1DTHA

Metalloprotease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QNLPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNIHVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLGLAPLGTMCDPKLSIGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTKGRSYEFSDDSMHYYERFLKQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATROLYSIN C
publication title Batimastat, a potent matrix mealloproteinase inhibitor, exhibits an unexpected mode of binding.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.24.42: Atrolysin C.
pdb deposition date 1996-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1dthA00
3KWVC 1XFYA 1K7IA 5CUHA 4HX3A 2W12A 1BKCI 4JPAA 2JNPA 1UTZA 3SHIA 4XM7A 2D1OA 3F15A 4PKVA 3F16A 1KAPP 1G05A 3USNA 1BKCE 1KBCA 2E3XA 4JQGA 1JH1A 1QJJA 4IJOA 2Z2DA 1ZXVA 3LE9A 1CK7A 2Y6DA 4XBHA 4H49A 3LUNA 3E8RA 1PWUA 1AF0A 2FV5A 4I03A 4R3VA 3ZUKA 1R55A 4ZR5A 2V4BA 2O36A 1UEAA 3KEJA 4PKTA 3DWBA 3K7NA 1BKCA 3HBVP 2RJQA 4PKRA 2ERPA 3HY7A 1SU3A 3OHOA 4GWMA 4L6TA 2DDYA 1D7XA 3O2XA 4XM8A 2A8HA 1R1IA 4AYKA 1I76A 1BQOA 4JA1A 1DMTA 4J4MA 5B5PA 4L19A 4WZVA 3OHLA 1IACA 1YCMA 5D2BA 1FLSA 4G0DA 1GXDA 1ROSA 3CKIA 2USNA 1BIWA 4WF6A 1D8FA 2DW0A 2XS3A 4Q1LA 1S4BP 4H3XA 1JKYA 1CGFA 2FV9A 1BUVM 1HY7A 1MMQA 2D1NA 3EHXA 1PWQA 3P1VA 1GO7P 1Y93A 2ERQA 2OW9A 1KUIA 1ZTQA 3LJZA 1GKCA 4H84A 1HOVA 1GE5A 3EDGA 4GR8A 1JAOA 966CA 4XM6A 1D5JA 3LKAA 4AXQA 3KHIA 4JIJA 1ZXCA 3DL1A 5BOTA 2J83A 5H8XA 5I0LA 2OY2A 4PKQA 2OXZA 1JIWP 4PKSA 2SRTA 1PWPA 1A85A 3LUMA 2K9CA 1HFSA 2Y6CA 4PKWA 1DTHA 3G42A 2KRJA 1OM8A 1MMPA 4DD8A 3LQBA 3LEAA 3LK8A 1WNIA 2JSDA 3L0TA 1XURA 2HU6A 2MZEA 2WOAA 1KUKA 2JIHA 1JK3A 1BZSA 1J7NA 1YP1A 4ILWD 3KMEA 1QIBA 1CQRA 4G9LA 2RJPA 1ND1A 3WV2A 5I12A 1KUHA 4ON1A 5I43A 1OS2A 1OMJA 2E2DA 2X7MA 1OO9A 3KECA 1MMRA 1O0TA 1ASTA 4AUOA 3B2ZA 4FXYP 1RMZA 1MNCA 1XFZA 1XFVA 4AIGA 3G5CA 5JMYA 2AIGP 3N2UA 4PKUA 3F17A 2N8RA 3B8ZA 5D3CA 1ZVXA 1CAQA 3LQ0A 5BOYA 1JJ9A 4FXQA 3KMCA 3NX7A 1IADA 1I73A 4FVLA 1ZP5A 1SMPA 3DPEA 2WO9A 4HMAA 2YIGA 4GF1A 5B5OA 2J0TA 1HFCA 2W15A 3K7LA 2AYKA 3DSLA 4H30A 3HYGA 3LIKA 1XFXA 2WO8A 1FBLA 1EAKA 2OXUA 2OY4A 2MLSA 3GBOA 3KRYA 2L0RA 3I7GA 4WK7A 3LMCA 3BA0A 1G4KA 1HV5A 3Q2HA 1IAAA 1CIZA 5CXAA 4CTHA 3RTTA 1ATLA 1O0QA 2JT5A 2DW1A 3WV1A 2W14A 1SLMA 5D1UA 830CA 1BM6A 1JAPA 2I47A 3AYUA 3N2VA 1C8TA 3EDHA 4H2EA 1BSWA 3HY9A 2OW2A 1G12A 3TT4A 1OS9A 1HTDA 3ELMA 5D1SA 1QUAA 456CA 1UMTA 4GQLA 1XUDA 1KUGA 3DPFA 4GR0A 2OI0A 4EFSA 2POJA 3VI1A 1CGEA 2DW2A 2YB9A 1Z3JA 2PJTA 3EDZA 1K7QA 2MZIA 2OVZA 3EWJA 3AIGA 1GE6A 1PWWA 1AKLA 1XFUA 2CLTA 1G9KA 5D1TA 3U1RA 1XUCA 2OVXA 1JANA 1IABA 3ZXHA 2CKIA 2EROA 2MLRA 1K7GA 1QICA 1CXVA 4QKZA 1D8MA 4DF9A 2MZHA 1B8YA 1MMBA 1QJIA 4WKEA 4L63A 1B3DA 3Q2GA 3B92A 3HB2P 1UTTA 3WV3A 4DPEA 4IN9A 4GUYA 4H1QA 1L6JA 4H76A 4A7BA 4GR3A 5LABA 1RM8A 2QPJA 3LJTA 5I3MA 1SRPA 2X3BA 1C3IA 3O64A 3TSKA 1BQQM 3KEKA 2OW1A 3HDAP 3F18A 1ZS0A 1G49A 2DDFA 1I1IP 2TCLA 3AYKA 3F1AA 3RTSA 5I4OA 1EB6A 4DV8A 1R1JA 4H82A 4GWNA 3VTGA 3TS4A 4JP4A 3UVCA 1A86A 1Y8JA 5D7WA 1R1HA 1Y0VA 1BUDA 3EHYA 5L79A 2JT6A 3L0VA 1YOUA 4WKIA 1USNA 2XS4A 3I7IA 1R54A 2W13A 2W0DA 1JIZA 1IAGA 1GKDA 4FU4A 1Q3AA 3F19A 3HDBA 1QIAA 2OZRA 3DNGA 1H71P 1IAEA 1EUBA 1UMSA 2K2GA 4I35A 3MA2A 1OM7A 1CGLA 3TVCA 1XFWA 3LIRA 4XCTA 1C7KA 1PWVA 1OM6A 3P24A 3HBUP 4IUWA 3LILA 1GE7A 5CZMA 3ZVSA 1KUFA 2OXWA 3LJGA 4A3WA 2OW0A 3LGPA 1SATA 2O3EA 1GO8P 2X3AA 2X3CA 3EDIA 1JAQA 1SLNA 5BPAA 5L7FA 1YQYA 5I2ZA 3V96B 1FM1A 1AYKA
chains in the Genus database with same CATH superfamily
3KWVC 1XFYA 1K7IA 5CUHA 4HX3A 2W12A 1BKCI 4JPAA 2JNPA 1UTZA 3SHIA 4XM7A 2D1OA 3F15A 4PKVA 3F16A 1KAPP 1G05A 3USNA 1BKCE 1KBCA 2E3XA 4JQGA 1JH1A 1QJJA 4IJOA 2Z2DA 1ZXVA 3LE9A 1CK7A 2Y6DA 4XBHA 4H49A 3LUNA 3E8RA 1PWUA 1AF0A 2FV5A 4I03A 4R3VA 3ZUKA 1R55A 4ZR5A 2V4BA 2O36A 1UEAA 3KEJA 4PKTA 3DWBA 3K7NA 1BKCA 3HBVP 2RJQA 4PKRA 2ERPA 3HY7A 1SU3A 3OHOA 4GWMA 4L6TA 2DDYA 1D7XA 3O2XA 4XM8A 2A8HA 1R1IA 4AYKA 1I76A 1BQOA 4JA1A 1DMTA 4J4MA 5B5PA 4L19A 4WZVA 3OHLA 1IACA 1YCMA 5D2BA 1FLSA 4G0DA 1GXDA 1ROSA 3CKIA 2USNA 1BIWA 4WF6A 1D8FA 2DW0A 2XS3A 4Q1LA 1S4BP 4H3XA 1JKYA 1CGFA 2FV9A 1BUVM 1HY7A 1MMQA 2D1NA 3EHXA 1PWQA 3P1VA 1GO7P 1Y93A 2ERQA 2OW9A 1KUIA 1ZTQA 1GKCA 3LJZA 4H84A 1HOVA 1GE5A 3EDGA 4GR8A 1JAOA 966CA 4XM6A 1D5JA 3LKAA 4AXQA 3KHIA 4JIJA 1ZXCA 3DL1A 5BOTA 2J83A 5H8XA 5I0LA 2OY2A 4PKQA 2OXZA 1JIWP 4PKSA 2SRTA 1PWPA 1A85A 3LUMA 2K9CA 1HFSA 2Y6CA 4PKWA 1DTHA 3G42A 2KRJA 1OM8A 1MMPA 4DD8A 3LQBA 3LEAA 3LK8A 1WNIA 2JSDA 3L0TA 1XURA 2HU6A 2MZEA 2WOAA 1KUKA 2JIHA 1JK3A 1BZSA 1J7NA 1YP1A 4ILWD 3KMEA 1QIBA 1CQRA 4G9LA 2RJPA 1ND1A 3WV2A 5I12A 1KUHA 4ON1A 5I43A 1OS2A 1OMJA 2E2DA 2X7MA 1OZ9A 1OO9A 3KECA 1MMRA 1O0TA 1ASTA 4AUOA 3B2ZA 4FXYP 1RMZA 1MNCA 1XFZA 1XFVA 4AIGA 3G5CA 5JMYA 2AIGP 3N2UA 4PKUA 3F17A 2N8RA 3B8ZA 5D3CA 1ZVXA 1CAQA 3LQ0A 5BOYA 1JJ9A 4FXQA 3KMCA 3NX7A 1IADA 1I73A 4FVLA 1ZP5A 1SMPA 3DPEA 2WO9A 4HMAA 3DTKA 2YIGA 4GF1A 5B5OA 2J0TA 1HFCA 2W15A 3K7LA 2AYKA 3DSLA 4H30A 3HYGA 3LIKA 1XFXA 2WO8A 1FBLA 1EAKA 2OXUA 2OY4A 2MLSA 3GBOA 3KRYA 2L0RA 3I7GA 4WK7A 3LMCA 3BA0A 1G4KA 1HV5A 3Q2HA 1IAAA 1CIZA 5CXAA 4CTHA 3RTTA 1ATLA 1O0QA 2JT5A 2DW1A 3WV1A 2W14A 1SLMA 5D1UA 830CA 1BM6A 1JAPA 2I47A 3AYUA 3N2VA 1C8TA 3EDHA 4H2EA 1BSWA 3HY9A 2OW2A 1G12A 3TT4A 1OS9A 1HTDA 3ELMA 5D1SA 1QUAA 456CA 1UMTA 4GQLA 1XUDA 1KUGA 3DPFA 4GR0A 2OI0A 4EFSA 2POJA 3VI1A 1CGEA 2DW2A 2YB9A 1Z3JA 2PJTA 3EDZA 1K7QA 4L7AA 2MZIA 2OVZA 3EWJA 3AIGA 1GE6A 1PWWA 1AKLA 1XFUA 2YUFA 2CLTA 1G9KA 5D1TA 3U1RA 1XUCA 2OVXA 1JANA 1IABA 3ZXHA 2CKIA 2EROA 2MLRA 1K7GA 3DTIA 1QICA 1CXVA 4QKZA 1D8MA 4DF9A 2MZHA 1B8YA 1MMBA 1QJIA 4WKEA 4L63A 1B3DA 3Q2GA 3B92A 3HB2P 1UTTA 3WV3A 4DPEA 4IN9A 4GUYA 4H1QA 1L6JA 4H76A 4A7BA 4GR3A 5LABA 1RM8A 2QPJA 3LJTA 5I3MA 1SRPA 2X3BA 1C3IA 3O64A 3TSKA 1BQQM 3KEKA 2OW1A 3HDAP 3F18A 1ZS0A 1G49A 2DDFA 1I1IP 2TCLA 3AYKA 3F1AA 3RTSA 5I4OA 1EB6A 4DV8A 1R1JA 4H82A 4GWNA 3VTGA 3TS4A 4JP4A 3UVCA 1A86A 1Y8JA 5D7WA 1R1HA 1Y0VA 1BUDA 3EHYA 5L79A 2JT6A 3L0VA 1YOUA 4WKIA 1USNA 2XS4A 3I7IA 1R54A 2W13A 2W0DA 1JIZA 1IAGA 1GKDA 4FU4A 1Q3AA 3F19A 3HDBA 1QIAA 2OZRA 3DNGA 1H71P 1IAEA 1EUBA 1UMSA 2K2GA 4I35A 3MA2A 1XM5A 1OM7A 1CGLA 3TVCA 1XFWA 3LIRA 4XCTA 1C7KA 1PWVA 3DTEA 1OM6A 3P24A 3HBUP 4IUWA 3LILA 1GE7A 5CZMA 3ZVSA 1KUFA 2OXWA 1TVIA 3LJGA 1XAXA 4A3WA 2OW0A 3LGPA 1SATA 2O3EA 1GO8P 2X3AA 2X3CA 3EDIA 1JAQA 1SLNA 5BPAA 5L7FA 1YQYA 5I2ZA 3V96B 1FM1A 1AYKA
chains in the Genus database with same CATH topology
3KWVC 1XFYA 1K7IA 5CUHA 4HX3A 2W12A 1BKCI 4JPAA 2JNPA 1UTZA 3SHIA 4XM7A 2D1OA 3F15A 4PKVA 3F16A 1KAPP 1G05A 3USNA 1BKCE 1KBCA 2E3XA 4JQGA 1JH1A 1QJJA 4IJOA 2Z2DA 1ZXVA 3LE9A 1CK7A 2Y6DA 4XBHA 4H49A 3LUNA 3E8RA 1PWUA 1AF0A 2FV5A 4I03A 4R3VA 3ZUKA 1R55A 4ZR5A 2V4BA 2O36A 1UEAA 3KEJA 4PKTA 3DWBA 3K7NA 1BKCA 3HBVP 2RJQA 4PKRA 2ERPA 3HY7A 1SU3A 3OHOA 4GWMA 4L6TA 2DDYA 1D7XA 3O2XA 4XM8A 2A8HA 1R1IA 4AYKA 1I76A 1BQOA 4JA1A 1DMTA 4J4MA 5B5PA 4L19A 4WZVA 3OHLA 1IACA 1YCMA 5D2BA 1FLSA 4G0DA 1GXDA 1ROSA 3CKIA 2USNA 1BIWA 4WF6A 1D8FA 2DW0A 2XS3A 4Q1LA 1S4BP 4H3XA 1JKYA 1CGFA 2FV9A 1BUVM 1HY7A 1MMQA 2D1NA 3EHXA 1PWQA 3P1VA 1GO7P 1Y93A 2ERQA 2OW9A 1KUIA 1ZTQA 3LJZA 1GKCA 4H84A 1HOVA 1GE5A 3EDGA 4GR8A 1JAOA 966CA 4XM6A 1D5JA 3LKAA 4AXQA 3KHIA 4JIJA 1ZXCA 3DL1A 5BOTA 2J83A 5H8XA 5I0LA 2OY2A 4PKQA 2OXZA 1JIWP 4PKSA 2SRTA 1PWPA 1A85A 3LUMA 2K9CA 1HFSA 2Y6CA 4PKWA 1DTHA 3G42A 2KRJA 1OM8A 1MMPA 4DD8A 3LQBA 3LEAA 3LK8A 1WNIA 2JSDA 3L0TA 1XURA 2HU6A 2MZEA 2WOAA 1KUKA 2JIHA 1JK3A 1BZSA 1J7NA 1YP1A 4ILWD 3KMEA 1QIBA 1CQRA 4G9LA 2RJPA 1ND1A 3WV2A 5I12A 1KUHA 4ON1A 5I43A 1OS2A 1OMJA 2E2DA 2X7MA 1OO9A 3KECA 1MMRA 1O0TA 1ASTA 4AUOA 3B2ZA 4FXYP 1RMZA 1MNCA 1XFZA 1XFVA 4AIGA 3G5CA 5JMYA 2AIGP 3N2UA 4PKUA 3F17A 2N8RA 3B8ZA 5D3CA 1ZVXA 1CAQA 3LQ0A 5BOYA 1JJ9A 4FXQA 3KMCA 3NX7A 1IADA 1I73A 4FVLA 1ZP5A 1SMPA 3DPEA 2WO9A 4HMAA 3DTKA 2YIGA 4GF1A 5B5OA 2J0TA 1HFCA 2W15A 3K7LA 2AYKA 3DSLA 4H30A 3HYGA 3LIKA 1XFXA 2WO8A 1FBLA 1EAKA 2OXUA 2OY4A 2MLSA 3GBOA 3KRYA 2L0RA 3I7GA 4WK7A 3LMCA 3BA0A 1G4KA 1HV5A 3Q2HA 1IAAA 1CIZA 5CXAA 4CTHA 3RTTA 1ATLA 1O0QA 2JT5A 2DW1A 3WV1A 2W14A 1SLMA 5D1UA 830CA 1BM6A 1JAPA 2I47A 3AYUA 3N2VA 1C8TA 3EDHA 4H2EA 1BSWA 3HY9A 2OW2A 1G12A 3TT4A 1OS9A 1HTDA 3ELMA 5D1SA 1QUAA 456CA 1UMTA 4GQLA 1XUDA 1KUGA 3DPFA 4GR0A 2OI0A 4EFSA 2POJA 3VI1A 1CGEA 2DW2A 2YB9A 1Z3JA 2PJTA 3EDZA 1K7QA 4L7AA 2MZIA 2OVZA 3EWJA 3AIGA 1GE6A 1PWWA 1AKLA 1XFUA 2YUFA 2CLTA 1G9KA 5D1TA 3U1RA 1XUCA 2OVXA 1JANA 1IABA 3ZXHA 2CKIA 2EROA 2MLRA 1K7GA 3DTIA 1QICA 1CXVA 4QKZA 1D8MA 4DF9A 2MZHA 1B8YA 1MMBA 1QJIA 4WKEA 4L63A 1B3DA 3Q2GA 3B92A 3HB2P 1UTTA 3WV3A 4DPEA 4IN9A 4GUYA 4H1QA 1L6JA 4H76A 4A7BA 4GR3A 5LABA 1RM8A 2QPJA 3LJTA 5I3MA 1SRPA 2X3BA 1C3IA 3O64A 3TSKA 1BQQM 3KEKA 2OW1A 3HDAP 3F18A 1ZS0A 1G49A 2DDFA 1I1IP 2TCLA 3AYKA 3F1AA 3RTSA 5I4OA 1EB6A 4DV8A 1R1JA 4H82A 4GWNA 3VTGA 3TS4A 4JP4A 3UVCA 1A86A 1Y8JA 5D7WA 1R1HA 1Y0VA 1BUDA 3EHYA 5L79A 2JT6A 3L0VA 1YOUA 4WKIA 1USNA 2XS4A 3I7IA 1R54A 2W13A 2W0DA 1JIZA 1IAGA 1GKDA 4FU4A 1Q3AA 3F19A 3HDBA 1QIAA 2OZRA 3DNGA 1H71P 1IAEA 1EUBA 1UMSA 2K2GA 4I35A 3MA2A 1OM7A 1CGLA 3TVCA 1XFWA 3LIRA 4XCTA 1C7KA 1PWVA 3DTEA 1OM6A 3P24A 3HBUP 4IUWA 3LILA 1GE7A 5CZMA 3ZVSA 1KUFA 2OXWA 3LJGA 4A3WA 2OW0A 3LGPA 1SATA 2O3EA 1GO8P 2X3AA 2X3CA 3EDIA 1JAQA 1SLNA 5BPAA 5L7FA 1YQYA 5I2ZA 3V96B 1FM1A 1AYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWV C;  1XFY A;  1K7I A;  5CUH A;  4HX3 A;  2W12 A;  1BKC I;  4JPA A;  2JNP A;  1UTZ A;  3SHI A;  4XM7 A;  2D1O A;  3F15 A;  4PKV A;  3F16 A;  1KAP P;  1G05 A;  3USN A;  1BKC E;  1KBC A;  2E3X A;  4JQG A;  1JH1 A;  1QJJ A;  4IJO A;  2Z2D A;  1ZXV A;  3LE9 A;  1CK7 A;  2Y6D A;  4XBH A;  4H49 A;  3LUN A;  3E8R A;  1PWU A;  1AF0 A;  2FV5 A;  4I03 A;  4R3V A;  3ZUK A;  1R55 A;  4ZR5 A;  2V4B A;  2O36 A;  1UEA A;  3KEJ A;  4PKT A;  3DWB A;  3K7N A;  1BKC A;  3HBV P;  2RJQ A;  4PKR A;  2ERP A;  3HY7 A;  1SU3 A;  3OHO A;  4GWM A;  4L6T A;  2DDY A;  1D7X A;  3O2X A;  4XM8 A;  2A8H A;  1R1I A;  4AYK A;  1I76 A;  1BQO A;  4JA1 A;  1DMT A;  4J4M A;  5B5P A;  4L19 A;  4WZV A;  3OHL A;  1IAC A;  1YCM A;  5D2B A;  1FLS A;  4G0D A;  1GXD A;  1ROS A;  3CKI A;  2USN A;  1BIW A;  4WF6 A;  1D8F A;  2DW0 A;  2XS3 A;  4Q1L A;  1S4B P;  4H3X A;  1JKY A;  1CGF A;  2FV9 A;  1BUV M;  1HY7 A;  1MMQ A;  2D1N A;  3EHX A;  1PWQ A;  3P1V A;  1GO7 P;  1Y93 A;  2ERQ A;  2OW9 A;  1KUI A;  1ZTQ A;  3LJZ A;  1GKC A;  4H84 A;  1HOV A;  1GE5 A;  3EDG A;  4GR8 A;  1JAO A;  966C A;  4XM6 A;  1D5J A;  3LKA A;  4AXQ A;  3KHI A;  4JIJ A;  1ZXC A;  3DL1 A;  5BOT A;  2J83 A;  5H8X A;  5I0L A;  2OY2 A;  4PKQ A;  2OXZ A;  1JIW P;  4PKS A;  2SRT A;  1PWP A;  1A85 A;  3LUM A;  2K9C A;  1HFS A;  2Y6C A;  4PKW A;  1DTH A;  3G42 A;  2KRJ A;  1OM8 A;  1MMP A;  4DD8 A;  3LQB A;  3LEA A;  3LK8 A;  1WNI A;  2JSD A;  3L0T A;  1XUR A;  2HU6 A;  2MZE A;  2WOA A;  1KUK A;  2JIH A;  1JK3 A;  1BZS A;  1J7N A;  1YP1 A;  4ILW D;  3KME A;  1QIB A;  1CQR A;  4G9L A;  2RJP A;  1ND1 A;  3WV2 A;  5I12 A;  1KUH A;  4ON1 A;  5I43 A;  1OS2 A;  1OMJ A;  2E2D A;  2X7M A;  1OO9 A;  3KEC A;  1MMR A;  1O0T A;  1AST A;  4AUO A;  3B2Z A;  4FXY P;  1RMZ A;  1MNC A;  1XFZ A;  1XFV A;  4AIG A;  3G5C A;  5JMY A;  2AIG P;  3N2U A;  4PKU A;  3F17 A;  2N8R A;  3B8Z A;  5D3C A;  1ZVX A;  1CAQ A;  3LQ0 A;  5BOY A;  1JJ9 A;  4FXQ A;  3KMC A;  3NX7 A;  1IAD A;  1I73 A;  4FVL A;  1ZP5 A;  1SMP A;  3DPE A;  2WO9 A;  4HMA A;  2YIG A;  4GF1 A;  5B5O A;  2J0T A;  1HFC A;  2W15 A;  3K7L A;  2AYK A;  3DSL A;  4H30 A;  3HYG A;  3LIK A;  1XFX A;  2WO8 A;  1FBL A;  1EAK A;  2OXU A;  2OY4 A;  2MLS A;  3GBO A;  3KRY A;  2L0R A;  3I7G A;  4WK7 A;  3LMC A;  3BA0 A;  1G4K A;  1HV5 A;  3Q2H A;  1IAA A;  1CIZ A;  5CXA A;  4CTH A;  3RTT A;  1ATL A;  1O0Q A;  2JT5 A;  2DW1 A;  3WV1 A;  2W14 A;  1SLM A;  5D1U A;  830C A;  1BM6 A;  1JAP A;  2I47 A;  3AYU A;  3N2V A;  1C8T A;  3EDH A;  4H2E A;  1BSW A;  3HY9 A;  2OW2 A;  1G12 A;  3TT4 A;  1OS9 A;  1HTD A;  3ELM A;  5D1S A;  1QUA A;  456C A;  1UMT A;  4GQL A;  1XUD A;  1KUG A;  3DPF A;  4GR0 A;  2OI0 A;  4EFS A;  2POJ A;  3VI1 A;  1CGE A;  2DW2 A;  2YB9 A;  1Z3J A;  2PJT A;  3EDZ A;  1K7Q A;  2MZI A;  2OVZ A;  3EWJ A;  3AIG A;  1GE6 A;  1PWW A;  1AKL A;  1XFU A;  2CLT A;  1G9K A;  5D1T A;  3U1R A;  1XUC A;  2OVX A;  1JAN A;  1IAB A;  3ZXH A;  2CKI A;  2ERO A;  2MLR A;  1K7G A;  1QIC A;  1CXV A;  4QKZ A;  1D8M A;  4DF9 A;  2MZH A;  1B8Y A;  1MMB A;  1QJI A;  4WKE A;  4L63 A;  1B3D A;  3Q2G A;  3B92 A;  3HB2 P;  1UTT A;  3WV3 A;  4DPE A;  4IN9 A;  4GUY A;  4H1Q A;  1L6J A;  4H76 A;  4A7B A;  4GR3 A;  5LAB A;  1RM8 A;  2QPJ A;  3LJT A;  5I3M A;  1SRP A;  2X3B A;  1C3I A;  3O64 A;  3TSK A;  1BQQ M;  3KEK A;  2OW1 A;  3HDA P;  3F18 A;  1ZS0 A;  1G49 A;  2DDF A;  1I1I P;  2TCL A;  3AYK A;  3F1A A;  3RTS A;  5I4O A;  1EB6 A;  4DV8 A;  1R1J A;  4H82 A;  4GWN A;  3VTG A;  3TS4 A;  4JP4 A;  3UVC A;  1A86 A;  1Y8J A;  5D7W A;  1R1H A;  1Y0V A;  1BUD A;  3EHY A;  5L79 A;  2JT6 A;  3L0V A;  1YOU A;  4WKI A;  1USN A;  2XS4 A;  3I7I A;  1R54 A;  2W13 A;  2W0D A;  1JIZ A;  1IAG A;  1GKD A;  4FU4 A;  1Q3A A;  3F19 A;  3HDB A;  1QIA A;  2OZR A;  3DNG A;  1H71 P;  1IAE A;  1EUB A;  1UMS A;  2K2G A;  4I35 A;  3MA2 A;  1OM7 A;  1CGL A;  3TVC A;  1XFW A;  3LIR A;  4XCT A;  1C7K A;  1PWV A;  1OM6 A;  3P24 A;  3HBU P;  4IUW A;  3LIL A;  1GE7 A;  5CZM A;  3ZVS A;  1KUF A;  2OXW A;  3LJG A;  4A3W A;  2OW0 A;  3LGP A;  1SAT A;  2O3E A;  1GO8 P;  2X3A A;  2X3C A;  3EDI A;  1JAQ A;  1SLN A;  5BPA A;  5L7F A;  1YQY A;  5I2Z A;  3V96 B;  1FM1 A;  1AYK A; 
#chains in the Genus database with same CATH topology
 3KWV C;  1XFY A;  1K7I A;  5CUH A;  4HX3 A;  2W12 A;  1BKC I;  4JPA A;  2JNP A;  1UTZ A;  3SHI A;  4XM7 A;  2D1O A;  3F15 A;  4PKV A;  3F16 A;  1KAP P;  1G05 A;  3USN A;  1BKC E;  1KBC A;  2E3X A;  4JQG A;  1JH1 A;  1QJJ A;  4IJO A;  2Z2D A;  1ZXV A;  3LE9 A;  1CK7 A;  2Y6D A;  4XBH A;  4H49 A;  3LUN A;  3E8R A;  1PWU A;  1AF0 A;  2FV5 A;  4I03 A;  4R3V A;  3ZUK A;  1R55 A;  4ZR5 A;  2V4B A;  2O36 A;  1UEA A;  3KEJ A;  4PKT A;  3DWB A;  3K7N A;  1BKC A;  3HBV P;  2RJQ A;  4PKR A;  2ERP A;  3HY7 A;  1SU3 A;  3OHO A;  4GWM A;  4L6T A;  2DDY A;  1D7X A;  3O2X A;  4XM8 A;  2A8H A;  1R1I A;  4AYK A;  1I76 A;  1BQO A;  4JA1 A;  1DMT A;  4J4M A;  5B5P A;  4L19 A;  4WZV A;  3OHL A;  1IAC A;  1YCM A;  5D2B A;  1FLS A;  4G0D A;  1GXD A;  1ROS A;  3CKI A;  2USN A;  1BIW A;  4WF6 A;  1D8F A;  2DW0 A;  2XS3 A;  4Q1L A;  1S4B P;  4H3X A;  1JKY A;  1CGF A;  2FV9 A;  1BUV M;  1HY7 A;  1MMQ A;  2D1N A;  3EHX A;  1PWQ A;  3P1V A;  1GO7 P;  1Y93 A;  2ERQ A;  2OW9 A;  1KUI A;  1ZTQ A;  1GKC A;  3LJZ A;  4H84 A;  1HOV A;  1GE5 A;  3EDG A;  4GR8 A;  1JAO A;  966C A;  4XM6 A;  1D5J A;  3LKA A;  4AXQ A;  3KHI A;  4JIJ A;  1ZXC A;  3DL1 A;  5BOT A;  2J83 A;  5H8X A;  5I0L A;  2OY2 A;  4PKQ A;  2OXZ A;  1JIW P;  4PKS A;  2SRT A;  1PWP A;  1A85 A;  3LUM A;  2K9C A;  1HFS A;  2Y6C A;  4PKW A;  1DTH A;  3G42 A;  2KRJ A;  1OM8 A;  1MMP A;  4DD8 A;  3LQB A;  3LEA A;  3LK8 A;  1WNI A;  2JSD A;  3L0T A;  1XUR A;  2HU6 A;  2MZE A;  2WOA A;  1KUK A;  2JIH A;  1JK3 A;  1BZS A;  1J7N A;  1YP1 A;  4ILW D;  3KME A;  1QIB A;  1CQR A;  4G9L A;  2RJP A;  1ND1 A;  3WV2 A;  5I12 A;  1KUH A;  4ON1 A;  5I43 A;  1OS2 A;  1OMJ A;  2E2D A;  2X7M A;  1OZ9 A;  1OO9 A;  3KEC A;  1MMR A;  1O0T A;  1AST A;  4AUO A;  3B2Z A;  4FXY P;  1RMZ A;  1MNC A;  1XFZ A;  1XFV A;  4AIG A;  3G5C A;  5JMY A;  2AIG P;  3N2U A;  4PKU A;  3F17 A;  2N8R A;  3B8Z A;  5D3C A;  1ZVX A;  1CAQ A;  3LQ0 A;  5BOY A;  1JJ9 A;  4FXQ A;  3KMC A;  3NX7 A;  1IAD A;  1I73 A;  4FVL A;  1ZP5 A;  1SMP A;  3DPE A;  2WO9 A;  4HMA A;  3DTK A;  2YIG A;  4GF1 A;  5B5O A;  2J0T A;  1HFC A;  2W15 A;  3K7L A;  2AYK A;  3DSL A;  4H30 A;  3HYG A;  3LIK A;  1XFX A;  2WO8 A;  1FBL A;  1EAK A;  2OXU A;  2OY4 A;  2MLS A;  3GBO A;  3KRY A;  2L0R A;  3I7G A;  4WK7 A;  3LMC A;  3BA0 A;  1G4K A;  1HV5 A;  3Q2H A;  1IAA A;  1CIZ A;  5CXA A;  4CTH A;  3RTT A;  1ATL A;  1O0Q A;  2JT5 A;  2DW1 A;  3WV1 A;  2W14 A;  1SLM A;  5D1U A;  830C A;  1BM6 A;  1JAP A;  2I47 A;  3AYU A;  3N2V A;  1C8T A;  3EDH A;  4H2E A;  1BSW A;  3HY9 A;  2OW2 A;  1G12 A;  3TT4 A;  1OS9 A;  1HTD A;  3ELM A;  5D1S A;  1QUA A;  456C A;  1UMT A;  4GQL A;  1XUD A;  1KUG A;  3DPF A;  4GR0 A;  2OI0 A;  4EFS A;  2POJ A;  3VI1 A;  1CGE A;  2DW2 A;  2YB9 A;  1Z3J A;  2PJT A;  3EDZ A;  1K7Q A;  4L7A A;  2MZI A;  2OVZ A;  3EWJ A;  3AIG A;  1GE6 A;  1PWW A;  1AKL A;  1XFU A;  2YUF A;  2CLT A;  1G9K A;  5D1T A;  3U1R A;  1XUC A;  2OVX A;  1JAN A;  1IAB A;  3ZXH A;  2CKI A;  2ERO A;  2MLR A;  1K7G A;  3DTI A;  1QIC A;  1CXV A;  4QKZ A;  1D8M A;  4DF9 A;  2MZH A;  1B8Y A;  1MMB A;  1QJI A;  4WKE A;  4L63 A;  1B3D A;  3Q2G A;  3B92 A;  3HB2 P;  1UTT A;  3WV3 A;  4DPE A;  4IN9 A;  4GUY A;  4H1Q A;  1L6J A;  4H76 A;  4A7B A;  4GR3 A;  5LAB A;  1RM8 A;  2QPJ A;  3LJT A;  5I3M A;  1SRP A;  2X3B A;  1C3I A;  3O64 A;  3TSK A;  1BQQ M;  3KEK A;  2OW1 A;  3HDA P;  3F18 A;  1ZS0 A;  1G49 A;  2DDF A;  1I1I P;  2TCL A;  3AYK A;  3F1A A;  3RTS A;  5I4O A;  1EB6 A;  4DV8 A;  1R1J A;  4H82 A;  4GWN A;  3VTG A;  3TS4 A;  4JP4 A;  3UVC A;  1A86 A;  1Y8J A;  5D7W A;  1R1H A;  1Y0V A;  1BUD A;  3EHY A;  5L79 A;  2JT6 A;  3L0V A;  1YOU A;  4WKI A;  1USN A;  2XS4 A;  3I7I A;  1R54 A;  2W13 A;  2W0D A;  1JIZ A;  1IAG A;  1GKD A;  4FU4 A;  1Q3A A;  3F19 A;  3HDB A;  1QIA A;  2OZR A;  3DNG A;  1H71 P;  1IAE A;  1EUB A;  1UMS A;  2K2G A;  4I35 A;  3MA2 A;  1XM5 A;  1OM7 A;  1CGL A;  3TVC A;  1XFW A;  3LIR A;  4XCT A;  1C7K A;  1PWV A;  3DTE A;  1OM6 A;  3P24 A;  3HBU P;  4IUW A;  3LIL A;  1GE7 A;  5CZM A;  3ZVS A;  1KUF A;  2OXW A;  1TVI A;  3LJG A;  1XAX A;  4A3W A;  2OW0 A;  3LGP A;  1SAT A;  2O3E A;  1GO8 P;  2X3A A;  2X3C A;  3EDI A;  1JAQ A;  1SLN A;  5BPA A;  5L7F A;  1YQY A;  5I2Z A;  3V96 B;  1FM1 A;  1AYK A; 
#chains in the Genus database with same CATH homology
 3KWV C;  1XFY A;  1K7I A;  5CUH A;  4HX3 A;  2W12 A;  1BKC I;  4JPA A;  2JNP A;  1UTZ A;  3SHI A;  4XM7 A;  2D1O A;  3F15 A;  4PKV A;  3F16 A;  1KAP P;  1G05 A;  3USN A;  1BKC E;  1KBC A;  2E3X A;  4JQG A;  1JH1 A;  1QJJ A;  4IJO A;  2Z2D A;  1ZXV A;  3LE9 A;  1CK7 A;  2Y6D A;  4XBH A;  4H49 A;  3LUN A;  3E8R A;  1PWU A;  1AF0 A;  2FV5 A;  4I03 A;  4R3V A;  3ZUK A;  1R55 A;  4ZR5 A;  2V4B A;  2O36 A;  1UEA A;  3KEJ A;  4PKT A;  3DWB A;  3K7N A;  1BKC A;  3HBV P;  2RJQ A;  4PKR A;  2ERP A;  3HY7 A;  1SU3 A;  3OHO A;  4GWM A;  4L6T A;  2DDY A;  1D7X A;  3O2X A;  4XM8 A;  2A8H A;  1R1I A;  4AYK A;  1I76 A;  1BQO A;  4JA1 A;  1DMT A;  4J4M A;  5B5P A;  4L19 A;  4WZV A;  3OHL A;  1IAC A;  1YCM A;  5D2B A;  1FLS A;  4G0D A;  1GXD A;  1ROS A;  3CKI A;  2USN A;  1BIW A;  4WF6 A;  1D8F A;  2DW0 A;  2XS3 A;  4Q1L A;  1S4B P;  4H3X A;  1JKY A;  1CGF A;  2FV9 A;  1BUV M;  1HY7 A;  1MMQ A;  2D1N A;  3EHX A;  1PWQ A;  3P1V A;  1GO7 P;  1Y93 A;  2ERQ A;  2OW9 A;  1KUI A;  1ZTQ A;  3LJZ A;  1GKC A;  4H84 A;  1HOV A;  1GE5 A;  3EDG A;  4GR8 A;  1JAO A;  966C A;  4XM6 A;  1D5J A;  3LKA A;  4AXQ A;  3KHI A;  4JIJ A;  1ZXC A;  3DL1 A;  5BOT A;  2J83 A;  5H8X A;  5I0L A;  2OY2 A;  4PKQ A;  2OXZ A;  1JIW P;  4PKS A;  2SRT A;  1PWP A;  1A85 A;  3LUM A;  2K9C A;  1HFS A;  2Y6C A;  4PKW A;  1DTH A;  3G42 A;  2KRJ A;  1OM8 A;  1MMP A;  4DD8 A;  3LQB A;  3LEA A;  3LK8 A;  1WNI A;  2JSD A;  3L0T A;  1XUR A;  2HU6 A;  2MZE A;  2WOA A;  1KUK A;  2JIH A;  1JK3 A;  1BZS A;  1J7N A;  1YP1 A;  4ILW D;  3KME A;  1QIB A;  1CQR A;  4G9L A;  2RJP A;  1ND1 A;  3WV2 A;  5I12 A;  1KUH A;  4ON1 A;  5I43 A;  1OS2 A;  1OMJ A;  2E2D A;  2X7M A;  1OO9 A;  3KEC A;  1MMR A;  1O0T A;  1AST A;  4AUO A;  3B2Z A;  4FXY P;  1RMZ A;  1MNC A;  1XFZ A;  1XFV A;  4AIG A;  3G5C A;  5JMY A;  2AIG P;  3N2U A;  4PKU A;  3F17 A;  2N8R A;  3B8Z A;  5D3C A;  1ZVX A;  1CAQ A;  3LQ0 A;  5BOY A;  1JJ9 A;  4FXQ A;  3KMC A;  3NX7 A;  1IAD A;  1I73 A;  4FVL A;  1ZP5 A;  1SMP A;  3DPE A;  2WO9 A;  4HMA A;  3DTK A;  2YIG A;  4GF1 A;  5B5O A;  2J0T A;  1HFC A;  2W15 A;  3K7L A;  2AYK A;  3DSL A;  4H30 A;  3HYG A;  3LIK A;  1XFX A;  2WO8 A;  1FBL A;  1EAK A;  2OXU A;  2OY4 A;  2MLS A;  3GBO A;  3KRY A;  2L0R A;  3I7G A;  4WK7 A;  3LMC A;  3BA0 A;  1G4K A;  1HV5 A;  3Q2H A;  1IAA A;  1CIZ A;  5CXA A;  4CTH A;  3RTT A;  1ATL A;  1O0Q A;  2JT5 A;  2DW1 A;  3WV1 A;  2W14 A;  1SLM A;  5D1U A;  830C A;  1BM6 A;  1JAP A;  2I47 A;  3AYU A;  3N2V A;  1C8T A;  3EDH A;  4H2E A;  1BSW A;  3HY9 A;  2OW2 A;  1G12 A;  3TT4 A;  1OS9 A;  1HTD A;  3ELM A;  5D1S A;  1QUA A;  456C A;  1UMT A;  4GQL A;  1XUD A;  1KUG A;  3DPF A;  4GR0 A;  2OI0 A;  4EFS A;  2POJ A;  3VI1 A;  1CGE A;  2DW2 A;  2YB9 A;  1Z3J A;  2PJT A;  3EDZ A;  1K7Q A;  4L7A A;  2MZI A;  2OVZ A;  3EWJ A;  3AIG A;  1GE6 A;  1PWW A;  1AKL A;  1XFU A;  2YUF A;  2CLT A;  1G9K A;  5D1T A;  3U1R A;  1XUC A;  2OVX A;  1JAN A;  1IAB A;  3ZXH A;  2CKI A;  2ERO A;  2MLR A;  1K7G A;  3DTI A;  1QIC A;  1CXV A;  4QKZ A;  1D8M A;  4DF9 A;  2MZH A;  1B8Y A;  1MMB A;  1QJI A;  4WKE A;  4L63 A;  1B3D A;  3Q2G A;  3B92 A;  3HB2 P;  1UTT A;  3WV3 A;  4DPE A;  4IN9 A;  4GUY A;  4H1Q A;  1L6J A;  4H76 A;  4A7B A;  4GR3 A;  5LAB A;  1RM8 A;  2QPJ A;  3LJT A;  5I3M A;  1SRP A;  2X3B A;  1C3I A;  3O64 A;  3TSK A;  1BQQ M;  3KEK A;  2OW1 A;  3HDA P;  3F18 A;  1ZS0 A;  1G49 A;  2DDF A;  1I1I P;  2TCL A;  3AYK A;  3F1A A;  3RTS A;  5I4O A;  1EB6 A;  4DV8 A;  1R1J A;  4H82 A;  4GWN A;  3VTG A;  3TS4 A;  4JP4 A;  3UVC A;  1A86 A;  1Y8J A;  5D7W A;  1R1H A;  1Y0V A;  1BUD A;  3EHY A;  5L79 A;  2JT6 A;  3L0V A;  1YOU A;  4WKI A;  1USN A;  2XS4 A;  3I7I A;  1R54 A;  2W13 A;  2W0D A;  1JIZ A;  1IAG A;  1GKD A;  4FU4 A;  1Q3A A;  3F19 A;  3HDB A;  1QIA A;  2OZR A;  3DNG A;  1H71 P;  1IAE A;  1EUB A;  1UMS A;  2K2G A;  4I35 A;  3MA2 A;  1OM7 A;  1CGL A;  3TVC A;  1XFW A;  3LIR A;  4XCT A;  1C7K A;  1PWV A;  3DTE A;  1OM6 A;  3P24 A;  3HBU P;  4IUW A;  3LIL A;  1GE7 A;  5CZM A;  3ZVS A;  1KUF A;  2OXW A;  3LJG A;  4A3W A;  2OW0 A;  3LGP A;  1SAT A;  2O3E A;  1GO8 P;  2X3A A;  2X3C A;  3EDI A;  1JAQ A;  1SLN A;  5BPA A;  5L7F A;  1YQY A;  5I2Z A;  3V96 B;  1FM1 A;  1AYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...