;  4XFE A;  4GLI A;  3QAX A;  2REG A;  1OVT A;  3A09 A;  4GOT A;  3SEY A;  4NF5 A;  3G3G A;  4U22 A;  4AQ4 A;  2L5V A;  3QUF A;  1BIY A;  2Z8D A;  4U23 A;  3Q29 A;  2XXH A;  4RNS A;  1N84 A;  4GL0 A;  1DSN A;  3DM0 A;  4ZDM A;  3PU5 A;  5J1D A;  4MX6 A;  1LBV A;  2X7Q A;  3K6U A;  1OQG A;  2F97 A;  3QUJ A;  1VSO A;  1B3E A;  1B3G A;  4F39 A;  5ISU A;  2PT1 A;  3IK6 B;  1IIT A;  2XD2 A;  5TPA B;  2LAO A;  4GWS A;  5I84 A;  3L6H A;  2I48 A;  4PFT A;  2E0S A;  1Y9U A;  5H8S A;  1Y1M A;  1URG A;  4OHN A;  1FTM A;  1MY1 A;  2OK2 A;  4XEQ A;  1FTK A;  1LAG E;  5DVJ A;  1R1N A;  1OVB A;  2QRY A;  2FYI A;  1B46 A;  1Y20 A;  3G3I A;  5I57 A;  3RNN A;  1AH5 A;  4Z0I A;  3O6I A;  5IZ3 B;  3K1M A;  3A29 A;  3PPP A;  3O28 A;  4G77 A;  1T0K A;  4H8J A;  1LBC A;  2R6G E;  5BUU A;  1NV2 A;  3HCQ A;  3U93 A;  2DE2 A;  2VPN A;  1B52 A;  3FVO A;  2Y7W A;  1B3L A;  1GV8 A;  2Z8F A;  3R7X A;  5DVF A;  5F24 A;  4K3F A;  4H1X A;  1GVC A;  2DXR A;  3OOA A;  4GF8 A;  5FTH A;  3RT8 A;  2O1L A;  5AE4 A;  3O2A A;  1A99 A;  4F1U A;  4P56 A;  4N4U A;  4F1Y A;  1LFI A;  4I1D A;  5EQ8 A;  3VE1 B;  1N7W A;  2I49 A;  4H6D A;  4PAF A;  1OMP A;  3GLB A;  3V83 A;  4P9K A;  4EQB A;  1CNQ A;  3JZJ A;  2PMS A;  3FGS A;  4TQU Q;  4ZED A;  5KDT A;  1B7U A;  4OFO A;  4PET A;  2DWA A;  3EF7 A;  1UIV A;  5FBP A;  1IXG A;  1XT8 A;  5CMM A;  4G8M A;  5EYH A;  3IR1 A;  3ONM A;  5KZT A;  1MPB A;  3HO7 A;  4F31 B;  3T66 A;  4F3P A;  2GHA A;  4QSC A;  5ET6 A;  2F7C A;  4PBH A;  1D3K A;  5H8H B;  4UAC A;  4JVD A;  3U65 A;  3TYH A;  1WDN A;  2PFZ A;  4MBP A;  4JWX A;  2V84 A;  4FED A;  2DDK A;  3USD A;  3RTF B;  3FV1 A;  2FVZ A;  2UVI A;  4RPO A;  5K2Y A;  3D1R A;  1WOD A;  3K4U A;  3BFU A;  4YB5 A;  4KPT A;  4OMB A;  4OXV A;  1Q1K A;  2WYK A;  4LZ7 A;  2ALU A;  4O8M A;  3T9H B;  3FXU A;  4MEV A;  2HZL A;  5ELV A;  3OEN A;  4OVT A;  1XVY A;  2R71 A;  4XKN A;  3TTR A;  1L5T A;  3TEL A;  2P3N A;  5CC2 A;  3DP4 A;  3IOW A;  1B2H A;  3R6U A;  1PBP A;  3JV9 A;  3RPL A;  2XWV A;  1UTB B;  3FBP A;  2G29 A;  2P2A A;  4JWY A;  2DSF A;  3GZG A;  3DP6 A;  1HSJ A;  1FTJ A;  3OMB A;  4IO7 A;  1NNP A;  5H8N B;  4R72 A;  1B4Z A;  4QFP A;  4EF2 A;  3LBS A;  2ONS A;  1VFD A;  2XXU A;  1FPB A;  3MWB A;  1RDY A;  4ZEF A;  4IY5 A;  2Q89 A;  2XX8 A;  2I0B A;  3KZG A;  3TTM A;  4EUO A;  1MY2 A;  4F3S A;  2V3Q A;  1Y3P A;  4GBW A;  4BDQ A;  1FJ6 A;  3MP6 A;  4MCO A;  4BLA A;  1YYZ A;  1M5D A;  2Q2C A;  4NED A;  2OJT A;  2QPQ A;  4MLV A;  4NE4 A;  1A40 A;  3CHG A;  4DCX A;  1B40 A;  3LR1 A;  2Y7I A;  2THI A;  3MQ9 A;  1SI1 A;  1FBH A;  1NH7 A;  4YKK A;  4I3E A;  1H3D A;  1QVS A;  4F3B A;  2O69 A;  2ABH A;  3IO4 A;  3A3U A;  1POT A;  4PAK A;  2F5X A;  3C35 A;  1B0L A;  1YPN A;  2F36 A;  3K02 A;  4LVQ A;  4X8R A;  1B1X A;  3K00 A;  1KZ8 A;  1DBZ A;  2RC9 A;  2XD3 A;  2HAU A;  4C1T A;  5I2N B;  4LQ2 A;  3LC8 A;  1FPK A;  1URS A;  1URD A;  3M8U A;  4GWU A;  3M3F A;  2IEE A;  2VGQ A;  4PGP A;  3UGW A;  3CFZ A;  1NI9 A;  2ZYM A;  3FVN A;  5ITP A;  3SZP A;  4PFW A;  4F29 A;  1IUD A;  5J16 A;  2Y7P A;  3G3J A;  2I4C A;  2KQZ A;  1BTJ A;  3NOH A;  1WVJ A;  1JEU A;  2OBG A;  4P0G A;  3OXN A;  1MXY A;  5IZ3 A;  1Q9D A;  3TDJ A;  5AA2 A;  5T3J A;  1NV5 A;  3MVZ A;  5CMB A;  5I3S A;  4R9F A;  4JSD A;  5I57 B;  2B65 A;  3DLN A;  3O6G A;  1ZBM A;  4QF9 A;  3B6W A;  4IO3 A;  2P0S A;  5FTI A;  1JW5 A;  4X9T A;  4DXC A;  3E3K A;  3U94 A;  3VVF A;  4H5F A;  4Q8R A;  3E13 X;  1SDX A;  1ELJ A;  4KHZ E;  1LST A;  3OSQ A;  5CM6 A;  3UN6 A;  3VLV A;  1NV4 A;  1YXI A;  1NH8 A;  4R6H A;  2DWH A;  3OD7 A;  2H99 A;  4RA1 A;  1MQG A;  3TTL A;  4Z7E A;  2WEF A;  3RGY A;  1XS5 A;  4KCC A;  4G8N A;  1HSE A;  1FBD A;  1QUK A;  1D9Q A;  5L9S A;  3TUS A;  2XXX A;  5CBS A;  2XXK A;  3HHF A;  4I8C A;  3PUZ E;  1SVX B;  5CMK A;  2NOO A;  4BDL A;  2Y7K A;  3TQL A;  4QXD A;  5M2V A;  1S7Y A;  3V8X B;  3FZV A;  1K9Y A;  1MDP 1;  3MVX A;  3TTN A;  1NV3 A;  2DS9 A;  4I9D A;  4RPN A;  3PMW A;  1N0T A;  1NV0 A;  3MW0 A;  5AA4 A;  4NN3 A;  2DQV A;  3ILT B;  1FJ9 A;  1FTO A;  5KDT B;  2O51 A;  1BKA A;  3CR9 A;  4OWD A;  4F22 A;  1OQH A;  1FPD A;  4KYE A;  1PEB A;  4N8G A;  5HPQ A;  1B0H A;  1DTG A;  1NUZ A;  4DI4 B;  4EF1 A;  2ZZX A;  4HCW A;  3CRB A;  3RY3 A;  4GBV A;  5EYF A;  1FPJ A;  2B4L A;  1D9V A;  3RYD A;  1MQJ A;  4YKI A;  3TMG A;  4OTE A;  2HPG A;  2FA7 A;  4MLQ A;  1SYH A;  1TWY A;  3FVK A;  5TP9 A;  1IMF A;  4FEC A;  3AXF A;  3B8B A;  4NX1 A;  3HST A;  3BIG A;  1LB8 A;  5FHO A;  4UA8 A;  4F18 A;  3IX1 A;  1K9Z A;  2CEX A;  1PBQ A;  1QW0 A;  2F3B A;  1VE4 A;  4MF3 A;  3PUV E;  2I6E A;  2O68 A;  1P1W A;  1YAE A;  4HCY A;  1G0I A;  2OWT A;  2H9B A;  3C32 A;  3KOS A;  3PMX A;  2PYY A;  1A55 A;  3HN0 A;  2XX9 A;  4R73 A;  1FQB A;  4H67 A;  5DT6 A;  3RPL B;  4NTL A;  2XX7 A;  3OO8 A;  3G3F A;  3B6Q A;  1MG1 A;  4H46 A;  3SEW A;  4KQP A;  4P1L A;  3IOT A;  2YLN A;  3KOT A;  4LA9 A;  1AIV A;  3TTK A;  2NWJ A;  3JYR A;  3E79 A;  3S2V A;  1P1O A;  4OVQ A;  1PC3 A;  5JEI A;  4P1E A;  3N6T A;  2F6G A;  3VFJ A;  2PT2 A;  3N5L A;  2PCR A;  1B9J A;  1QUJ A;  4E0W A;  3O9P A;  1HSL A;  1ZKB A;  3IAZ A;  1P1N A;  4ZE9 A;  2Z22 A;  1VR5 A;  1JVX A;  4G68 C;  3O66 A;  1LAF E;  1B3F A;  1BP5 A;  5JTY A;  5EQA A;  1FPL A;  3TCG A;  1ZJL A;  2AL4 A;  4PGN A;  3U1O A;  3RN8 A;  3FJG A;  3FXR A;  1B6H A;  4OFL A;  2QMW A;  1BLF A;  4QHQ A;  3SES A;  4OQO A;  4PAI A;  4OAN A;  5I56 A;  3N26 A;  3CSB A;  1USY E;  4R2F A;  1NV6 A;  5I2N A;  1ZIU A;  1YZ0 A;  2V3T A;  3SDF A;  4R2B A;  5IM2 A;  2PVU A;  3K2D A;  1FQF A;  3IOU A;  4QFO A;  2V4C A;  1NNF A;  4NF4 A;  4MIJ A;  2XXR A;  3VV5 A;  3FUZ A;  1Z7M E;  4FE8 A;  3C34 A;  4TOZ A;  4QSD A;  1FBP A;  1PB9 A;  2HHM A;  2VD2 A;  4PFY A;  4F2Q A;  2OZZ A;  2ZXT A;  3GBB A;  3FAT A;  2FIX A;  2WX9 A;  4MNC A;  1N7X A;  2RF1 A;  4RJZ A;  4OVS A;  2UVJ A;  4YZZ A;  4THI A;  4FAT A;  3H6W A;  1B32 A;  1US4 A;  4KXP A;  3S9N C;  5AA2 B;  3SKP A;  3SEU A;  3ZSF A;  4FBP A;  2XXQ A;  3A3C A;  4X1D A;  1D9Y A;  3F11 A;  2YJP A;  3TPA A;  1R9L A;  3IOV A;  4ZEK A;  4MMP A;  3C36 A;  2F6P A;  4HE1 A;  4R75 A;  4XF5 A;  4IO4 A;  4P3L A;  1H44 A;  4WEP A;  2CZL A;  3O29 A;  2CEY A;  3VVE A;  2DWJ A;  2Q88 A;  1LBW A;  2GH9 A;  5EHS A;  1TFA A;  2F8D A;  2ZYO A;  4OFJ A;  1SD3 A;  2RC8 A;  1IMD A;  4DXB A;  1P99 A;  3TFL A;  3D4C A;  4H5G A;  2AYS A;  3L6G A;  5AA1 A;  1B3H A;  1UQW A;  4KI0 E;  4P11 A;  1H76 A;  4XTC Q;  1MQD A;  2HEU A;  4N91 A;  3ILU B;  2B3B A;  3ISP A;  5I58 B;  2DP8 A;  1FQC A;  3MJN A;  2QVU A;  2XWK A;  4JVC A;  4JXI A;  3LUY A;  4NF6 B;  1FPF A;  4IGT A;  1Y4C A;  5CMC A;  3P7I A;  1JQF A;  4OYV A;  1H45 A;  1ZLQ A;  1XVX A;  1ANF A;  3H6T A;  3IOR A;  5AA4 B;  3S9L C;  1BK4 A;  4N17 A;  3FIR A;  2HXW A;  1MXZ A;  2I0C A;  3FD3 A;  4PDD A;  2XXP A;  4NG7 A;  2XHD A;  3G3K A;  4TLL B;  1XHY A;  3QMF A;  5IZ1 A;  2Q9T A;  4JBZ A;  1Z7N E;  1EZO A;  3MPL A;  3B6T A;  5TP9 B;  2HFB A;  1LAX A;  4PE3 A;  4YKP A;  1PB7 A;  3EKI A;  3KN3 A;  3UA8 A;  2V3U A;  1OLC A;  3MP1 A;  3PV0 E;  3H7M A;  4GWW A;  1M5C A;  4KYS A;  1RDZ A;  2QJE A;  3RUM A;  4P47 A;  2D21 A;  3EHS A;  2HAV A;  1IMC A;  4POX A;  1IXI A;  4N8Y A;  2WBB A;  4GD5 A;  3PGF A;  4PBQ A;  1IEJ A;  4EXL A;  1R6Z A;  4X48 A;  3CSG A;  1QKB A;  2GHB A;  3U72 A;  4QSE A;  4QBA A;  1F9B A;  4OER A;  3VDF A;  1PDA A;  4U2R A;  2Z23 A;  1QUL A;  1QKA A;  3MBP A;  1INP A;  1QUI A;  2R9J A;  3H06 B;  3OEM A;  1M5B A;  1LBZ A;  4H45 A;  5DEX A;  5TU0 A;  4R9G A;  5JTY B;  2JJK A;  1FQA A;  1POY 1;  2F7B A;  5EQ7 A;  3EHT A;  4IGR A;  1I6A A;  2BJJ X;  4OA4 A;  1FBF A;  1UTH A;  3SEV A;  3CVG A;  4BDM A;  2G93 A;  4JB7 A;  2H4I A;  4O3A A;  1IZ1 A;  4P8B A;  4G4P A;  4O3C A;  2XWI A;  5I56 B;  4AS4 A;  1MY4 A;  3EQ1 A;  4OVP A;  4GWO A;  1EH3 A;  4N15 A;  1SYI A;  3FV2 A;  1GTK A;  4C1U A;  1QJM A;  1B05 A;  4NF4 B;  4R6Y A;  2I3W A;  1SW2 A;  1EZP A;  3HV1 A;  4WKM A;  4GL8 A;  1Y4T A;  4ZEI A;  2Y7R A;  3FVG A;  2PFY A;  4N07 A;  1IMB A;  1US5 A;  4U21 A;  3H6U A;  3I3V A;  1J1N A;  1SBP A;  2I58 A;  2Q8M A;  3K6V A;  3O97 A;  3MPK A;  3MP8 A;  2AL5 A;  4F2O A;  3OO7 A;  3KBR A;  3KJ7 A;  4DCY A;  3TCH A;  2D5W A;  1MQH A;  4IR8 A;  2ZZV A;  2VHA A;  3U8Q A;  1MXU A;  5I2K A;  4Q30 B;  1SW1 A;  3LSX A;  3MZ1 A;  4Q0C A;  4O3B A;  3UP9 A;  1FRP A;  2X7P A;  1JW1 A;  4KFQ A;  3KC0 A;  4ONY A;  4PC9 A;  1RYO A;  4IO2 A;  2HXR A;  4WED A;  2YPN A;  1CE2 A;  5DW8 A;  4HE2 A;  1FQD A;  3KFM A;  3VXC A;  1B5H A;  3LSW A;  3HFU A;  2QSX A;  5I58 A;  2R8T A;  1MXV A;  3VLU A;  2AIX A;  1EYJ A;  3KJT A;  1MS7 A;  2REJ A;  2UVH A;  2KLF A;  4G8H A;  4NF6 A;  1QGX A;  3B7D A;  3LUZ A;  2FBP A;  1NNT A;  4DLD A;  4FIM A;  2Z8E A;  4IY6 A;  1FBG A;  1B7H A;  4OEN A;  3T1B A;  4ELP A;  2V93 A;  4EXK A;  4YIC A;  3MC2 A;  4EDP A;  3PMV A;  5CRY A;  3CFL A;  2OX3 A;  3C9H A;  1ZMG A;  1SW4 A;  4G61 A;  1IMA A;  2OWS A;  4XKQ A;  4KYD A;  2B3F A;  4R74 A;  4JWO A;  3KC1 A;  2Q8J A;  1FPE A;  1S9T A;  5JK4 A;  1AL3 A;  2KR0 A;  4OEV A;  3Q25 A;  4RYA A;  4LZ5 A;  2WKY A;  5H8Q A;  5AA2 D;  1MRP A;  2ESN A;  4N6P A;  1SPI A;  2NUV A;  3IFA A;  2M8C A;  5L9O A;  1A7L A;  4QFK A;  2Q2A A;  3TZA A;  2DWI A;  2F78 A;  5L8D A;  1OIB A;  1DOT A;  4NHB A;  4X04 A;  3S9E A;  2QVV A;  3MUQ A;  4JSO A;  3G7W A;  2O7U A;  2RCA A;  4NGU A;  2P1S A;  1LFG A;  4L17 A;  2RKM A;  1JVY A;  4PFI A;  1NKX A;  4NWC A;  4NF8 A;  2XXV A;  1DMB A;  3BBR A;  3CIJ A;  4N13 A;  2QS3 A;  1S50 A;  5I59 B;  3S9M C;  1NUY A;  2CZH A;  4U1O A;  4MNI A;  4ZEC A;  4LZ8 A;  3S4U A;  3KSX A;  5ET5 A;  4GX4 A;  1NV1 A;  4KD5 A;  2DVZ A;  2ZMB A;  4YB6 A;  2O1M A;  3IL1 B;  3EN3 A;  2O6A A;  4G68 A;  4MHF A;  4ELQ A;  1ZTY A;  4KCD A;  4NF0 A;  2ZYK A;  3CG1 A;  3I6V A;  4M1V A;  3LSF B;  4BDO A;  3VLW A;  4YKJ A;  3U92 A;  4HE0 A;  1LAH E;  5LTC A;  2HZK A;  3IB1 A;  4U4S A;  4ISU A;  5BWJ A;  2XXW A;  4JVI A;  2PBW A;  4I40 A;  3R26 A;  2VT5 A;  2X26 A;  2VPO A;  4QFN A;  5A5X A;  1FPG A;  3QYT A;  3MVY A;  3KSJ A;  3MAM A;  4ND9 A;  1IXH A;  4HW8 A;  3T93 B;  3IB2 A;  3QXM A;  4RY1 A;  4Q5T A;  4RXL A;  5DEX B;  5IGA A;  3N94 A;  1SW5 A;  1XC1 A;  4U1Z A;  1B5I A;  1N76 A;  1MDQ A;  4GXA A;  2DE4 A;  4AS5 A;  3H4Z A;  4I62 A;  2F35 A;  4OVR A;  1A8F A;  1MQI A;  5F7V A;  2QS1 A;  1UTH B;  4X1B A;  2H98 A;  4GX3 A;  1MPC A;  2NXO A;  2QFL A;  3PPN A;  1FW0 A;  1MY3 A;  3UK4 A;  1GR2 A;  1LBY A;  1JEV A;  4GVO A;  1XOC A;  4XKR A;  4H8I A;  1D4N A;  2P3V A;  1Q35 A;  5CI5 A;  3H6V A;  4H0W A;  5I5P A;  1MY0 A;  1VFE A;  4OZ9 A;  1DCU A;  2A5T A;  1H43 A;  1DK4 A;  2CZI A;  3PUY E;  4O94 A;  4RK9 A;  3RLF E;  1B5J A;  4KR5 A;  1AOV A;  2QS2 A;  3E78 A;  1NUX A;  4OVJ A;  4FAJ A;  1PB8 A;  2F7A A;  2HCA A;  3LV0 A;  4PF8 A;  3HPI A;  3B50 A;  5ICQ A;  4DIG A;  4MH5 A;  1FPI A;  1LGB C;  4ECF A;  5DYH A;  2OWZ A;  4PE5 B;  2H25 A;  2Q74 A;  4ZE8 A;  1EZ9 A;  1RKM A;  4GWX A;  4NQ8 A;  1CB6 A;  1AWB A;  5I2K B;  3RPW A;  3ZKK A;  4POW A;  3CFX A;  1NV7 A;  3D4G A;  1YCJ A;  3T9V A;  3TQW A;  4XKP A;  3W15 C;  3KN7 A;  1VDW A;  2ONR A;  4GIZ A;  2RC7 A;  4QRZ A;  3Q27 A;  3W9W A;  4LUB A;  4IO6 A;  5ET7 A;  3ROJ A;  1ATG A;  3UOR A;  4DXU A;  3VXB A;  1SQY A;  1LBB A;  1P1U A;  1DPE A;  3QIM A;  1B1H A;  3K1P A;  4JDF A;  2WYP A;  1B7Z A;  2F3D A;  3TAJ A;  3T9X B;  1LCF A;  1M5E A;  2PX1 A;  4PFB A;  1O64 A;  4FOR A;  1FSA A;  3LSL A;  5K2X A;  1LCT A;  2QS4 A;  1NUW A;  2A5S A;  2F34 A;  2WBD A;  4OES A;  4ZZA A;  3KGC A;  1I6Q A;  3K6W A;  2MKZ A;  5FHM A;  4YMB A;  3ECR A;  3IJX B;  1DTZ A;  2Y5K A;  4PF6 A;  4PCD A;  2ZNS A;  3Q28 A;  3SER A;  2CMO A;  5CBR A;  4HS7 A;  2ANJ A;  1MXW A;  4EQ7 A;  4U4X A;  1FCK A;  1R9Q A;  3EHU A;  1N3W A;  4PQJ A;  3T96 B;  1EU8 A;  1NMU A;  1IXC A;  2B4M A;  2OCU A;  3TKD A;  4HTG A;  5I7I A;  1TT1 A;  3I5O A;  4C0R A;  1TFD A;  4MAG A;  3SET A;  4YU0 A;  3RT6 B;  1KA0 A;  5H8Q B;  4QFL A;  1JP4 A;  1JW4 A;  4E0X A;  4MNP A;  2I3V A;  4M4G A;  1O63 A;  5HM4 B;  5DVI A;  3E9X A;  2VP1 A;  5I59 A;  3UIF A;  3MVW A;  3ZS6 A;  5A5L A;  4MJO A;  3DEL B;  4NMY A;  2QMX A;  3PPQ A;  4NF8 B;  2UXA A;  1IIW A;  2IA4 A;  1N04 A;  1FTL A;  4BDN A;  2QL3 A;  3OO6 A;  1NNK A;  1IME A;  3FJ7 A;  3MST A;  1P1Q A;  3PD9 A;  3M3K A;  2XXT A;  3GBA A;  1Y3Q A;  5B7D A;  1EYK A;  4R6K A;  3TCF A;  4DZ1 A;  4G68 B;  4PTK A;  1A54 A;  1B51 A;  3E4R A;  3IB0 A;  3K0V A;  1I6B A;  1FQE A;  1I69 A;  3GXA A;  2GQ1 A;  3MZB A;  3CG3 A;  2HQ0 A;  2DOJ A;  2ONK E;  5KCJ A;  5ESY A;  4GQO A;  1FBC A;  1KWH A;  1MM6 A;  3H03 A;  3Q26 A;  5H8F A;  2V25 A;  4DI3 D;  2DXY A;  1ZU0 A;  2OLB A;  2FNC A;  1RDX A;  2CZK A;  5A5X B;  2XXY A;  4GXS B;  4LAT A;  4PFR A;  4F3G A;  3RQT A;  4PFU A;  4ELO A;  4AB6 A;  3FXQ A;  1A8E A;  1II5 A;  5FHN A;  5L9M A;  3V89 B;  4N6K A;  4G2Z A;  3PTY A;  1B4H A;  1TXF A;  3QSL A;  4OEU A;  2XA5 A;  4P0I A;  1MM7 A;  4NF5 B;  5IAI A;  2BJI A;  4OET A;  2ZNU A;  4GRK A;  4ESW A;  5TPA A;  3BIH A;  4TLM B;  4FJP A;  2UVG A;  4N81 A;  4ZS9 A;  1DPP A;  3H3G A;  1B58 A;  1MXX A;  2ZNT A;  3VVD A;  4XXU A;  4YMA A;  1AMF A;  2I4B A;  5IZZ A;  3C33 A;  4ZEB A;  2A5T B;  3BKI B;  1FBE A;  2DYX A;  3PUX E;  4LQ5 A;  5AA3 A;  4O7M A;  4EQ9 A;  4GFR A;  4RK2 A;  2VD3 A;  3BFT A;  3HHG A;  2E1S A;  3KN8 A;  2QVR A;  3FAS A;  5ITO A;  3CI8 A;  3WAF A;  5LOM A;  3IJO B;  4DE8 A;  3T9U A;  4GWY A;  2Y84 A;  3EPE A;  4DDD A;  3W9V A;  1NL5 A;  1Y1Z A;  2GRV A;  2ZZW A;  3ODB A;  4LN5 A;  2ZYN A;  5EYG A;  1SI0 A;  2XWO A;  2H5Y A;  1LLS A;  1GGG A;  1YTV A;  2O84 X;  4AB5 A;  1EYI A;  3OEL A;  2UYE A;  3DP8 A;  3KG2 A;  2FIE A;  3PUW E;  3PPR A;  4IB2 A;  4I3Y A;  4WXJ A;  4MFI A;  5EQ9 A;  5IKB A;  3C31 A;  3V5A A;  2Y5L A;  2DE3 A;  5H8H A;  1NFT A;  3G3H A;  5HBC A;  1USY H;  4ELR A;  2NVU B;  4F19 A;  1RYX A;  1XI6 A; 
#chains in the Genus database with same CATH homology
 3MZ9 A;  4LP2 B;  4IO5 A;  3K01 A;  2UYF A;  4H65 A;  4ZZE A;  3M3L A;  3QK6 A;  4FEB A;  3TEP A;  1MH3 A;  1LFH A;  3K1N A;  3O6H A;  2D3I A;  2VOZ A;  1MH4 A;  2GFE A;  2O7I A;  4PP0 A;  4XIG Q;  3PD8 A;  3N6U A;  1UTB A;  3OEK A;  1JET A;  5ICT A;  4F1V A;  3SEX A;  1M5F A;  5H8N A;  1JNF A;  3PPO A;  4YB7 A;  3RTW B;  1LB9 A;  4LON B;  4BDR A;  3THI A;  2XXI A;  3KEI A;  4ESX A;  2RCB A;  1MPD A;  3OO9 A;  1UIU A;  1OLA A;  2RIN A;  5EHM A;  1IQ7 A;  5DTB A;  3TOD A;  4NWD A;  3K6X A;  3WAE A;  5F1Q A;  5B70 A;  2DVC A;  3ZKL A;  1N3X A;  4YAH X;  5KCJ B;  1O7T A;  3C4M A;  3IO6 A;  1Y3N A;  2W7Y A;  3T22 A;  3OSR A;  5H8F B;  3FJM A;  4GLI A;  3QAX A;  2REG A;  1OVT A;  3A09 A;  4GOT A;  3SEY A;  4NF5 A;  3G3G A;  4U22 A;  4AQ4 A;  3QUF A;  1BIY A;  2Z8D A;  4U23 A;  3Q29 A;  2XXH A;  4RNS A;  1N84 A;  4GL0 A;  1DSN A;  3DM0 A;  4ZDM A;  3PU5 A;  5J1D A;  2X7Q A;  3K6U A;  1OQG A;  2F97 A;  3QUJ A;  1VSO A;  1B3E A;  1B3G A;  4F39 A;  5ISU A;  2PT1 A;  3IK6 B;  1IIT A;  2XD2 A;  5TPA B;  2LAO A;  5I84 A;  3L6H A;  2I48 A;  4PFT A;  2E0S A;  1Y9U A;  5H8S A;  1Y1M A;  1URG A;  4OHN A;  1FTM A;  1MY1 A;  2OK2 A;  1FTK A;  1LAG E;  5DVJ A;  1R1N A;  1OVB A;  2QRY A;  2FYI A;  1B46 A;  1Y20 A;  3G3I A;  5I57 A;  3RNN A;  1AH5 A;  4Z0I A;  3O6I A;  3K1M A;  3PPP A;  3O28 A;  4G77 A;  1T0K A;  4H8J A;  1LBC A;  2R6G E;  5BUU A;  3HCQ A;  3U93 A;  2DE2 A;  1B52 A;  3FVO A;  2Y7W A;  1B3L A;  1GV8 A;  2Z8F A;  3R7X A;  5DVF A;  4K3F A;  4H1X A;  1GVC A;  2DXR A;  3OOA A;  4GF8 A;  5FTH A;  3RT8 A;  2O1L A;  5AE4 A;  3O2A A;  1A99 A;  4F1U A;  4F1Y A;  1LFI A;  4I1D A;  3VE1 B;  1N7W A;  2I49 A;  4H6D A;  1OMP A;  3GLB A;  3V83 A;  4EQB A;  3JZJ A;  2PMS A;  3FGS A;  4TQU Q;  4ZED A;  5KDT A;  1B7U A;  4OFO A;  4PET A;  2DWA A;  3EF7 A;  1UIV A;  1IXG A;  1XT8 A;  5CMM A;  4G8M A;  3IR1 A;  3ONM A;  5KZT A;  1MPB A;  3HO7 A;  4F31 B;  3T66 A;  4F3P A;  2GHA A;  4QSC A;  2F7C A;  1D3K A;  5H8H B;  4UAC A;  3TYH A;  1WDN A;  4MBP A;  4JWX A;  2V84 A;  4FED A;  3USD A;  3RTF B;  3FV1 A;  2UVI A;  4RPO A;  5K2Y A;  1WOD A;  3K4U A;  3BFU A;  4YB5 A;  4KPT A;  4OMB A;  4OXV A;  1Q1K A;  4LZ7 A;  2ALU A;  3T9H B;  3FXU A;  2HZL A;  5ELV A;  3OEN A;  1XVY A;  2R71 A;  4XKN A;  3TTR A;  1L5T A;  3TEL A;  5CC2 A;  3DP4 A;  3IOW A;  1B2H A;  3R6U A;  1PBP A;  3JV9 A;  1UTB B;  2G29 A;  2P2A A;  4JWY A;  2DSF A;  3GZG A;  3DP6 A;  1HSJ A;  1FTJ A;  3OMB A;  4IO7 A;  1NNP A;  5H8N B;  4R72 A;  1B4Z A;  4QFP A;  4EF2 A;  3LBS A;  2ONS A;  1VFD A;  2XXU A;  3MWB A;  4ZEF A;  4IY5 A;  2Q89 A;  2XX8 A;  2I0B A;  3KZG A;  3TTM A;  4EUO A;  1MY2 A;  4F3S A;  2V3Q A;  1Y3P A;  4BDQ A;  3MP6 A;  4BLA A;  1M5D A;  2Q2C A;  4NED A;  2OJT A;  2QPQ A;  4MLV A;  4NE4 A;  1A40 A;  4DCX A;  1B40 A;  3LR1 A;  2Y7I A;  2THI A;  3MQ9 A;  1SI1 A;  1NH7 A;  4YKK A;  1H3D A;  1QVS A;  4F3B A;  2O69 A;  2ABH A;  3IO4 A;  3A3U A;  1POT A;  2F5X A;  3C35 A;  1B0L A;  1YPN A;  2F36 A;  3K02 A;  4LVQ A;  1B1X A;  3K00 A;  2RC9 A;  2XD3 A;  2HAU A;  4C1T A;  5I2N B;  4LQ2 A;  3LC8 A;  1URS A;  1URD A;  3M8U A;  3M3F A;  2IEE A;  2VGQ A;  3UGW A;  3CFZ A;  2ZYM A;  3FVN A;  5ITP A;  4PFW A;  4F29 A;  1IUD A;  2Y7P A;  3G3J A;  2I4C A;  1BTJ A;  1WVJ A;  1JEU A;  2OBG A;  4P0G A;  3OXN A;  1MXY A;  3TDJ A;  5AA2 A;  3MVZ A;  5CMB A;  4R9F A;  4JSD A;  5I57 B;  2B65 A;  3DLN A;  3O6G A;  1ZBM A;  4QF9 A;  3B6W A;  4IO3 A;  2P0S A;  5FTI A;  1JW5 A;  4X9T A;  4DXC A;  3E3K A;  3U94 A;  3VVF A;  4H5F A;  4Q8R A;  3E13 X;  1SDX A;  1ELJ A;  4KHZ E;  1LST A;  3OSQ A;  5CM6 A;  3UN6 A;  3VLV A;  1NH8 A;  4R6H A;  2DWH A;  3OD7 A;  2H99 A;  4RA1 A;  1MQG A;  3TTL A;  4Z7E A;  3RGY A;  1XS5 A;  4KCC A;  4G8N A;  1HSE A;  1QUK A;  5L9S A;  3TUS A;  2XXX A;  5CBS A;  3HHF A;  4I8C A;  3PUZ E;  1SVX B;  5CMK A;  2NOO A;  4BDL A;  2Y7K A;  3TQL A;  5M2V A;  1S7Y A;  3V8X B;  3FZV A;  1MDP 1;  3MVX A;  3TTN A;  2DS9 A;  4I9D A;  4RPN A;  3PMW A;  1N0T A;  3MW0 A;  5AA4 A;  2DQV A;  3ILT B;  5KDT B;  1FTO A;  2O51 A;  1BKA A;  3CR9 A;  4OWD A;  4F22 A;  1OQH A;  4KYE A;  1PEB A;  5HPQ A;  1B0H A;  1DTG A;  4EF1 A;  4HCW A;  3CRB A;  3RY3 A;  5EYF A;  1D9V A;  1MQJ A;  4YKI A;  3TMG A;  4OTE A;  2FA7 A;  4MLQ A;  1SYH A;  1TWY A;  3FVK A;  5TP9 A;  4FEC A;  3AXF A;  3HST A;  1LB8 A;  5FHO A;  4UA8 A;  4F18 A;  3IX1 A;  1PBQ A;  1QW0 A;  1VE4 A;  4MF3 A;  3PUV E;  2I6E A;  2O68 A;  1P1W A;  1YAE A;  4HCY A;  2OWT A;  2H9B A;  3C32 A;  3KOS A;  3PMX A;  2PYY A;  1A55 A;  3HN0 A;  2XX9 A;  4R73 A;  1FQB A;  4H67 A;  5DT6 A;  4NTL A;  2XX7 A;  3OO8 A;  3G3F A;  3B6Q A;  1MG1 A;  3SEW A;  4KQP A;  3IOT A;  2YLN A;  3KOT A;  4LA9 A;  1AIV A;  3TTK A;  2NWJ A;  3JYR A;  3S2V A;  1P1O A;  1PC3 A;  5JEI A;  3N6T A;  2F6G A;  3VFJ A;  2PT2 A;  3N5L A;  1B9J A;  1QUJ A;  4E0W A;  3O9P A;  1HSL A;  1ZKB A;  3IAZ A;  1P1N A;  4ZE9 A;  2Z22 A;  1VR5 A;  1JVX A;  4G68 C;  3O66 A;  1LAF E;  1B3F A;  1BP5 A;  5JTY A;  3TCG A;  1ZJL A;  2AL4 A;  3U1O A;  3RN8 A;  3FJG A;  3FXR A;  1B6H A;  4OFL A;  2QMW A;  1BLF A;  4QHQ A;  3SES A;  4OQO A;  5I56 A;  3N26 A;  3CSB A;  1USY E;  4R2F A;  5I2N A;  1ZIU A;  2V3T A;  3SDF A;  4R2B A;  2PVU A;  3K2D A;  1FQF A;  3IOU A;  4QFO A;  1NNF A;  4NF4 A;  2XXR A;  3VV5 A;  3FUZ A;  1Z7M E;  4FE8 A;  3C34 A;  4TOZ A;  4QSD A;  1PB9 A;  2VD2 A;  4PFY A;  4F2Q A;  2OZZ A;  2ZXT A;  3GBB A;  3FAT A;  1N7X A;  2RF1 A;  4RJZ A;  2UVJ A;  4YZZ A;  4THI A;  4FAT A;  3H6W A;  1B32 A;  1US4 A;  3S9N C;  5AA2 B;  3SKP A;  3SEU A;  3ZSF A;  2XXQ A;  3A3C A;  4X1D A;  1D9Y A;  3F11 A;  2YJP A;  3TPA A;  1R9L A;  3IOV A;  4ZEK A;  3C36 A;  2F6P A;  4R75 A;  4IO4 A;  1H44 A;  4WEP A;  2CZL A;  3O29 A;  3VVE A;  2DWJ A;  2Q88 A;  2GH9 A;  5EHS A;  1TFA A;  2F8D A;  2ZYO A;  4OFJ A;  1SD3 A;  2RC8 A;  4DXB A;  1P99 A;  3TFL A;  3D4C A;  4H5G A;  2AYS A;  3L6G A;  5AA1 A;  1B3H A;  1UQW A;  4KI0 E;  4P11 A;  1H76 A;  4XTC Q;  1MQD A;  2HEU A;  3ILU B;  2B3B A;  5I58 B;  2DP8 A;  1FQC A;  3MJN A;  4JXI A;  3LUY A;  4NF6 B;  4IGT A;  1Y4C A;  5CMC A;  3P7I A;  1JQF A;  4OYV A;  1H45 A;  1ZLQ A;  1XVX A;  1ANF A;  3H6T A;  3IOR A;  5AA4 B;  3S9L C;  3FIR A;  2HXW A;  1MXZ A;  2I0C A;  3FD3 A;  2XXP A;  2XHD A;  3G3K A;  4TLL B;  1XHY A;  2Q9T A;  4JBZ A;  1Z7N E;  1EZO A;  3MPL A;  3B6T A;  5TP9 B;  2HFB A;  1LAX A;  4YKP A;  1PB7 A;  3KN3 A;  3UA8 A;  2V3U A;  1OLC A;  3MP1 A;  3PV0 E;  3H7M A;  1M5C A;  4KYS A;  2QJE A;  3RUM A;  2D21 A;  3EHS A;  2HAV A;  4POX A;  1IXI A;  4GD5 A;  3PGF A;  1IEJ A;  4EXL A;  1R6Z A;  4X48 A;  3CSG A;  1QKB A;  2GHB A;  3U72 A;  4QSE A;  1F9B A;  4OER A;  3VDF A;  1PDA A;  4U2R A;  2Z23 A;  1QUL A;  1QKA A;  3MBP A;  1QUI A;  2R9J A;  3H06 B;  3OEM A;  1M5B A;  5DEX A;  5TU0 A;  4R9G A;  5JTY B;  1FQA A;  1POY 1;  2F7B A;  3EHT A;  4IGR A;  1I6A A;  2BJJ X;  1UTH A;  3SEV A;  3CVG A;  4BDM A;  2G93 A;  4JB7 A;  2H4I A;  4O3A A;  1IZ1 A;  4G4P A;  4O3C A;  5I56 B;  1MY4 A;  3EQ1 A;  4GWO A;  1EH3 A;  1SYI A;  3FV2 A;  1GTK A;  4C1U A;  1QJM A;  1B05 A;  4NF4 B;  4R6Y A;  2I3W A;  1SW2 A;  1EZP A;  3HV1 A;  4WKM A;  4GL8 A;  1Y4T A;  4ZEI A;  2Y7R A;  3FVG A;  4N07 A;  1US5 A;  4U21 A;  3H6U A;  3I3V A;  1J1N A;  1SBP A;  2I58 A;  3K6V A;  3O97 A;  3MPK A;  3MP8 A;  2AL5 A;  4F2O A;  3OO7 A;  3KBR A;  3KJ7 A;  4DCY A;  3TCH A;  2D5W A;  1MQH A;  2VHA A;  3U8Q A;  1MXU A;  5I2K A;  4Q30 B;  1SW1 A;  3LSX A;  3MZ1 A;  4Q0C A;  4O3B A;  3UP9 A;  2X7P A;  1JW1 A;  4KFQ A;  4ONY A;  1RYO A;  4IO2 A;  4WED A;  2YPN A;  1CE2 A;  1FQD A;  3KFM A;  3VXC A;  1B5H A;  3LSW A;  2QSX A;  5I58 A;  1MXV A;  3VLU A;  2AIX A;  3KJT A;  1MS7 A;  2REJ A;  2UVH A;  2KLF A;  4G8H A;  4NF6 A;  3B7D A;  1NNT A;  4DLD A;  4FIM A;  2Z8E A;  4IY6 A;  1B7H A;  4OEN A;  4ELP A;  2V93 A;  4EXK A;  4YIC A;  3MC2 A;  4EDP A;  3PMV A;  5CRY A;  3CFL A;  3C9H A;  1ZMG A;  1SW4 A;  2OWS A;  4XKQ A;  4KYD A;  2B3F A;  4R74 A;  4JWO A;  2Q8J A;  1S9T A;  5JK4 A;  1AL3 A;  4OEV A;  3Q25 A;  4RYA A;  4LZ5 A;  2WKY A;  5H8Q A;  5AA2 D;  1MRP A;  2ESN A;  4N6P A;  2NUV A;  2M8C A;  5L9O A;  1A7L A;  4QFK A;  2Q2A A;  3TZA A;  2DWI A;  2F78 A;  5L8D A;  1OIB A;  1DOT A;  3S9E A;  3MUQ A;  4JSO A;  3G7W A;  2O7U A;  2RCA A;  2P1S A;  1LFG A;  4L17 A;  2RKM A;  1JVY A;  1NKX A;  4NWC A;  4NF8 A;  2XXV A;  1DMB A;  3BBR A;  3CIJ A;  4N13 A;  2QS3 A;  1S50 A;  5I59 B;  3S9M C;  4U1O A;  4ZEC A;  4LZ8 A;  3S4U A;  3KSX A;  4KD5 A;  2DVZ A;  2ZMB A;  4YB6 A;  2O1M A;  3IL1 B;  3EN3 A;  2O6A A;  4G68 A;  4ELQ A;  1ZTY A;  4KCD A;  2ZYK A;  3CG1 A;  3I6V A;  4M1V A;  3LSF B;  4BDO A;  3VLW A;  4YKJ A;  3U92 A;  1LAH E;  2HZK A;  3IB1 A;  4U4S A;  4ISU A;  5BWJ A;  2XXW A;  2PBW A;  3R26 A;  2X26 A;  4QFN A;  5A5X A;  3QYT A;  3MVY A;  3KSJ A;  3MAM A;  4ND9 A;  1IXH A;  4HW8 A;  3T93 B;  3IB2 A;  3QXM A;  4RY1 A;  4Q5T A;  4RXL A;  5DEX B;  3N94 A;  1SW5 A;  1XC1 A;  4U1Z A;  1B5I A;  1N76 A;  1MDQ A;  4GXA A;  2DE4 A;  3H4Z A;  4I62 A;  2F35 A;  1A8F A;  1MQI A;  5F7V A;  2QS1 A;  1UTH B;  4X1B A;  2H98 A;  1MPC A;  2NXO A;  3PPN A;  1FW0 A;  1MY3 A;  3UK4 A;  1GR2 A;  1JEV A;  4GVO A;  4XKR A;  1XOC A;  4H8I A;  1D4N A;  1Q35 A;  5CI5 A;  3H6V A;  4H0W A;  1MY0 A;  1VFE A;  4OZ9 A;  2A5T A;  1H43 A;  3PUY E;  4RK9 A;  3RLF E;  1B5J A;  4KR5 A;  1AOV A;  2QS2 A;  4OVJ A;  4FAJ A;  1PB8 A;  2F7A A;  2HCA A;  3HPI A;  5ICQ A;  4DIG A;  4MH5 A;  1LGB C;  4ECF A;  5DYH A;  4PE5 B;  2H25 A;  4ZE8 A;  1EZ9 A;  1RKM A;  1CB6 A;  5I2K B;  3RPW A;  3ZKK A;  4POW A;  3CFX A;  3D4G A;  1YCJ A;  3T9V A;  3TQW A;  4XKP A;  3W15 C;  3KN7 A;  2ONR A;  4GIZ A;  2RC7 A;  4QRZ A;  3Q27 A;  3W9W A;  4LUB A;  4IO6 A;  1ATG A;  3UOR A;  4DXU A;  3VXB A;  1SQY A;  1LBB A;  1P1U A;  1DPE A;  3QIM A;  1B1H A;  3K1P A;  4JDF A;  1B7Z A;  3TAJ A;  3T9X B;  1LCF A;  1M5E A;  2PX1 A;  1O64 A;  4FOR A;  3LSL A;  5K2X A;  1LCT A;  2QS4 A;  2A5S A;  2F34 A;  4ZZA A;  4OES A;  3KGC A;  1I6Q A;  3K6W A;  5FHM A;  4YMB A;  3ECR A;  3IJX B;  1DTZ A;  2ZNS A;  3Q28 A;  3SER A;  2CMO A;  5CBR A;  4HS7 A;  2ANJ A;  1MXW A;  4EQ7 A;  4U4X A;  1FCK A;  1R9Q A;  3EHU A;  1N3W A;  4PQJ A;  3T96 B;  1EU8 A;  1NMU A;  1IXC A;  2OCU A;  3TKD A;  4HTG A;  1TT1 A;  3I5O A;  4C0R A;  1TFD A;  3SET A;  4YU0 A;  3RT6 B;  5H8Q B;  4QFL A;  1JW4 A;  4E0X A;  2I3V A;  4M4G A;  1O63 A;  5HM4 B;  5DVI A;  3E9X A;  2VP1 A;  5I59 A;  3UIF A;  3MVW A;  3ZS6 A;  3DEL B;  4NMY A;  2QMX A;  3PPQ A;  4NF8 B;  2UXA A;  1IIW A;  2IA4 A;  1N04 A;  1FTL A;  4BDN A;  2QL3 A;  3OO6 A;  1NNK A;  3FJ7 A;  1P1Q A;  3PD9 A;  3M3K A;  2XXT A;  3GBA A;  1Y3Q A;  5B7D A;  4R6K A;  3TCF A;  4DZ1 A;  4G68 B;  1A54 A;  1B51 A;  3E4R A;  3IB0 A;  3K0V A;  1I6B A;  1FQE A;  1I69 A;  3GXA A;  3MZB A;  3CG3 A;  2HQ0 A;  2DOJ A;  2ONK E;  5KCJ A;  4GQO A;  1KWH A;  1MM6 A;  3H03 A;  3Q26 A;  5H8F A;  2V25 A;  2DXY A;  1ZU0 A;  2OLB A;  2FNC A;  5A5X B;  2XXY A;  4GXS B;  4LAT A;  4F3G A;  3RQT A;  4PFU A;  4ELO A;  4AB6 A;  3FXQ A;  1A8E A;  1II5 A;  5FHN A;  5L9M A;  3V89 B;  4G2Z A;  1B4H A;  1TXF A;  3QSL A;  4OEU A;  4P0I A;  1MM7 A;  4NF5 B;  5IAI A;  4OET A;  2ZNU A;  4GRK A;  4ESW A;  5TPA A;  4TLM B;  4FJP A;  2UVG A;  4ZS9 A;  1DPP A;  3H3G A;  1B58 A;  1MXX A;  2ZNT A;  3VVD A;  4XXU A;  4YMA A;  1AMF A;  2I4B A;  3C33 A;  4ZEB A;  2A5T B;  3BKI B;  2DYX A;  3PUX E;  4LQ5 A;  5AA3 A;  4EQ9 A;  4GFR A;  4RK2 A;  2VD3 A;  3BFT A;  3HHG A;  2E1S A;  3KN8 A;  3FAS A;  5ITO A;  3CI8 A;  3WAF A;  5LOM A;  3IJO B;  4DE8 A;  3T9U A;  2Y84 A;  3EPE A;  4DDD A;  3W9V A;  1NL5 A;  1Y1Z A;  2GRV A;  3ODB A;  2ZYN A;  1SI0 A;  2H5Y A;  1LLS A;  1GGG A;  1YTV A;  2O84 X;  4AB5 A;  3OEL A;  2UYE A;  3DP8 A;  3KG2 A;  3PUW E;  3PPR A;  4IB2 A;  4WXJ A;  4MFI A;  5IKB A;  3C31 A;  3V5A A;  2DE3 A;  5H8H A;  1NFT A;  3G3H A;  5HBC A;  1USY H;  4ELR A;  2NVU B;  4F19 A;  1RYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...