1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
1GVIA 2QLVB 3QQ3B 3WIIL 1GQJA 3OKDB 1P84K 2XTJD 5HPMB 2BVDA 3NGBB 5C9JB 4MS8C 2D7QA 4N0FB 1KTLA 3IVKB 2ZUVA 4CVWA 2AQ2A 3UTTB 3NJ3A 4YE4L 1CGUA 1BFTA 4PRHA 15C8L 4GO9A 4D0BA 4E9LA 1I8KA 3VJ6B 3SDAD 4M48L 2E8YA 2ORBH 3CU1A 2YLAA 1J5OL 3OBAA 1RK0B 1MFBL 5I1LA 1LLOA 1G84A 4LCUA 1JYXA 3BN3B 1DANT 4FXKA 3T04D 1HSAB 1TJHH 5FL0A 2ZX9A 4LSVH 3KLSA 1QSFB 3S4SG 1FNHA 3ZDXF 4OUUA 1QQDA 1YEEH 4OZIE 1EHLH 3C08L 4AW7A 3OV6A 5LGKA 1T80A 2YBRA 4I4WA 4HC1A 1ACYL 4J3OC 1WCBA 2IBZX 5ECUA 3ZTJH 4BFIB 1S7UB 5GZOD 4BF7A 4WKFA 2NNAA 4FZ8L 3T77B 4YBLC 1U58A 2D24A 1FA2A 2WWMD 3N12A 2JTDA 5J89A 3BP6A 4GRMB 5MENA 5D5MA 1GXEA 1YEGL 2GAZB 3QBTB 5IF0A 3EMCA 4XX1G 3RAJL 5IHUH 3V0VA 5CP3H 1EBPA 5IT2L 2YFNA 3WSQL 2HFTA 3K2UL 4ALAL 3ARGC 2R23A 4P2QB 3X12B 4QXGH 4MB3A 5TDNA 1QOXA 4X98A 1T1YB 5H35A 3FB5A 3TA3B 4LKCA 4AEEA 3TBTB 4H8VA 1VFUA 1ZVYA 2Z31A 4IPLA 1RY7B 4NZJA 2I24N 2CDGB 3MLWH 1ED3B 2RCSH 5IHBA 1KBBA 2G2RB 3MOQA 1A6WL 3HS0B 2FRGP 5CP7A 5DJ6A 2DWDB 2C1OA 1G6VK 3VXRB 2ZJSL 4P2QD 5HGAA 3LZFL 2IALA 1XIWC 2CKNA 3FTGA 4N90E 3L1OL 2XIDA 2VC2L 2AJUH 2E6QA 1JTPA 2EE3A 1DR9A 3PL6A 4YBLB 5C09D 3VIPA 4LKXA 4X5XB 4FXLA 1D6EA 1YNKL 5I8EB 4I48B 2AW2A 2W07A 4JZNB 3WF2A 3PXJA 3TV3H 4LLVB 3KYMB 2R69H 5K9JL 5MEQA 4RFEB 1Z9OA 5DO2C 1JFQL 1EHXA 1KC5L 4UFIA 3GRWH 1X5ZA 3THMH 43CAA 2BVYA 5JBEA 2ZOLA 1LK2A 2DSUA 3VXMB 1UVQA 3PWPB 2XWJA 4XH2A 3TBVB 4FABL 2O9OA 3MACL 1EAJA 1MPAL 4MA1C 4JRWA 4XP1L 2F18A 3AIQA 1OW0A 4N1EA 3T0VA 3L3DB 1YECL 3ZT6A 5C7XH 1U8LB 3P9WB 3KPRE 4NHUB 2K3TA 3HNVL 5IM7B 1JPFA 4LPCA 1E15A 3Q5OA 4PTMA 1FSKC 4HK0A 4A6YB 1VFMA 2VISB 2J8UE 2NY3C 3VFWA 1QRNB 4M6OL 1TQVA 5EB8A 3QGVA 3C8KA 2NY5L 4YXKH 1L0PA 1TQSA 2DICA 4IDJH 3ZJKA 2XZCH 3CFJA 4ZFOB 3WFHA 4LARL 1V02A 1NWTA 2DYPB 3ARZA 4V1DD 5I18L 1HYSC 2YXMA 3I02A 4M61A 1A9BB 1VBUA 4NO3B 1L9NA 3KYNA 4NQXA 5C0EB 5A40E 4BQ4A 4RDQF 4FNUA 1KENL 3L4XA 2VI0A 5EO1B 4MXWH 4PP2B 1X5IA 3BEWB 1KACB 3OR6B 4Y88A 1I9IL 4KTEL 2I07A 2BJMH 1H3PL 3VH8B 4DKFL 2OJZL 2ERJB 2BX5A 3M8OL 2DT1A 4R90L 2CK0H 3D0VB 2NW0A 4YXLL 4PGDB 2V5SA 5FO9B 1UD3A 3GSRA 2XGBA 3S6TA 3VXME 2PB1A 5I71B 4YH6A 2X4NB 2E9JA 3ZQ9A 3W11C 4PMNA 4YHEA 2WWKO 3F4VA 3EBAA 5BMFL 1MWAL 4O2CB 3PL6B 3BAYA 3D25A 5CMAA 5ESVA 4JFFB 3AXXA 4JFVA 5CSBA 5CCKL 4NQEA 5FYKD 2AJVH 1CXLA 5EUOA 1UHVA 5D9NA 3D39E 1ZU8A 1IAKB 2YA0A 2BFGA 5J1AB 1J12A 3PGDB 3WNKA 2JCCF 3HI6L 2FEDC 4ZXBA 1XH1A 2VABB 2BHYA 3EJRA 2EDNA 1TR1A 5HPMA 4WFGD 3OB0H 3ULVF 1TMCB 5FA3B 4PSRA 1MVFA 4UDTA 4WUUD 3WFEL 3HR5B 3PQYE 1AJ7H 3BUTA 2EDOA 2YL8A 1T89A 3BQUD 4LKCB 3RAJH 3OJ2C 3PJSA 2NYYD 4NQUA 1AH1A 2P24A 3I2CH 5IW1A 3WSQH 4PJ9B 1TDQA 4BQ6A 4G5ZL 3QFJD 5GS1C 4JFYA 4NQSA 5ITBL 4WGVB 4QRRA 3ECQA 3W29A 3DSFH 1FAKT 2XTJE 2CQVA 1JF6A 4OLXH 1KN2L 5DJ8A 5GNYA 3ZHDA 3LRSA 1WP6A 3DO3A 3H9SA 5FF6A 1S46A 5C3LD 1YMHB 3AI0A 1T6VN 2QSTA 4MWFB 2CLRA 3SKMA 1BEYH 4XMKL 4QHLA 1CD1A 1GGBH 5E56A 5HHME 3WHXA 4F7CB 4YDJA 3AAZA 3QUKB 3QR3A 2BXYA 3H0TA 3IDIA 3INUL 5EBMB 4F9DA 1J0JA 3G6JA 4HWUA 2WIIB 4OM1L 5FOBA 3AIVA 2WBJD 4UR9A 1U58B 3DBXA 4Z2HA 1ZMYA 5C0NC 2MPAH 5D8JH 1IGFH 2BNQA 3W9DA 4DM1A 4PJHB 4QRQB 4YK4C 5HGGS 2EIZB 1K4DB 1EEYA 5ICXA 3Q2CA 5IEHA 5B38B 1S78D 4DQOH 1IKFL 5FO8A 4BQ5A 3SJVB 4FQCL 1E70M 1H5BA 3RY5A 2D22A 3THML 4CW1A 5I76B 1BHGA 3ZYOA 2R1YB 3MRPA 3IAGC 4Z77A 3QO1A 2R2BA 4MD0A 1PIFA 3TIDA 4PCTA 3SDYL 3GJFH 1UA7A 3QHOA 1YY9D 3W0KA 4NXKA 4JG0L 1C5BH 3QQ3A 4JFDD 1WFNA 1I1RA 1WBZA 4HJ0C 4OTXH 4S1QL 3UTSA 1Z0MA 2XQBL 1SJEB 3Q48A 2XJ7A 3O2LA 1AGCB 1A7NL 3GIVA 4P9MH 1FP8A 3P3YA 4QP0A 1DSFL 4OD2A 1CD9B 2IALB 1CGSH 3L4ZA 4MS8D 4D9LL 4HIHA 3FB5B 1SYSA 2P8LB 1T0MA 1RZ7L 3QNXA 3JWDC 1GNXA 3W5NA 5EOCJ 4PJ7E 4D6HA 2GCYB 2APWA 4K71B 1LO4L 4KKAC 3QDGD 4DZBA 3GH4A 1INQB 4Z0BL 1NLBH 3RPMA 3U5UA 4UQCA 5SWZD 3VTRA 1F4XH 3M46A 1UD8A 4HIIA 3AHXA 4JKWA 1ZWIB 15C8H 2CRZA 1BIHA 1HTYA 1A7PL 1A6ZA 3D85D 5ETUB 2X2JA 3L4YA 4QNPE 1NWRA 5DWUL 2VLKB 4FFYL 1FFQA 2IG2H 4HIEA 3VRLE 1BGGA 4MLIA 3MOAL 4OAWA 3TT3H 3V0WL 1C8PA 1A4JB 4QLRA 2NNAB 4X6CB 3WELA 1TJHL 1FHGA 2LVEA 3BP4B 4OGXL 2WIIA 4UMGA 2X7LB 3BIKA 3VXUA 2OZ4H 4P4RA 4JFHE 1X5KA 1Z9SA 1IEAB 5GRWA 4POZD 4U0QB 3O0RH 4L29A 5MEOA 2WZEA 1J0ZA 1UZ6F 4J4PD 5EU3A 3GGWB 1HKJA 3TH2T 4NO0D 4HIJB 3GSXA 1XC6A 4ACPA 5LWYH 1E43A 3HCVA 3IAPA 1E6OH 4L5FH 1NM9A 4QHUA 3LKQA 5KBNC 1PBGA 4MZ2A 1R87A 2XTKA 3T0WA 1G0DA 3WD1A 4M3JA 4MQ7B 1DLHB 1T7ZA 4WI5A 2FSEA 4ZFFB 1Q94B 1IAIH 2GSGA 4HCRL 2HJFB 2QJDA 4X9BA 4TULH 1PJ9A 3SGKC 4CADA 1S5IL 3BVTA 1LEIA 4KUZL 4U1NA 3KYOB 3ZE1F 3EYUH 2CEQA 2DQXA 2V9TA 2DKSA 4H1LB 3FONB 1JMZA 3SO3C 4JFZH 1BYDA 1BZQK 2EIBA 3FB6A 3SKUD 5DURB 5IUSA 2JB6A 3NCYP 5TE7H 2GJRA 1S9YB 1A8JH 4QRTB 4B7IA 1C16B 3FMGL 1G1YA 4IOIA 3PHAA 3RM4A 4LSQH 3S34L 3ARBC 1SYTA 2HMIC 1G1CA 5ALCL 1ROWA 4UT9L 2ATPA 1KB9K 5D1XA 5LAXA 3RNQA 5SWQB 3HZMA 4H26A 3B5GA 4IS6A 4JM2D 1MLBA 1S7SA 1OAZH 2OTUB 1T3FB 3ARRA 1ITCA 1G9EA 1A5FH 1KT2A 5HNNA 5E2VL 3E8UH 1EPFA 2Q7YA 5DS8A 1J1OL 1TZ7A 2C1PB 1L7IL 4FZEL 2Q8BL 3GO1L 5I1CL 3VFPA 4O02H 1VPOH 3T4AA 3MLZH 4NRXA 4GW5B 2FYYB 2VT0A 4NQDB 1NC2A 1CXIA 5IKCB 4A6YA 2KBGA 1KUMA 4XCNA 3HZ3A 5I74C 3QHZL 3V4UH 2VLRA 5F7YC 1JPGA 1UXSB 1MJ8H 1T83C 3WJLC 3OIHA 4NC1C 1MQRA 3K2MC 1N0XH 4HUVA 5A3HA 3BE1L 3SDCA 5ANMA 3OXSB 1AXTL 5E00B 5JXEA 4GRWF 4EE9A 4A3YA 1QBML 5TDOB 4JFOA 2EE9A 1JTOA 4G8GB 4ZUVB 3VE0A 1G9MC 4OIAA 2VUYA 1CLZH 3SKMB 3W0WE 5KJRL 1HYSD 1CZ1A 1MHHB 3ZDYE 3V7AE 4HT1H 1OT2A 2IQ9H 4HIHB 3QIWC 4XNZB 1NBVH 3RY6A 1U0QA 5F6HI 2GK1B 1H0DB 3NBNA 5AYIA 2VRKA 4EQ2A 1MCSA 2PNDA 5J13B 4ZAKC 1OT1A 4PTTB 4U3HA 1PX4A 4PGCA 1HXJA 3LIZH 3KPLB 4BZ2L 1P5UA 3WDPP 1N6VA 5HYFA 2W91A 4DKAA 4RX4A 3BT2H 3T0BA 2X89A 3WS6C 3MGAA 5AY7A 1KNOA 3O81A 3BVWA 4Z77B 4U1HB 3NSXA 2DF3A 5L6YH 3MLRL 4U6YA 2E3VA 4R90H 2WUBL 3LS5H 4JHWL 1XH3A 3ABZA 3CUHA 1GGYA 1FZKB 1GC1L 4YFDB 4FQQB 4P57B 5IBUG 1FBIH 2VKWA 2FX8H 3KS0H 1U3JA 4JFUA 3LS5L 4JHWH 3DDGA 4XNXL 2RIKA 2XFXA 4ZSOB 3G6MA 5IEKA 1NJ9B 2FEDD 2EIZA 4F58L 4GW4B 1MI5A 1HH6A 3GMNB 3QXAB 8A3HA 1RH9A 1IGMH 4L4JA 3P30H 1DTUA 5CHNB 5EFFA 2OTPA 2EZ0C 1SMOA 5KTEH 4ZFFA 1HXKA 3WIJA 4EN3C 2E9WA 1H5BB 2IADA 1YJDC 4DO6A 4W6YB 4PRHE 4RGOL 1K5NB 3BPCA 4OQTL 3P9LA 4Q6IA 3U48A 4YIQB 4V1DE 4J1UA 4ZFOL 2FZ3B 4RAVA 3DX4A 2R15A 1QSVA 1VEPA 1JI1A 2JK5A 5FGCE 4RFOH 3VFUB 1R5VB 1L0YA 1ZGLA 4OLVL 3DUUA 1SYVB 2DIAA 1FL3A 3WHE0 4P3CH 2AJ3A 4H88L 3IDIB 5EBMA 5EUKA 2AXGB 2YD5A 1VEOA 2HP4A 1E3XA 2B1AL 2A77H 5KW9H 3N11A 1KCVL 2CLVB 3H54A 2DQHH 4KZDH 2JCCB 1WUNT 2R4SL 4KI5E 1S9WB 5LAXB 2XACC 1RZ8A 4LYQA 3K7UA 1I7RA 4CN4A 3LQAH 4OFVA 1E4JA 3P77B 1INQA 5HD8D 3EKCA 1NFIA 3MX0A 4NRZA 1I1XA 4NHCH 4H0IA 4EN3A 5B21A 2OYLA 5JIIA 1W9UA 2JLLA 4GXUN 2GTZA 2IH3B 4BS0A 3O6FD 1JNEA 1EEUA 2YL9A 3SCMC 1KIQB 3HB3C 3T8XB 5D7KD 2C3GA 3EO9H 3TIDB 2F9BT 1S7XA 3HG1A 4X99A 2DBLL 5I16B 1QFHA 1QRKA 3EZ8A 1GHRA 4EJ1C 1DVFC 2V9QA 3F6IA 3HLAA 4Y4KD 2BVOB 5TQ0L 3T65B 4R0LA 4GBXC 4FQJH 1G0XA 3L5JA 5FB8B 4N0FA 4PJ7F 1VACB 1OAYL 5AYUL 4QLKA 2WVVB 4TOYL 5IW3A 4FQLH 1BQCA 1T21A 1ESWA 5CZVH 4LLYB 5MP6H 4U1KA 2VRAA 5IROC 1MIEL 3GNOA 2AXHA 1UR9A 1NMAH 3B9KD 3K46A 4P99A 4JG0H 3JTSA 5K9QI 2CLZA 1KXHA 2WCAA 2AJVL 3AFLA 5EU7E 3P0VH 3S36X 2UY5A 1BAFH 1VHPA 4G9FA 5DTFA 2R2EA 5TJWK 3BDBA 3LHPL 1QKZL 3DMMB 4JO4L 5ACZA 4FQHB 4OAWB 2DWEA 1ISWA 1NQ6A 2VLJD 4FLOA 3PTQA 3N1MC 4MJ6A 1KPRA 1DQML 4L8CA 2DLHA 4JN2A 3LIZL 1KYOJ 1WZMA 3JV0A 4LVNC 4PJDE 5J57B 4X7FC 3GB7B 1RIVL 5JO5B 3L3OA 5JR1H 3FAWA 5D1XB 5D7SL 1NUDA 4K3JH 1QUNA 4WF7A 4FFYH 4PMRA 2XYLA 3RY4A 3GIVB 5HYSG 4P2YA 1E1FA 1Q72L 5JXAL 3UJIH 3CSYB 4DEPB 3WQWA 3LV3A 4GQ9L 4JRXE 5IIEA 2ADGA 4FG6C 4PJFB 1N6QL 4BZYA 4UNIA 5D9PA 4B15A 1JUFA 1ODUA 5IV2B 4XGZA 1ES0B 3BRFA 1TENA 4W88A 1L9MA 4JRYB 4U7MA 2NY1C 3RL1A 3MLWL 3WDHA 2XN9D 3O4OC 5SWSD 1UC6A 1FO0H 1LEIB 2ARWA 4TNVF 3MJ8A 4UT7L 3DXAA 2VXVL 1HINH 1NBZA 1T20A 2YMXL 3QUYC 2E9MA 3RUGA 4H20H 4LLDB 2GITA 2AV7A 1OWWA 4JPWH 2V7NB 3U36A 5HDLA 4DGVH 5DMJB 5C09B 3MRCA 2D0HA 1ZHLA 1ZSDB 3UTPE 4PRIE 4F3FA 5IVZB 3IFOA 5DLMH 4DUVA 2ZCKL 1OB0A 4K3EH 4LFHD 4HKJB 5D7IF 4U1HA 3VDAA 5HGAB 4DOHB 4X4YB 5IFTA 4ISVA 4QT5A 2VYRE 3RWFB 2ZUQC 4KRLB 4IISA 1ZHKB 5I66B 1TPXC 2F7QA 4MCYB 1W1YA 4HJGB 4Z5RB 4UQAA 4LGSB 4NWTL 4AEIH 3LRGA 4PTUA 1TA3B 5GGUA 5D1QC 1P7KA 2X42A 3W11D 5IR1B 5LGJB 3P77A 3RI5F 1XGRB 1UD5A 2ZX7A 4NRXB 1UR0A 3PHQB 3QXDA 2CPUA 1Q9WB 4UQ2B 3C5SA 4FA8A 4JFHD 1KB3A 3RFZC 3THCA 1RURL 3N1PC 4ONFH 4K7PX 4P46A 4JZJB 4UUJA 5EBLB 2VAJA 3OXSA 1U8IA 5CEXA 5C0DB 4XB7A 5A3IC 4WI9A 3N9KA 4M93C 5I1EL 3WUWA 3VWKD 5J3HC 4XPAH 1UKPA 1JF1B 5GRJL 5I1GL 2O9TA 1QWUA 3DDFA 1KN4H 1M05A 1S7UA 1ZT7A 2EDDA 9CGTA 2Y8VA 4FFVC 2EEBA 3LD8B 2VDOH 2WWDA 1OLLA 3IGAA 5B4MD 3WD4A 4HPGA 2FDBP 3RUGE 5DD6A 5GS0D 4TNWK 2I60L 5FIEA 2UWEE 5A16A 2ID5A 2QQLL 3RJYA 4QRPD 2GI7A 3A67L 2WC4A 5DUPL 3X13B 4ODWB 5IHZB 3AB0C 1FN4B 2ICES 4LLDA 2Z93B 4CJ1A 3MOBL 3TVMC 3KS0J 4G6KL 1CLZL 3MRMA 1MWAH 4Y2DD 2IH3A 4X6DF 3UC0H 5IMMB 3L4UA 4KDTA 3BJ91 4G6MH 4IMLA 1HCVA 4K7FB 2C4FT 1WDQA 4W70A 5D2LB 3SGEH 2IF7A 3STLA 1S5HB 1U42A 1WC7A 5HDBE 4KK6D 1K3IA 2WBJC 1DE4B 3PP3K 4F57H 4D94A 5AD0B 4ZFGL 2VR4A 2CERA 5FYJU 5EO0B 2V3FA 1Q6EA 4KUCF 2GUOA 4MXVF 5BROA 4WI8A 3RZCA 1MFVA 3HE6D 2IXVA 2OTWA 5CJXA 3RDTD 3EYFB 3TPUA 3D0LA 3BP5A 5BOZG 5TDNB 3ZDYF 3DROB 3RGVD 4NRZB 2YWYA 2YDSA 1MUJB 4ODBD 3LXCA 2D31B 1TQCC 5J6HA 5HI4C 1RVFH 3H2WA 4JG1H 1V3LA 2B4CC 4LBEA 2IQAB 1NFDF 4WTZG 2YJQA 1SJVA 1QSZA 4KXZH 2V9RA 1KV3A 5F96L 3ARGB 4PP2A 1DN2A 1GC1H 4BSJA 5DJAB 2YPLB 1IARB 3AS3A 3W4RA 5B39G 5HYJA 3CC5B 4KROB 5JIWA 3CSGA 3MV7B 4J3XA 4XBPB 2FZ3A 2CRMA 4GXVL 4P46B 1DDHA 2VCCA 4AIUA 3MSDA 1FP5A 4OZHF 4GG6F 4I18B 4F15C 3MA7A 5AC4A 1YEHH 2NMSA 2DT3A 4KI1A 5JA9A 1QI3A 4P8WA 4ODUA 4IMKA 5IJKA 4JL2A 3S3PA 1YEHL 4RDQG 4LVOC 4KHTH 4FXGA 4MPKA 4OF8A 3V4VH 1SY6A 3NCEB 4PLOB 4HJJL 1HXMA 3GSVB 1SQ2N 2D7TH 4JHBA 1I4FB 3F12B 1E6PA 2WMGA 3I50H 4OIIH 3RTQA 3KPRB 5IWLC 4RE4A 4RGOH 4OOUA 3FCTA 1KFWA 3RVVD 1INEL 1BVKB 5C7XL 2W63A 1LD9B 3NIGF 4Y19B 1PY4A 3CNKA 4EOWL 2XV6B 3JV6B 2AERT 4X5LA 3B6SA 3S96B 4AD0A 5B8CB 4ZUSA 5J9PB 4ZD3L 1ES0A 1G7IA 4BQ3A 3FQWA 1U8OB 4RMVA 4GG6A 5DA4A 5DFTA 3IFPB 1QPKA 2CHNA 3LQAL 4P5MB 4F7MB 2VNCA 1U8QB 4MQXC 2EXWD 3X3FL 1DQLL 3MV8A 3OG6B 3RUGB 3SDXF 3T09A 3V9FA 3ZT7A 4PP1D 4ACZB 4J4PC 3WYRA 2J7DA 2J62A 4HUUB 1J0IA 1EAPA 1U8MA 2UWEB 3GZAA 1QFWH 5T33H 5E6YA 4O58H 3P4NA 1FPTL 1UQSA 3P11L 3SE8L 1DBAL 1HXYB 3EO1A 2WVUA 4MXVE 1J0KA 1CGSL 2XZAL 5EBWA 3WIFB 2PETA 1BPLB 4NBYB 2WHLA 1QO3B 4G7VH 5HDBF 3LV3B 3IRZA 2QV4A 3MLPA 1ZS8B 4JY6A 4QHLB 2CITA 4L3EA 5ALBL 1JD9A 5D96C 1XGPB 1YEDB 4ZS6D 5J8OA 5DJAA 2EPNA 1EHNA 2WKGA 1FNFA 3DX8A 5FUZH 2EADA 1W3KA 3ZKXB 3BPOB 2BVPA 5D4YA 1LDPL 5D6DA 1T1WA 5CGYD 5SV3A 4DOHE 4ONHA 5F1KC 1AE6L 1EFXD 5CEYA 3NCYS 2FATL 4PJHA 4YLQT 4FQLL 4OFDA 3VXPB 3TBWA 1S3KH 4XVTH 2OXGA 4C57C 5F7EL 2VDPL 1ZANL 4FFWC 2P24B 1LEKA 3CLEL 3P2TA 1FYTE 3B43A 4GAJH 2QADC 2NY4C 3TZVB 5E7BA 4Y5XA 5IFPA 3CLWA 3FQRB 1WIPA 4TVSa 5MEPA 4FQXC 3RPKA 1S5HA 1WC7B 1YPZE 4JM2C 4WFHD 3V5DA 3RVWD 2VABA 1Y18B 2Y7QA 2I9TA 2PWHA 1LEGB 2D9QB 1HKKA 4HBQA 3HUJF 3W53A 5HGDB 3SHSA 4F8QA 1NAML 2Y07H 4LVNB 2KH2B 5C0FB 4HLZG 2NZIA 4LCIL 1XGUA 4X7EC 4NFBA 4OT1L 4OCYH 4XWGL 4POYA 5F1NB 3UROR 1UA6L 1QSFD 1U41A 4FG6D 3RL1B 5D7SH 3BKJL 1P4BH 1OCWL 2AKRB 3II1A 4W4OC 1TG7A 3OZ9H 4MAYB 7A3HA 2JIEA 3FB7B 1HEZB 3UG4A 4WVRA 1K2DB 4P59L 4UT9H 3VMOA 2O5XL 1YMME 3NCCB 3H9ZA 2W60A 4LU5L 4HXAL 3S37H 1R24A 2X2HA 3ARFC 3FONA 4FF5A 2WW8A 5TD4A 4Z2LA 2XNAB 1MLCA 1G7MB 3FB6B 3ZKQD 3G6AB 2NY4B 4OSUH 3TZVC 1IGCL 2IEPA 1P6FA 4QCIB 1HOCB 3MRFA 1JZ4A 3E2HC 4NKIH 5CBEA 3DUHA 3QO1B 5EU6E 1V0LA 2O9RA 2RCSL 4HWZB 3SDXE 3F62A 1CVRA 3HNTL 5JW3H 3LSOB 2YFOA 1C7SA 1TETH 3O3DA 4X6EB 2OR8A 3RTQD 3GSWA 3GK8L 4HPYH 5HBBA 1MOEA 1N59B 5EU4B 5ISZD 5EULV 5FKPB 2PWDA 2F8QA 3E1F1 5D2LE 5D7IA 3GM0A 3VNYA 2XY2A 3S36L 5EU3B 1DWFM 5ENWB 2ZXQA 1MCDA 4P5TC 2XVKA 1U8PA 4EXKA 5FECB 4LCWB 2C7UA 4J28A 3EYQD 4UZSA 5DQDL 1E6JL 4AZ8A 3CFIC 1VFAB 5DS8B 5ABFA 1HWWA 4O51B 1CK0H 4WI3A 1OSEA 5L7XH 1I7ZB 3S5ZA 3WXWH 2CBUA 3FFDB 1DDHB 1TLKA 3HZKB 4JPIA 1E4LA 3FRPA 3TESA 1ZA6A 4ETQA 1QFUL 1KJ2H 3WNPA 4JN1H 2PTTB 3HR6A 2PO6C 1HXYA 4N42A 2A6KA 3VIOA 3MPCA 2HTLC 4U5KA 4NIKB 4GMTL 4HIXH 2V17H 5C9JA 1G7JA 3MUZ1 4OZIA 4Q6YA 2B0SL 2ZKHH 4DZBB 5FM4A 3NFSH 3VNZA 1JNJA 1IM9D 4Y8DC 2DJSA 5GS0C 1SM3L 1CICA 1BX2B 2IFFL 1V7ML 4P8VA 3VFVB 1KTBA 4NNYA 4Z7QF 3I84A 5DRZA 1U3HA 1MF2L 3SDCC 1CE1L 1J10A 3BISA 4MHHI 5CJQL 4WEBH 5E2TH 3VXSB 4XPAL 3ZDXE 4AMKH 3B6SB 5CIPB 4HX1A 1XCXA 4X6FA 3DVGA 1UKSA 5BO1H 2AV1A 1AC0A 4EI5B 1G7IB 3RWEB 5B38G 1HKLL 2FX8L 1PZ5B 3L5XL 4OF5A 2WMIA 1BYAA 3UPRB 2DS4A 4D8PA 5DT1L 3G5VA 1N26A 2C0HA 1I85A 1D5MA 4NUGH 2ESCA 2Y7QB 5INCA 4JM2F 1RMFL 4W4NA 1F6FB 3QIUA 3GBDA 3LS4L 2DAVA 4WI6A 3MJ7B 3LKQB 1HJXA 2WZHA 1LO5A 1CIUA 3HG1E 2FLRT 4G8GA 1E6ZA 3N9GL 3WDQA 3VWKA 4AG4H 2AAAA 2E7MA 1GAFH 2X2YA 3GRWL 4YHNA 5GRVK 1UYQA 1VFOA 3JVGA 5DK0B 4PJEB 4HFWB 4QRRD 2B31A 4XXCA 2DI8A 4PJDF 3S4SB 2MQ0A 4MVBC 1RP8A 4LHUB 2G8ZA 4G5ZH 2EDBA 5CEYB 2DQHL 4QRUA 2X5PA 1CLYH 3CFBB 4TUKH 1TMQA 2Q86B 1MFAH 2J79A 3QFDB 4F33A 4ATDA 4HGKC 4HPHA 1NANH 3QXWA 1BQHB 1IC7L 3WQ4A 4JDTH 2P5EE 2XPGB 1MFEH 4MNJA 3HZYB 4LCCB 1EMTL 4ZYKA 2XUCA 3JWDL 2FJHB 2XTJC 3IK2A 3PN8A 2NY2D 1XGYL 4BFIA 3VGHA 2HFFA 1MELA 4OZ4B 2P5EB 3VFSA 2H8PA 3OWEA 5D96B 1FORL 1GSMA 3FO0H 1D6VL 1RUML 4ETYA 1OGAA 2BHUA 3L7FB 4HEPG 4JHOA 4I3SH 3B9AA 4OGZA 5BS0D 3JWOL 2PWGA 3EYVB 4JFFE 2YUVA 4MDOA 4O02L 1JNNL 2R2CA 3PZQA 2BOBB 3IJHB 3VXMA 3CMOL 4YK4B 5TE6H 4JVWA 3U9PL 1JRHI 2EH8L 4OF3A 5JZ7C 3K81A 1TITA 4HPOL 4ZPTB 5HHOB 3LN4A 3REWB 2FLBT 2IAMB 1LE5A 1BVLB 1N0XL 4OFYD 3CXDL 4PUEA 5EWIH 4AT6A 4NZDA 2HT3C 1JPST 4FTVE 1JE6A 2QQKH 4G3YH 5EOQH 3FFDA 3HZKA 4LSSH 3AUVA 3SOBH 5D1QA 1UKTA 5CAYB 2XN9A 2AABH 1E1EA 4L4OA 3WH9A 1JPTH 5A2IH 1FDLH 1AD9B 3QG6B 2PF0A 5D6CB 2C9AA 3B5HA 4MXQD 1UM6L 4BZ1L 1VAHA 1DEEB 1K85A 2F7RA 3LHPH 2ADGB 4PD4J 4XAKE 2WLZA 3K4DA 3V6BR 3GMRA 3U30C 3VXSE 3MV8E 5EO1A 3MTRA 5C3TA 4YZFF 2ZICA 2YC1A 1KTDB 2ITCB 3WIHA 2F53B 1N0LA 3OR6A 1A14L 1F90L 2YD4A 1AD0A 4DVBA 1UWGH 1A7RH 1EV2E 1QG3A 4H25A 4YHLL 1WWWX 4O2FB 2W67A 4PEEA 1OQXA 2OSLB 1NCUA 1F4WL 2UUDK 5E7FA 3VXPA 3H8NA 1DFBH 5T1KA 2WSPA 2X1OA 3UTQB 2BNRE 5I8OH 5IB1B 5IFAH 1TNMA 5A8QA 3ET9F 2BSRA 3Q0HA 5AG9A 2KQNA 5HHVL 4NKQB 4X7CC 1PKQA 4HK3N 5DJZA 4HX1B 4ALAH 2ZSWB 2J4WL 3GBLA 3OKEA 5EIIA 3MYJB 3T77A 4ISVB 2CD0A 1KCKA 3BD5A 2PTUA 1MRDL 1GQIA 4L3ED 5HGHB 2V7HB 1DBJH 3P9MB 5EZOH 3V0AC 4K7PL 3WBDA 2DDQL 3IXAB 5F89A 4PTUB 4YFEA 4ZFZB 1NGYB 3PL6D 3PGDA 4HF5H 4PJAA 3VXRD 3ZKSD 5FXCH 3RVWC 2EO7A 2DLIA 4OLWL 4NQCE 3ULVC 1CR9H 3N1AA 4MNGA 4CUCA 1YEEL 1EHLL 4R4ND 2YRLA 4JO3H 4YDIH 1UM5H 2QHRH 1GJIA 4BCEA 4JKPH 1T83A 3AVEA 4R26H 1MEXL 3UTZB 2XIBA 3UETA 5I8EA 4GAGH 3HE7C 4AT6B 2Y06L 4XGZB 5JBFA 3TT1H 2UY3A 4X9YA 4FZ8H 1IQDB 5SX4I 1NBZB 1T20B 3D0VA 1RQ5A 4AG4L 4K23H 1HP4A 2X0YA 1QLRB 1KTCA 5E8PA 5DJ6B 3AM8A 1J05B 1CFSA 3FFCD 3WBAA 5LG1A 1M03A 1KIQA 2EBNA 3P73A 1IAOA 1W72A 4MJID 4F7EA 1M53A 1NAMH 2L4OA 5T1MB 2AJSL 2ESVD 1O7AA 4MCZB 5J1SC 3MLYH 1JGLH 3TYFA 1YEKL 1ZOXA 5KVMC 2WHJA 3B2VH 1S5IH 2KZWA 2D4DA 2Z8WC 5K9QG 4KUZH 3AIWA 3WHXB 3RBGA 4PJBF 1QRND 5DEGB 1RFDH 4GI9A 4B9YA 2GJZA 4ZFMA 4L9LA 4CRPA 1CL7H 1BFNA 2Z4QA 2VTFA 4Y2DC 2RHEA 1RUQL 1C90A 1LE9B 4JFTA 4GRWE 4CD8A 1JHKH 4KRPB 1KIPA 2IPKB 3AREB 3O3BB 4MA8H 1TQTA 2ZUWA 2AXJA 3SDDA 1KXTB 4PRPE 3WQ5A 3PJSB 5I1JL 2AI0L 5T5NF 3PNWB 1OARH 3Q6GH 2I25N 1F4XL 1QPXA 2PBOA 2C3WA 2P5WD 4D6FA 2P8PA 1ITXA 2ZSVA 4LF3B 2X9YA 1JZ5A 1MCOL 2VISA 2WMIB 4ODTH 4YDKH 3U4BL 4MNKA 5F9AC 3BP7A 1R0AH 2QBWA 4M7KL 5HHXL 5CZVL 1WBZB 2C5DC 3UTSB 5J6GB 4R0LB 5E0QA 4ODSL 5DEZA 2ZPKL 5FHAL 3RVXD 4JCLA 1RZJL 2OR9L 4FMKA 4FABH 5I1AA 4HBCL 1D6EB 3DO7A 5EU5B 1I1AA 4HKJA 5I6SA 4P5TB 4ELKA 2VZ3A 5DEFA 2L7JA 4F37F 2ALWA 4JFFD 1UJ3C 5DFVD 1A6VH 3ULVL 4HAGA 5GRUL 2ICWJ 1KJ2A 2P44B 1GPOL 1ZTXL 4M7LH 4OGYH 2BY0A 4Z95H 4G7YL 5IIEB 3QWQB 3UG5A 4MD4B 1BVZA 2DEPA 5D71H 3B3IB 3HMXH 5EZIL 3VIIA 4X0KB 5IVXF 2BSRB 4N5ED 1QI0A 4LYRA 3O11A 4B3LA 1HVXA 5I18H 1AHWC 2PYFA 1YN6A 4WW1A 4M5ZH 5E8NA 4PJIA 4A2LA 4JAMB 5I6XC 5FDWB 3EJQA 2YWZA 4M1CC 5DMGD 5IJVA 1I7ZA 1FH5H 3GI8H 2DM7A 3DX3A 2DQGL 4I1NB 3V7MA 1T2QH 2NY1B 1AC6A 4PJCA 4P2RB 1MQPA 1XF5A 5IMOB 5GIRB 4PJ8C 1YMHA 3O2DH 1A1NB 1DBKH 1CGXA 3MNVA 2GJXA 3L95A 1CWVA 2V2WB 4K55A 4NO3A 1F4YL 3BAEL 5C0EA 3T1FB 2EH7L 3DV4B 3O3BA 3RVTC 1XGTA 3AXHA 2VLRE 2GIYA 2YS4A 5EMYA 4L1DA 4PUDA 2GCYA 5FKAB 1KEMH 4MLSA 5ICYB 4X9GA 1JGVH 1U91A 3QPXH 3WLWC 1H2JA 1HDMB 5FYLH 1EA9C 5DFAA 2VLRB 1OIMA 4NQEE 4OBRA 3MRNA 5A6AA 1MEXH 4DVRH 3VFRB 4N9OB 2AK4D 3QUYB 4G6AC 1GOQA 2GJ6E 1VDGA 2YPLE 4MSWB 4Y5XC 1AD9A 4OIBA 3MMDA 3O45B 1W0VA 1EDGA 3SCUA 3FT4A 3MR9A 5DO8A 3PF2A 1CXHA 4ZE5A 5I2IA 2DQCH 2KUTA 1CD8A 3QZWA 5JOFB 2UZIH 3F7PC 1OSZB 4Z7VB 1W9PA 3WJJC 3PDGA 1SBSH 1WLHA 4X83A 3CTTA 3FRUB 4M02A 4X80H 2VDQH 5A8OA 4CVXB 2B5IB 5HGHA 3SGKA 3B2VL 3RZWA 1EMTH 3UXFA 4HQQH 2Z91B 1K8IA 2A3BA 5I1HL 4WJ5A 3MBXH 4ZENA 3EMZA 5HJ3A 5AUMB 5EIVA 1MFEL 1U8OA 5H35B 4GG6B 3FFCB 4A4AA 2DQDL 4ERSL 3V5HB 2JIXA 2DGAA 4KUCD 5MEPB 1ISZA 5A69A 3F65A 4KTEH 1R75A 4N9GB 4DJMA 5ESAB 43C9A 4MDPA 4NCC1 4HDIA 3KAAA 3S3SA 2BP3A 3UZQA 1Q6CA 3SURA 4L3CA 3G5XA 2X4OA 4G7VL 1DBBH 3F7VB 4MWFA 4TXEA 4W7VA 2NX5B 2P5ED 5DFWH 4YUEH 5DUML 5JBDA 3I6GB 3CH1A 2YL6A 3C60D 3RDKA 1UYWH 2DI9A 3CLFL 5EBGA 4EDXA 3L5HA 4OZHE 2BDNH 3TN0C 5DUMH 1PFCA 2WB5A 3J7HA 4XHJD 4AY0A 3WUBA 5CUSH 1QI2A 1V6YA 5C0BD 2HA1A 3HC0B 4URTB 1BFOB 1JV5B 3VXUD 3L6FB 4FNSA 3IDGB 4Q97A 4D9QE 1LP9F 1MWAA 2FL5A 5DC9B 4AXNA 1OP5H 3SIMA 3HG1D 4OUUB 3A4XA 3KJ6H 4ONHB 3VU2A 1C3FA 4HK3J 3STLB 3F7RA 1WCBB 5DJDB 1EJOL 1QKZH 3D85A 4JO4H 1ZLSH 3BEVB 2PW1B 1FG2B 3RPIA 4IMLB 5IW6B 1SEBB 1T0PB 2X4UB 1BBDH 1OGAE 4HV8B 1YEGH 5I30H 3E6FB 3GFUA 5CD5D 2UYLA 3RWGB 3WH8A 4XNYL 1SEQH 3OKNB 2IGTA 3FT3B 3G6LA 4NSKA 4HG4J 2E9IA 1A47A 3DROA 2W5FA 3UR8A 1EIBA 2OW6A 4J27A 1NWSA 2D23A 3ARTA 2ZG3A 4JVUA 4P57A 4LHUG 1W9DM 3MUJA 3D3AA 1E40A 1X5LA 35C8H 2M1KA 1OY3B 2D03L 4PRAA 3S37L 5IT2H 5JXAH 4V28A 4XAWH 5T3ZH 4M7JL 1PYWA 3G5ZB 2DPEA 2DSKA 1RD6A 1LO0H 2YZ1A 1RZJC 1EZVY 4MAUH 4BK5A 3CVHB 4PUBH 4FQ1H 5GSVB 2OP4L 5AG8A 4YN5A 3QEHB 3SY0B 4TX8A 3JZ7A 1ZA6B 4ETQB 1J8KA 3A6BH 3VI4F 3D87B 4JO3L 3QIWB 5C8JB 5EIQA 4NZRH 4JPKH 4EBQH 1A6UH 1R5VA 4TVPH 5JNYA 2EXOA 2Y2WA 4HXBL 4KV5F 5IQ7L 3PHOA 3NIFE 1O0VA 4OCXL 3WKML 4LVEA 5I75B 5LXGL 3MBEB 4Z8FL 4HPYL 3W24A 1NSNH 4PRBA 4X7TA 1FQ9C 1LO2L 2VVNA 3T1WA 1F3DJ 2QQKL 1AO7E 1ORQB 4H0HB 4BKLA 3TV3L 3MNVB 1GJWA 2GJXB 3F7YB 1EXUA 1S9VA 3SKNB 3WFCH 1B6UA 3TONA 4ELME 5MP6L 3QI9D 1B3JA 5ERWB 3GMNA 2Z92A 2XVPA 4P3WA 5D72H 1MH5B 2F74A 3JVGC 2CDEA 1NH6A 4JDZA 3VRIA 4OCNC 4UFJA 4MNQB 4RWHA 4X6BB 3ZO0A 5EFDA 1QD0A 2BNQD 2A6JB 3OA5A 4WJXA 1H8OA 2YPLA 5EPMB 5HDOA 3CJJA 5LGHH 3QJFA 1B1YA 1GL4B 4P3DB 3BAXA 3LKPB 1VB9A 1CLXA 5I16A 4WFFD 1XR8A 4WWID 2AJXL 3N15A 2J2ZA 3GUTB 3QRGL 3EO1B 2V17L 2VXQH 5ACLA 2YPLD 5E2WL 3PE9A 4MJ2A 3OKKB 4P5TA 5DYOA 5DZNA 1UCBL 2V5TA 1G7JB 5LCVL 3BXNA 4OKVA 3FQTA 3NFPA 3DUSA 4PJXA 2VVSA 1RHHA 3CFEB 3RJQB 2BMKB 2R56H 3LRKA 1R0AL 25C8L 1EQPA 1KJ2B 1RZ8B 3IDYC 3MGTA 2Y5TA 3FCTB 3C8DA 4NT6B 4OGXH 5ANME 4MXWL 4G9DA 5FV2A 3EGSA 2VLRD 3V5KB 2O5ZL 4GAJL 2AV7B 1RUAH 2YKLL 3BUYB 1E0WA 4LLWA 3VFRA 1MWAB 2E5EA 3DVNB 1RZIB 4NBZB 4Y4FD 1FL6B 4WV1C 4AC1X 3BGMB 2ESVB 5BCAA 1AXTH 4PJ7A 3LOWA 4Y2OA 3IKCB 2W59A 2X4NA 3WBEA 5H2BB 5IQ9B 1TZGL 3OSKA 4ZQKB 1PIGA 1KBGL 3IF1A 1NWUA 1ED3A 1HHKA 4NUGL 1FZMB 4Z78A 1TVHB 1KYOK 4TULL 5EZJA 3OAYH 4F57L 4FTVA 3O3EB 5DMIH 5FM8A 3QG7L 2YRPA 2YD6A 1N64H 3BH4A 1Z5LB 2VKXA 3FQNA 5I19L 3G08B 1YQVL 5IK3B 4BQ9A 3CH1B 1NKRA 5GS0H 4JGJA 1U3HC 1NAKL 4G7YH 3QULA 4XNQA 5DVMA 3T1FA 4KU1A 5HD8C 1IV8A 1I9RH 5IESH 2WANA 3KZSA 1VSCA 3NA4A 3UJTH 5D71L 1UG6A 4PMOA 2D7OA 2DI7A 3JUYA 4Z7UA 5LYRA 4IRJA 4HWBA 3PV7A 3FFCA 2Y24A 3OJVC 1YDPA 1CLYL 3BUPA 4TSCH 1YC7A 5EU4A 3CPLA 4JO2H 5BZDB 5JPMB 3SCMD 3HB3D 5SWSB 1I8MB 2WUBH 2XA8H 3OKLA 4CVZB 2BY1A 2HKHH 3LXBA 3MLSH 2J77A 5F3HB 1CIDA 3VFGH 1R3HA 3JV4B 1KXQA 4JG1L 2GJJA 4MXQC 3QIUC 1WK0A 3QCTH 5D6CA 1A5FL 3O11B 3VI4E 2WP3T 3U7YH 3CU7A 2CMRH 5DXWA 4YHGA 5BS0B 1WCQA 4U6HB 5JOFA 5D6DC 4ZAKA 5DD1H 3D25B 3FB8B 1CBVH 4NQDD 2IGFL 1MCOH 2AS5M 1I8IA 1ULVA 4E41A 5AD0A 1T4KB 4QRPE 3QDGE 3OGRA 4KKBD 4E0RA 4NWUH 3B8YA 5C07D 1AIFA 4XXCC 4OM1H 5DJCA 3GI9H 3GXPA 1VKXB 4XP6L 4UU9A 2HWZL 3PDOB 2F5BH 2GKIA 4MJIA 2J8GA 3WH6A 1PD6A 3UESA 1FAIH 4X8XA 4BH7A 4HSQA 3S5YA 5E95B 3MRMB 1MFUA 4PG2C 5C08A 4FQJL 2M26A 1A7OH 2CO6B 3FO1B 5C8BB 2ICWI 1DL7L 3BEWA 5DJZB 1P1ZB 3BE1H 3X14A 4R8WL 2VDQL 3KLAB 1HDMA 1FO0B 2R9HD 1G7HA 3AM8C 2NZ9C 3MXWL 4KRUA 5IBUB 2HJKB 1E5JA 4YDVB 1NMAL 3UYRH 5T3ZD 3CC5A 2D7MA 5HI5C 1ZLWH 2EPLX 5CGMA 1JDCA 3WD2A 3WH7A 4DWSD 3ARDA 1FGNL 1DSFH 3WUWB 1S7RB 3ULVD 2G9HB 4RISH 2VQ1B 2HTKD 2ADJB 3E2HB 4K71C 4FK9A 1UT9A 1TVNA 4FQHA 1ZT7B 5JNYB 1I7UB 2DYPD 5HVFB 4ZO8A 4KJQD 2W0PA 1OTTD 2RGSA 1P6AB 4XHQA 1LP9E 2IFFH 2KKQA 1JNHA 3ZL4H 4LXFA 1OP5K 1CD1B 1UFUA 1LK3H 2D3LA 1EX0A 5JUVA 3EJUA 1UWGL 1KCUH 1UR4A 1J7VR 3MRKA 3HG3A 4R27A 5I9QB 3CVHA 4KH2A 1TCRB 4MCYA 1K4CA 3RWIA 4LLQA 1SVZA 3FZUD 3WS3B 4FLQA 4G80B 1A7QL 5ENWA 1A1MB 3W0WA 3ULUF 2GW5A 3DMMA 2UWFA 4Y5VA 2EDYA 1OCQA 2E7BA 4ML4A 2X70A 1BOGB 1IAOB 3TJHC 3NDYA 4YUEL 5IM7A 2Q8AH 4OCMC 1QR1B 5H2BA 3H9YA 2CXKA 1XR9B 3MSPA 5IHRA 3BVNB 2OMBA 3L3IB 4FQXB 4N8PA 4QWWC 1HHGB 4QTIL 4RFNC 3U5YA 5ESQA 3U4AA 2A9MH 4PJHE 3MV9B 1H3GA 4JE4B 1CDYA 4WDIB 4YAQB 2V5YA 3IDMA 3AZRA 2OJEB 5FD0A 3GXIA 1FZJB 5E9DB 2WBJA 3VA6A 4KHTL 3QFJE 3LDBC 1U2HA 2GY7B 4QHNB 3RWCB 3W27A 2JB5L 2F19L 3IXAA 4N0RA 5C2BH 1BBDL 4GPNA 3B9KB 1AVAA 5CJ5A 2UY7A 1IKFH 3VGFA 4PRNA 4U6XA 4NZTH 2WZIA 4GRWH 1E6OL 2CKBA 5D1QD 1TVBA 4A6YH 1NARA 2WXDM 1MAML 1YQVH 3AQUA 1MFAL 4PGJA 4E5XB 3BN9C 5DJ0A 4WFGE 1QVOA 5DVLA 2DM3A 4RGNB 3FOMA 5FIPA 2EEAA 3MJ8B 3SPVB 2NY0B 5MHSD 3AHTA 3BKJH 1R3KA 1FVEB 3CSBA 3KPSB 3LEXA 2H9GA 4JREC 3CFBA 1XZ0A 2I5YL 4NKDA 5FYKE 3VGEA 3JXAA 5KSAC 4XV0A 4MB5A 5DF0A 1EEYB 5L88L 1XCQB 1KB9J 4CU6A 4HP5A 4C56B 1XH2A 3IJ7A 5BXSA 4MYWB 2M8XA 2HMID 1FG2A 5IW6A 3JTTA 3MA9H 2CGRH 5F70A 4UBDD 3K3QA 3OR7A 3VXQA 4M56A 2EPOA 3MRDA 3P11H 4JJ5B 2XZQH 4FFVD 4MCZA 3L3OB 1WITA 4OQTA 1C5CL 1W72H 5H94A 3EYFA 1CFNA 4ZXOA 3QG6A 5D4QA 1GGCH 3RZCB 4M48H 4PN2A 4FTVB 3QCUH 2HLAA 2FH6A 5F9JB 5D1XC 3QEQD 5I1JH 1Z5LA 5JUEL 2NY7H 1T1XA 3S36H 4TOYH 1BIIA 1C1EH 3PWLB 5GRJH 5I1GH 1CXKA 4P5KA 2VWEC 2A74A 4LSVL 1I85C 4LLUA 2ZCLL 4PMYA 2C1PA 4BYHA 5A1AA 1F11B 1P2CA 1YNLH 2J8UB 5HI3C 3IDMB 3ESVF 3T2QA 1LO2H 3BAIA 1QACA 2Z8RA 3ZKNC 2F5AL 3VWJD 3V52H 1V0MA 1ND0A 2FBJH 3VFOB 3CUGA 1J1PL 4LPVA 1ZLVK 3P4NB 1TQWA 2WQRA 3OKOA 5CILL 3LB6D 2G5BA 1RHHB 3CFEA 1PQZB 4G6KH 2FH8A 3MRLB 1NMBL 3N85L 4M1DL 4IJ3B 3RM9A 3MUY1 4YHLH 1HXMB 2CIKA 3HC4L 2CBJA 3VFSB 4M6OH 4YGVB 1AQKL 1BYCA 4ZUUA 4NM8H 2V5CA 3RDTA 4U05A 4GT7A 4GW1B 1UWEL 3EMQA 3UAJD 3L5WB 1ZLVH 1BF8A 1V3IA 2WMJA 5E9DD 4RGNC 4J8RA 3QEUB 3C2AL 2C3HA 1NFIB 4J12A 4Y19A 1MRFH 2J5LB 4W68A 3A22A 3L3HA 1OPGH 2AMGA 4W6XB 1W0VB 1XT5A 5DRXA 2Q76A 1QHOA 4LP5A 1CECA 1S7QA 3SQOL 3M8OH 2EPMX 5D5ME 3HZVB 3ZMRA 1R86A 1E0OB 4PJXE 4PLKC 1NC2B 3AMGA 1HKLH 4FQ1L 2MQ3A 4CNIB 3VW3H 1G7HB 1EGJH 4M62H 1MI5E 4Y7EA 1DVFA 5GSRA 4MNMA 2WIMA 5D5MB 4IHOB 3P73B 3MA7B 3VGDA 1I7UA 5ANMB 5FA4B 1I3GL 1HYRC 2MJWA 3HNSH 3I75A 5GGTA 4GSDH 1E4MM 1VACA 1QNSA 4CD6A 3GMRB 1QA9B 1T5WA 1TVBB 1HH6B 4HUXA 5CEZH 3LKOA 1QR4A 5KSVA 4DGVL 3UR7A 1RJLA 1JWMA 5L0QC 5KS9F 1A2YB 4XBGA 2APXA 3WCYA 8FABA 3ALGA 3GNMH 4IUGA 5A6BD 1MFCL 1YEIL 1XH0A 4PY7B 1VESA 3EOAB 4OLZL 3C5ZB 2AJSH 2XYCA 4L8SA 3HNVH 3T0EB 3FB7A 5J56B 5FM5M 2OTUA 3FT2B 5FUCE 3KPNB 5AWNH 2YHGA 5MERA 4M93B 5F71A 5BV7C 3I3BA 3MRFB 1QR1A 12E8L 4XHJC 3WE6A 1QWNA 1NDMA 4KGLA 5I2UA 2XHYA 4L8BB 3G6AA 2FEEL 1JZ3A 1BOGA 4D3CH 4CD5A 4H5SB 4M43H 4KY1L 2V3DA 4CAGA 2A1WL 3MJ9A 3WN5A 2MCG1 2APVA 5CXPA 2YPVH 3I6LE 4JHAL 4Y4KB 1DHKA 1HVQA 2X09A 2H26B 3UG3A 1HJSA 2CKRA 1TCRA 1Y6KR 2Z9TA 3QNZA 4OCSH 1CDUA 2WMKA 3W81A 3C60A 2R0LH 1FYHB 5HGBB 3VD5A 4BK4A 7FABL 4M1RA 1E4WH 5D93C 2A38A 4GKSA 2EH8H 5CZXD 4JFPB 2G60L 4WWKC 3TFKC 2FR4A 1HCFX 4JFEE 1AGEA 3MSGA 1IT0A 1F11A 3QDGA 1FV1A 3MCKA 2HWZH 2Z31D 1FZOA 4S0TD 3U9UA 4WUKH 2JK5B 1QYGL 3FN0L 5D7LD 5FUCC 2ZP0T 4NQCA 2Y72A 4YE4H 4XP5L 5M03A 4I4WB 3P4MA 3JWOC 3MNWA 5HI5D 2VZUA 1FIEA 2VLMD 3KYAA 1Q38A 3NCFB 3CZFA 4HWEH 1FCGA 3MODL 1GZJA 3WIHH 5A2CA 3WN5C 3B9KC 4DO4A 5EC2A 4BA0A 4YHYB 2UVEA 4LDOB 3MFFB 4GH7B 2F5AH 4UQEA 5A95A 3VRJA 4M7LL 4OGYL 4EDXB 5IB4B 4HKXB 1K8DA 3BZEA 4ELMF 4U49A 5CCKH 1R46A 5MEQB 3U6RB 2O92A 3QQ9D 4L9LB 2EKJA 4JLRA 1RZGA 5GSVA 4UU9B 1UADC 3D39B 3FO2B 3R1GH 5FYLD 1ZKAA 1UD4A 1LNUB 4M5ZL 4DEPC 5DRZB 3RVVC 3ELAT 3PABA 4D9LH 4I0CC 4OQ1A 4LSTL 2NQCA 4JM4L 1MI5B 4I5BA 5A43C 3BVVA 2Z91A 2XZAH 3ARFD 4W8AA 4KQ3L 1TTGA 2AKRA 5E8NB 3UPAA 4E41E 1RK0A 2K9UA 3BVNA 4L9LC 5FGBA 4Z0BH 1QNZH 1R7AA 3R4DA 2H8PB 3F58L 5KSBF 1WCGA 2R4SH 5J11C 3X11A 1EAPB 3PHSA 2EXWC 4PJBA 3VXOB 1FFPA 3MCG1 3P0YH 2Z8VC 4ODHH 3PZMA 4Q2ZB 3B9KA 1CICC 5I24A 2Y6SC 6CGTA 4AMCA 3F6LA 1OAUL 3OKOB 2J4WH 2CO7B 5F72S 2XFYA 1FVCA 1DQTA 1FH8A 3UBXG 1IEBB 1KULA 1F3DH 3ARQA 1PG7W 3DX9A 1JXJA 2IPTH 3JWOH 3BLPX 2JF7A 1K3ZA 2EDFA 4NC2B 1I1YB 5F44A 1ADQL 1G6RL 3QUYD 1S7VB 4F7TA 1MQKH 1MYRA 3NCBB 1I7TA 3IDGA 3TTYA 1HH9B 4M7LT 5BJTB 2E4TA 3HNTH 1FRGL 4H1LG 1E4IA 3OF6A 4PJEF 5ITFB 4WENB 4M6NL 4K3EL 4Y5VB 1R7OA 5ICXB 2QHRL 1AO7A 4N0CC 2VZTA 5GJSH 4IRSD 4XI5C 5D7JC 2Z1KA 3EOBA 3UCQA 2YR3A 1M4KA 2VMFA 1V0KA 2GUYA 1BJMA 1M7IB 1CZ8L 3GSUB 1CE6B 3MACH 4QXTB 2C3XA 3MRHA 4R2GC 4WFED 4E8DA 2BY2A 1EEQA 3AAZB 4XC3H 4NQED 3NH7H 4ZFOA 1WWBX 3WNLA 1FSKB 2R2HA 4QEGA 1H8NA 2NX5A 4M43L 1CGWA 2GVYA 4HS3B 3T08A 4JY5H 4Y4HB 2GSJA 4LSQL 4RBPK 3S34H 2QMJA 1B90A 4CL7A 5FA3A 5L88H 3QRGH 1YA5A 4HKZB 3TO4A 4X5XA 4NX0A 3CHCA 1CDCA 2CRYA 5HGBA 2JIWA 4PY8J 3QT2A 1NGZB 4JDVA 3VX1A 3IDXL 2CJUL 2IFGA 4S3KA 4LRIC 1IT9H 4OGAC 3AISA 1OAKH 2XWTA 1U8NB 5CEZD 1ZAGA 4UCFA 2A3HA 1IKNA 1KBKA 2R2BB 43CAB 5JOPE 3WL1A 3GMOB 1TNNA 3AREC 3MRIB 3TYGH 4HZ8A 4GZJA 1HJWA 2DH3A 2G5BB 1C1EL 3NUKA 3I9GH 4PJFF 3AS0A 5D2NE 3SDDC 4PG2A 4C54A 2PW1A 3RPIB 4AD4A 4GO8A 1K6QL 3I3DA 2VDPH 1PQZA 4U4BA 4ZDHB 3V8OA 2EDWA 2H32H 2J4GA 5ESVB 5DUPH 4OI7A 5FKYA 1UXWA 1UZ6E 4Q58C 4OCRH 3GBNH 2X7LA 2EDTA 4Q7DA 3ZTNL 3BGFC 1OGAB 4P46D 3RTQC 5L7XL 5IWLA 3D39A 3ZR6A 3VILA 4BKLB 3EAKA 1NGXA 5DJDA 3DYOA 4R26L 1NMBH 4M1DH 1T1XB 4OB5H 2O61B 4ODXB 4IRSA 4QHUB 2QL1A 1US2A 3N1FC 3BO8B 1ACYH 3GNPA 1DUYA 3IETB 3O9WA 2WBGA 1I1AC 2NLJA 3BYTA 1JWUB 3OKEB 5TF0A 4LQFH 1WB0A 2BERA 4F79A 3EJPA 3ULVE 1E6RA 1KR0A 3DV6B 3C87A 2J6EH 5DMIL 3TTOA 5C71A 4UB0H 3W82A 4QHKI 2QQNH 4M29A 1GQKA 2WBKA 3MREB 5C0DA 4B41A 3LMJH 2J6EL 4TSAH 4JZJA 4UUJB 3A23A 4GKNB 3Q5TA 4DN4L 3BH9A 1ZT4A 1XV8A 4W86A 2HKFH 1MAJA 2Z4QB 4X7DC 1XGQB 4OD2B 1B2WH 1OTSC 1KLUA 2OCFD 2UY6A 5EN2B 4LSUL 1EEZA 4J3VA 4G8EA 1BGAA 2X44D 1IC7H 4NOFA 4WW2A 4QRTA 2MMXA 4PRHB 1KB5A 2HAZA 3Q5YA 1A1OA 2NZ9D 3S37X 1E28A 3NFPB 1AXSA 1F02I 4V1DB 3MJ9H 1CICB 1BQHG 5C07E 4HKBA 3HG4A 1FGVH 3G6JE 3U7AA 4U1NB 2ED8A 3EJZD 3KPNA 3APGA 4LPWA 2OBGA 1C5DB 3A47A 1YNKH 5FCZA 1J05A 1NCCH 3BPNB 4I5BB 2Z93A 4EI5D 2ZWZA 3C9NA 2JEPA 1FFOB 3BH8B 2RBLA 2NY7L 2WLYA 2WAHA 5CIPA 1GHSA 3LS4H 5TE6L 2IPUK 3U9PH 3R0NA 2DJ4A 4GRLD 3DRQA 1FNLA 3WFCL 5CBAA 5J13C 4NZFA 1IGFL 4E41D 3DMMD 5CG0A 3NZ8B 5CJOH 1EGZA 4XP6H 3S8WA 3U46B 4HKXA 1TZIB 3FZUC 4YHPA 5GRXG 5SV4A 3W2DL 3DI2B 1UWIA 1IEAA 2V7HA 1F13A 3U4EB 3D69A 4BM7A 1R8LA 1L0XA 2VDNL 5ID1A 3Q1SH 1NGYA 4P0DA 4BA8A 1GZQB 3QWRD 2J6EA 1KXTA 3PWVA 5CILH 2OW7A 4RISL 4QRPB 3U0TB 3LKOB 4F7CA 5KSVB 2AXFA 1NCBL 1T66D 4N8VA 5EA0H 2WWMC 4GW5A 1J8HD 3KLHC 1YNTB 4YO0A 3MV7A 5HTSA 4LYPA 4PLNC 3MCKB 4WWKD 3M07A 3HHRB 5SWSA 5F6IB 2PYEB 3HG2A 1OP3H 3JSSA 4QOKD 2G3IA 1D7FA 1UGNA 4W4OA 3EYSL 3HPJB 3FL7A 4I18A 1FORH 4F33B 5L8LB 4H25B 2XQYK 4OFYA 1BD2E 1CDIA 3SDAB 1K9FA 3EOYG 2GT9B 3QDMA 1OSPH 4YZFE 2NXYB 3GMQB 3BKYL 5EBWB 1MCWW 1D3CA 1MCQA 2WW5A 1IBGH 4PS4H 4N0YH 3EJYD 2G9HA 3QHNA 2VLKA 2BVUA 3F5WB 3RM8A 5KVFL 1AP2B 2VQUA 5TGBB 4WY7H 3DYMA 5FUZL 2A6DB 4F7PA 4UV4L 1E4KA 1QYGH 2E27L 4YC2C 3V79C 2EEDA 1P4IL 1JDAA 2IMNA 2MFNA 3D6GA 2XN9E 2CRIA 3O4LA 1MVYA 5KSAD 3H6JA 3O6MH 5CUSL 5I8KH 3SPVA 1MFBH 2E27H 4KC3B 4QTIH 2BVQB 1AIFB 5DJCB 3UYOD 1LWHA 1A6TA 2FGWL 2BDNL 3AHZA 3VINA 1V3KA 1KELL 3TT3L 4UOW1 4OJFL 5F3BB 4NM4L 1JPTL 1HNYA 3SO3B 3EW3B 1TJIL 4DUXA 1JPSL 2H45A 5T1LB 5HDQH 1CFTB 5F1SA 4XPFH 4DK6A 4OD1H 1Q9OB 2FB4L 4OF7A 4X9FA 1A6PA 5D9SB 2QSQA 4F9LC 3HAEH 5F9OL 5F21B 1UWQA 3ZE0F 4FQ2H 4HOWA 3PZTA 2CDGA 4PMZA 3MRGB 4RFNB 5IB2A 3MV9A 5GRZA 5HY9A 3POCA 4QXUH 4F9PA 2FO4B 5EOCL 3ULUC 4KQ3H 4QDMA 3OKDA 2JEQA 3QHTC 4UILL 3BZFB 4P23A 3SCNA 2DWDA 1F42A 1TTFA 4LSTH 1ECEA 2UVFA 4JFSA 1P4LA 1DQQA 2HKHL 3BWUC 1A7BA 3C09B 3KYNB 4P5KB 4X6CA 4DK3A 4DN4H 1CI5A 4XNMB 2WVTA 3QFJB 3MV9E 3GMMA 4O9HH 3TBTA 3EYUL 5I9QC 1D5IL 5F3HA 3QEGH 3QIBC 5ALCH 1EO8H 3EFFA 1XIWA 3MS8A 3R06A 1CT8B 3BDYL 4RZCB 4PRIB 1ZWIA 2VDKH 4MMZC 1PZUB 5T1KB 1MNUH 4RAVB 5CPTA 1Z3GH 1KGCE 2P49B 2P7TA 2IPTL 5E1AB 4PRDB 5GGRA 3MROB 5JHDE 4RL3A 3QDAA 2DWEB 3TBVA 1A6AB 4U7KA 3OR7B 4KFZC 1SYVA 1NOFA 3WIIH 4XI5D 5D7JD 1G9NH 1B30A 4AD1A 4XZWA 1JPGB 1UXSA 3WKNA 3KPOB 5DEGA 2DBLH 4JQIH 5LXGH 3O3EA 4Z8FH 2DQFA 3CUPB 1G7PA 2OQJA 4ZSOA 2EYTB 3U46A 2QR0A 1I3VA 4X7SL 4FZEH 5I1CH 2A3AA 4YX2H 5IQ7H 3V6OA 5I15H 2G75B 1I8KB 5HYEA 1ZS8A 3RWCA 1LK2B 5C08B 4NN6C 1L4IA 2FBJL 4YX2L 1HJUA 1A64A 2ZPKH 1T04A 3AHYA 1QLFB 1JNLL 1UZ8B 1HHIB 2Y8KA 1FGNH 4L8SC 5FCUH 5BXFA 3CBWA 1QFUH 3T8XA 4XXDA 4BSVB 2P4AB 2G2RA 3EIFA 2WP3O 1FNSL 2PO6D 3BIAX 3EBVA 3WJJA 3IKKA 4NM8L 4HT1L 5CP7B 2IQ9L 4XP4L 3ZZ1A 3QO0B 4ZTPH 3QUYA 3UTTE 3DETC 1GVYA 2OL3A 3T0DA 4U3XA 3LRHA 4N8CH 3NPSC 5BXRA 1BD2D 3WKZA 1C5DA 4PJGA 1A7NH 2DLFL 3C6LC 5E09A 4QHKJ 1V6XA 1WIUA 1MJ7L 1JYWA 4P7RA 1ZL1A 4OZIB 1O7DC 3OAZH 4UTFA 1T7YA 5KANG 5C0AB 1MCFA 2PCPB 4MNHB 1OSZA 4APQA 4Z7VA 3ZE0E 1ZB5A 4YDJB 4TTDC 3PDDA 3TBYB 5IF0B 4PJ9C 3X3GL 3TN0A 5K59F 3F58H 1XF3B 1NC4D 4D9QD 2ICCA 2CIIA 2ZKHL 3OZ9L 3V0VB 1RZKH 3BUBA 5C92A 2Q8AL 3QUXA 1GJUA 4KQ4H 3WLWD 3OAZK 2VAAB 2BK8A 3IJSB 2Q6WB 2ADIB 3WO4C 1QNRA 2OWCA 5BZWB 2WV3A 5CLWA 2Z92B 4NO2A 3AMCA 2EO1A 1B0GB 4OSUL 3KR3L 1ZJBA 1AMYA 1HJVA 2OI9B 4UNUA 3ULUH 1RZFH 4IOFC 1UASA 1X5HA 5IOPA 2W65A 5IW1B 4PJFE 2EC9T 3CK0L 3GKWL 2LAAA 4YWGL 1VFAA 4YHKL 1R3IH 1A0QL 3FOLB 4Z7WF 1WFOA 1EUTA 3CK0H 3DIFA 3GEWB 3GMLB 5HPOA 1CPUA 3VIJA 1FNEB 3A3HA 3PXHA 4HXBH 2VR9A 4XPFL 2MTPA 1S78C 2P5WB 5KS9B 1PKQE 1VADB 4W81A 5B22A 5E2UH 2J1KA 4ORGA 4TUFA 1IGIL 4PV8A 5KVEL 2MCPH 1MPAH 5ADPH 5GJSL 1P5VA 4U1IA 4WHYG 3WNNA 2YPKB 4OLVH 1G7LB 3O6LH 4M3KB 2YKKA 4L3EB 5JIHA 1Q0YL 2I5YH 2QQQA 4XPGL 1X4YA 3ROOB 4K7PY 3R8QA 2YD1A 1Y0LB 4PJXB 4DFHA 4ZOEA 2DL2A 3SUSA 1FH5L 5DFVC 2PW2A 4WHTA 1OVZA 2Y5TB 4HJ0D 4YDLB 1JVKA 4NN7B 4MD4A 1UD6A 4Z2GA 2YN3A 3VFMB 3UO1L 1WTGT 3GJEB 3LH2L 2ADFL 3SBWC 1S7WA 1GHFL 3L9RA 4HEME 3S9DB 2X1QA 5L2JB 2HKFL 3KXFD 2J88H 4EI5C 5IMMA 1MCRA 1B2WL 1KJ3H 3VXMD 1CL7L 3BEVA 4WNQB 4LCCA 1FP9A 2VWEE 4M4PA 3AJ7A 4KKAD 1A6AA 2EKSB 4NCDA 1RIHH 3D2UD 2BRRH 4BSWA 3WEZA 5EBLA 2WCSA 1M71A 2FO1A 4JCMA 1MAKA 1LEGA 4HGWA 1R3LA 3FT3A 4M8VA 3GXDA 2IGFH 2YL5A 5ICZA 2A6KB 1NGPH 3Q6GL 4V2CB 1CTOA 4PMQA 4XWOD 1V6WA 1KLUB 3DUUB 1IL1A 4APQD 3AMDA 1MCPH 2XY1A 4UINH 4PCSA 4RQQB 3T0EC 4GLRH 5CGTA 1OTUC 5AEAA 2AXFB 3EJTA 1CFQA 3H7LA 4UDUB 1UZ1A 3RVTD 1QA9A 1T5WB 4LSSL 2F8OA 1DQQB 3IT8D 3VVGA 4J1UB 3FN0H 5E5MA 2DQTH 2NCMA 3JTSB 3U9UB 4POZC 4GFTB 3ME0A 1HHKB 1G94A 4PJEA 3DVFA 3NFNB 4I2XE 2LFGA 3L6FA 4BH8A 1BECA 3VFUA 1F8TH 2A3CA 4DN3H 4P8UA 4OI8A 3QISA 4LASH 3F7QA 3RI5K 5F7MC 1RULL 3CIVA 3MRRA 4ZXLA 1O6IA 4Y4KC 3MLXH 3CCHB 3BW9B 1MQQA 1QI4A 4LCCC 4JZ5A 4OB5L 4UZUA 4I3RL 4FRWA 1H4PA 3VXSA 1QHZA 4HQQL 3RWEA 3IFOB 3Q1SL 1CS6A 1S7QB 2EYSA 1H15B 4J3SA 3EFDH 1NP0A 1XF4A 1U3ZA 3LRLA 2BOCB 4ZNEE 2BFVL 3HPLB 2FX7H 4OKVB 3UTSD 2IWGA 1XYZA 3GI8L 5T5NG 4MAVA 3ARBB 3TOPA 4C56E 4FNTA 4HJGA 3QEUA 4G9DB 1DP0A 1AKJD 3IGUA 1WSST 4OLUL 3QZWG 1KCSL 1C08B 4LRIA 2AVGA 3EO0B 5HJ3B 1DFBL 1ONQB 1X6LA 1W0WB 1QBLH 3MCLL 1WWAX 3SCVA 1OGGA 2X4PB 4OZFG 1IKNC 4HUWA 5TE4H 4P3DA 3QA3A 2FSEB 3KL5A 4W85A 4S3JA 3U36B 3LCYA 1N6UA 3QFDA 2BCKB 5DC0A 1SVCP 1E27A 4GAYA 1LO0L 3H55A 1FNEA 3KHOA 3TNNA 1YY8B 4HMEA 3ULUE 4DKDC 3DIFB 1AY1H 2ARJA 4O4YH 3ZHKA 1JZ2A 4PRPA 1T2XA 4AZBA 5E8DL 2CR6A 3ARSA 3QPQD 4PV8B 5HDQL 1FHLA 4Q9RL 5EG6C 1IGML 2O26U 3G08A 4UTBH 5IK3A 4D6DA 1DANU 4O4YL 1KXQE 3CUIA 1G7LA 3HU7A 1VJZA 4NZRL 4KHXL 1INEH 5A8MA 2QEJA 4PB9L 1G5AA 2Y4SA 3NCMA 2WNWA 4HUNB 1A2YA 2NX5D 4LHQB 4OZGB 1ZHBA 1FC1A 3HI5H 4EIGB 1EH9A 2D7TL 2GJPA 3ULSB 1SBSL 1FHDA 4NNXB 2C3VB 3UBXI 3OAUL 2Y06H 2E7LA 1HIMH 2XVGA 1I3RB 3MNZA 3SDDD 1S7SB 4NZTL 2FD6H 3D9AL 5D2LF 3DVNA 5HHMB 2BXZA 4PR5B 2OSLA 1JGLL 5E5RB 3AHVA 4GO6B 4JFPA 3MROA 3FHQA 4JQVC 2CYGA 5I1HH 3WEXB 3MBXL 4QYOB 4JFZL 4NO2B 1GOGA 1PEZA 2VL5B 3C5SB 3VSUA 3QIWD 4HWNA 4OCSL 1N3NB 1EO8L 1C16A 2O5XH 4EI6A 3MXVL 3TBYA 4OUEA 1DQLH 1ETZA 3MRGA 4M9OA 5CD5C 4OJYA 4R4FH 4Z7VF 5DJ8B 3IU3A 2PWEA 2CIIB 5B3NA 1RUPH 2RJMA 1FFNA 5F1IA 5JHLL 4JQXA 4TQEH 3RNQB 2CGRL 3BP5B 4BQ2A 2RGMA 3RJXA 3FY1A 3KL3A 3H9SD 5J9PA 1WTLA 3EUUA 1WBXB 1CLCA 2VSDA 5DJ2A 3NMEA 2CUIA 2NXYD 3ZJ7A 4YBQD 1IQDA 3FQWB 4M7KH 5A16B 3VX0A 4UTAL 4HS8H 4PY7A 2PW2B 4WHTB 1HL8A 5CPQA 4UQ9A 3AU1A 3CPLB 1MHCA 1IFHH 2PBGA 3MMEA 3RVXC 3BCDA 2DQUH 5IFJA 3N50A 4DKEH 2OR9H 3SE4A 3IANA 4PV9A 2P5WA 3I6LD 5KS9A 1U8HA 1OM3H 3ARFA 3BRGC 2O9PA 3W25A 1PBYA 2AEPH 1OAYH 5AYUH 3VXRA 1Z9LA 5IB4A 1QSEE 1OL0A 4Y5YC 3MRHB 4PLJD 2J25A 5LBSH 1J1PH 4ZXBD 2VSCA 4JGUA 1RULH 3GSVA 5J7CC 1JZ8A 1A4JA 3CX2A 3W39B 4JLRB 1ZVSA 4ZTPL 5IMKB 2X6MA 3DX8B 3DTXA 2EYTA 4Z7OF 3NTCH 4HIJA 3LRMA 3EDDA 1CFNB 2UY2A 3ROLA 2VAAA 2Q20A 4M6AA 1KT2B 3N85H 1C8QA 2OI9C 3AREA 4X8JB 4AM0A 3WXVL 3ZM8A 3QDMD 2VIRB 2ESVA 5GJTL 3BFOA 4UILH 5D9OA 4Y1AE 5DMGC 1LO3L 5A6SA 1WT5C 2GY5A 2DLFH 3S5LA 5I23A 1RJYA 3DMMC 3GMPA 1MXDA 3QNXB 2OR7A 4QOKA 1W2KT 1YPZA 4JJ5A 3J8F7 4I3GA 2QSVA 3BD4A 5EU6A 5I6XB 2D3NA 5AZ2L 4HUWB 3QEGL 3QQ4A 3KPSD 4LEXL 5E8PB 3UDWA 2F61A 1RPKA 2JJVA 3VFWB 3ARDB 4ZS7H 1JGUH 4HGWB 4CN1A 3DC0A 1E3ZA 3ILQD 4QCEA 5K9KA 3HE6C 3GMOA 2HLFC 2YBRB 1NEZG 4KV5E 1Q0XL 2PXYA 4GQ9H 3TA3D 4MJ5B 4YNYB 1P7QB 1N2RA 1NFDE 4MA3B 3TO2A 3GNRA 4F7EB 1Y7VA 5D7LA 3SGDH 3F5LA 4LGRB 3S35X 1LJYA 4M4RA 2NR6D 1AY1L 4WKAA 4JFXA 1QVOB 5DSCA 1I1AB 4FXKB 1NCAH 5C0RL 2ICWB 4MD5A 1H0DA 2JELL 2P1YA 3RTQB 3GKWH 2VL4A 3AS1A 4JKMA 1JGVL 4JHZA 5E0CA 1E4XH 1BVKA 3DGCR 4PJ5A 4LLVA 5DQDH 2XFRA 4XC1H 3ESUF 3LKRB 2X10A 4P23C 4MSWA 4LCYB 5JW4Q 2ZWLT 4NPYB 4U31A 1XR9A 4E42A 3VH8G 5INDB 4OZFB 4QLJA 1PX8A 1AP2A 5C0CE 2UUDH 4JRXA 2R29H 5ESQB 5IBLD 4PRID 1MCWM 3NN8B 5DHVA 4FMVA 4UI2A 1CGYA 3BP7B 3NYDA 5C0BA 3P9MA 1E6XM 3EYPA 3SCTA 4I0PC 1YYLH 4WV1A 4ZTOL 3X3FH 1C91A 2FBOJ 3AIBA 5D7IB 4I13B 1PG7L 5GGQH 3U0WL 12E8H 2J88L 2VXTL 1U2CA 2XVLA 2HVKA 4Y0GA 1WV7T 3DYPA 3TA3A 1B3XA 3HMXL 2VXSH 3IJYA 4HZLB 3CHEA 3D5OF 1U92B 1Z0NA 3T0XA 3NSMA 4JY4A 4RAUB 5TH2A 3T0ED 3VD4A 3PWVB 2Z8SA 2YOCA 1OTUD 1QFOA 4I0PB 4XBPA 2PYEA 25C8H 3CAFA 4X6CE 3TC9A 3KPSA 4HFWA 1YNTA 4YO0B 4TUOB 3HPJA 4LNVA 4ENEC 5ECJE 1B0WA 2R2EB 3WUGA 4M9PA 1UVQB 3C60C 3QOMA 1DUYB 3IETA 5HHQA 3N18A 5AAMA 5IROA 3MMEB 1OF2B 3KPMA 2A0LC 1KJVA 2JJSC 3LQMA 4U1JB 5BRPA 3QIUD 1Q9KB 4O00A 1S3KL 3BZFA 1Y6NR 4P23B 5A2AA 4F8XA 4GRWB 1BG9A 2PYFB 4DKEL 2VDML 2EDQA 1DQJA 2V6HA 1NGQH 3DLQR 4Z7WB 5F7KC 4NQEB 4U1KB 3OHXB 1KEML 1NMCB 4WHCA 1IC5H 3NZHH 5E9DA 3NZ8A 2OX5A 1MCHA 4ZUUB 1OLZA 1LD9A 4EIZC 3KPPA 5CSZB 4MJIB 5FAAA 3O8XB 3HE6B 5D7JA 2YZ8A 2AK1L 2V2TA 3IXTB 5CEZL 1I9JL 4GI8A 2AAVA 1MW2A 4NUJA 4TUJB 4NJAH 4KK8D 5GS0L 1BIIB 4EN3B 4P7NA 3WFEH 1U8KA 1C7TA 1HN1A 2D20A 5CSUA 2A74B 2Y5EA 3WEMA 3SGJC 1AGFA 2F19H 3HMWH 4I3RH 1LG1A 2P8PB 4TUKL 4W93A 3PWLA 4FP8L 3HG1B 3PWNB 1XIWD 3CH9A 1E6SM 3RX8A 1PAMA 1UB5A 2DQEL 3BSZL 4XPBL 3S35L 4IRZL 1M7DB 5IV2A 2J7HA 3WMBA 1PSKH 2ZCHH 2BFVH 2QKIA 4QOKB 1ZT4B 3MQIA 2W61A 4PTVA 2HH0L 4GKNA 3NGBC 4PGCB 3JWDH 3WFHB 5IVOA 2DMBA 4Q0XH 3AIUA 4G8FA 1NOWA 4NQCB 5JIKA 3LEVL 4OT1H 2FJFB 1KB5B 3H9SB 1H15A 1B3VA 3I6GA 3O4OB 3UJIL 5DK2A 4KGJA 1F5WA 3LPFA 2B2XH 2W38A 3VFGL 3AYSA 3N13A 4NP4H 1R33A 5TH2B 4K7PH 4UAOB 4FLSA 4FNPA 4F9LA 3H9HB 4OD3H 2QSCL 2A83B 3FKUS 4P2OA 1SMAA 1ZHKA 3PP4L 1XZ0B 4MAUL 4RZCA 4PREA 4DTGH 4P2RE 4U1GB 5HI3D 4Z5RA 1MCNA 1WF5A 3QXAA 5DUBA 4GQPH 3LD8C 4C56A 5IR1A 4W8LA 5DHYB 4HPOH 2WMFA 1PG7X 1BBJB 4LQ1A 4NQVA 4P2OD 1PDKA 4NHUA 1F45A 1Z2KA 3QYCA 1RUKH 1B0RA 3O41B 3O2WH 3G6DL 3DHUA 1FRGH 1F6LL 4IBLT 1CFTA 3ECBA 5T3XD 3ILPB 5C0CD 1V03A 5AYBA 1NDMB 4ZQKA 1LP9B 1KLGB 2D7PA 4JFFA 5KSUB 3MRQB 3GSNL 3I50L 4QWWD 5IG7A 4XCEA 3QXVA 4YHPB 4UIKH 4A3HA 1TXKA 3MO1B 4PPTA 3G5VB 1BTCA 3WF1A 1DL7H 1EGJA 2ENYA 3QR2A 4L4TE 5FB8A 5DA0B 1WZKA 1QVBA 4OZGE 2J7LA 2ERJC 3THDA 3U0PB 1NEZB 2G75A 4PJFA 5EOTA 5C1MB 3BXWA 1YMMB 4NN7C 4BZ1H 4I0KA 3CSYA 4ZOBA 4JRYA 1KIUA 4ZPTA 1BOYA 5HHOA 5DJ2B 2GFTA 1WVZA 4V1DA 1BG4A 1IAMA 2B4CH 1HILB 1CLOL 1MJUL 1A14H 1F90H 4WWKA 4D0DB 2F15A 1IT9L 1S9XA 2VOTA 4Z7WE 4YFLF 2R1XB 2YRZA 1XD1A 1N8ZB 3ZL4L 2Q7NA 1BQHA 5AC5A 3T0EA 1E72M 3WUZA 4KVNH 4ZYKB 1NCWH 3SJVA 3V6OC 3GXTA 4Z7OE 1ZV5A 1JGDA 1U36A 5E2WH 2YSSB 1HHJA 3CZFB 3HZVA 1K6QH 4L8CB 4LFHG 2GSIB 1AKJA 3DURA 3DTXB 4UBDC 2X1IA 1RZKL 3SUTA 5DRWA 4R5EA 5BV7B 4AISA 4R7NA 3U6RA 1JZ7A 4X7TB 5ISZA 2ZXAA 5C0IB 1TQUA 3SKJH 4O2FA 5L8KB 1LGVA 3D0LB 3DSNA 1V6VA 2FX9L 5LBSL 1NUGA 4EKJA 3WFDL 1WBYA 3PGCB 5FM5O 2FNBA 3LZFH 3HR5A 4LVOB 3QUZA 2ZCKH 3C6LA 3EOBB 4LLYA 1AGFB 3H7BA 4NQDE 1CGTA 2PR4H 2AGJH 4J6RL 4NYLA 4KK9C 5JDJA 3CZEA 4Q22A 4KRTA 1II4E 1U8KB 3IF1B 4MNGE 5GRYA 3RX5A 3QG7H 1TIUA 2ICEA 3KLAA 1FV1B 3MRCB 4UQDA 4U7SA 1ZA3B 4QTHA 4ZFGH 2F54B 3OKMA 1KCRL 2GITB 4L3CB 4IDLA 5F9WB 3WNMA 2J7CA 1HKFA 2CDFB 3SE3C 3UEZA 4MZ3A 5IB5B 3O6LL 4LSPL 4JL1A 4XZUA 2DSWA 3TPUB 3QCVH 5C08D 1IZKA 2VQTA 3TO2B 3UBXB 1CWYA 4PBVC 2A9NH 2P8LA 4HMCA 5IB3B 3GDBA 2EQDA 4F9JA 3LMJL 4RCAA 4YHML 1NGZA 5DZLA 2F8VA 4MD5B 2BRQA 1IQWL 1VENA 4PJCF 3SQOH 2OSYA 4R9HA 4JO2L 5EORL 3HAEA 1HWGB 3O8XA 4GZEA 4PJIF 1GGBL 4NC1E 2VH5H 3QUZD 1YHTA 4M5YL 2ZJSH 3OTTA 5EH1A 3BW9A 5CKGA 4ZNEA 1M6OA 4AJ0A 4MA8L 4L3EE 3VI3E 3MRPB 1KOAA 2ITDA 1CBGA 4PJGF 2QHLA 3BKCL 4YHNB 3CZGA 2N7AA 1EO5A 5HHXH 3MGOA 3HC3H 4JO1H 2WBWB 3P40A 5EU6B 4Y1AA 4ELMA 2EDRA 4XMPH 2O5YH 2D0GA 2QR0B 1L7TH 5EZJB 3FQRA 2GJZB 1BP3B 2YLLA 4Z78B 3BZDA 1RV6X 5ISZB 3GGWA 3PZOA 2Q86A 5KAQG 2P46B 1IGYB 2J8UF 2O5YL 4N0UE 1M05B 4M81A 4RMWA 3WF4A 1JNLH 4JFWA 1DEEA 5EDXA 3SUUA 2VCAA 1DUZA 4XT1C 3IS1X 4HUVB 3PWJA 5E9AA 1WBYB 1IMHC 2AEPL 1KWKA 1FAIL 1DLFL 2DSZA 3QUKA 5TPWH 2IPKA 2K7PA 4IOSD 4N5UA 5E03A 4JN1L 2MHAA 2P47B 3OKYA 1QO3A 3SOBL 1C8YA 2FDMA 2C4FU 1C5BL 4KVCH 1IC1A 2D2OA 1B4JL 3EFFB 4ONOA 3VSTA 4D0DA 1J9CT 3BUYA 4BFEA 1XYFA 1FFRA 4PJ5B 4KVCL 1I7TB 3A6CH 4CMHB 4Z18A 2YUXA 4I9WD 2GDVA 1P7KB 4LPUA 2FECL 1VIWA 3L9RB 1OTTC 1PZ2A 3CFCL 3TJEL 1U93A 3S98A 3OL2A 1KJMB 2Y6SD 1GONA 2P48B 4JRXB 1WDRA 4FTVD 5A2BA 3U82B 3RZCD 1WISA 3C2AH 4KQ4L 3QEQB 4DUWA 2VURA 1XSIA 1G01A 1UCTA 1XH3B 1I9IH 1JK8A 4TSCL 4JREB 4HULB 5KOVC 4U6YB 4U2YA 3KDMA 4DCQB 5TE4L 2DSVA 1NCDL 1O7SA 2NY0C 1HJQA 2XA3A 1NUFA 2EIEA 3MUAA 2APFA 3PABB 4U1IB 1LHZA 4LGPB 5GZOC 1YMMA 4CU7A 1CU4H 1OP3K 4C56D 3QCTL 4NKOB 5GS2D 4JJHA 2FGWH 4IRJB 3KLDA 1RP9A 1E0VA 2A6JA 4HWEL 1UZ8A 2J74A 1XGZA 4OZFH 3U2SB 3O6ML 5I8KL 1MQ8A 4IRSC 4PJCE 3O0RL 5EZOL 2QV2A 2ZUMA 2VDLL 2QF8A 1U91B 3SE4C 4BH8B 1LP9A 4HZ6A 4MA7H 2NW2A 1I75A 4EKXA 5J6GA 2PR4L 3TT1L 4L4TD 2VQ1A 2W9EH 4P5TD 4S1SH 1EJOH 2XPKA 2Z35A 4ODUB 5CJ8A 1TJIH 3FQUA 1UUQA 1JN6B 4POUB 2CNCA 5F7DA 2IH1A 4FXGB 5E00A 3PL6C 3EYQC 2D3VA 2E8ZA 2Y07L 2GJ6B 2XRAH 1M7IA 3GSUA 2UZYB 1P6WA 1R6VA 5FKAA 5FOJA 4YHYC 4DGIH 2XKNB 4WI2A 3ZKXC 3O3DB 1O5DT 4X4ME 3BUIA 2NY6D 1QNZL 3K80A 3MRJA 3O2VH 2W0KA 4EZMA 5DJYB 2C4XA 3BP6B 4GRMA 4PYHA 5ITFA 1MHCB 2FHBA 1IL1B 1NFDA 1PVHA 4RMSA 3MRBB 3TEUA 3VSVA 4D6JA 3ZYIA 4YR6B 1WT5A 3EDEA 3GSWB 4KY1H 3M17B 2Q7YB 4AEFA 4HHAA 2HFGH 2XWEA 4N0UA 1W0WA 3WY4A 1X4ZA 1XCQA 3BYYA 4NRSA 1OAUH 4JAMA 3CFDB 4F7MA 4O58L 1JNNH 1QBBA 3BPLB 5IHSA 3GH5A 4G6JH 3BDYH 1RUPL 4C55A 5DMKB 1J86A 1IJ9A 4NOBA 5D1XD 1WAWA 1YUHA 5CKAA 2RGLA 1U30A 3FW6A 5IB2B