1DTGA

Human transferrin n-lobe mutant h249e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
331
structure length
331
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDNYELLCLDNTRKPVDEYKDCHLAQVPSETVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of the iron ligand His 249 to Glu in the N-lobe of human transferrin abolishes the dilysine "trigger" but does not significantly affect iron release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords TRANSFERRIN
total genus 106
structure length 331
sequence length 331
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 2000-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1dtgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1dtgA02
4C1UA 2HQ0A 3UGWA 1AL3A 1MQDA 2Z8EA 2PX1A 1RKMA 4OENA 3PGFA 4U2RA 3OMBA 4YU0A 2F7AA 1JVYA 1ZBMA 3ONMA 4YAHX 3G3GA 3OO8A 2RC8A 3O6IA 1JEVA 4Z0IA 5DVJA 1IIWA 1CE2A 3KJTA 3K6XA 2DVZA 3O6HA 1JVXA 2F6PA 4O3CA 1P99A 3USDA 1MRPA 1MDQA 3ILUB 4FATA 1LFHA 4RYAA 2NVUB 5DVFA 1D9VA 3K6VA 3KSJA 1MY3A 2ESNA 2VHAA 5TPAA 5JK4A 3OXNA 3WAEA 3B6TA 3VE1B 2F36A 3OEKA 1DPPA 4HTGA 3L6GA 4ELRA 1FQBA 4X1BA 1AOVA 3BFTA 1L5TA 2THIA 5CC2A 3M8UA 3UK4A 5CM6A 3N26A 3JYRA 4H67A 4XKPA 3M3KA 2DWJA 3K00A 3OEMA 4YKJA 4M4GA 3FASA 3MZBA 4IO2A 3ILTB 1RYOA 3CFLA 1BTJA 1PB8A 4NTLA 2ZYNA 3IB1A 1QJMA 1M5CA 4Q8RA 1LSTA 4OZ9A 3VXBA 3JZJA 5CMBA 1ZKBA 5KCJB 4F19A 3S9MC 4PFTA 1PEBA 2W7YA 3IO6A 3IO4A 4IO3A 5I56A 2QMWA 1B9JA 4NEDA 1LAFE 4ZZAA 1H43A 1MXWA 1GVCA 1LFGA 1ANFA 2UVGA 3N94A 1URSA 2BJJX 3FXRA 1MQJA 2NOOA 3K02A 4LATA 5H8QB 4EF2A 1BP5A 2ZNTA 3I3VA 3T22A 5CBRA 3FVKA 2RCBA 1FTLA 4NF4A 1Z7NE 5TU0A 4NF5B 3HHFA 1ZLQA 5FHNA 4F29A 2F7BA 5H8HA 2I3VA 5K2XA 5I56B 3E13X 3V83A 4OXVA 1LB9A 1I6AA 3PMVA 1UTBB 4UACA 3EHTA 1NNTA 5AE4A 3KN7A 1P1OA 3N6UA 4IGTA 2UYFA 4GL8A 3VFJA 5IAIA 4GQOA 1LCTA 1A55A 2R9JA 2VP1A 2Z8DA 1M5DA 3C34A 2DWIA 2O7UA 1IITA 3KOTA 4ELQA 2F78A 4F3PA 2LAOA 3S9EA 4GLIA 5ELVA 1Y20A 1BKAA 2IA4A 3OOAA 4KYSA 5I57A 4QF9A 3KEIA 3V89B 2Q88A 3MC2A 5BUUA 4RNSA 4ZECA 3F11A 5H8NB 2O1MA 2Y7PA 4WEPA 1MQGA 1D9YA 4GXSB 1Z7ME 4OERA 3DM0A 3K6UA 4GWOA 3Q28A 1R6ZA 3TTLA 3P7IA 4K3FA 3DLNA 4R72A 3FV2A 1TT1A 1ZTYA 1P1QA 3MP8A 3LR1A 2HZKA 3IORA 3I5OA 1SW1A 1SD3A 1LAHE 3MPKA 3QIMA 2RKMA 4X48A 3TCGA 4ZEDA 1DTZA 1QULA 2VD2A 2XXVA 2YLNA 3VXCA 3O6GA 4LQ2A 4TQUQ 3MZ1A 1OLAA 4ESXA 3R6UA 1GGGA 2I0CA 1S50A 4U23A 3RN8A 3H06B 3MVYA 4ZE8A 5AA4A 5I2NB 1I69A 1IXCA 1LB8A 2Y7RA 4QSEA 4BDMA 4QSCA 4OEVA 5FHOA 4F3GA 4X9TA 1IZ1A 2ANJA 3U93A 4QFKA 3A3CA 3QUJA 4GRKA 4HCYA 4POWA 2UVHA 3KOSA 4F31B 1Y3QA 2Q8JA 2DQVA 3RT6B 3UORA 2I6EA 4ZS9A 4RPNA 1MXVA 1B52A 3U8QA 1URDA 3QK6A 3LC8A 5J1DA 3H03A 4ELOA 4DCXA 4ZE9A 2O68A 2PYYA 2RINA 4ZZEA 4QFPA 4Q30B 3T66A 2OJTA 3RTWB 2IEEA 1POY1 1B3EA 1UIUA 5ICQA 3PUZE 4LUBA 4YB5A 1FTKA 1H76A 3E4RA 5DYHA 1B7ZA 3K0VA 2V25A 3LSLA 1MQIA 4ND9A 1JW4A 2XXUA 5EHMA 2QSXA 1Y3PA 2HZLA 4ESWA 5I2KB 1B3HA 1R9QA 3FZVA 3TYHA 4G8MA 1TWYA 4EXLA 4F2OA 3EN3A 1NKXA 4GF8A 1QUJA 1B7HA 1Y3NA 3LSFB 4KFQA 1RYXA 4XKRA 3TELA 4YZZA 3FV1A 4KCDA 5EYFA 4JXIA 4BDQA 5H8FA 2DE4A 3PPNA 2V84A 3GBAA 5B7DA 2XXIA 2PVUA 1B1HA 2H25A 2OWTA 4UA8A 1ZU0A 4LVQA 3KGCA 4MLVA 1MY0A 2XXYA 1BIYA 3IJXB 1HSJA 3PPPA 5DTBA 1YAEA 1WDNA 1P1WA 5F7VA 1FQCA 3CRBA 1MQHA 1N0TA 1B40A 2DVCA 3KN8A 3ODBA 1OIBA 3LSWA 4R9FA 1MM7A 2GHAA 2I4CA 1A8EA 3T96B 4EXKA 1LAGE 1FQDA 2REGA 5HBCA 5I58A 4DIGA 3H7MA 1F9BA 2YPNA 3VLWA 3RNNA 3BKIB 4BDNA 2G29A 3ZKLA 1IXGA 4EQ7A 4EQBA 4O3AA 3B6WA 1LLSA 5IKBA 1JEUA 3H6UA 3C33A 2V93A 4R2FA 2GRVA 5FTIA 2R6GE 3E9XA 1N76A 3TQLA 4F18A 3EPEA 2O84X 3MQ9A 5AA2A 3KN3A 1US5A 4BLAA 1Q35A 3CIJA 3TODA 1UTHA 4MF3A 4DDDA 1A7LA 2D21A 3EHSA 2E1SA 4E0WA 5ISUA 2OBGA 2DSFA 4Q0CA 4R6KA 3VV5A 3UIFA 4F1UA 3RUMA 5H8HB 1VFDA 4N6PA 3B7DA 4H8IA 3I6VA 2I48A 2XXQA 3C36A 4FECA 1Y1MA 4JWXA 3VVFA 5I58B 3PUWE 1YTVA 4KHZE 1B46A 2DWHA 4XIGQ 4RY1A 3G3HA 4PETA 4RPOA 2AL5A 1S7YA 2GH9A 2XXWA 1UIVA 5FHMA 3FVNA 2NXOA 2V3UA 3C35A 3QXMA 1O64A 4GD5A 3TDJA 2AIXA 3LUYA 5AA2B 1EZOA 2Q2CA 2O6AA 1SI1A 3ECRA 1DSNA 2B3FA 1QVSA 2B3BA 2FNCA 2RCAA 3WAFA 2G93A 3TKDA 1FCKA 4NMYA 4WEDA 1B58A 3TTMA 4O3BA 4U21A 3T9UA 5M2VA 3RPWA 4F1VA 2AL4A 4N13A 3SEXA 2O7IA 1MH3A 1MDP1 3FJGA 3W9VA 3MBPA 2NUVA 1N7XA 2M8CA 1SQYA 3MVZA 3G3KA 4GFRA 4KYEA 4JWOA 5H8QA 4BDRA 4RK2A 4AB5A 1P1UA 2HAUA 1N7WA 4TOZA 1S9TA 2DE3A 5CMKA 3IOVA 2VD3A 4I9DA 1A40A 1UTHB 3MP6A 4NF5A 5L9OA 2PT2A 1B5HA 2DYXA 2Q9TA 3HCQA 3K1PA 4MBPA 5F1QA 3FIRA 4E0XA 3LBSA 3SDFA 3MJNA 2DWAA 1N04A 2H99A 4IY6A 5L9SA 4P0IA 2UVJA 4R74A 3VLUA 5AA2D 1DMBA 1VE4A 2HXWA 4OWDA 4GXAA 1EZ9A 3G3FA 3HSTA 4Q5TA 4QFLA 3FXUA 3SKPA 1B5JA 2XXPA 5DVIA 3H6TA 3KJ7A 2FA7A 4F39A 4H6DA 4RJZA 1VSOA 3TCFA 1IEJA 2Q89A 2A5SA 1LAXA 1URGA 1MXUA 2XX8A 4R73A 2F97A 1D3KA 4FE8A 4OYVA 4L17A 3PD8A 1HSLA 3IX1A 4XKQA 2H4IA 1LBBA 1XT8A 4YKKA 4ZEBA 2P0SA 2XXTA 4EUOA 1Y9UA 1N3XA 4HW8A 3CSBA 3Q25A 3H4ZA 5ITPA 1US4A 2ONRA 4OFOA 1SI0A 2H98A 3RGYA 3TMGA 4OTEA 1SDXA 2XD2A 4P0GA 3OENA 1B4HA 2D5WA 2UVIA 2HEUA 3QSLA 4KCCA 4OHNA 1B3FA 1NL5A 4IB2A 4IO4A 3CG3A 4OQOA 1JW1A 2H5YA 2ZYKA 4IO6A 1II5A 3N6TA 5ITOA 1M5EA 1MM6A 1FTOA 1NH7A 1UQWA 3MVXA 4H0WA 3FGSA 1B1XA 4IGRA 4LQ5A 2REJA 3H3GA 4G8HA 2V3QA 4R6HA 2HCAA 1A54A 3K6WA 4NF6A 1N84A 2B65A 3IJOB 4OEUA 2QJEA 3TFLA 4DXUA 4F2QA 1FQEA 1TFDA 4ELPA 3D4CA 3OELA 3MZ9A 3PUYE 4GVOA 1MXYA 1ZJLA 4JBZA 3U72A 4FAJA 5I2KA 4TLMB 3RTFB 4YMBA 3H6WA 4ZDMA 5I84A 4G8NA 5DT6A 4Z7EA 3JV9A 2F5XA 2HFBA 2OCUA 1IQ7A 3AXFA 3FATA 3MW0A 4R75A 1OQHA 4RXLA 5CBSA 1OLCA 2NWJA 4DZ1A 3OO7A 1D4NA 1CB6A 1MXZA 4U4SA 1B0HA 2OZZA 3FVOA 3GZGA 3PUVE 5CI5A 1TFAA 2QS4A 1Y1ZA 2O51A 3RY3A 1MPCA 2YJPA 3VDFA 3KG2A 4GIZA 3SETA 1KWHA 1B32A 1B51A 2Y84A 1O7TA 3FUZA 2F6GA 1FW0A 2E0SA 3IAZA 3O29A 3HHGA 4FEBA 4XTCQ 1POTA 2I3WA 4FJPA 4ZEIA 3G7WA 4R2BA 4QFOA 1PDAA 3IOWA 3CVGA 5B70A 5BWJA 3HN0A 3DP6A 4H65A 4DCYA 1JW5A 5KCJA 4NWCA 1XVXA 1GTKA 4LZ5A 4MLQA 3FXQA 2XXRA 1JETA 3S2VA 4YKIA 3DELB 3CG1A 3T9HB 1LGBC 1XOCA 4PFUA 2PMSA 4RA1A 3ZSFA 1MH4A 1MY2A 3T9VA 4OMBA 4F3BA 3IL1B 4JDFA 3SEUA 3SEVA 3TTRA 1SW5A 1FQAA 4LP2B 5AA3A 3KFMA 1PB7A 4DXCA 3BFUA 1SVXB 1Y4TA 3MVWA 3H6VA 4ZEFA 5L8DA 3VVEA 1OVBA 2RC9A 3GBBA 1SW2A 1HSEA 3U1OA 2DS9A 3PMXA 1MPBA 3CR9A 2UYEA 4YB6A 2H9BA 4IY5A 2OK2A 2X7PA 1R9LA 1NH8A 4DLDA 1VFEA 3A3UA 4QRZA 3TZAA 5AA4B 1I6BA 5A5XB 4FEDA 3TCHA 3EHUA 4BDOA 2Q2AA 2VOZA 5LOMA 3E3KA 2Z8FA 3FJMA 3PV0E 3OSQA 1NMUA 2I49A 4U22A 5H8FB 5H8NA 2DOJA 3THIA 4ECFA 5KDTB 4G4PA 2DE2A 2F35A 1NFTA 4H1XA 4NF4B 3EF7A 4OESA 3K1MA 1QKAA 5I2NA 4ZEKA 3RQTA 1XVYA 2QS1A 5EHSA 3K1NA 2WKYA 1GV8A 2A5TA 3LSXA 3TTKA 4I1DA 4U4XA 3IR1A 1PBPA 2QRYA 1USYH 3U92A 3UP9A 3W15C 1FTMA 2Z22A 2ZYOA 3C4MA 3IK6B 2XXXA 4YMAA 2XXHA 2UXAA 1B3LA 3GXAA 4LZ8A 1MY1A 4N07A 2RC7A 2GHBA 2ZNUA 3C31A 1FQFA 3HPIA 4KD5A 2P1SA 2RF1A 3CFZA 3Q29A 4NE4A 4PFYA 3OSRA 5AA1A 1USYE 4HS7A 4MFIA 2Y7KA 5FTHA 2ZNSA 2O1LA 3D4GA 3G3IA 2ZXTA 3PUXE 5DEXB 4POXA 5JTYB 3L6HA 1LFIA 4EF1A 1DPEA 4JB7A 4C1TA 1OVTA 1DTGA 1SBPA 3MPLA 3R26A 4FIMA 2QMXA 3FVGA 4G68B 3W9WA 4BDLA 4GOTA 3TTNA 1NNPA 5CMCA 3UA8A 2Y7IA 4KI0E 5L9MA 2D3IA 1ZIUA 3PU5A 3SEYA 5K2YA 1OMPA 1OQGA 1MXXA 1YCJA 2F7CA 3O9PA 5CMMA 1DOTA 1PC3A 1PBQA 5H8SA 2I4BA 3G3JA 4OETA 2I58A 5TP9A 1QKBA 4XXUA 1I6QA 3IOTA 5KZTA 3C32A 3OO6A 2AYSA 4IO5A 3K2DA 1GR2A 3OO9A 4GL0A 4QHQA 1ZMGA 4U1ZA 5DEXA 2QS3A 4NF8A 4KQPA 4WXJA 1WODA 4IO7A 3GLBA 1B4ZA 4NF8B 3R7XA 2XHDA 4PFWA 3QAXA 4F1YA 3IOUA 3KSXA 5CRYA 3MWBA 1H3DA 4THIA 3RLFE 1A8FA 5TP9B 3VLVA 3N5LA 3S4UA 3B6QA 2QL3A 1QW0A 3O2AA 1JNFA 1WVJA 4ONYA 4XKNA 1T0KA 2XD3A 2V3TA 2DP8A 4H8JA 4M1VA 2F34A 2FYIA 1QUKA 2A5TB 2OWSA 4LONB 1MPDA 4G68C 2PBWA 3SEWA 4HCWA 2KLFA 2VGQA 1QUIA 3V8XB 4YKPA 3V5AA 1H45A 4PP0A 1TXFA 4DXBA 5I59A 3TUSA 1Y4CA 2QS2A 3OD7A 4I62A 3MAMA 4U1OA 4RK9A 1FTJA 3TQWA 4G68A 3M3LA 4JWYA 3T93B 3M3FA 4F22A 4C0RA 4FORA 3O97A 3C9HA 1B2HA 1IXHA 3PPOA 4G77A 4P11A 3T9XB 5A5XA 4WKMA 1EZPA 1AH5A 4QFNA 4YICA 4MH5A 1MY4A 1LBCA 2P2AA 2X26A 4AB6A 3SERA 1YPNA 4NF6B 1B05A 4NWDA 3TEPA 5HPQA 1NNKA 4ISUA 4KR5A 1H44A 5JEIA 1M5FA 2GFEA 3FD3A 5ICTA 3HO7A 3K01A 3QYTA 1EU8A 3BBRA 3FJ7A 1NNFA 2R71A 1XHYA 2XX9A 4JSOA 1AMFA 2HAVA 3CI8A 2QPQA 1ELJA 3QUFA 2Y7WA 1MS7A 4OFLA 4YB7A 2ABHA 1P1NA 3O28A 4H5GA 5HM4B 4I8CA 3PD9A 1B6HA 2ONKE 1B3GA 2PT1A 3S9LC 1B5IA 1B7UA 3A09A 3ZKKA 5I57B 1O63A 3IB2A 3TPAA 4LA9A 4F3SA 5KDTA 1ATGA 4EDPA 4KPTA 1A99A 1SW4A 2Z23A 3U94A 3Q26A 3DP4A 2OLBA 3O66A 3PPRA 4QSDA 1IXIA 2DXYA 4X1DA 1IUDA 3TAJA 1B0LA 3RT8A 3MUQA 4PE5B 3S9NC 1LCFA 4EQ9A 3ZS6A 4KYDA 3UN6A 1N3WA 3MP1A 3PPQA 1VR5A 2CZLA 4JSDA 3SESA 4TLLB 1J1NA 1SYHA 3VVDA 1XC1A 2O69A 4LZ7A 3CSGA 2ZYMA 3K4UA 4OVJA 4R9GA 4R6YA 4DE8A 5I59B 1SYIA 4H5FA 3KBRA 3KZGA 2ZMBA 1MG1A 1JQFA 1M5BA 1BLFA 2ONSA 3HV1A 3EQ1A 4PQJA 1Q1KA 2XX7A 1AIVA 1R1NA 3DP8A 5TPAB 4AQ4A 1PB9A 2F8DA 5JTYA 3Q27A 1XS5A 1EH3A 3PMWA 4G2ZA 2DXRA 2ALUA 2I0BA 2X7QA 4OFJA 3IB0A 3CFXA 2CMOA 1UTBA
chains in the Genus database with same CATH superfamily
4NX1A 2F7AA 4YAHX 1JEVA 4Z0IA 1IIWA 2PFZA 4KXPA 1IMCA 1MDQA 3WAEA 2F36A 3M8UA 4H67A 4XKPA 3K00A 4IO2A 1BTJA 1PB8A 2ZYNA 4OZ9A 5KCJB 1ZKBA 3S9MC 1PEBA 3IO4A 1B9JA 4ZZAA 1H43A 4MEVA 2UVGA 1MQJA 4EF2A 1G0IA 2R8TA 2RCBA 4N8YA 1FTLA 4NF4A 2XWIA 4NF5B 1ZLQA 2F7BA 4HE1A 5H8HA 5K2XA 1LB9A 3PMVA 4QXDA 3N6UA 2UYFA 5IAIA 5I7IA 4PDDA 2QVRA 3C34A 3D1RA 4ELQA 3S9EA 1BKAA 2IA4A 3OOAA 3MC2A 5ET7A 2Y7PA 1D9YA 1EYJA 4GWOA 4K3FA 4H45A 4PFBA 4PE3A 4X48A 3TCGA 1QULA 4N15A 2YLNA 4HXVA 3O6GA 4LQ2A 2I0CA 4U23A 3RN8A 3MVYA 5I2NB 1I69A 4QFKA 4POWA 3KOSA 4F31B 4GWYA 1Y3QA 2Q8JA 3RT6B 1LBZA 1MXVA 3QK6A 2VPOA 3ISPA 4DCXA 4MJOA 2JJKA 1POY1 1UIUA 5ICQA 4PGNA 3KC0A 4LUBA 3E4RA 2V25A 3LSLA 4PF6A 4X04A 5EHMA 1Y3PA 2HZLA 1R9QA 4EXLA 3EN3A 4DI4B 1RYXA 3TELA 4YZZA 3FV1A 3PPNA 5B7DA 2OWTA 1DBZA 1FPGA 1BIYA 1D9QA 3PPPA 1YAEA 4PFIA 3UORA 3KN8A 1MM7A 2GHAA 5I58A 5HBCA 1IMDA 2QVVA 3VLWA 2G29A 3ZKLA 4EQBA 3T0JA 4R2FA 2V93A 4GWXA 1N76A 3TQLA 1FBFA 3MQ9A 1FRPA 4BLAA 3CIJA 3HFUA 1UTHA 3EHSA 2E1SA 3GYYA 4E0WA 3VV5A 3IFCA 1EYKA 4N6PA 3I6VA 3VVFA 4XIGQ 1NV4A 4PETA 4RPOA 4GWSA 3LUYA 2B3FA 1QVSA 2G93A 4O3BA 4U21A 3T9UA 5M2VA 3SEXA 2O7IA 3MBPA 5I2KB 3MVZA 4KYEA 1SQYA 3G3KA 2OX3A 2HAUA 1S9TA 4I9DA 3MP6A 4NF5A 4JVCA 4PBHA 2Q9TA 4MBPA 4IY6A 2H99A 4P0IA 3VLUA 5AA2D 4OWDA 4GXAA 3G3FA 3HSTA 1B5JA 4F39A 4H6DA 3TCFA 1NV6A 2F97A 4OYVA 4XKQA 4IR8A 1HSLA 3IX1A 2H4IA 4HW8A 2XD2A 2D5WA 4KCCA 1B3FA 3CG3A 1II5A 5DW8A 4LQ5A 2REJA 3H3GA 4G8HA 2V3QA 1FBHA 2B65A 3TFLA 4PC9A 1DK4A 1MXYA 3H6WA 4H46A 5I84A 4R75A 4RXLA 1OLCA 4DZ1A 1CB6A 1MXZA 1B0HA 1FPEA 1TFAA 2YJPA 4OVQA 4GIZA 1B32A 1B51A 2Y84A 3RLFE 4DI3D 2F6GA 4FEBA 1POTA 2I3WA 4FJPA 4NF0A 4QFOA 3IOWA 3CVGA 4DCYA 1XVXA 4LZ5A 4MLQA 1LGBC 1XOCA 4PFUA 4OA4A 4OMBA 3TTRA 4N4UA 3SEVA 5AA3A 1PB7A 1SVXB 1KA1A 1OVBA 2DS9A 3BIHA 3A3UA 1I6BA 4AS5A 4FEDA 3TCHA 2Z8FA 3FJMA 3PV0E 1NMUA 3THIA 5H8NA 5KDTB 2F35A 1FTAA 1LBWA 4H1XA 3EF7A 4GX3A 1USYH 2Z22A 3IK6B 4N07A 2XXHA 1B3LA 2RC7A 4FBPA 2BJIA 2O1LA 5DEXB 5JTYB 3L6HA 4JB7A 1DTGA 3FVGA 4GOTA 1ZIUA 4XF5A 1YCJA 3O9PA 5TP9A 3IOTA 4NHBA 4IO5A 3K2DA 1GR2A 2QS3A 1WODA 3R7XA 4PFWA 4THIA 4F2OA 2Q74A 2XD3A 2V3TA 2F34A 2A5TB 2PBWA 1QUIA 4YKPA 3TUSA 3OD7A 4GBWA 4G68A 4HE0A 4JWYA 4WKMA 1AH5A 2X26A 1FPLA 4ISUA 1H44A 3FD3A 5ICTA 3HO7A 4JSOA 2HAVA 1G0HA 3O28A 4N17A 1B7UA 1K9YA 3IB2A 3TPAA 1NI9A 4F3SA 4PAFA 1SW4A 3Q26A 4PTKA 3DP4A 2OLBA 4X1DA 1IUDA 3TAJA 3S9NC 4PE5B 4KYDA 3UN6A 3MP1A 3PPQA 4JSDA 1J1NA 1SYHA 3VVDA 3CSGA 2ZYMA 1FJ6A 5I3SA 1SYIA 1BLFA 1Q1KA 5TPAB 2F8DA 3Q27A 2ALUA 2I0BA 3IB0A 2GH9A 4C1UA 3UGWA 1AL3A 1RKMA 1IMBA 4U2RA 1ZBMA 3ONMA 3G3GA 3FBPA 3OO8A 3O6IA 5DVJA 3KJTA 3K6XA 2DVZA 1FPDA 1JVXA 2F6PA 4O3CA 1LFHA 1D9VA 3KSJA 2VHAA 4P3LA 3OEKA 1AOVA 1L5TA 2DDKA 3N26A 2DWJA 3OEMA 4M4GA 1Q9DA 3CFLA 4NTLA 4ZECA 1QJMA 3JZJA 2GQ1A 2W7YA 3IO6A 4IO3A 1GVCA 1ANFA 3N94A 2BJJX 3NOHA 3FXRA 2NOOA 3K02A 4LATA 1FPFA 2ZNTA 4JVIA 4P1EA 5TU0A 3HHFA 5FHNA 4GX6A 2I3VA 3E13X 5J16A 4OXVA 5ITPA 1UTBB 3KN7A 3VFJA 2CZHA 4GQOA 2R9JA 1M5DA 2F78A 4MHFA 5I57A 4QF9A 3KEIA 4P8BA 5H8NB 1LBVA 1Z7ME 4MAGA 3Q28A 3TTLA 3P7IA 4R72A 1ZTYA 3LR1A 3IORA 1SW1A 4ZEDA 2XXVA 3VXCA 3R6UA 1GGGA 3H06B 4BDMA 5FHOA 4X9TA 1IZ1A 3U93A 3QUJA 2DQVA 2I6EA 4ZS9A 3U8QA 1URDA 3LC8A 2O68A 3T66A 2OJTA 3RTWB 2IEEA 5IZZA 1B3EA 3PUZE 4YB5A 1FTKA 1B7ZA 4NAPA 5EYHA 1TWYA 1NKXA 1QUJA 1Y3NA 4KFQA 4O7MA 2DE4A 4UA8A 3KGCA 1MY0A 3LV0A 2XXYA 1P1WA 3CRBA 3B50A 1MQHA 2DVCA 1FQDA 4DIGA 2YPNA 3BKIB 4EQ7A 3H6UA 2OWZA 5AA2A 3KN3A 5A5LA 1FPBA 5ISUA 2OBGA 4Q0CA 3UIFA 5H8HB 1VFDA 5I58B 4FECA 1YTVA 3G3HA 1S7YA 1FPIA 3C35A 4N6DA 4GD5A 3TDJA 2AIXA 2RCAA 3TKDA 1FCKA 3TTMA 1NUZA 1MH3A 4PFRA 4JWOA 5H8QA 1P1UA 2WBDA 3IOVA 2VD3A 1RDXA 2PT2A 3HCQA 3K1PA 4OANA 2HXWA 4Q5TA 3SKPA 5DVIA 4I3EA 4OVSA 1URGA 4R73A 4YKKA 2P0SA 1N3XA 4OTEA 1SDXA 1B4HA 2XWKA 4OHNA 1NL5A 4IO4A 1NV5A 2H5YA 2ZYKA 3N6TA 4H0WA 4IGRA 4MNIA 2Y5KA 4R6HA 1A54A 1TFDA 3U72A 3MZ9A 1NV2A 4G8NA 4Z7EA 3JV9A 2HFBA 5CBSA 1OQHA 3OO7A 1D4NA 5CI5A 3FVOA 3GZGA 1Y1ZA 3SETA 1KWHA 1O7TA 3O29A 3IAZA 2E0SA 3HN0A 5KCJA 1JW5A 4NWCA 3DELB 2PMSA 4P47A 4RA1A 1MH4A 1MY2A 3SEUA 5ET5A 4DXCA 5L8DA 3H6VA 4ZEFA 3VVEA 3GBBA 1HSEA 1MPBA 3CR9A 2UYEA 4YB6A 4O94A 2QFLA 2OK2A 2X7PA 3ROJA 1NH8A 2L5VA 2Q2AA 5LOMA 1DCUA 3OSQA 5H8FB 2DOJA 4OESA 5I2NA 3K1NA 2WKYA 4PF8A 3TTKA 3UP9A 3U92A 1FTMA 3C4MA 2XXXA 2UXAA 5H8FA 3C31A 3Q29A 4PAKA 5FTHA 2ZNSA 3D4GA 3G3IA 3SZPA 2PFYA 4POXA 1OVTA 3MPLA 4FIMA 4G68B 3W9WA 5IM2A 1FBDA 5CMCA 3UA8A 2Y7IA 2D3IA 3PU5A 3SEYA 1OQGA 1MXXA 2F7CA 1PC3A 1PBQA 5H8SA 2I4BA 4OETA 2I58A 5KZTA 4U1ZA 1ZMGA 2WYKA 4KQPA 3GLBA 3QAXA 4NN3A 1A8FA 5TP9B 3VLVA 3N5LA 1T0KA 2QL3A 1WVJA 4M1VA 2DP8A 4H8JA 4GX4A 4LONB 2OWSA 4NGUA 4G68C 3SEWA 2VGQA 1TXFA 5I59A 1Y4CA 4U1OA 3MAMA 4P1LA 1FTJA 4RK9A 4FORA 3C9HA 4G77A 4P11A 5A5XA 1LBCA 3CHGA 4NWDA 3TEPA 1FBEA 1EU8A 3FJ7A 2R71A 2QPQA 1ELJA 2Y7WA 2WX9A 2ZZVA 4YB7A 4H5GA 5HM4B 4I8CA 3PD9A 2CEXA 3S9LC 3A09A 5I57B 5KDTA 4EDPA 4KPTA 3EKIA 3O66A 1IXIA 2DXYA 3RT8A 1LCFA 1N3WA 1VR5A 2CZLA 4TLLB 5I59B 4OVJA 2HXRA 4R9GA 4DE8A 3RYDA 4H5FA 3HV1A 1MG1A 1JQFA 1M5BA 3EQ1A 3DP8A 4AQ4A 1EH3A 4G2ZA 5ET6A 3ECRA 2CMOA 1P1QA 1MQDA 2VPNA 4YU0A 1JVYA 2WBBA 1QGXA 2CZKA 4PBQA 3O6HA 1P99A 3USDA 1MRPA 4RYAA 2NVUB 1CNQA 3K6VA 5DVFA 5T3JA 5TPAA 5JK4A 3OXNA 3B6TA 3VE1B 3L6GA 4X1BA 2THIA 3RPLB 4OVPA 3UK4A 3M3KA 4YKJA 3FASA 3ILTB 1M5CA 1LSTA 4F19A 4PFTA 5I56A 1MXWA 2CZIA 1LFGA 3T22A 3QMFA 3FVKA 1Z7NE 4AS4A 5I56B 3V83A 4UACA 1NNTA 4GL8A 1LCTA 1A55A 2VP1A 4OVRA 1IITA 4GLIA 1Y20A 4KYSA 5EQ7A 3V89B 4GWWA 3F11A 2O1MA 4OERA 4GXSB 2MKZA 3K6UA 1EYIA 1R6ZA 1SPIA 1YZ0A 3DLNA 3MP8A 2HZKA 3QIMA 1SD3A 1LAHE 2RKMA 1DTZA 1S50A 1K9ZA 5AA4A 1IXCA 4QSCA 4OEVA 2ANJA 4HCYA 4G61A 2RINA 4ZZEA 1MQIA 2XXUA 4MMPA 3FZVA 3TYHA 4G8MA 3FXBA 3B8BA 4XKRA 1KZ8A 4KCDA 5EYFA 2V84A 1B1HA 1ZU0A 4MX6A 4LVQA 4MLVA 1NV3A 5DTBA 1FQCA 1B40A 3ODBA 4R9FA 3LSWA 2REGA 3H7MA 1F9BA 4BDNA 4O3AA 1LLSA 5IKBA 1JEUA 2GRVA 2R6GE 3E9XA 4F18A 3KBZA 2XWOA 1US5A 2ZZXA 1Q35A 2KQZA 4PAIA 3TODA 4R6KA 2DSFA 4F1UA 3RUMA 3B7DA 2I48A 5IZ3A 3C36A 1Y1MA 3PTYA 3PUWE 1RDZA 4RY1A 2XXWA 1UIVA 3FVNA 2NXOA 1FJ9A 1EZOA 1SI1A 1DSNA 3WAFA 2FNCA 2CEYA 4NMYA 1B58A 3RPWA 1MDP1 3FJGA 3W9VA 4BDRA 4RK2A 1N7WA 4TOZA 2XXKA 1B5HA 2ZZWA 2DYXA 3MJNA 2DWAA 1N04A 5L9SA 2UVJA 1DMBA 1EZ9A 1NUWA 2WEFA 3FXUA 2XXPA 3H6TA 2FA7A 2FHYA 4RJZA 1IEJA 5FBPA 1LAXA 4MNCA 4L17A 1XT8A 4ZEBA 1INPA 4UABA 3CSBA 3Q25A 1US4A 2H98A 3TMGA 4P0GA 4GWUA 2UVIA 2QVUA 4IB2A 4XEQA 1JW1A 4IO6A 5ITOA 1M5EA 1MM6A 4ZEIA 4ZE9A 3MVXA 3FGSA 1LEVA 2HCAA 3K6WA 3IJOB 4OEUA 2QJEA 4DXUA 3PUYE 3OELA 4GVOA 4JBZA 5I2KA 5I5PA 4TLMB 4ZDMA 1FBPA 5DT6A 2F5XA 2OCUA 1IQ7A 3AXFA 3MW0A 4U4SA 2OZZA 3PUVE 2QS4A 2O51A 3RY3A 1MPCA 3VDFA 3KG2A 2F3DA 2HHMA 3FUZA 4XTCQ 2P3NA 4N6KA 4R2BA 1PDAA 3DP6A 2FBPA 3FXQA 2XXRA 1JETA 3S2VA 4YKIA 5IGAA 3CG1A 2FVZA 3T9HB 3T9VA 4JDFA 1FQAA 4LP2B 1Y4TA 2FIXA 2RC9A 1SW2A 3PMXA 1NUXA 5LTCA 4P9KA 2H9BA 1R9LA 4DLDA 3TZAA 5A5XB 3EHUA 4BDOA 2VOZA 4U22A 1NFTA 5IZ1A 3K1MA 1QKAA 4ZEKA 2QS1A 5EHSA 1GV8A 3LSXA 4U4XA 1FBCA 5IZ3B 2ZYOA 4YMAA 4N13A 4F2QA 3RTFB 2ZNUA 1FQFA 3HPIA 4NE4A 2RF1A 3CFZA 3OSRA 4I40A 1USYE 4HS7A 5AA1A 4MFIA 2Y7KA 4F3PA 4LN5A 4EF1A 1DPEA 4C1TA 5LDZA 1SBPA 3R26A 4BDLA 2QMXA 1NNPA 4KI0E 1FPJA 1OMPA 5CMMA 4I3YA 3G3JA 4XXUA 3C32A 3OO6A 3OO9A 4GL0A 4WXJA 4NF8B 4F1YA 3KSXA 1H3DA 3S4UA 3B6QA 1JNFA 1QUKA 5EQ8A 4PP0A 5EYGA 3TQWA 3M3LA 3T93B 3M3FA 4C0RA 3O97A 1IXHA 1EZPA 4MH5A 1MY4A 2P2AA 1YPNA 5HPQA 4KR5A 1M5FA 3QYTA 1FSAA 3BBRA 2XX9A 1AMFA 3IFAA 1MS7A 4OFLA 2ABHA 1P1NA 1XI6A 1LBXA 3MYUA 1B6HA 2Z23A 1AWBA 3PPRA 4QSDA 1B0LA 3MUQA 4EQ9A 3ZS6A 1XC1A 2O69A 4LZ7A 4R6YA 1NV1A 2XX7A 4PQJA 5ESYA 1PB9A 1XS5A 2DXRA 4OFJA 2HQ0A 2Z8EA 2PX1A 4OENA 3PGFA 4NG7A 3OMBA 2B4MA 1RDYA 2RC8A 1CE2A 4PDHA 3ILUB 4FATA 1MY3A 2ESNA 3MSTA 1DPPA 4HTGA 4ELRA 1FQBA 3BFTA 5CC2A 5CM6A 3JYRA 3MZBA 1RYOA 4Q8RA 3IB1A 3VXBA 5CMBA 2QMWA 4NEDA 1LAFE 1NV0A 1URSA 4PCDA 5H8QB 1BP5A 3I3VA 5CBRA 4F29A 1I6AA 3EHTA 5AE4A 2B4LA 1P1OA 4IGTA 2Z8DA 2DWIA 2O7UA 3KOTA 2LAOA 5ELVA 1IMFA 5BUUA 1NUYA 2Q88A 4RNSA 4WEPA 1MQGA 3DM0A 3FV2A 1TT1A 3I5OA 3MPKA 3LUZA 2VD2A 3E79A 4TQUQ 3MZ1A 1OLAA 4ESXA 4ZE8A 1LB8A 2Y7RA 4QSEA 4F3GA 3A3CA 4GRKA 2UVHA 4RPNA 1B52A 1NV7A 5J1DA 3H03A 4ELOA 2PYYA 5ET8A 4QFPA 4Q30B 1H76A 5DYHA 4OVTA 3K0VA 4ND9A 1JW4A 2QSXA 4ESWA 4JVDA 1B3HA 3RPLA 2PCRA 4GF8A 1B7HA 3LSFB 4JXIA 4BDQA 1FPKA 3GBAA 2XXIA 2PVUA 4N91A 4PGPA 2H25A 2V4CA 3IJXB 1HSJA 1WDNA 5F7VA 1N0TA 1OIBA 2I4CA 1A8EA 3T96B 4EXKA 1LAGE 1VDWA 3RNNA 1IXGA 3B6WA 3C33A 5FTIA 4GBVA 3EPEA 2O84X 5EQ9A 4DDDA 4MF3A 1A7LA 4H8IA 2XXQA 4JWXA 4GWZA 4KHZE 1B46A 2DWHA 2AL5A 5FHMA 2V3UA 3QXMA 1O64A 3U65A 5AA2B 2Q2CA 2O6AA 2VT5A 2B3BA 4XFEA 4WEDA 4F1VA 2AL4A 2XA5A 2WYPA 2KR0A 2NUVA 1N7XA 2M8CA 4GFRA 4AB5A 2DE3A 3KC1A 5CMKA 1A40A 1UTHB 5L9OA 5F1QA 4E0XA 3FIRA 3LBSA 3SDFA 2FIEA 4R74A 1VE4A 4QFLA 4HE2A 5EQAA 3KJ7A 1VSOA 2Q89A 2A5SA 2XX8A 1MXUA 1D3KA 4FE8A 3PD8A 1LBBA 2XXTA 4EUOA 1Y9UA 3H4ZA 2ONRA 4OFOA 1SI0A 3RGYA 3OENA 2HEUA 3QSLA 4OQOA 3BIGA 1NH7A 1FTOA 1UQWA 4O7IA 3ZSFA 1B1XA 4X8RA 4N81A 4NF6A 1N84A 1FQEA 4ELPA 3D4CA 1ZJLA 4FAJA 4MCOA 4YMBA 3FATA 3A29A 1IMAA 2NWJA 1FW0A 3HHGA 3G7WA 5B70A 2P3VA 5BWJA 4H65A 1GTKA 1IMEA 4F3BA 3IL1B 1SW5A 3KFMA 3T1BA 3BFUA 3MVWA 1FBGA 3U1OA 2HPGA 4IY5A 1VFEA 4QRZA 5AA4B 1LBYA 4MNPA 3E3KA 2I49A 4ECFA 4G4PA 2DE2A 4NF4B 3RQTA 1XVYA 5F24A 2A5TA 4I1DA 3IR1A 1PBPA 2QRYA 3W15C 3GXAA 1YYZA 1MY1A 4LZ8A 4KD5A 2GHBA 2P1SA 4PFYA 3PUXE 2ZXTA 1LFIA 1KA0A 3TTNA 5L9MA 5K2YA 1DOTA 1QKBA 1I6QA 2AYSA 4QHQA 5DEXA 4NF8A 4IO7A 1B4ZA 2XHDA 3IOUA 5CRYA 3MWBA 3O2AA 4ONYA 1QW0A 4XKNA 2FYIA 4QBAA 1MPDA 4HCWA 2KLFA 3V8XB 4DXBA 3V5AA 1H45A 2QS2A 4I62A 2Y5LA 4F22A 4NQ8A 3PPOA 1B2HA 1BK4A 4P56A 3T9XB 4QFNA 4AB6A 4YICA 3SERA 4NF6B 1B05A 1NNKA 5JEIA 2GFEA 3K01A 1NNFA 1JP4A 1XHYA 3QUFA 3CI8A 2ONKE 1B3GA 2PT1A 1B5IA 3ZKKA 1O63A 2XWVA 4LA9A 1ATGA 1A99A 3U94A 4O8MA 2F3BA 1YXIA 4MIJA 3SESA 2Q8MA 3E78A 3K4UA 3KBRA 3KZGA 2ZMBA 4N8GA 2ONSA 1AIVA 1R1NA 5JTYA 3PMWA 2X7QA 3CFXA 2D21A 1UTBA
chains in the Genus database with same CATH topology
4C1UA 2HQ0A 3UGWA 1AL3A 1MQDA 2Z8EA 2PX1A 1RKMA 4OENA 3PGFA 4U2RA 3OMBA 4YU0A 2F7AA 1JVYA 1ZBMA 3ONMA 4YAHX 3G3GA 3OO8A 2RC8A 3O6IA 1JEVA 4Z0IA 5DVJA 1IIWA 1CE2A 3KJTA 3K6XA 2DVZA 3O6HA 1JVXA 2F6PA 4O3CA 1P99A 3USDA 1MRPA 1MDQA 3ILUB 4FATA 1LFHA 4RYAA 2NVUB 5DVFA 1D9VA 3K6VA 3KSJA 1MY3A 2ESNA 2VHAA 5TPAA 5JK4A 3OXNA 3WAEA 3B6TA 3VE1B 2F36A 3OEKA 1DPPA 4HTGA 3L6GA 4ELRA 1FQBA 4X1BA 1AOVA 3BFTA 1L5TA 2THIA 5CC2A 3M8UA 3UK4A 5CM6A 3N26A 3JYRA 4H67A 4XKPA 3M3KA 2DWJA 3K00A 3OEMA 4YKJA 4M4GA 3FASA 3MZBA 4IO2A 3ILTB 1RYOA 3CFLA 1BTJA 1PB8A 4NTLA 2ZYNA 3IB1A 1QJMA 1M5CA 4Q8RA 1LSTA 4OZ9A 3VXBA 3JZJA 5CMBA 1ZKBA 5KCJB 4F19A 3S9MC 4PFTA 1PEBA 2W7YA 3IO6A 3IO4A 4IO3A 5I56A 2QMWA 1B9JA 4NEDA 1LAFE 4ZZAA 1H43A 1MXWA 1GVCA 1LFGA 1ANFA 2UVGA 3N94A 1URSA 2BJJX 3FXRA 1MQJA 2NOOA 3K02A 4LATA 5H8QB 4EF2A 1BP5A 2ZNTA 3I3VA 3T22A 5CBRA 3FVKA 2RCBA 1FTLA 4NF4A 1Z7NE 5TU0A 4NF5B 3HHFA 1ZLQA 5FHNA 4F29A 2F7BA 5H8HA 2I3VA 5K2XA 5I56B 3E13X 3V83A 4OXVA 1LB9A 1I6AA 3PMVA 1UTBB 4UACA 3EHTA 1NNTA 5AE4A 3KN7A 1P1OA 3N6UA 4IGTA 2UYFA 4GL8A 3VFJA 5IAIA 4GQOA 1LCTA 1A55A 2R9JA 2VP1A 2Z8DA 1M5DA 3C34A 2DWIA 2O7UA 1IITA 3KOTA 4ELQA 2F78A 4F3PA 2LAOA 3S9EA 4GLIA 5ELVA 1Y20A 1BKAA 2IA4A 3OOAA 4KYSA 5I57A 4QF9A 3KEIA 3V89B 2Q88A 3MC2A 5BUUA 4RNSA 4ZECA 3F11A 5H8NB 2O1MA 2Y7PA 4WEPA 1MQGA 1D9YA 4GXSB 1Z7ME 4OERA 3DM0A 3K6UA 4GWOA 3Q28A 1R6ZA 3TTLA 3P7IA 4K3FA 3DLNA 4R72A 3FV2A 1TT1A 1ZTYA 1P1QA 3MP8A 3LR1A 2HZKA 3IORA 3I5OA 1SW1A 1SD3A 1LAHE 3MPKA 3QIMA 2RKMA 4X48A 3TCGA 4ZEDA 1DTZA 1QULA 2VD2A 2XXVA 2YLNA 3VXCA 3O6GA 4LQ2A 4TQUQ 3MZ1A 1OLAA 4ESXA 3R6UA 1GGGA 2I0CA 1S50A 4U23A 3RN8A 3H06B 3MVYA 4ZE8A 5AA4A 5I2NB 1I69A 1IXCA 1LB8A 2Y7RA 4QSEA 4BDMA 4QSCA 4OEVA 5FHOA 4F3GA 4X9TA 1IZ1A 2ANJA 3U93A 4QFKA 3A3CA 3QUJA 4GRKA 4HCYA 4POWA 2UVHA 3KOSA 4F31B 1Y3QA 2Q8JA 2DQVA 3RT6B 3UORA 2I6EA 4ZS9A 4RPNA 1MXVA 1B52A 3U8QA 1URDA 3QK6A 3LC8A 5J1DA 3H03A 4ELOA 4DCXA 4ZE9A 2O68A 2PYYA 2RINA 4ZZEA 4QFPA 4Q30B 3T66A 2OJTA 3RTWB 2IEEA 1POY1 1B3EA 1UIUA 5ICQA 3PUZE 4LUBA 4YB5A 1FTKA 1H76A 3E4RA 5DYHA 1B7ZA 3K0VA 2V25A 3LSLA 1MQIA 4ND9A 1JW4A 2XXUA 5EHMA 2QSXA 1Y3PA 2HZLA 4ESWA 5I2KB 1B3HA 1R9QA 3FZVA 3TYHA 4G8MA 1TWYA 4EXLA 4F2OA 3EN3A 1NKXA 4GF8A 1QUJA 1B7HA 1Y3NA 3LSFB 4KFQA 1RYXA 4XKRA 3TELA 4YZZA 3FV1A 4KCDA 5EYFA 4JXIA 4BDQA 5H8FA 2DE4A 3PPNA 2V84A 3GBAA 5B7DA 2XXIA 2PVUA 1B1HA 2H25A 2OWTA 4UA8A 1ZU0A 4LVQA 3KGCA 4MLVA 1MY0A 2XXYA 1BIYA 3IJXB 1HSJA 3PPPA 5DTBA 1YAEA 1WDNA 1P1WA 5F7VA 1FQCA 3CRBA 1MQHA 1N0TA 1B40A 2DVCA 3KN8A 3ODBA 1OIBA 3LSWA 4R9FA 1MM7A 2GHAA 2I4CA 1A8EA 3T96B 4EXKA 1LAGE 1FQDA 2REGA 5HBCA 5I58A 4DIGA 3H7MA 1F9BA 2YPNA 3VLWA 3RNNA 3BKIB 4BDNA 2G29A 3ZKLA 1IXGA 4EQ7A 4EQBA 4O3AA 3B6WA 1LLSA 5IKBA 1JEUA 3H6UA 3C33A 2V93A 4R2FA 2GRVA 5FTIA 2R6GE 3E9XA 1N76A 3TQLA 4F18A 3EPEA 2O84X 3MQ9A 5AA2A 3KN3A 1US5A 4BLAA 1Q35A 3CIJA 3TODA 1UTHA 4MF3A 4DDDA 1A7LA 2D21A 3EHSA 2E1SA 4E0WA 5ISUA 2OBGA 2DSFA 4Q0CA 4R6KA 3VV5A 3UIFA 4F1UA 3RUMA 5H8HB 1VFDA 4N6PA 3B7DA 4H8IA 3I6VA 2I48A 2XXQA 3C36A 4FECA 1Y1MA 4JWXA 3VVFA 5I58B 3PUWE 1YTVA 4KHZE 1B46A 2DWHA 4XIGQ 4RY1A 3G3HA 4PETA 4RPOA 2AL5A 1S7YA 2GH9A 2XXWA 1UIVA 5FHMA 3FVNA 2NXOA 2V3UA 3C35A 3QXMA 1O64A 4GD5A 3TDJA 2AIXA 3LUYA 5AA2B 1EZOA 2Q2CA 2O6AA 1SI1A 3ECRA 1DSNA 2B3FA 1QVSA 2B3BA 2FNCA 2RCAA 3WAFA 2G93A 3TKDA 1FCKA 4NMYA 4WEDA 1B58A 3TTMA 4O3BA 4U21A 3T9UA 5M2VA 3RPWA 4F1VA 2AL4A 4N13A 3SEXA 2O7IA 1MH3A 1MDP1 3FJGA 3W9VA 3MBPA 2NUVA 1N7XA 2M8CA 1SQYA 3MVZA 3G3KA 4GFRA 4KYEA 4JWOA 5H8QA 4BDRA 4RK2A 4AB5A 1P1UA 2HAUA 1N7WA 4TOZA 1S9TA 2DE3A 5CMKA 3IOVA 2VD3A 4I9DA 1A40A 1UTHB 3MP6A 4NF5A 5L9OA 2PT2A 1B5HA 2DYXA 2Q9TA 3HCQA 3K1PA 4MBPA 5F1QA 3FIRA 4E0XA 3LBSA 3SDFA 3MJNA 2DWAA 1N04A 2H99A 4IY6A 5L9SA 4P0IA 2UVJA 4R74A 3VLUA 5AA2D 1DMBA 1VE4A 2HXWA 4OWDA 4GXAA 1EZ9A 3G3FA 3HSTA 4Q5TA 4QFLA 3FXUA 3SKPA 1B5JA 2XXPA 5DVIA 3H6TA 3KJ7A 2FA7A 4F39A 4H6DA 4RJZA 1VSOA 3TCFA 1IEJA 2Q89A 2A5SA 1LAXA 1URGA 1MXUA 2XX8A 4R73A 2F97A 1D3KA 4FE8A 4OYVA 4L17A 3PD8A 1HSLA 3IX1A 4XKQA 2H4IA 1LBBA 1XT8A 4YKKA 4ZEBA 2P0SA 2XXTA 4EUOA 1Y9UA 1N3XA 4HW8A 3CSBA 3Q25A 3H4ZA 5ITPA 1US4A 2ONRA 4OFOA 1SI0A 2H98A 3RGYA 3TMGA 4OTEA 1SDXA 2XD2A 4P0GA 3OENA 1B4HA 2D5WA 2UVIA 2HEUA 3QSLA 4KCCA 4OHNA 1B3FA 1NL5A 4IB2A 4IO4A 3CG3A 4OQOA 1JW1A 2H5YA 2ZYKA 4IO6A 1II5A 3N6TA 5ITOA 1M5EA 1MM6A 1FTOA 1NH7A 1UQWA 3MVXA 4H0WA 3FGSA 1B1XA 4IGRA 4LQ5A 2REJA 3H3GA 4G8HA 2V3QA 4R6HA 2HCAA 1A54A 3K6WA 4NF6A 1N84A 2B65A 3IJOB 4OEUA 2QJEA 3TFLA 4DXUA 4F2QA 1FQEA 1TFDA 4ELPA 3D4CA 3OELA 3MZ9A 3PUYE 4GVOA 1MXYA 1ZJLA 4JBZA 3U72A 4FAJA 5I2KA 4TLMB 3RTFB 4YMBA 3H6WA 4ZDMA 5I84A 4G8NA 5DT6A 4Z7EA 3JV9A 2F5XA 2HFBA 2OCUA 1IQ7A 3AXFA 3FATA 3MW0A 4R75A 1OQHA 4RXLA 5CBSA 1OLCA 2NWJA 4DZ1A 3OO7A 1D4NA 1CB6A 1MXZA 4U4SA 1B0HA 2OZZA 3FVOA 3GZGA 3PUVE 5CI5A 1TFAA 2QS4A 1Y1ZA 2O51A 3RY3A 1MPCA 2YJPA 3VDFA 3KG2A 4GIZA 3SETA 1KWHA 1B32A 1B51A 2Y84A 1O7TA 3FUZA 2F6GA 1FW0A 2E0SA 3IAZA 3O29A 3HHGA 4FEBA 4XTCQ 1POTA 2I3WA 4FJPA 4ZEIA 3G7WA 4R2BA 4QFOA 1PDAA 3IOWA 3CVGA 5B70A 5BWJA 3HN0A 3DP6A 4H65A 4DCYA 1JW5A 5KCJA 4NWCA 1XVXA 1GTKA 4LZ5A 4MLQA 3FXQA 2XXRA 1JETA 3S2VA 4YKIA 3DELB 3CG1A 3T9HB 1LGBC 1XOCA 4PFUA 2PMSA 4RA1A 3ZSFA 1MH4A 1MY2A 3T9VA 4OMBA 4F3BA 3IL1B 4JDFA 3SEUA 3SEVA 3TTRA 1SW5A 1FQAA 4LP2B 5AA3A 3KFMA 1PB7A 4DXCA 3BFUA 1SVXB 1Y4TA 3MVWA 3H6VA 4ZEFA 5L8DA 3VVEA 1OVBA 2RC9A 3GBBA 1SW2A 1HSEA 3U1OA 2DS9A 3PMXA 1MPBA 3CR9A 2UYEA 4YB6A 2H9BA 4IY5A 2OK2A 2X7PA 1R9LA 1NH8A 4DLDA 1VFEA 3A3UA 4QRZA 3TZAA 5AA4B 1I6BA 5A5XB 4FEDA 3TCHA 3EHUA 4BDOA 2Q2AA 2VOZA 5LOMA 3E3KA 2Z8FA 3FJMA 3PV0E 3OSQA 1NMUA 2I49A 4U22A 5H8FB 5H8NA 2DOJA 3THIA 4ECFA 5KDTB 4G4PA 2DE2A 2F35A 1NFTA 4H1XA 4NF4B 3EF7A 4OESA 3K1MA 1QKAA 5I2NA 4ZEKA 3RQTA 1XVYA 2QS1A 5EHSA 3K1NA 2WKYA 1GV8A 2A5TA 3LSXA 3TTKA 4I1DA 4U4XA 3IR1A 1PBPA 2QRYA 1USYH 3U92A 3UP9A 3W15C 1FTMA 2Z22A 2ZYOA 3C4MA 3IK6B 2XXXA 4YMAA 2XXHA 2UXAA 1B3LA 3GXAA 4LZ8A 1MY1A 4N07A 2RC7A 2GHBA 2ZNUA 3C31A 1FQFA 3HPIA 4KD5A 2P1SA 2RF1A 3CFZA 3Q29A 4NE4A 4PFYA 3OSRA 5AA1A 1USYE 4HS7A 4MFIA 2Y7KA 5FTHA 2ZNSA 2O1LA 3D4GA 3G3IA 2ZXTA 3PUXE 5DEXB 4POXA 5JTYB 3L6HA 1LFIA 4EF1A 1DPEA 4JB7A 4C1TA 1OVTA 1DTGA 1SBPA 3MPLA 3R26A 4FIMA 2QMXA 3FVGA 4G68B 3W9WA 4BDLA 4GOTA 3TTNA 1NNPA 5CMCA 3UA8A 2Y7IA 4KI0E 5L9MA 2D3IA 1ZIUA 3PU5A 3SEYA 5K2YA 1OMPA 1OQGA 1MXXA 1YCJA 2F7CA 3O9PA 5CMMA 1DOTA 1PC3A 1PBQA 5H8SA 2I4BA 3G3JA 4OETA 2I58A 5TP9A 1QKBA 4XXUA 1I6QA 3IOTA 5KZTA 3C32A 3OO6A 2AYSA 4IO5A 3K2DA 1GR2A 3OO9A 4GL0A 4QHQA 1ZMGA 4U1ZA 5DEXA 2QS3A 4NF8A 4KQPA 4WXJA 1WODA 4IO7A 3GLBA 1B4ZA 4NF8B 3R7XA 2XHDA 4PFWA 3QAXA 4F1YA 3IOUA 3KSXA 5CRYA 3MWBA 1H3DA 4THIA 3RLFE 1A8FA 5TP9B 3VLVA 3N5LA 3S4UA 3B6QA 2QL3A 1QW0A 3O2AA 1JNFA 1WVJA 4ONYA 4XKNA 1T0KA 2XD3A 2V3TA 2DP8A 4H8JA 4M1VA 2F34A 2FYIA 1QUKA 2A5TB 2OWSA 4LONB 1MPDA 4G68C 2PBWA 3SEWA 4HCWA 2KLFA 2VGQA 1QUIA 3V8XB 4YKPA 3V5AA 1H45A 4PP0A 1TXFA 4DXBA 5I59A 3TUSA 1Y4CA 2QS2A 3OD7A 4I62A 3MAMA 4U1OA 4RK9A 1FTJA 3TQWA 4G68A 3M3LA 4JWYA 3T93B 3M3FA 4F22A 4C0RA 4FORA 3O97A 3C9HA 1B2HA 1IXHA 3PPOA 4G77A 4P11A 3T9XB 5A5XA 4WKMA 1EZPA 1AH5A 4QFNA 4YICA 4MH5A 1MY4A 1LBCA 2P2AA 2X26A 4AB6A 3SERA 1YPNA 4NF6B 1B05A 4NWDA 3TEPA 5HPQA 1NNKA 4ISUA 4KR5A 1H44A 5JEIA 1M5FA 2GFEA 3FD3A 5ICTA 3HO7A 3K01A 3QYTA 1EU8A 3BBRA 3FJ7A 1NNFA 2R71A 1XHYA 2XX9A 4JSOA 1AMFA 2HAVA 3CI8A 2QPQA 1ELJA 3QUFA 2Y7WA 1MS7A 4OFLA 4YB7A 2ABHA 1P1NA 3O28A 4H5GA 5HM4B 4I8CA 3PD9A 1B6HA 2ONKE 1B3GA 2PT1A 3S9LC 1B5IA 1B7UA 3A09A 3ZKKA 5I57B 1O63A 3IB2A 3TPAA 4LA9A 4F3SA 5KDTA 1ATGA 4EDPA 4KPTA 1A99A 1SW4A 2Z23A 3U94A 3Q26A 3DP4A 2OLBA 3O66A 3PPRA 4QSDA 1IXIA 2DXYA 4X1DA 1IUDA 3TAJA 1B0LA 3RT8A 3MUQA 4PE5B 3S9NC 1LCFA 4EQ9A 3ZS6A 4KYDA 3UN6A 1N3WA 3MP1A 3PPQA 1VR5A 2CZLA 4JSDA 3SESA 4TLLB 1J1NA 1SYHA 3VVDA 1XC1A 2O69A 4LZ7A 3CSGA 2ZYMA 3K4UA 4OVJA 4R9GA 4R6YA 4DE8A 5I59B 1SYIA 4H5FA 3KBRA 3KZGA 2ZMBA 1MG1A 1JQFA 1M5BA 1BLFA 2ONSA 3HV1A 3EQ1A 4PQJA 1Q1KA 2XX7A 1AIVA 1R1NA 3DP8A 5TPAB 4AQ4A 1PB9A 2F8DA 5JTYA 3Q27A 1XS5A 1EH3A 3PMWA 4G2ZA 2DXRA 2ALUA 2I0BA 2X7QA 4OFJA 3IB0A 3CFXA 2CMOA 1UTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1U A;  2HQ0 A;  3UGW A;  1AL3 A;  1MQD A;  2Z8E A;  2PX1 A;  1RKM A;  4OEN A;  3PGF A;  4U2R A;  3OMB A;  4YU0 A;  2F7A A;  1JVY A;  1ZBM A;  3ONM A;  4YAH X;  3G3G A;  3OO8 A;  2RC8 A;  3O6I A;  1JEV A;  4Z0I A;  5DVJ A;  1IIW A;  1CE2 A;  3KJT A;  3K6X A;  2DVZ A;  3O6H A;  1JVX A;  2F6P A;  4O3C A;  1P99 A;  3USD A;  1MRP A;  1MDQ A;  3ILU B;  4FAT A;  1LFH A;  4RYA A;  2NVU B;  5DVF A;  1D9V A;  3K6V A;  3KSJ A;  1MY3 A;  2ESN A;  2VHA A;  5TPA A;  5JK4 A;  3OXN A;  3WAE A;  3B6T A;  3VE1 B;  2F36 A;  3OEK A;  1DPP A;  4HTG A;  3L6G A;  4ELR A;  1FQB A;  4X1B A;  1AOV A;  3BFT A;  1L5T A;  2THI A;  5CC2 A;  3M8U A;  3UK4 A;  5CM6 A;  3N26 A;  3JYR A;  4H67 A;  4XKP A;  3M3K A;  2DWJ A;  3K00 A;  3OEM A;  4YKJ A;  4M4G A;  3FAS A;  3MZB A;  4IO2 A;  3ILT B;  1RYO A;  3CFL A;  1BTJ A;  1PB8 A;  4NTL A;  2ZYN A;  3IB1 A;  1QJM A;  1M5C A;  4Q8R A;  1LST A;  4OZ9 A;  3VXB A;  3JZJ A;  5CMB A;  1ZKB A;  5KCJ B;  4F19 A;  3S9M C;  4PFT A;  1PEB A;  2W7Y A;  3IO6 A;  3IO4 A;  4IO3 A;  5I56 A;  2QMW A;  1B9J A;  4NED A;  1LAF E;  4ZZA A;  1H43 A;  1MXW A;  1GVC A;  1LFG A;  1ANF A;  2UVG A;  3N94 A;  1URS A;  2BJJ X;  3FXR A;  1MQJ A;  2NOO A;  3K02 A;  4LAT A;  5H8Q B;  4EF2 A;  1BP5 A;  2ZNT A;  3I3V A;  3T22 A;  5CBR A;  3FVK A;  2RCB A;  1FTL A;  4NF4 A;  1Z7N E;  5TU0 A;  4NF5 B;  3HHF A;  1ZLQ A;  5FHN A;  4F29 A;  2F7B A;  5H8H A;  2I3V A;  5K2X A;  5I56 B;  3E13 X;  3V83 A;  4OXV A;  1LB9 A;  1I6A A;  3PMV A;  1UTB B;  4UAC A;  3EHT A;  1NNT A;  5AE4 A;  3KN7 A;  1P1O A;  3N6U A;  4IGT A;  2UYF A;  4GL8 A;  3VFJ A;  5IAI A;  4GQO A;  1LCT A;  1A55 A;  2R9J A;  2VP1 A;  2Z8D A;  1M5D A;  3C34 A;  2DWI A;  2O7U A;  1IIT A;  3KOT A;  4ELQ A;  2F78 A;  4F3P A;  2LAO A;  3S9E A;  4GLI A;  5ELV A;  1Y20 A;  1BKA A;  2IA4 A;  3OOA A;  4KYS A;  5I57 A;  4QF9 A;  3KEI A;  3V89 B;  2Q88 A;  3MC2 A;  5BUU A;  4RNS A;  4ZEC A;  3F11 A;  5H8N B;  2O1M A;  2Y7P A;  4WEP A;  1MQG A;  1D9Y A;  4GXS B;  1Z7M E;  4OER A;  3DM0 A;  3K6U A;  4GWO A;  3Q28 A;  1R6Z A;  3TTL A;  3P7I A;  4K3F A;  3DLN A;  4R72 A;  3FV2 A;  1TT1 A;  1ZTY A;  1P1Q A;  3MP8 A;  3LR1 A;  2HZK A;  3IOR A;  3I5O A;  1SW1 A;  1SD3 A;  1LAH E;  3MPK A;  3QIM A;  2RKM A;  4X48 A;  3TCG A;  4ZED A;  1DTZ A;  1QUL A;  2VD2 A;  2XXV A;  2YLN A;  3VXC A;  3O6G A;  4LQ2 A;  4TQU Q;  3MZ1 A;  1OLA A;  4ESX A;  3R6U A;  1GGG A;  2I0C A;  1S50 A;  4U23 A;  3RN8 A;  3H06 B;  3MVY A;  4ZE8 A;  5AA4 A;  5I2N B;  1I69 A;  1IXC A;  1LB8 A;  2Y7R A;  4QSE A;  4BDM A;  4QSC A;  4OEV A;  5FHO A;  4F3G A;  4X9T A;  1IZ1 A;  2ANJ A;  3U93 A;  4QFK A;  3A3C A;  3QUJ A;  4GRK A;  4HCY A;  4POW A;  2UVH A;  3KOS A;  4F31 B;  1Y3Q A;  2Q8J A;  2DQV A;  3RT6 B;  3UOR A;  2I6E A;  4ZS9 A;  4RPN A;  1MXV A;  1B52 A;  3U8Q A;  1URD A;  3QK6 A;  3LC8 A;  5J1D A;  3H03 A;  4ELO A;  4DCX A;  4ZE9 A;  2O68 A;  2PYY A;  2RIN A;  4ZZE A;  4QFP A;  4Q30 B;  3T66 A;  2OJT A;  3RTW B;  2IEE A;  1POY 1;  1B3E A;  1UIU A;  5ICQ A;  3PUZ E;  4LUB A;  4YB5 A;  1FTK A;  1H76 A;  3E4R A;  5DYH A;  1B7Z A;  3K0V A;  2V25 A;  3LSL A;  1MQI A;  4ND9 A;  1JW4 A;  2XXU A;  5EHM A;  2QSX A;  1Y3P A;  2HZL A;  4ESW A;  5I2K B;  1B3H A;  1R9Q A;  3FZV A;  3TYH A;  4G8M A;  1TWY A;  4EXL A;  4F2O A;  3EN3 A;  1NKX A;  4GF8 A;  1QUJ A;  1B7H A;  1Y3N A;  3LSF B;  4KFQ A;  1RYX A;  4XKR A;  3TEL A;  4YZZ A;  3FV1 A;  4KCD A;  5EYF A;  4JXI A;  4BDQ A;  5H8F A;  2DE4 A;  3PPN A;  2V84 A;  3GBA A;  5B7D A;  2XXI A;  2PVU A;  1B1H A;  2H25 A;  2OWT A;  4UA8 A;  1ZU0 A;  4LVQ A;  3KGC A;  4MLV A;  1MY0 A;  2XXY A;  1BIY A;  3IJX B;  1HSJ A;  3PPP A;  5DTB A;  1YAE A;  1WDN A;  1P1W A;  5F7V A;  1FQC A;  3CRB A;  1MQH A;  1N0T A;  1B40 A;  2DVC A;  3KN8 A;  3ODB A;  1OIB A;  3LSW A;  4R9F A;  1MM7 A;  2GHA A;  2I4C A;  1A8E A;  3T96 B;  4EXK A;  1LAG E;  1FQD A;  2REG A;  5HBC A;  5I58 A;  4DIG A;  3H7M A;  1F9B A;  2YPN A;  3VLW A;  3RNN A;  3BKI B;  4BDN A;  2G29 A;  3ZKL A;  1IXG A;  4EQ7 A;  4EQB A;  4O3A A;  3B6W A;  1LLS A;  5IKB A;  1JEU A;  3H6U A;  3C33 A;  2V93 A;  4R2F A;  2GRV A;  5FTI A;  2R6G E;  3E9X A;  1N76 A;  3TQL A;  4F18 A;  3EPE A;  2O84 X;  3MQ9 A;  5AA2 A;  3KN3 A;  1US5 A;  4BLA A;  1Q35 A;  3CIJ A;  3TOD A;  1UTH A;  4MF3 A;  4DDD A;  1A7L A;  2D21 A;  3EHS A;  2E1S A;  4E0W A;  5ISU A;  2OBG A;  2DSF A;  4Q0C A;  4R6K A;  3VV5 A;  3UIF A;  4F1U A;  3RUM A;  5H8H B;  1VFD A;  4N6P A;  3B7D A;  4H8I A;  3I6V A;  2I48 A;  2XXQ A;  3C36 A;  4FEC A;  1Y1M A;  4JWX A;  3VVF A;  5I58 B;  3PUW E;  1YTV A;  4KHZ E;  1B46 A;  2DWH A;  4XIG Q;  4RY1 A;  3G3H A;  4PET A;  4RPO A;  2AL5 A;  1S7Y A;  2GH9 A;  2XXW A;  1UIV A;  5FHM A;  3FVN A;  2NXO A;  2V3U A;  3C35 A;  3QXM A;  1O64 A;  4GD5 A;  3TDJ A;  2AIX A;  3LUY A;  5AA2 B;  1EZO A;  2Q2C A;  2O6A A;  1SI1 A;  3ECR A;  1DSN A;  2B3F A;  1QVS A;  2B3B A;  2FNC A;  2RCA A;  3WAF A;  2G93 A;  3TKD A;  1FCK A;  4NMY A;  4WED A;  1B58 A;  3TTM A;  4O3B A;  4U21 A;  3T9U A;  5M2V A;  3RPW A;  4F1V A;  2AL4 A;  4N13 A;  3SEX A;  2O7I A;  1MH3 A;  1MDP 1;  3FJG A;  3W9V A;  3MBP A;  2NUV A;  1N7X A;  2M8C A;  1SQY A;  3MVZ A;  3G3K A;  4GFR A;  4KYE A;  4JWO A;  5H8Q A;  4BDR A;  4RK2 A;  4AB5 A;  1P1U A;  2HAU A;  1N7W A;  4TOZ A;  1S9T A;  2DE3 A;  5CMK A;  3IOV A;  2VD3 A;  4I9D A;  1A40 A;  1UTH B;  3MP6 A;  4NF5 A;  5L9O A;  2PT2 A;  1B5H A;  2DYX A;  2Q9T A;  3HCQ A;  3K1P A;  4MBP A;  5F1Q A;  3FIR A;  4E0X A;  3LBS A;  3SDF A;  3MJN A;  2DWA A;  1N04 A;  2H99 A;  4IY6 A;  5L9S A;  4P0I A;  2UVJ A;  4R74 A;  3VLU A;  5AA2 D;  1DMB A;  1VE4 A;  2HXW A;  4OWD A;  4GXA A;  1EZ9 A;  3G3F A;  3HST A;  4Q5T A;  4QFL A;  3FXU A;  3SKP A;  1B5J A;  2XXP A;  5DVI A;  3H6T A;  3KJ7 A;  2FA7 A;  4F39 A;  4H6D A;  4RJZ A;  1VSO A;  3TCF A;  1IEJ A;  2Q89 A;  2A5S A;  1LAX A;  1URG A;  1MXU A;  2XX8 A;  4R73 A;  2F97 A;  1D3K A;  4FE8 A;  4OYV A;  4L17 A;  3PD8 A;  1HSL A;  3IX1 A;  4XKQ A;  2H4I A;  1LBB A;  1XT8 A;  4YKK A;  4ZEB A;  2P0S A;  2XXT A;  4EUO A;  1Y9U A;  1N3X A;  4HW8 A;  3CSB A;  3Q25 A;  3H4Z A;  5ITP A;  1US4 A;  2ONR A;  4OFO A;  1SI0 A;  2H98 A;  3RGY A;  3TMG A;  4OTE A;  1SDX A;  2XD2 A;  4P0G A;  3OEN A;  1B4H A;  2D5W A;  2UVI A;  2HEU A;  3QSL A;  4KCC A;  4OHN A;  1B3F A;  1NL5 A;  4IB2 A;  4IO4 A;  3CG3 A;  4OQO A;  1JW1 A;  2H5Y A;  2ZYK A;  4IO6 A;  1II5 A;  3N6T A;  5ITO A;  1M5E A;  1MM6 A;  1FTO A;  1NH7 A;  1UQW A;  3MVX A;  4H0W A;  3FGS A;  1B1X A;  4IGR A;  4LQ5 A;  2REJ A;  3H3G A;  4G8H A;  2V3Q A;  4R6H A;  2HCA A;  1A54 A;  3K6W A;  4NF6 A;  1N84 A;  2B65 A;  3IJO B;  4OEU A;  2QJE A;  3TFL A;  4DXU A;  4F2Q A;  1FQE A;  1TFD A;  4ELP A;  3D4C A;  3OEL A;  3MZ9 A;  3PUY E;  4GVO A;  1MXY A;  1ZJL A;  4JBZ A;  3U72 A;  4FAJ A;  5I2K A;  4TLM B;  3RTF B;  4YMB A;  3H6W A;  4ZDM A;  5I84 A;  4G8N A;  5DT6 A;  4Z7E A;  3JV9 A;  2F5X A;  2HFB A;  2OCU A;  1IQ7 A;  3AXF A;  3FAT A;  3MW0 A;  4R75 A;  1OQH A;  4RXL A;  5CBS A;  1OLC A;  2NWJ A;  4DZ1 A;  3OO7 A;  1D4N A;  1CB6 A;  1MXZ A;  4U4S A;  1B0H A;  2OZZ A;  3FVO A;  3GZG A;  3PUV E;  5CI5 A;  1TFA A;  2QS4 A;  1Y1Z A;  2O51 A;  3RY3 A;  1MPC A;  2YJP A;  3VDF A;  3KG2 A;  4GIZ A;  3SET A;  1KWH A;  1B32 A;  1B51 A;  2Y84 A;  1O7T A;  3FUZ A;  2F6G A;  1FW0 A;  2E0S A;  3IAZ A;  3O29 A;  3HHG A;  4FEB A;  4XTC Q;  1POT A;  2I3W A;  4FJP A;  4ZEI A;  3G7W A;  4R2B A;  4QFO A;  1PDA A;  3IOW A;  3CVG A;  5B70 A;  5BWJ A;  3HN0 A;  3DP6 A;  4H65 A;  4DCY A;  1JW5 A;  5KCJ A;  4NWC A;  1XVX A;  1GTK A;  4LZ5 A;  4MLQ A;  3FXQ A;  2XXR A;  1JET A;  3S2V A;  4YKI A;  3DEL B;  3CG1 A;  3T9H B;  1LGB C;  1XOC A;  4PFU A;  2PMS A;  4RA1 A;  3ZSF A;  1MH4 A;  1MY2 A;  3T9V A;  4OMB A;  4F3B A;  3IL1 B;  4JDF A;  3SEU A;  3SEV A;  3TTR A;  1SW5 A;  1FQA A;  4LP2 B;  5AA3 A;  3KFM A;  1PB7 A;  4DXC A;  3BFU A;  1SVX B;  1Y4T A;  3MVW A;  3H6V A;  4ZEF A;  5L8D A;  3VVE A;  1OVB A;  2RC9 A;  3GBB A;  1SW2 A;  1HSE A;  3U1O A;  2DS9 A;  3PMX A;  1MPB A;  3CR9 A;  2UYE A;  4YB6 A;  2H9B A;  4IY5 A;  2OK2 A;  2X7P A;  1R9L A;  1NH8 A;  4DLD A;  1VFE A;  3A3U A;  4QRZ A;  3TZA A;  5AA4 B;  1I6B A;  5A5X B;  4FED A;  3TCH A;  3EHU A;  4BDO A;  2Q2A A;  2VOZ A;  5LOM A;  3E3K A;  2Z8F A;  3FJM A;  3PV0 E;  3OSQ A;  1NMU A;  2I49 A;  4U22 A;  5H8F B;  5H8N A;  2DOJ A;  3THI A;  4ECF A;  5KDT B;  4G4P A;  2DE2 A;  2F35 A;  1NFT A;  4H1X A;  4NF4 B;  3EF7 A;  4OES A;  3K1M A;  1QKA A;  5I2N A;  4ZEK A;  3RQT A;  1XVY A;  2QS1 A;  5EHS A;  3K1N A;  2WKY A;  1GV8 A;  2A5T A;  3LSX A;  3TTK A;  4I1D A;  4U4X A;  3IR1 A;  1PBP A;  2QRY A;  1USY H;  3U92 A;  3UP9 A;  3W15 C;  1FTM A;  2Z22 A;  2ZYO A;  3C4M A;  3IK6 B;  2XXX A;  4YMA A;  2XXH A;  2UXA A;  1B3L A;  3GXA A;  4LZ8 A;  1MY1 A;  4N07 A;  2RC7 A;  2GHB A;  2ZNU A;  3C31 A;  1FQF A;  3HPI A;  4KD5 A;  2P1S A;  2RF1 A;  3CFZ A;  3Q29 A;  4NE4 A;  4PFY A;  3OSR A;  5AA1 A;  1USY E;  4HS7 A;  4MFI A;  2Y7K A;  5FTH A;  2ZNS A;  2O1L A;  3D4G A;  3G3I A;  2ZXT A;  3PUX E;  5DEX B;  4POX A;  5JTY B;  3L6H A;  1LFI A;  4EF1 A;  1DPE A;  4JB7 A;  4C1T A;  1OVT A;  1DTG A;  1SBP A;  3MPL A;  3R26 A;  4FIM A;  2QMX A;  3FVG A;  4G68 B;  3W9W A;  4BDL A;  4GOT A;  3TTN A;  1NNP A;  5CMC A;  3UA8 A;  2Y7I A;  4KI0 E;  5L9M A;  2D3I A;  1ZIU A;  3PU5 A;  3SEY A;  5K2Y A;  1OMP A;  1OQG A;  1MXX A;  1YCJ A;  2F7C A;  3O9P A;  5CMM A;  1DOT A;  1PC3 A;  1PBQ A;  5H8S A;  2I4B A;  3G3J A;  4OET A;  2I58 A;  5TP9 A;  1QKB A;  4XXU A;  1I6Q A;  3IOT A;  5KZT A;  3C32 A;  3OO6 A;  2AYS A;  4IO5 A;  3K2D A;  1GR2 A;  3OO9 A;  4GL0 A;  4QHQ A;  1ZMG A;  4U1Z A;  5DEX A;  2QS3 A;  4NF8 A;  4KQP A;  4WXJ A;  1WOD A;  4IO7 A;  3GLB A;  1B4Z A;  4NF8 B;  3R7X A;  2XHD A;  4PFW A;  3QAX A;  4F1Y A;  3IOU A;  3KSX A;  5CRY A;  3MWB A;  1H3D A;  4THI A;  3RLF E;  1A8F A;  5TP9 B;  3VLV A;  3N5L A;  3S4U A;  3B6Q A;  2QL3 A;  1QW0 A;  3O2A A;  1JNF A;  1WVJ A;  4ONY A;  4XKN A;  1T0K A;  2XD3 A;  2V3T A;  2DP8 A;  4H8J A;  4M1V A;  2F34 A;  2FYI A;  1QUK A;  2A5T B;  2OWS A;  4LON B;  1MPD A;  4G68 C;  2PBW A;  3SEW A;  4HCW A;  2KLF A;  2VGQ A;  1QUI A;  3V8X B;  4YKP A;  3V5A A;  1H45 A;  4PP0 A;  1TXF A;  4DXB A;  5I59 A;  3TUS A;  1Y4C A;  2QS2 A;  3OD7 A;  4I62 A;  3MAM A;  4U1O A;  4RK9 A;  1FTJ A;  3TQW A;  4G68 A;  3M3L A;  4JWY A;  3T93 B;  3M3F A;  4F22 A;  4C0R A;  4FOR A;  3O97 A;  3C9H A;  1B2H A;  1IXH A;  3PPO A;  4G77 A;  4P11 A;  3T9X B;  5A5X A;  4WKM A;  1EZP A;  1AH5 A;  4QFN A;  4YIC A;  4MH5 A;  1MY4 A;  1LBC A;  2P2A A;  2X26 A;  4AB6 A;  3SER A;  1YPN A;  4NF6 B;  1B05 A;  4NWD A;  3TEP A;  5HPQ A;  1NNK A;  4ISU A;  4KR5 A;  1H44 A;  5JEI A;  1M5F A;  2GFE A;  3FD3 A;  5ICT A;  3HO7 A;  3K01 A;  3QYT A;  1EU8 A;  3BBR A;  3FJ7 A;  1NNF A;  2R71 A;  1XHY A;  2XX9 A;  4JSO A;  1AMF A;  2HAV A;  3CI8 A;  2QPQ A;  1ELJ A;  3QUF A;  2Y7W A;  1MS7 A;  4OFL A;  4YB7 A;  2ABH A;  1P1N A;  3O28 A;  4H5G A;  5HM4 B;  4I8C A;  3PD9 A;  1B6H A;  2ONK E;  1B3G A;  2PT1 A;  3S9L C;  1B5I A;  1B7U A;  3A09 A;  3ZKK A;  5I57 B;  1O63 A;  3IB2 A;  3TPA A;  4LA9 A;  4F3S A;  5KDT A;  1ATG A;  4EDP A;  4KPT A;  1A99 A;  1SW4 A;  2Z23 A;  3U94 A;  3Q26 A;  3DP4 A;  2OLB A;  3O66 A;  3PPR A;  4QSD A;  1IXI A;  2DXY A;  4X1D A;  1IUD A;  3TAJ A;  1B0L A;  3RT8 A;  3MUQ A;  4PE5 B;  3S9N C;  1LCF A;  4EQ9 A;  3ZS6 A;  4KYD A;  3UN6 A;  1N3W A;  3MP1 A;  3PPQ A;  1VR5 A;  2CZL A;  4JSD A;  3SES A;  4TLL B;  1J1N A;  1SYH A;  3VVD A;  1XC1 A;  2O69 A;  4LZ7 A;  3CSG A;  2ZYM A;  3K4U A;  4OVJ A;  4R9G A;  4R6Y A;  4DE8 A;  5I59 B;  1SYI A;  4H5F A;  3KBR A;  3KZG A;  2ZMB A;  1MG1 A;  1JQF A;  1M5B A;  1BLF A;  2ONS A;  3HV1 A;  3EQ1 A;  4PQJ A;  1Q1K A;  2XX7 A;  1AIV A;  1R1N A;  3DP8 A;  5TPA B;  4AQ4 A;  1PB9 A;  2F8D A;  5JTY A;  3Q27 A;  1XS5 A;  1EH3 A;  3PMW A;  4G2Z A;  2DXR A;  2ALU A;  2I0B A;  2X7Q A;  4OFJ A;  3IB0 A;  3CFX A;  2CMO A;  1UTB A; 
#chains in the Genus database with same CATH topology
 4NX1 A;  2F7A A;  4YAH X;  1JEV A;  4Z0I A;  1IIW A;  2PFZ A;  4KXP A;  1IMC A;  1MDQ A;  3WAE A;  2F36 A;  3M8U A;  4H67 A;  4XKP A;  3K00 A;  4IO2 A;  1BTJ A;  1PB8 A;  2ZYN A;  4OZ9 A;  5KCJ B;  1ZKB A;  3S9M C;  1PEB A;  3IO4 A;  1B9J A;  4ZZA A;  1H43 A;  4MEV A;  2UVG A;  1MQJ A;  4EF2 A;  1G0I A;  2R8T A;  2RCB A;  4N8Y A;  1FTL A;  4NF4 A;  2XWI A;  4NF5 B;  1ZLQ A;  2F7B A;  4HE1 A;  5H8H A;  5K2X A;  1LB9 A;  3PMV A;  4QXD A;  3N6U A;  2UYF A;  5IAI A;  5I7I A;  4PDD A;  2QVR A;  3C34 A;  3D1R A;  4ELQ A;  3S9E A;  1BKA A;  2IA4 A;  3OOA A;  3MC2 A;  5ET7 A;  2Y7P A;  1D9Y A;  1EYJ A;  4GWO A;  4K3F A;  4H45 A;  4PFB A;  4PE3 A;  4X48 A;  3TCG A;  1QUL A;  4N15 A;  2YLN A;  4HXV A;  3O6G A;  4LQ2 A;  2I0C A;  4U23 A;  3RN8 A;  3MVY A;  5I2N B;  1I69 A;  4QFK A;  4POW A;  3KOS A;  4F31 B;  4GWY A;  1Y3Q A;  2Q8J A;  3RT6 B;  1LBZ A;  1MXV A;  3QK6 A;  2VPO A;  3ISP A;  4DCX A;  4MJO A;  2JJK A;  1POY 1;  1UIU A;  5ICQ A;  4PGN A;  3KC0 A;  4LUB A;  3E4R A;  2V25 A;  3LSL A;  4PF6 A;  4X04 A;  5EHM A;  1Y3P A;  2HZL A;  1R9Q A;  4EXL A;  3EN3 A;  4DI4 B;  1RYX A;  3TEL A;  4YZZ A;  3FV1 A;  3PPN A;  5B7D A;  2OWT A;  1DBZ A;  1FPG A;  1BIY A;  1D9Q A;  3PPP A;  1YAE A;  4PFI A;  3UOR A;  3KN8 A;  1MM7 A;  2GHA A;  5I58 A;  5HBC A;  1IMD A;  2QVV A;  3VLW A;  2G29 A;  3ZKL A;  4EQB A;  3T0J A;  4R2F A;  2V93 A;  4GWX A;  1N76 A;  3TQL A;  1FBF A;  3MQ9 A;  1FRP A;  4BLA A;  3CIJ A;  3HFU A;  1UTH A;  3EHS A;  2E1S A;  3GYY A;  4E0W A;  3VV5 A;  3IFC A;  1EYK A;  4N6P A;  3I6V A;  3VVF A;  4XIG Q;  1NV4 A;  4PET A;  4RPO A;  4GWS A;  3LUY A;  2B3F A;  1QVS A;  2G93 A;  4O3B A;  4U21 A;  3T9U A;  5M2V A;  3SEX A;  2O7I A;  3MBP A;  5I2K B;  3MVZ A;  4KYE A;  1SQY A;  3G3K A;  2OX3 A;  2HAU A;  1S9T A;  4I9D A;  3MP6 A;  4NF5 A;  4JVC A;  4PBH A;  2Q9T A;  4MBP A;  4IY6 A;  2H99 A;  4P0I A;  3VLU A;  5AA2 D;  4OWD A;  4GXA A;  3G3F A;  3HST A;  1B5J A;  4F39 A;  4H6D A;  3TCF A;  1NV6 A;  2F97 A;  4OYV A;  4XKQ A;  4IR8 A;  1HSL A;  3IX1 A;  2H4I A;  4HW8 A;  2XD2 A;  2D5W A;  4KCC A;  1B3F A;  3CG3 A;  1II5 A;  5DW8 A;  4LQ5 A;  2REJ A;  3H3G A;  4G8H A;  2V3Q A;  1FBH A;  2B65 A;  3TFL A;  4PC9 A;  1DK4 A;  1MXY A;  3H6W A;  4H46 A;  5I84 A;  4R75 A;  4RXL A;  1OLC A;  4DZ1 A;  1CB6 A;  1MXZ A;  1B0H A;  1FPE A;  1TFA A;  2YJP A;  4OVQ A;  4GIZ A;  1B32 A;  1B51 A;  2Y84 A;  3RLF E;  4DI3 D;  2F6G A;  4FEB A;  1POT A;  2I3W A;  4FJP A;  4NF0 A;  4QFO A;  3IOW A;  3CVG A;  4DCY A;  1XVX A;  4LZ5 A;  4MLQ A;  1LGB C;  1XOC A;  4PFU A;  4OA4 A;  4OMB A;  3TTR A;  4N4U A;  3SEV A;  5AA3 A;  1PB7 A;  1SVX B;  1KA1 A;  1OVB A;  2DS9 A;  3BIH A;  3A3U A;  1I6B A;  4AS5 A;  4FED A;  3TCH A;  2Z8F A;  3FJM A;  3PV0 E;  1NMU A;  3THI A;  5H8N A;  5KDT B;  2F35 A;  1FTA A;  1LBW A;  4H1X A;  3EF7 A;  4GX3 A;  1USY H;  2Z22 A;  3IK6 B;  4N07 A;  2XXH A;  1B3L A;  2RC7 A;  4FBP A;  2BJI A;  2O1L A;  5DEX B;  5JTY B;  3L6H A;  4JB7 A;  1DTG A;  3FVG A;  4GOT A;  1ZIU A;  4XF5 A;  1YCJ A;  3O9P A;  5TP9 A;  3IOT A;  4NHB A;  4IO5 A;  3K2D A;  1GR2 A;  2QS3 A;  1WOD A;  3R7X A;  4PFW A;  4THI A;  4F2O A;  2Q74 A;  2XD3 A;  2V3T A;  2F34 A;  2A5T B;  2PBW A;  1QUI A;  4YKP A;  3TUS A;  3OD7 A;  4GBW A;  4G68 A;  4HE0 A;  4JWY A;  4WKM A;  1AH5 A;  2X26 A;  1FPL A;  4ISU A;  1H44 A;  3FD3 A;  5ICT A;  3HO7 A;  4JSO A;  2HAV A;  1G0H A;  3O28 A;  4N17 A;  1B7U A;  1K9Y A;  3IB2 A;  3TPA A;  1NI9 A;  4F3S A;  4PAF A;  1SW4 A;  3Q26 A;  4PTK A;  3DP4 A;  2OLB A;  4X1D A;  1IUD A;  3TAJ A;  3S9N C;  4PE5 B;  4KYD A;  3UN6 A;  3MP1 A;  3PPQ A;  4JSD A;  1J1N A;  1SYH A;  3VVD A;  3CSG A;  2ZYM A;  1FJ6 A;  5I3S A;  1SYI A;  1BLF A;  1Q1K A;  5TPA B;  2F8D A;  3Q27 A;  2ALU A;  2I0B A;  3IB0 A;  2GH9 A;  4C1U A;  3UGW A;  1AL3 A;  1RKM A;  1IMB A;  4U2R A;  1ZBM A;  3ONM A;  3G3G A;  3FBP A;  3OO8 A;  3O6I A;  5DVJ A;  3KJT A;  3K6X A;  2DVZ A;  1FPD A;  1JVX A;  2F6P A;  4O3C A;  1LFH A;  1D9V A;  3KSJ A;  2VHA A;  4P3L A;  3OEK A;  1AOV A;  1L5T A;  2DDK A;  3N26 A;  2DWJ A;  3OEM A;  4M4G A;  1Q9D A;  3CFL A;  4NTL A;  4ZEC A;  1QJM A;  3JZJ A;  2GQ1 A;  2W7Y A;  3IO6 A;  4IO3 A;  1GVC A;  1ANF A;  3N94 A;  2BJJ X;  3NOH A;  3FXR A;  2NOO A;  3K02 A;  4LAT A;  1FPF A;  2ZNT A;  4JVI A;  4P1E A;  5TU0 A;  3HHF A;  5FHN A;  4GX6 A;  2I3V A;  3E13 X;  5J16 A;  4OXV A;  5ITP A;  1UTB B;  3KN7 A;  3VFJ A;  2CZH A;  4GQO A;  2R9J A;  1M5D A;  2F78 A;  4MHF A;  5I57 A;  4QF9 A;  3KEI A;  4P8B A;  5H8N B;  1LBV A;  1Z7M E;  4MAG A;  3Q28 A;  3TTL A;  3P7I A;  4R72 A;  1ZTY A;  3LR1 A;  3IOR A;  1SW1 A;  4ZED A;  2XXV A;  3VXC A;  3R6U A;  1GGG A;  3H06 B;  4BDM A;  5FHO A;  4X9T A;  1IZ1 A;  3U93 A;  3QUJ A;  2DQV A;  2I6E A;  4ZS9 A;  3U8Q A;  1URD A;  3LC8 A;  2O68 A;  3T66 A;  2OJT A;  3RTW B;  2IEE A;  5IZZ A;  1B3E A;  3PUZ E;  4YB5 A;  1FTK A;  1B7Z A;  4NAP A;  5EYH A;  1TWY A;  1NKX A;  1QUJ A;  1Y3N A;  4KFQ A;  4O7M A;  2DE4 A;  4UA8 A;  3KGC A;  1MY0 A;  3LV0 A;  2XXY A;  1P1W A;  3CRB A;  3B50 A;  1MQH A;  2DVC A;  1FQD A;  4DIG A;  2YPN A;  3BKI B;  4EQ7 A;  3H6U A;  2OWZ A;  5AA2 A;  3KN3 A;  5A5L A;  1FPB A;  5ISU A;  2OBG A;  4Q0C A;  3UIF A;  5H8H B;  1VFD A;  5I58 B;  4FEC A;  1YTV A;  3G3H A;  1S7Y A;  1FPI A;  3C35 A;  4N6D A;  4GD5 A;  3TDJ A;  2AIX A;  2RCA A;  3TKD A;  1FCK A;  3TTM A;  1NUZ A;  1MH3 A;  4PFR A;  4JWO A;  5H8Q A;  1P1U A;  2WBD A;  3IOV A;  2VD3 A;  1RDX A;  2PT2 A;  3HCQ A;  3K1P A;  4OAN A;  2HXW A;  4Q5T A;  3SKP A;  5DVI A;  4I3E A;  4OVS A;  1URG A;  4R73 A;  4YKK A;  2P0S A;  1N3X A;  4OTE A;  1SDX A;  1B4H A;  2XWK A;  4OHN A;  1NL5 A;  4IO4 A;  1NV5 A;  2H5Y A;  2ZYK A;  3N6T A;  4H0W A;  4IGR A;  4MNI A;  2Y5K A;  4R6H A;  1A54 A;  1TFD A;  3U72 A;  3MZ9 A;  1NV2 A;  4G8N A;  4Z7E A;  3JV9 A;  2HFB A;  5CBS A;  1OQH A;  3OO7 A;  1D4N A;  5CI5 A;  3FVO A;  3GZG A;  1Y1Z A;  3SET A;  1KWH A;  1O7T A;  3O29 A;  3IAZ A;  2E0S A;  3HN0 A;  5KCJ A;  1JW5 A;  4NWC A;  3DEL B;  2PMS A;  4P47 A;  4RA1 A;  1MH4 A;  1MY2 A;  3SEU A;  5ET5 A;  4DXC A;  5L8D A;  3H6V A;  4ZEF A;  3VVE A;  3GBB A;  1HSE A;  1MPB A;  3CR9 A;  2UYE A;  4YB6 A;  4O94 A;  2QFL A;  2OK2 A;  2X7P A;  3ROJ A;  1NH8 A;  2L5V A;  2Q2A A;  5LOM A;  1DCU A;  3OSQ A;  5H8F B;  2DOJ A;  4OES A;  5I2N A;  3K1N A;  2WKY A;  4PF8 A;  3TTK A;  3UP9 A;  3U92 A;  1FTM A;  3C4M A;  2XXX A;  2UXA A;  5H8F A;  3C31 A;  3Q29 A;  4PAK A;  5FTH A;  2ZNS A;  3D4G A;  3G3I A;  3SZP A;  2PFY A;  4POX A;  1OVT A;  3MPL A;  4FIM A;  4G68 B;  3W9W A;  5IM2 A;  1FBD A;  5CMC A;  3UA8 A;  2Y7I A;  2D3I A;  3PU5 A;  3SEY A;  1OQG A;  1MXX A;  2F7C A;  1PC3 A;  1PBQ A;  5H8S A;  2I4B A;  4OET A;  2I58 A;  5KZT A;  4U1Z A;  1ZMG A;  2WYK A;  4KQP A;  3GLB A;  3QAX A;  4NN3 A;  1A8F A;  5TP9 B;  3VLV A;  3N5L A;  1T0K A;  2QL3 A;  1WVJ A;  4M1V A;  2DP8 A;  4H8J A;  4GX4 A;  4LON B;  2OWS A;  4NGU A;  4G68 C;  3SEW A;  2VGQ A;  1TXF A;  5I59 A;  1Y4C A;  4U1O A;  3MAM A;  4P1L A;  1FTJ A;  4RK9 A;  4FOR A;  3C9H A;  4G77 A;  4P11 A;  5A5X A;  1LBC A;  3CHG A;  4NWD A;  3TEP A;  1FBE A;  1EU8 A;  3FJ7 A;  2R71 A;  2QPQ A;  1ELJ A;  2Y7W A;  2WX9 A;  2ZZV A;  4YB7 A;  4H5G A;  5HM4 B;  4I8C A;  3PD9 A;  2CEX A;  3S9L C;  3A09 A;  5I57 B;  5KDT A;  4EDP A;  4KPT A;  3EKI A;  3O66 A;  1IXI A;  2DXY A;  3RT8 A;  1LCF A;  1N3W A;  1VR5 A;  2CZL A;  4TLL B;  5I59 B;  4OVJ A;  2HXR A;  4R9G A;  4DE8 A;  3RYD A;  4H5F A;  3HV1 A;  1MG1 A;  1JQF A;  1M5B A;  3EQ1 A;  3DP8 A;  4AQ4 A;  1EH3 A;  4G2Z A;  5ET6 A;  3ECR A;  2CMO A;  1P1Q A;  1MQD A;  2VPN A;  4YU0 A;  1JVY A;  2WBB A;  1QGX A;  2CZK A;  4PBQ A;  3O6H A;  1P99 A;  3USD A;  1MRP A;  4RYA A;  2NVU B;  1CNQ A;  3K6V A;  5DVF A;  5T3J A;  5TPA A;  5JK4 A;  3OXN A;  3B6T A;  3VE1 B;  3L6G A;  4X1B A;  2THI A;  3RPL B;  4OVP A;  3UK4 A;  3M3K A;  4YKJ A;  3FAS A;  3ILT B;  1M5C A;  1LST A;  4F19 A;  4PFT A;  5I56 A;  1MXW A;  2CZI A;  1LFG A;  3T22 A;  3QMF A;  3FVK A;  1Z7N E;  4AS4 A;  5I56 B;  3V83 A;  4UAC A;  1NNT A;  4GL8 A;  1LCT A;  1A55 A;  2VP1 A;  4OVR A;  1IIT A;  4GLI A;  1Y20 A;  4KYS A;  5EQ7 A;  3V89 B;  4GWW A;  3F11 A;  2O1M A;  4OER A;  4GXS B;  2MKZ A;  3K6U A;  1EYI A;  1R6Z A;  1SPI A;  1YZ0 A;  3DLN A;  3MP8 A;  2HZK A;  3QIM A;  1SD3 A;  1LAH E;  2RKM A;  1DTZ A;  1S50 A;  1K9Z A;  5AA4 A;  1IXC A;  4QSC A;  4OEV A;  2ANJ A;  4HCY A;  4G61 A;  2RIN A;  4ZZE A;  1MQI A;  2XXU A;  4MMP A;  3FZV A;  3TYH A;  4G8M A;  3FXB A;  3B8B A;  4XKR A;  1KZ8 A;  4KCD A;  5EYF A;  2V84 A;  1B1H A;  1ZU0 A;  4MX6 A;  4LVQ A;  4MLV A;  1NV3 A;  5DTB A;  1FQC A;  1B40 A;  3ODB A;  4R9F A;  3LSW A;  2REG A;  3H7M A;  1F9B A;  4BDN A;  4O3A A;  1LLS A;  5IKB A;  1JEU A;  2GRV A;  2R6G E;  3E9X A;  4F18 A;  3KBZ A;  2XWO A;  1US5 A;  2ZZX A;  1Q35 A;  2KQZ A;  4PAI A;  3TOD A;  4R6K A;  2DSF A;  4F1U A;  3RUM A;  3B7D A;  2I48 A;  5IZ3 A;  3C36 A;  1Y1M A;  3PTY A;  3PUW E;  1RDZ A;  4RY1 A;  2XXW A;  1UIV A;  3FVN A;  2NXO A;  1FJ9 A;  1EZO A;  1SI1 A;  1DSN A;  3WAF A;  2FNC A;  2CEY A;  4NMY A;  1B58 A;  3RPW A;  1MDP 1;  3FJG A;  3W9V A;  4BDR A;  4RK2 A;  1N7W A;  4TOZ A;  2XXK A;  1B5H A;  2ZZW A;  2DYX A;  3MJN A;  2DWA A;  1N04 A;  5L9S A;  2UVJ A;  1DMB A;  1EZ9 A;  1NUW A;  2WEF A;  3FXU A;  2XXP A;  3H6T A;  2FA7 A;  2FHY A;  4RJZ A;  1IEJ A;  5FBP A;  1LAX A;  4MNC A;  4L17 A;  1XT8 A;  4ZEB A;  1INP A;  4UAB A;  3CSB A;  3Q25 A;  1US4 A;  2H98 A;  3TMG A;  4P0G A;  4GWU A;  2UVI A;  2QVU A;  4IB2 A;  4XEQ A;  1JW1 A;  4IO6 A;  5ITO A;  1M5E A;  1MM6 A;  4ZEI A;  4ZE9 A;  3MVX A;  3FGS A;  1LEV A;  2HCA A;  3K6W A;  3IJO B;  4OEU A;  2QJE A;  4DXU A;  3PUY E;  3OEL A;  4GVO A;  4JBZ A;  5I2K A;  5I5P A;  4TLM B;  4ZDM A;  1FBP A;  5DT6 A;  2F5X A;  2OCU A;  1IQ7 A;  3AXF A;  3MW0 A;  4U4S A;  2OZZ A;  3PUV E;  2QS4 A;  2O51 A;  3RY3 A;  1MPC A;  3VDF A;  3KG2 A;  2F3D A;  2HHM A;  3FUZ A;  4XTC Q;  2P3N A;  4N6K A;  4R2B A;  1PDA A;  3DP6 A;  2FBP A;  3FXQ A;  2XXR A;  1JET A;  3S2V A;  4YKI A;  5IGA A;  3CG1 A;  2FVZ A;  3T9H B;  3T9V A;  4JDF A;  1FQA A;  4LP2 B;  1Y4T A;  2FIX A;  2RC9 A;  1SW2 A;  3PMX A;  1NUX A;  5LTC A;  4P9K A;  2H9B A;  1R9L A;  4DLD A;  3TZA A;  5A5X B;  3EHU A;  4BDO A;  2VOZ A;  4U22 A;  1NFT A;  5IZ1 A;  3K1M A;  1QKA A;  4ZEK A;  2QS1 A;  5EHS A;  1GV8 A;  3LSX A;  4U4X A;  1FBC A;  5IZ3 B;  2ZYO A;  4YMA A;  4N13 A;  4F2Q A;  3RTF B;  2ZNU A;  1FQF A;  3HPI A;  4NE4 A;  2RF1 A;  3CFZ A;  3OSR A;  4I40 A;  1USY E;  4HS7 A;  5AA1 A;  4MFI A;  2Y7K A;  4F3P A;  4LN5 A;  4EF1 A;  1DPE A;  4C1T A;  5LDZ A;  1SBP A;  3R26 A;  4BDL A;  2QMX A;  1NNP A;  4KI0 E;  1FPJ A;  1OMP A;  5CMM A;  4I3Y A;  3G3J A;  4XXU A;  3C32 A;  3OO6 A;  3OO9 A;  4GL0 A;  4WXJ A;  4NF8 B;  4F1Y A;  3KSX A;  1H3D A;  3S4U A;  3B6Q A;  1JNF A;  1QUK A;  5EQ8 A;  4PP0 A;  5EYG A;  3TQW A;  3M3L A;  3T93 B;  3M3F A;  4C0R A;  3O97 A;  1IXH A;  1EZP A;  4MH5 A;  1MY4 A;  2P2A A;  1YPN A;  5HPQ A;  4KR5 A;  1M5F A;  3QYT A;  1FSA A;  3BBR A;  2XX9 A;  1AMF A;  3IFA A;  1MS7 A;  4OFL A;  2ABH A;  1P1N A;  1XI6 A;  1LBX A;  3MYU A;  1B6H A;  2Z23 A;  1AWB A;  3PPR A;  4QSD A;  1B0L A;  3MUQ A;  4EQ9 A;  3ZS6 A;  1XC1 A;  2O69 A;  4LZ7 A;  4R6Y A;  1NV1 A;  2XX7 A;  4PQJ A;  5ESY A;  1PB9 A;  1XS5 A;  2DXR A;  4OFJ A;  2HQ0 A;  2Z8E A;  2PX1 A;  4OEN A;  3PGF A;  4NG7 A;  3OMB A;  2B4M A;  1RDY A;  2RC8 A;  1CE2 A;  4PDH A;  3ILU B;  4FAT A;  1MY3 A;  2ESN A;  3MST A;  1DPP A;  4HTG A;  4ELR A;  1FQB A;  3BFT A;  5CC2 A;  5CM6 A;  3JYR A;  3MZB A;  1RYO A;  4Q8R A;  3IB1 A;  3VXB A;  5CMB A;  2QMW A;  4NED A;  1LAF E;  1NV0 A;  1URS A;  4PCD A;  5H8Q B;  1BP5 A;  3I3V A;  5CBR A;  4F29 A;  1I6A A;  3EHT A;  5AE4 A;  2B4L A;  1P1O A;  4IGT A;  2Z8D A;  2DWI A;  2O7U A;  3KOT A;  2LAO A;  5ELV A;  1IMF A;  5BUU A;  1NUY A;  2Q88 A;  4RNS A;  4WEP A;  1MQG A;  3DM0 A;  3FV2 A;  1TT1 A;  3I5O A;  3MPK A;  3LUZ A;  2VD2 A;  3E79 A;  4TQU Q;  3MZ1 A;  1OLA A;  4ESX A;  4ZE8 A;  1LB8 A;  2Y7R A;  4QSE A;  4F3G A;  3A3C A;  4GRK A;  2UVH A;  4RPN A;  1B52 A;  1NV7 A;  5J1D A;  3H03 A;  4ELO A;  2PYY A;  5ET8 A;  4QFP A;  4Q30 B;  1H76 A;  5DYH A;  4OVT A;  3K0V A;  4ND9 A;  1JW4 A;  2QSX A;  4ESW A;  4JVD A;  1B3H A;  3RPL A;  2PCR A;  4GF8 A;  1B7H A;  3LSF B;  4JXI A;  4BDQ A;  1FPK A;  3GBA A;  2XXI A;  2PVU A;  4N91 A;  4PGP A;  2H25 A;  2V4C A;  3IJX B;  1HSJ A;  1WDN A;  5F7V A;  1N0T A;  1OIB A;  2I4C A;  1A8E A;  3T96 B;  4EXK A;  1LAG E;  1VDW A;  3RNN A;  1IXG A;  3B6W A;  3C33 A;  5FTI A;  4GBV A;  3EPE A;  2O84 X;  5EQ9 A;  4DDD A;  4MF3 A;  1A7L A;  4H8I A;  2XXQ A;  4JWX A;  4GWZ A;  4KHZ E;  1B46 A;  2DWH A;  2AL5 A;  5FHM A;  2V3U A;  3QXM A;  1O64 A;  3U65 A;  5AA2 B;  2Q2C A;  2O6A A;  2VT5 A;  2B3B A;  4XFE A;  4WED A;  4F1V A;  2AL4 A;  2XA5 A;  2WYP A;  2KR0 A;  2NUV A;  1N7X A;  2M8C A;  4GFR A;  4AB5 A;  2DE3 A;  3KC1 A;  5CMK A;  1A40 A;  1UTH B;  5L9O A;  5F1Q A;  4E0X A;  3FIR A;  3LBS A;  3SDF A;  2FIE A;  4R74 A;  1VE4 A;  4QFL A;  4HE2 A;  5EQA A;  3KJ7 A;  1VSO A;  2Q89 A;  2A5S A;  2XX8 A;  1MXU A;  1D3K A;  4FE8 A;  3PD8 A;  1LBB A;  2XXT A;  4EUO A;  1Y9U A;  3H4Z A;  2ONR A;  4OFO A;  1SI0 A;  3RGY A;  3OEN A;  2HEU A;  3QSL A;  4OQO A;  3BIG A;  1NH7 A;  1FTO A;  1UQW A;  4O7I A;  3ZSF A;  1B1X A;  4X8R A;  4N81 A;  4NF6 A;  1N84 A;  1FQE A;  4ELP A;  3D4C A;  1ZJL A;  4FAJ A;  4MCO A;  4YMB A;  3FAT A;  3A29 A;  1IMA A;  2NWJ A;  1FW0 A;  3HHG A;  3G7W A;  5B70 A;  2P3V A;  5BWJ A;  4H65 A;  1GTK A;  1IME A;  4F3B A;  3IL1 B;  1SW5 A;  3KFM A;  3T1B A;  3BFU A;  3MVW A;  1FBG A;  3U1O A;  2HPG A;  4IY5 A;  1VFE A;  4QRZ A;  5AA4 B;  1LBY A;  4MNP A;  3E3K A;  2I49 A;  4ECF A;  4G4P A;  2DE2 A;  4NF4 B;  3RQT A;  1XVY A;  5F24 A;  2A5T A;  4I1D A;  3IR1 A;  1PBP A;  2QRY A;  3W15 C;  3GXA A;  1YYZ A;  1MY1 A;  4LZ8 A;  4KD5 A;  2GHB A;  2P1S A;  4PFY A;  3PUX E;  2ZXT A;  1LFI A;  1KA0 A;  3TTN A;  5L9M A;  5K2Y A;  1DOT A;  1QKB A;  1I6Q A;  2AYS A;  4QHQ A;  5DEX A;  4NF8 A;  4IO7 A;  1B4Z A;  2XHD A;  3IOU A;  5CRY A;  3MWB A;  3O2A A;  4ONY A;  1QW0 A;  4XKN A;  2FYI A;  4QBA A;  1MPD A;  4HCW A;  2KLF A;  3V8X B;  4DXB A;  3V5A A;  1H45 A;  2QS2 A;  4I62 A;  2Y5L A;  4F22 A;  4NQ8 A;  3PPO A;  1B2H A;  1BK4 A;  4P56 A;  3T9X B;  4QFN A;  4AB6 A;  4YIC A;  3SER A;  4NF6 B;  1B05 A;  1NNK A;  5JEI A;  2GFE A;  3K01 A;  1NNF A;  1JP4 A;  1XHY A;  3QUF A;  3CI8 A;  2ONK E;  1B3G A;  2PT1 A;  1B5I A;  3ZKK A;  1O63 A;  2XWV A;  4LA9 A;  1ATG A;  1A99 A;  3U94 A;  4O8M A;  2F3B A;  1YXI A;  4MIJ A;  3SES A;  2Q8M A;  3E78 A;  3K4U A;  3KBR A;  3KZG A;  2ZMB A;  4N8G A;  2ONS A;  1AIV A;  1R1N A;  5JTY A;  3PMW A;  2X7Q A;  3CFX A;  2D21 A;  1UTB A; 
#chains in the Genus database with same CATH homology
 4C1U A;  2HQ0 A;  3UGW A;  1AL3 A;  1MQD A;  2Z8E A;  2PX1 A;  1RKM A;  4OEN A;  3PGF A;  4U2R A;  3OMB A;  4YU0 A;  2F7A A;  1JVY A;  1ZBM A;  3ONM A;  4YAH X;  3G3G A;  3OO8 A;  2RC8 A;  3O6I A;  1JEV A;  4Z0I A;  5DVJ A;  1IIW A;  1CE2 A;  3KJT A;  3K6X A;  2DVZ A;  3O6H A;  1JVX A;  2F6P A;  4O3C A;  1P99 A;  3USD A;  1MRP A;  1MDQ A;  3ILU B;  4FAT A;  1LFH A;  4RYA A;  2NVU B;  5DVF A;  1D9V A;  3K6V A;  3KSJ A;  1MY3 A;  2ESN A;  2VHA A;  5TPA A;  5JK4 A;  3OXN A;  3WAE A;  3B6T A;  3VE1 B;  2F36 A;  3OEK A;  1DPP A;  4HTG A;  3L6G A;  4ELR A;  1FQB A;  4X1B A;  1AOV A;  3BFT A;  1L5T A;  2THI A;  5CC2 A;  3M8U A;  3UK4 A;  5CM6 A;  3N26 A;  3JYR A;  4H67 A;  4XKP A;  3M3K A;  2DWJ A;  3K00 A;  3OEM A;  4YKJ A;  4M4G A;  3FAS A;  3MZB A;  4IO2 A;  3ILT B;  1RYO A;  3CFL A;  1BTJ A;  1PB8 A;  4NTL A;  2ZYN A;  3IB1 A;  1QJM A;  1M5C A;  4Q8R A;  1LST A;  4OZ9 A;  3VXB A;  3JZJ A;  5CMB A;  1ZKB A;  5KCJ B;  4F19 A;  3S9M C;  4PFT A;  1PEB A;  2W7Y A;  3IO6 A;  3IO4 A;  4IO3 A;  5I56 A;  2QMW A;  1B9J A;  4NED A;  1LAF E;  4ZZA A;  1H43 A;  1MXW A;  1GVC A;  1LFG A;  1ANF A;  2UVG A;  3N94 A;  1URS A;  2BJJ X;  3FXR A;  1MQJ A;  2NOO A;  3K02 A;  4LAT A;  5H8Q B;  4EF2 A;  1BP5 A;  2ZNT A;  3I3V A;  3T22 A;  5CBR A;  3FVK A;  2RCB A;  1FTL A;  4NF4 A;  1Z7N E;  5TU0 A;  4NF5 B;  3HHF A;  1ZLQ A;  5FHN A;  4F29 A;  2F7B A;  5H8H A;  2I3V A;  5K2X A;  5I56 B;  3E13 X;  3V83 A;  4OXV A;  1LB9 A;  1I6A A;  3PMV A;  1UTB B;  4UAC A;  3EHT A;  1NNT A;  5AE4 A;  3KN7 A;  1P1O A;  3N6U A;  4IGT A;  2UYF A;  4GL8 A;  3VFJ A;  5IAI A;  4GQO A;  1LCT A;  1A55 A;  2R9J A;  2VP1 A;  2Z8D A;  1M5D A;  3C34 A;  2DWI A;  2O7U A;  1IIT A;  3KOT A;  4ELQ A;  2F78 A;  4F3P A;  2LAO A;  3S9E A;  4GLI A;  5ELV A;  1Y20 A;  1BKA A;  2IA4 A;  3OOA A;  4KYS A;  5I57 A;  4QF9 A;  3KEI A;  3V89 B;  2Q88 A;  3MC2 A;  5BUU A;  4RNS A;  4ZEC A;  3F11 A;  5H8N B;  2O1M A;  2Y7P A;  4WEP A;  1MQG A;  1D9Y A;  4GXS B;  1Z7M E;  4OER A;  3DM0 A;  3K6U A;  4GWO A;  3Q28 A;  1R6Z A;  3TTL A;  3P7I A;  4K3F A;  3DLN A;  4R72 A;  3FV2 A;  1TT1 A;  1ZTY A;  1P1Q A;  3MP8 A;  3LR1 A;  2HZK A;  3IOR A;  3I5O A;  1SW1 A;  1SD3 A;  1LAH E;  3MPK A;  3QIM A;  2RKM A;  4X48 A;  3TCG A;  4ZED A;  1DTZ A;  1QUL A;  2VD2 A;  2XXV A;  2YLN A;  3VXC A;  3O6G A;  4LQ2 A;  4TQU Q;  3MZ1 A;  1OLA A;  4ESX A;  3R6U A;  1GGG A;  2I0C A;  1S50 A;  4U23 A;  3RN8 A;  3H06 B;  3MVY A;  4ZE8 A;  5AA4 A;  5I2N B;  1I69 A;  1IXC A;  1LB8 A;  2Y7R A;  4QSE A;  4BDM A;  4QSC A;  4OEV A;  5FHO A;  4F3G A;  4X9T A;  1IZ1 A;  2ANJ A;  3U93 A;  4QFK A;  3A3C A;  3QUJ A;  4GRK A;  4HCY A;  4POW A;  2UVH A;  3KOS A;  4F31 B;  1Y3Q A;  2Q8J A;  2DQV A;  3RT6 B;  3UOR A;  2I6E A;  4ZS9 A;  4RPN A;  1MXV A;  1B52 A;  3U8Q A;  1URD A;  3QK6 A;  3LC8 A;  5J1D A;  3H03 A;  4ELO A;  4DCX A;  4ZE9 A;  2O68 A;  2PYY A;  2RIN A;  4ZZE A;  4QFP A;  4Q30 B;  3T66 A;  2OJT A;  3RTW B;  2IEE A;  1POY 1;  1B3E A;  1UIU A;  5ICQ A;  3PUZ E;  4LUB A;  4YB5 A;  1FTK A;  1H76 A;  3E4R A;  5DYH A;  1B7Z A;  3K0V A;  2V25 A;  3LSL A;  1MQI A;  4ND9 A;  1JW4 A;  2XXU A;  5EHM A;  2QSX A;  1Y3P A;  2HZL A;  4ESW A;  5I2K B;  1B3H A;  1R9Q A;  3FZV A;  3TYH A;  4G8M A;  1TWY A;  4EXL A;  4F2O A;  3EN3 A;  1NKX A;  4GF8 A;  1QUJ A;  1B7H A;  1Y3N A;  3LSF B;  4KFQ A;  1RYX A;  4XKR A;  3TEL A;  4YZZ A;  3FV1 A;  4KCD A;  5EYF A;  4JXI A;  4BDQ A;  5H8F A;  2DE4 A;  3PPN A;  2V84 A;  3GBA A;  5B7D A;  2XXI A;  2PVU A;  1B1H A;  2H25 A;  2OWT A;  4UA8 A;  1ZU0 A;  4LVQ A;  3KGC A;  4MLV A;  1MY0 A;  2XXY A;  1BIY A;  3IJX B;  1HSJ A;  3PPP A;  5DTB A;  1YAE A;  1WDN A;  1P1W A;  5F7V A;  1FQC A;  3CRB A;  1MQH A;  1N0T A;  1B40 A;  2DVC A;  3KN8 A;  3ODB A;  1OIB A;  3LSW A;  4R9F A;  1MM7 A;  2GHA A;  2I4C A;  1A8E A;  3T96 B;  4EXK A;  1LAG E;  1FQD A;  2REG A;  5HBC A;  5I58 A;  4DIG A;  3H7M A;  1F9B A;  2YPN A;  3VLW A;  3RNN A;  3BKI B;  4BDN A;  2G29 A;  3ZKL A;  1IXG A;  4EQ7 A;  4EQB A;  4O3A A;  3B6W A;  1LLS A;  5IKB A;  1JEU A;  3H6U A;  3C33 A;  2V93 A;  4R2F A;  2GRV A;  5FTI A;  2R6G E;  3E9X A;  1N76 A;  3TQL A;  4F18 A;  3EPE A;  2O84 X;  3MQ9 A;  5AA2 A;  3KN3 A;  1US5 A;  4BLA A;  1Q35 A;  3CIJ A;  3TOD A;  1UTH A;  4MF3 A;  4DDD A;  1A7L A;  2D21 A;  3EHS A;  2E1S A;  4E0W A;  5ISU A;  2OBG A;  2DSF A;  4Q0C A;  4R6K A;  3VV5 A;  3UIF A;  4F1U A;  3RUM A;  5H8H B;  1VFD A;  4N6P A;  3B7D A;  4H8I A;  3I6V A;  2I48 A;  2XXQ A;  3C36 A;  4FEC A;  1Y1M A;  4JWX A;  3VVF A;  5I58 B;  3PUW E;  1YTV A;  4KHZ E;  1B46 A;  2DWH A;  4XIG Q;  4RY1 A;  3G3H A;  4PET A;  4RPO A;  2AL5 A;  1S7Y A;  2GH9 A;  2XXW A;  1UIV A;  5FHM A;  3FVN A;  2NXO A;  2V3U A;  3C35 A;  3QXM A;  1O64 A;  4GD5 A;  3TDJ A;  2AIX A;  3LUY A;  5AA2 B;  1EZO A;  2Q2C A;  2O6A A;  1SI1 A;  3ECR A;  1DSN A;  2B3F A;  1QVS A;  2B3B A;  2FNC A;  2RCA A;  3WAF A;  2G93 A;  3TKD A;  1FCK A;  4NMY A;  4WED A;  1B58 A;  3TTM A;  4O3B A;  4U21 A;  3T9U A;  5M2V A;  3RPW A;  4F1V A;  2AL4 A;  4N13 A;  3SEX A;  2O7I A;  1MH3 A;  1MDP 1;  3FJG A;  3W9V A;  3MBP A;  2NUV A;  1N7X A;  2M8C A;  1SQY A;  3MVZ A;  3G3K A;  4GFR A;  4KYE A;  4JWO A;  5H8Q A;  4BDR A;  4RK2 A;  4AB5 A;  1P1U A;  2HAU A;  1N7W A;  4TOZ A;  1S9T A;  2DE3 A;  5CMK A;  3IOV A;  2VD3 A;  4I9D A;  1A40 A;  1UTH B;  3MP6 A;  4NF5 A;  5L9O A;  2PT2 A;  1B5H A;  2DYX A;  2Q9T A;  3HCQ A;  3K1P A;  4MBP A;  5F1Q A;  3FIR A;  4E0X A;  3LBS A;  3SDF A;  3MJN A;  2DWA A;  1N04 A;  2H99 A;  4IY6 A;  5L9S A;  4P0I A;  2UVJ A;  4R74 A;  3VLU A;  5AA2 D;  1DMB A;  1VE4 A;  2HXW A;  4OWD A;  4GXA A;  1EZ9 A;  3G3F A;  3HST A;  4Q5T A;  4QFL A;  3FXU A;  3SKP A;  1B5J A;  2XXP A;  5DVI A;  3H6T A;  3KJ7 A;  2FA7 A;  4F39 A;  4H6D A;  4RJZ A;  1VSO A;  3TCF A;  1IEJ A;  2Q89 A;  2A5S A;  1LAX A;  1URG A;  1MXU A;  2XX8 A;  4R73 A;  2F97 A;  1D3K A;  4FE8 A;  4OYV A;  4L17 A;  3PD8 A;  1HSL A;  3IX1 A;  4XKQ A;  2H4I A;  1LBB A;  1XT8 A;  4YKK A;  4ZEB A;  2P0S A;  2XXT A;  4EUO A;  1Y9U A;  1N3X A;  4HW8 A;  3CSB A;  3Q25 A;  3H4Z A;  5ITP A;  1US4 A;  2ONR A;  4OFO A;  1SI0 A;  2H98 A;  3RGY A;  3TMG A;  4OTE A;  1SDX A;  2XD2 A;  4P0G A;  3OEN A;  1B4H A;  2D5W A;  2UVI A;  2HEU A;  3QSL A;  4KCC A;  4OHN A;  1B3F A;  1NL5 A;  4IB2 A;  4IO4 A;  3CG3 A;  4OQO A;  1JW1 A;  2H5Y A;  2ZYK A;  4IO6 A;  1II5 A;  3N6T A;  5ITO A;  1M5E A;  1MM6 A;  1FTO A;  1NH7 A;  1UQW A;  3MVX A;  4H0W A;  3FGS A;  1B1X A;  4IGR A;  4LQ5 A;  2REJ A;  3H3G A;  4G8H A;  2V3Q A;  4R6H A;  2HCA A;  1A54 A;  3K6W A;  4NF6 A;  1N84 A;  2B65 A;  3IJO B;  4OEU A;  2QJE A;  3TFL A;  4DXU A;  4F2Q A;  1FQE A;  1TFD A;  4ELP A;  3D4C A;  3OEL A;  3MZ9 A;  3PUY E;  4GVO A;  1MXY A;  1ZJL A;  4JBZ A;  3U72 A;  4FAJ A;  5I2K A;  4TLM B;  3RTF B;  4YMB A;  3H6W A;  4ZDM A;  5I84 A;  4G8N A;  5DT6 A;  4Z7E A;  3JV9 A;  2F5X A;  2HFB A;  2OCU A;  1IQ7 A;  3AXF A;  3FAT A;  3MW0 A;  4R75 A;  1OQH A;  4RXL A;  5CBS A;  1OLC A;  2NWJ A;  4DZ1 A;  3OO7 A;  1D4N A;  1CB6 A;  1MXZ A;  4U4S A;  1B0H A;  2OZZ A;  3FVO A;  3GZG A;  3PUV E;  5CI5 A;  1TFA A;  2QS4 A;  1Y1Z A;  2O51 A;  3RY3 A;  1MPC A;  2YJP A;  3VDF A;  3KG2 A;  4GIZ A;  3SET A;  1KWH A;  1B32 A;  1B51 A;  2Y84 A;  1O7T A;  3FUZ A;  2F6G A;  1FW0 A;  2E0S A;  3IAZ A;  3O29 A;  3HHG A;  4FEB A;  4XTC Q;  1POT A;  2I3W A;  4FJP A;  4ZEI A;  3G7W A;  4R2B A;  4QFO A;  1PDA A;  3IOW A;  3CVG A;  5B70 A;  5BWJ A;  3HN0 A;  3DP6 A;  4H65 A;  4DCY A;  1JW5 A;  5KCJ A;  4NWC A;  1XVX A;  1GTK A;  4LZ5 A;  4MLQ A;  3FXQ A;  2XXR A;  1JET A;  3S2V A;  4YKI A;  3DEL B;  3CG1 A;  3T9H B;  1LGB C;  1XOC A;  4PFU A;  2PMS A;  4RA1 A;  3ZSF A;  1MH4 A;  1MY2 A;  3T9V A;  4OMB A;  4F3B A;  3IL1 B;  4JDF A;  3SEU A;  3SEV A;  3TTR A;  1SW5 A;  1FQA A;  4LP2 B;  5AA3 A;  3KFM A;  1PB7 A;  4DXC A;  3BFU A;  1SVX B;  1Y4T A;  3MVW A;  3H6V A;  4ZEF A;  5L8D A;  3VVE A;  1OVB A;  2RC9 A;  3GBB A;  1SW2 A;  1HSE A;  3U1O A;  2DS9 A;  3PMX A;  1MPB A;  3CR9 A;  2UYE A;  4YB6 A;  2H9B A;  4IY5 A;  2OK2 A;  2X7P A;  1R9L A;  1NH8 A;  4DLD A;  1VFE A;  3A3U A;  4QRZ A;  3TZA A;  5AA4 B;  1I6B A;  5A5X B;  4FED A;  3TCH A;  3EHU A;  4BDO A;  2Q2A A;  2VOZ A;  5LOM A;  3E3K A;  2Z8F A;  3FJM A;  3PV0 E;  3OSQ A;  1NMU A;  2I49 A;  4U22 A;  5H8F B;  5H8N A;  2DOJ A;  3THI A;  4ECF A;  5KDT B;  4G4P A;  2DE2 A;  2F35 A;  1NFT A;  4H1X A;  4NF4 B;  3EF7 A;  4OES A;  3K1M A;  1QKA A;  5I2N A;  4ZEK A;  3RQT A;  1XVY A;  2QS1 A;  5EHS A;  3K1N A;  2WKY A;  1GV8 A;  2A5T A;  3LSX A;  3TTK A;  4I1D A;  4U4X A;  3IR1 A;  1PBP A;  2QRY A;  1USY H;  3U92 A;  3UP9 A;  3W15 C;  1FTM A;  2Z22 A;  2ZYO A;  3C4M A;  3IK6 B;  2XXX A;  4YMA A;  2XXH A;  2UXA A;  1B3L A;  3GXA A;  4LZ8 A;  1MY1 A;  4N07 A;  2RC7 A;  2GHB A;  2ZNU A;  3C31 A;  1FQF A;  3HPI A;  4KD5 A;  2P1S A;  2RF1 A;  3CFZ A;  3Q29 A;  4NE4 A;  4PFY A;  3OSR A;  5AA1 A;  1USY E;  4HS7 A;  4MFI A;  2Y7K A;  5FTH A;  2ZNS A;  2O1L A;  3D4G A;  3G3I A;  2ZXT A;  3PUX E;  5DEX B;  4POX A;  5JTY B;  3L6H A;  1LFI A;  4EF1 A;  1DPE A;  4JB7 A;  4C1T A;  1OVT A;  1DTG A;  1SBP A;  3MPL A;  3R26 A;  4FIM A;  2QMX A;  3FVG A;  4G68 B;  3W9W A;  4BDL A;  4GOT A;  3TTN A;  1NNP A;  5CMC A;  3UA8 A;  2Y7I A;  4KI0 E;  5L9M A;  2D3I A;  1ZIU A;  3PU5 A;  3SEY A;  5K2Y A;  1OMP A;  1OQG A;  1MXX A;  1YCJ A;  2F7C A;  3O9P A;  5CMM A;  1DOT A;  1PC3 A;  1PBQ A;  5H8S A;  2I4B A;  3G3J A;  4OET A;  2I58 A;  5TP9 A;  1QKB A;  4XXU A;  1I6Q A;  3IOT A;  5KZT A;  3C32 A;  3OO6 A;  2AYS A;  4IO5 A;  3K2D A;  1GR2 A;  3OO9 A;  4GL0 A;  4QHQ A;  1ZMG A;  4U1Z A;  5DEX A;  2QS3 A;  4NF8 A;  4KQP A;  4WXJ A;  1WOD A;  4IO7 A;  3GLB A;  1B4Z A;  4NF8 B;  3R7X A;  2XHD A;  4PFW A;  3QAX A;  4F1Y A;  3IOU A;  3KSX A;  5CRY A;  3MWB A;  1H3D A;  4THI A;  3RLF E;  1A8F A;  5TP9 B;  3VLV A;  3N5L A;  3S4U A;  3B6Q A;  2QL3 A;  1QW0 A;  3O2A A;  1JNF A;  1WVJ A;  4ONY A;  4XKN A;  1T0K A;  2XD3 A;  2V3T A;  2DP8 A;  4H8J A;  4M1V A;  2F34 A;  2FYI A;  1QUK A;  2A5T B;  2OWS A;  4LON B;  1MPD A;  4G68 C;  2PBW A;  3SEW A;  4HCW A;  2KLF A;  2VGQ A;  1QUI A;  3V8X B;  4YKP A;  3V5A A;  1H45 A;  4PP0 A;  1TXF A;  4DXB A;  5I59 A;  3TUS A;  1Y4C A;  2QS2 A;  3OD7 A;  4I62 A;  3MAM A;  4U1O A;  4RK9 A;  1FTJ A;  3TQW A;  4G68 A;  3M3L A;  4JWY A;  3T93 B;  3M3F A;  4F22 A;  4C0R A;  4FOR A;  3O97 A;  3C9H A;  1B2H A;  1IXH A;  3PPO A;  4G77 A;  4P11 A;  3T9X B;  5A5X A;  4WKM A;  1EZP A;  1AH5 A;  4QFN A;  4YIC A;  4MH5 A;  1MY4 A;  1LBC A;  2P2A A;  2X26 A;  4AB6 A;  3SER A;  1YPN A;  4NF6 B;  1B05 A;  4NWD A;  3TEP A;  5HPQ A;  1NNK A;  4ISU A;  4KR5 A;  1H44 A;  5JEI A;  1M5F A;  2GFE A;  3FD3 A;  5ICT A;  3HO7 A;  3K01 A;  3QYT A;  1EU8 A;  3BBR A;  3FJ7 A;  1NNF A;  2R71 A;  1XHY A;  2XX9 A;  4JSO A;  1AMF A;  2HAV A;  3CI8 A;  2QPQ A;  1ELJ A;  3QUF A;  2Y7W A;  1MS7 A;  4OFL A;  4YB7 A;  2ABH A;  1P1N A;  3O28 A;  4H5G A;  5HM4 B;  4I8C A;  3PD9 A;  1B6H A;  2ONK E;  1B3G A;  2PT1 A;  3S9L C;  1B5I A;  1B7U A;  3A09 A;  3ZKK A;  5I57 B;  1O63 A;  3IB2 A;  3TPA A;  4LA9 A;  4F3S A;  5KDT A;  1ATG A;  4EDP A;  4KPT A;  1A99 A;  1SW4 A;  2Z23 A;  3U94 A;  3Q26 A;  3DP4 A;  2OLB A;  3O66 A;  3PPR A;  4QSD A;  1IXI A;  2DXY A;  4X1D A;  1IUD A;  3TAJ A;  1B0L A;  3RT8 A;  3MUQ A;  4PE5 B;  3S9N C;  1LCF A;  4EQ9 A;  3ZS6 A;  4KYD A;  3UN6 A;  1N3W A;  3MP1 A;  3PPQ A;  1VR5 A;  2CZL A;  4JSD A;  3SES A;  4TLL B;  1J1N A;  1SYH A;  3VVD A;  1XC1 A;  2O69 A;  4LZ7 A;  3CSG A;  2ZYM A;  3K4U A;  4OVJ A;  4R9G A;  4R6Y A;  4DE8 A;  5I59 B;  1SYI A;  4H5F A;  3KBR A;  3KZG A;  2ZMB A;  1MG1 A;  1JQF A;  1M5B A;  1BLF A;  2ONS A;  3HV1 A;  3EQ1 A;  4PQJ A;  1Q1K A;  2XX7 A;  1AIV A;  1R1N A;  3DP8 A;  5TPA B;  4AQ4 A;  1PB9 A;  2F8D A;  5JTY A;  3Q27 A;  1XS5 A;  1EH3 A;  3PMW A;  4G2Z A;  2DXR A;  2ALU A;  2I0B A;  2X7Q A;  4OFJ A;  3IB0 A;  3CFX A;  2CMO A;  1UTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...