1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
4GINA 2VXQH 5E00A 3MU7A 5IFHL 3WN6A 3C5ZC 1FO0B 1DDHA 2ZCKL 1RUMH 1K4DB 5D93C 4JG0H 1FGNL 4ISVB 3VFVB 1Y6NR 3TF7C 2XZAL 4KHXH 3STZB 7FABL 5IB4A 5F44A 2FYYA 5KAQG 1VFOA 3MXVL 1OTUC 5HHOE 4BZ2L 5FHBH 3BPNB 2EE9A 1OINA 4MQTB 1UM4L 4PJIF 3ARTA 3RA7L 3X12B 5JW4N 4NQSA 1H15A 2X4NB 2XACC 1A64A 2E3VA 3I75B 3MLVH 1J0KA 3AMLA 5KOMC 2A6DB 3T3ME 5C9JA 5F7HA 5EDXA 2RR3A 2FJHA 2QQQA 4UQ3B 1Z3GL 4RFEB 1ETZA 4GKLA 3WQ4A 3X13A 2YD5A 3FHAA 3OHXA 1MWOA 2DH3A 4NQUA 1UWXH 4OFYA 4DM1A 1D6EB 2VKXA 4PJEF 4YDLC 1FNAA 5T1LD 1BFTA 3ZJ6A 4R90L 4P5MA 2OYLA 2YRZA 2K9UA 4F7EB 1B88A 1AE6H 4XNXH 2V6HA 2AS5M 4U1KA 4G80A 3TJHD 4YNYB 3LEYH 3S7GA 3T65B 1YEDA 2OW7A 4X80H 4YBQC 1F6AB 1OM3L 2YPKB 4XNUL 1I8KA 3JV4A 5JW3L 5C0IA 2J7LA 4OJYA 1QNRA 1R3LA 4E5XA 4J4PC 1NWUA 5GGSY 3IDIA 1YA5A 2AJYL 1DFBH 4M81A 2QHLA 2Z31D 1RI8A 4R96B 4WI7A 3QQ9C 5JUEH 3JWOH 4WJ5B 3F7VA 1Q6GA 3V95A 2UY4A 3MRIB 3QUZA 2I5YH 1HINL 5C08E 3FQTB 4XWGH 3A0OA 5C8BB 3HUJB 4KVNH 2YBRB 1YPZB 1M7DA 2WUBH 1AKJA 1MCOL 4M61B 4POYA 1LWJA 3V5DB 3UYRH 1UD8A 4S10A 2VE6B 3RY4A 5KSAA 1J9CT 4O2EA 4QFUA 1T6WA 2BOCA 4QXTA 3GSRA 4P2QE 3CX5K 2LFGA 4UQ9A 5SWZB 5JBFA 5GIRA 3ELAT 1Z5LA 4TX8A 5C0CB 1T20A 1FDLL 3O6FB 2DB8A 1UWUA 3MBXL 1CDGA 3BEWB 2UY3A 1KOAA 3TCLA 3RL2B 2X1OA 2Y72A 3VH8G 1U8OB 3HNTL 4NT6A 4DTGH 1HZHL 4YDKH 1WJ3A 4FRWA 1U6AL 1C12A 5IB1A 1UEYA 4PTTB 15C8H 3MV9B 2VDRH 3ULVE 3QCTL 1FYTD 3EYQD 5E0QA 3DUSB 3FN0H 1A1OB 4G6KH 5C09D 4MDOA 3QUYB 2X9WA 5J1TC 3MA9L 3F8UB 3TT3L 4WDIB 4P5TD 1MJJA 3K4AA 3RL1A 4TUJB 1JGVL 3MLUL 3V6ZA 5HDBE 5B39A 1A3RL 4OGXL 5SWQB 4P8WA 3DROA 1U8PB 2YSSA 6A3HA 3ZT6A 3FQRA 4U1IB 1JZ6A 1XIWC 2VX7A 4JFFE 3HB3D 4PRNB 1UD4A 4FQXD 3MUJA 4LGPB 3TBVA 1GORA 3DV4A 1EFXB 4P2RB 2EEDA 2PO6A 2DTML 4W5UA 4S1RL 4PGZA 3IKKA 4PRAA 3FT4B 2GUYA 5E00B 2F61A 3BZFA 3EIFA 4HGWA 5I1CH 3FB6A 4ODWA 5DS8A 2XFXB 1MJ8H 1DDHB 3VIKA 4CVWA 1FLTX 1GZJA 4HCRL 4WHDA 3MRHB 1AGFB 1B0WA 1QQDA 1L9NA 5ELIA 4F37K 5A2JH 2OR9L 4JO2H 3MJ9H 1BFVH 3KPQB 3GJFH 3KR3H 4XAWL 4XXDA 1JI2A 3GSQB 3LEXA 5ACLA 1E4WL 2P48B 4IMKC 3MUZ1 3QR2A 4LFHG 1QNZH 5GGVY 3N85L 2NY6C 4QRRB 5D7LB 1MFAH 5EBMB 5HGAA 2G3NA 5IVZA 2EXWD 1MI5A 5CMAB 3WD5L 1MFBL 1WC7B 4OLVH 3S5ZA 1J05A 4C7DA 4Y4KC 4AZ5A 5FYLD 3SCWA 2ZXQA 4PRHD 3SOBH 5FO9B 3ZJ7A 4ODSL 2J8OA 2PW1A 4Z78A 1VFMA 1GZPB 1ETZB 1NCCH 4X6BA 5I74B 1BIHA 1PW3A 3V4VH 3VG9C 4LLYA 1KCKA 4UTBH 4H8WC 1HHGA 1JNNH 5IWLA 3RM8A 3DYMA 1A4KB 1C7SA 4P5MB 3L4XA 1NLDH 1UWGL 1YDPB 1QRNE 4L8SA 3KG5A 1MIEH 4U1KB 1UR1A 5IJKA 1J8HA 1OCWH 3SDDD 1KTRL 1GCYA 3ZL4H 4L4TB 3MRRA 4BZ1H 4NCC2 2I9TB 3MGTA 1MAJA 5JXEA 4YX2L 3VGAB 2YS4A 5C0IB 5ID0A 2QKIA 3A6BH 2EDBA 3IDIB 1OGAB 25C8L 5D5MA 4NO2B 3BAEH 4KRPC 3D4ZA 4PRIA 3F58L 4NO5B 4UQEA 5E5MA 4J23A 3S6CA 2W60A 3QUZB 3GSWB 5HXMA 2DLFL 1J5OL 4M29A 3FO0L 2OK0H 4PMOA 3LN9A 4PP2A 3KYKL 1QW9A 1AKJB 3TH3T 3AIBA 3MV01 5IVOA 5BQ7A 1DN0B 4GRWB 3SUUA 4HWZB 4DZBB 4OI7A 1OAKL 5TDPA 5DJXA 3GGWA 1ADQL 2BOCB 4MWFB 5DRNB 1KN2H 1DUZA 5C0AD 2QHRH 5IEHB 4X8XA 1CLZH 1QSFB 3BP5A 5GIRB 1B30A 4GW5A 3LPWA 3B2VH 3BIAX 1JZ8A 4TNWF 4G8FB 4X6DA 2BSSB 5I30L 4P2OA 1FP8A 5DVOA 1NQ6A 2OSWA 4G43A 1HHIA 4ZYKA 4FNSA 4C58B 3W39A 5INDB 1EUTA 2V2TB 4NT6B 3AROA 4P9HH 1ITBB 5DURB 3GYCA 4XMLH 5BVPH 1YEJH 2R2BB 2HAZA 2GSJA 1I8MB 4ONHB 3V4UH 4HA3A 5D7JD 5JORA 1X7QA 3ULVF 4GXUN 3CPLB 3WL9A 2A77H 4LNRB 5HHMD 3M1BA 5EUKA 4Z7WB 4EBQH 3QG7L 4QXWA 4E41E 1ACYH 3VXMA 4BA8A 2GY5A 3EFDH 3VKKA 4MDPA 1AMYA 3KPRB 4Y16D 5HDBF 9CGTA 5B39B 3EYUL 4AW7A 1QVOA 3N12A 4J12A 1YMHA 5HYFA 3QIWA 4LDOB 3VO0A 2V38A 1NBZB 3FQRB 4UNTA 3LMJL 4GG6B 4FQQB 4JKPH 1F3DJ 4JPKH 3WXWH 2YFOA 1W72A 4JM2A 2C26A 4RE3A 3G6AA 4ACZA 2DJ4A 2PCPB 1H0GA 2XTKA 2FWOB 1G9ML 1QI0A 3D3VE 4RAVB 4NGHH 2V3EA 4ZE5A 3NACH 1FNEA 3KXFE 3TJHC 1P6AB 4JY5H 4MLSA 1Z2KA 4TTDD 5JHDA 2Y8VA 3V0WH 2OZ4H 1E4XI 3QSKB 3PZ9A 1V0MA 2HTKD 4NJ9L 2VDOL 4EOWH 2ZX8A 3LRKA 1TCRA 4Q9QL 3AHZA 1QFWH 5CCKL 2CKNA 5KSBF 2UZIL 1CL7I 2Z31C 3MV7B 5E1AA 1GCFA 3JUYA 1INEL 1F4XH 4KZDH 1GHFL 4WCYH 4MB4A 4KI5E 1UQSA 2XRAL 1ED3A 3LEXB 3MFGB 2AJZB 3SE8H 2EE3A 5FECA 2XWEA 4WKFA 1CGYA 2ENSA 5HGAB 4HDIB 3RIAF 2W0KA 3SJVA 4PJAA 1MCLA 2EH7L 1XR8B 1MI5B 1JTOA 1P1ZA 1RJYB 1T66D 3S37X 5IQ9B 2ZNWA 1I1RA 1TZGH 4LLQB 2YKLL 2R1WA 4M1GL 2VRKA 1EA9C 2EPMX 4MGXA 1TQVA 5BZWB 4ATDA 2PW1B 3ZDYF 1T03H 4H88H 2MJWA 4GXPA 4U3HA 4LLYB 4M43L 4NQCA 3TIEB 4PJFE 1W0VB 4LLMB 4R7NB 5ALBH 1GGYA 5E8EA 4K94H 2EEBA 1S7WA 4RZCA 4MNQE 4DVBA 3EYQC 4H2CA 3RIKA 3MRCA 4MHHI 1J8HB 5E03A 2C3VB 2ZCHH 1EK3A 4YHZH 5D4QA 1IFHH 1UC6A 4OD1H 4P5TC 3M7SA 3MBEB 1F13A 2MPAH 1R3JA 2QV4A 1QX1A 1X4YA 1BP3B 3MRJA 2WXDM 4XP1L 5EU7E 5ID0B 1BIIB 1CFTA 4WW2C 4ZNCD 2BMKA 4PMYA 4W8BA 4U6HB 4EN3A 1NCDH 3LKSB 4GAYA 4QLJA 1BD2E 1U93B 5E5MB 4HAGA 1JNLH 1UJ3C 3VJ6B 3TBWB 1EH9A 3W0WD 3HB3C 3U7VA 1HSAB 2BSTA 4FQXC 1OARL 4U1HA 4M1DL 3GMMB 3U46A 4RGNB 5BQ7B 12E8L 1D6VL 1IM9D 1TPXC 1YNKL 2P8MB 3BZ4A 2XVLA 5DJXB 4O2CA 3ZE1F 1HKFA 4EAMA 5KSAD 3L3HB 4JG1H 4RWYL 1XZ0B 4HIJA 2XG9A 2AJSL 2BVEA 2ZG1A 3PP4H 3GM0A 4Y89A 3UTPD 1EJOL 3CFIC 4YQXL 4G43B 2X4UB 3DX6A 1HHIB 4ZYKB 3P9WB 5ITFB 5FOOA 3L3OB 1CDCA 1IC7L 1TVHB 3OR6A 4G9FA 5EORH 4H25A 1S8DA 2EACA 3M46A 1B4JL 1QR1A 5FA4B 3E3QE 4P23D 1LDSA 5JORB 1X7QB 5DUMH 4NN7B 1IGIL 1AQDB 3R8QA 3M1BB 3RWHB 4EKXA 4GKZB 2EXWC 1QLEH 4FLQA 4M9PA 1KUMA 3VXMB 5GNZA 2JFEX 2G60H 3AGVA 4L4PA 1MJUH 4DKAA 3UTTD 1PSKL 4RISH 1H49A 3MGOA 5M95B 3VW3H 1NGYA 1E40A 1I85A 1NCBH 1YMHB 2A6JA 3QIWB 5DD5H 2VSCA 5B38G 1S9VA 1WNOA 4JKLA 1W72B 4JM2B 4ODVL 3KPOB 1KTLB 2ZJSH 3C09B 3U4BH 5T5FH 3LRMA 3WHXA 4DGYL 3G5YA 2IADB 2YD6A 2CESA 2CLZB 1FNEB 1H0DB 4XVSL 5D2NA 3TTOA 4W68A 3QQ3A 5EU6A 1XRVA 2APWA 3SDDC 4GMTL 5CJXA 2J8UE 1BYDA 4R4FL 5A6JA 4HK3N 2PO6D 3DJ9A 1KPUA 4LLUA 5HHPA 1AH1A 2JF1A 4WHYH 1Q9LA 1TCRB 2QSQA 2QPSA 2DT2A 1N3NA 5DJ2A 3D0VB 4IRSB 5LAXA 3ULUF 4UNVA 1PX3A 3QPXH 3L3IA 4KDWA 2P5WA 4HXBL 5FAAA 3F7YA 3S4SA 2AQ1A 4M7KL 3D85B 3RWFB 4ZDHA 3CZEA 5JZ7D 4FFVD 1UQSB 1E6OL 1TQCC 1Q94A 2QQKL 2AJXH 1GC1H 2BNQE 1MQKH 4U1LB 4CW1A 1P1ZB 1HQ4A 4CU7A 4FABL 2UZYB 5LWYH 5CKGA 3RTQA 2DQHL 2VLLA 2FLBT 3MUY1 5LBSL 3FNDA 5KS9E 1TUXA 4UFLA 3NA9H 4PG2C 4NHCH 3P73A 4N0YL 2X4PB 5DA4A 3GNOA 3D87B 5IG7A 1G7PA 1RU9H 4AEFA 5HGGS 4Y5XC 3A6OA 5I8OL 4ACYA 4NQCB 3EYOB 3VWKA 1RK1B 4PJFF 5D7JC 4B9YA 3HC0A 2H2SD 2MMXA 5ITBL 1NH6A 4LAQH 1GGIH 1HYRC 1S7WB 4RZCB 1A2YB 1F11B 1XEDA 3RNQA 4NFDA 3VXUD 1MVUB 2GI7A 5C6PB 5IHZB 4I3RL 4UTAL 2KUTA 4Y16C 2KQMA 1HHKB 3GHEH 1CZ1A 3SKOB 1NC2B 2H6PA 4F2MA 4QHLA 1VGKB 5JXED 2NSXA 43CAA 2FBOJ 2WBGA 2JEQA 1J18A 4K7PH 5HY9B 4GAYB 4CMHC 1H3PL 4PRID 4P8VA 5D6DA 5L9DL 5FV2A 5CGMA 5H37H 3DX3A 3BKMH 3S34H 3U7YL 2BSTB 3SGKA 5DMKA 4D2NA 3TN0A 1O7VA 3AISA 4LSRL 4TTDC 3BZ4B 3HC3L 3HLAA 4TSCL 3SCVA 4JQXA 1N4XL 3HS0A 2HTKC 3BPLB 1YY9D 4HIJB 1R3IL 1FNFA 3REWA 3ZO9A 4YAQB 5EB8A 2DSZA 5I1KH 1P69B 4BUHA 4AT6B 4ZENA 4P2OD 2DI9A 5JBEA 3T0VA 1H2JA 1IKFH 2W0PA 5HOSA 2AI0H 1QYGH 2G8ZA 2PKDA 4WK9A 3OR6B 3QDHA 4H25B 5IV2A 2R8SH 1S8DB 4RIRA 5GHWL 4ZTOL 2ZUQC 5FGSA 3DBXA 2JJVA 4YN5A 2NW3A 4EJ1C 3O45A 3WENA 2Y7QA 1T66C 4XX1E 4ZPVA 4UQDA 1QLFB 3RVWD 5MP6L 3QHTC 1L0XA 4PJXE 1CECA 5D1XD 4KV5F 2BNJA 3S5LG 3ZSSA 3BUYB 5MEQB 3EJSA 4DO5A 1RFDL 2APFA 5GISL 3HI6L 5I1DB 5ICXA 1CCZA 5BRQA 4DFHA 4OF5A 1DZBA 2YD9A 4HF5H 1F3JA 3RPKA 4GIAA 3FXYA 4LEOB 1EGJA 3CVHA 5F7DA 2AEWA 3FT3B 1LDPH 3MO1B 1OD7A 3DX1A 3TA3B 3QEUA 5D2NB 4PJ9A 1E4MM 3LY6A 5EU6B 3B2UD 4M8UA 1LNUA 4Y8AA 2J8UF 2XWTB 2W62A 2D03H 5JHDD 1ZLSL 5I1EL 3EO1B 4FFYH 1I7TA 3IETB 2ED9A 3NCJH 2M1KA 5DRWA 4LCYB 2X1PA 4BQ8A 1Q9LB 5EO0B 1HNYA 4HWNA 5DJ2B 1X1NA 1OAZL 2P45B 3BEVA 1VJZA 1OAUH 5D72H 2EC9T 5DO8A 2J7DA 3RCNA 3F7YB 5J4MA 5M17A 3S4SB 3H9SB 4JZ5A 3NTCH 1CBVL 4W4OC 1E5NA 2Q76B 3WBAA 2GSGA 1MSPA 4OQTA 3L6FB 4NM8L 3VFNA 5ENWA 5TFSL 3K0WA 1HHJA 4KUCD 3MOBL 5TE7H 5JMOC 1Q94B 4QOKA 1ISZA 4HIXL 5D2LB 4OGAD 4HPHA 2E4TA 2EDDA 5KSAC 3SJVD 1OSEA 4JRXA 1KGWA 3DVGB 3G6MA 3THDA 2IXUA 4O4YL 2FZ3B 3OKKA 2CKBB 1T5WB 3HC4L 1PIFA 2G3JA 5GRXG 3HMWH 3P73B 2E27H 4OCSH 3ZHKA 3OJDA 2OJEB 1FH5L 1U8JB 1PG7W 2HRPH 3VX1A 1OGTB 3D69B 2VRQA 1TNMA 1MLCA 3AXLA 1X5IA 4H8WL 3RX8A 2APBA 5JLZA 2EAEA 1UWRA 5HYEA 2CDEA 5A8QA 3WD2A 2VX4A 4NZUH 5MENA 4LLVA 1RIHH 4P23C 4X9GA 2L0DA 2P42B 1U58A 2NX5A 3FB8A 4AIEA 2VLKA 4RNRB 4XP4L 2DIBA 4BFIA 4MA1C 3X14A 3DSFL 4DGVL 3W5NA 4NC0B 1CIDA 1SY6H 2W9LA 4GS7C 4JO1L 5EU5B 4F2MB 5DC0A 4TQEH 2WUCL 43CAB 1P7HL 1Q6CA 2R4SL 5FXCH 4I3GA 2YPLA 4QRPB 4EN3D 1QP1A 4PV8A 4P8XA 3EYVA 2GITB 3QFJB 4OGZA 4N0FA 3ARVA 3WJLC 4UU9B 1KTDA 2WMGA 1NP0A 3TN0B 2ZUMA 2WV3A 3B9KA 2EE6A 4DN4L 3PGFL 4UNUA 2IAMB 1S7RB 4HK0A 4PR5B 4PCSA 3WIHA 3BKYH 1QPPA 2PO6C 1XMWA 3SDCA 2E9LA 1BSIA 4TSAL 1E5JA 2VURA 1QPKA 3EO0A 5EUOA 5FYJD 3REWB 1XC6A 3LCYA 2V5CA 2XY2A 3DIFB 4M7JH 1I75A 3AZRA 1W3LA 2Q20A 3VVGA 1DSFH 3WIJA 3EZJB 1HCFX 1G0YR 4KRLB 1G7IA 4XC3H 5JZ7C 4FFVC 3WDQA 5LQBL 2G9HB 4G9FD 4RIRB 3D39A 4ZSOE 1KCSL 1N59A 2XWJA 5I8CA 3G5ZB 2YUXA 3O3BB 5JOPE 2E6PA 1QI2A 2VDLH 3DBXB 5IB3A 4PGCA 2HA1A 4YEEA 4XC1L 1L0PA 1QOKA 4Z8FH 4R2GB 4ZPVB 4BJLA 1MHCA 1ZT7A 1RHHB 1KIPA 1WBZA 3Q48A 1IM3B 1NP2A 2ZP0T 1UZ6E 4PPTA 4PJXF 4C7GA 1C5CH 2ESCA 1OAQL 5FYKL 1T80A 5LCVL 1ONQB 4JKWA 2C4FU 1TFHA 2NY1D 1Y18A 3ARRA 5ICXB 2OYMA 3FOMA 4DGIH 3DGGA 2WHJA 1NFIB 4ZUWB 2IFGA 1YY8A 4MX7B 4HPGA 1UR9A 5EZJA 5C2UB 3CVHB 2ZUWA 5IWLC 2H2SC 1UB6A 4OSUL 4OKDA 4G7VH 5TH2A 1J01A 5A8PA 3B3IB 2IG2H 5ILTL 2A38A 4L8SC 3QEUB 2CPCA 3RGVA 1LNUB 1LP9F 4LVNC 1BM3L 1JWSB 4S3JA 3GSXB 5E08H 1I7TB 4HMDA 4XTRD 2VI0A 4HUUB 2HVJA 1RUPH 4NZRH 5JXEC 2AXGA 2WIIB 3W28A 4O58L 2CO7B 1CXKA 4KROB 1MCDA 4XVTL 3BEVB 2DH2A 4XBEH 1S7SB 4DWSA 4UZUA 5IVXE 2WP3T 3VWJB 4P46A 5A95A 5DLMH 2P5WD 5D7IA 4F57H 4F7PA 3ZMRA 1LO2L 2NR6D 1CICB 2FSEA 4Z5RA 3RM4A 3MREB 1YHTA 3GHBH 1IEHA 3NAAL 4ATWA 2CXKA 2WBKA 3MV8E 3VFNB 3PDOB 5ENWB 4JRYE 1EOMA 3L95B 5D8ZA 3QDMA 1VFBA 4QOKB 4E42A 2FR4B 5I18L 4GQ9H 43C9B 2XKNA 4JRXB 3AJ7A 2UY2A 1YY9C 4KJPD 3SDAA 1RZGA 3H3BC 1JYXA 2VLRE 1NM9A 3OKKB 3RTQD 5DQ9B 4JFQA 5F89A 3WH9A 1CE6B 4ZFGL 5GNYA 1DEDA 5IROC 3VRLF 4P2OC 3UESA 4JKMA 3V52H 3EJPA 3R0NA 3T2NL 5KTEH 3MJ7A 1HE7A 2WYSA 2NZIA 3IT8D 1NGQH 2C3XA 4Y4HD 3L5WA 2UWFA 3AIWA 2WNGA 3BT2L 3VWKD 2Y4SA 1NAKH 3QJHB 4WGWB 5CEYB 3VD4A 5FUCE 5IT2L 3BZEA 4KKAD 3MSGA 2VDQH 1GJIA 3TO2B 5F7EH 5JQ6H 2WHLA 2VLKB 1ZAGA 4GJTB 4RQQB 4WU7B 5JHLH 3RVWC 2WP3O 3MQIA 3BISA 5D1XC 3CTTA 3V5KA 3HMXL 1KNOB 1T3FA 2B31A 1RZJH 2R23B 2C1OA 1E4XL 4U7SA 3D1MC 1DBBH 4N90E 4Q6IA 4IM8A 4DW2H 5L0QC 3JZ7A 4JQIH 4UT9L 1KLUA 5IW1A 4XAKD 1QTYT 2ZPKL 4PV8B 3KLHD 1FP9A 4N0FB 1CL7L 2D0HA 1NGPL 4NKDA 4I2XE 4C59B 3SUWA 1I9RH 1KTDB 2G2RA 1UVQB 4D9RE 5E8PA 1HH9A 2X2IA 2ICCA 1AXTL 3B2UC 3O6MH 4PJIA 3Q6GH 4FNLH 4P9ML 3O11A 1GW1A 5ISZE 4H41A 1DBKL 5BO1L 4X4MA 2XZCL 4G8IB 1KXHA 1CU4H 4I3SL 4NZTH 1AO7A 4WSJA 2JALA 2H9GA 2CKRA 4K71B 4F15C 1BECA 4TPRH 4UMGA 3RWEA 3MRQB 3KYOA 2D7OA 2BHZA 3QXDA 1HN1A 1W2KT 5C6TL 1G7IB 2BDNH 2V7HA 4PJEA 1SEQL 1QHOA 3LQAH 2XYLA 5JTWA 4KVCL 3D39B 5DFWH 3CZ8A 1ZOXA 4NNYB 5TF1L 3W82A 3LKRA 1RVFL 3WFZA 2QQNL 5I8CB 3THCA 1RULH 1KJ2H 2EH8L 4J3SA 4OGAC 3ALXA 2W65B 1AD9A 2I07B 2WANA 5J6HA 3D48R 4FXLA 3CUHA 1A7OL 5ADOL 5A2IH 1NFDF 1W32A 3MRPA 1J1XH 1Y18B 3MRLB 3B8SA 2BSRA 5HDQL 3L4YA 3VXRA 1AQHA 3PWJB 4NPYA 4XCEB 1KULA 5CAYB 3HZYA 3I50H 4K3JL 5GJSH 1BQUA 4LCCA 5TH2B 2E8ZA 4FFZL 5GGQL 1LO5B 4D0BB 3RKPA 3LN5B 3FFCD 4F9PC 4PJ9D 4CN6A 3IK2A 4UFJA 4PMXA 4TUOA 4X7DC 3ECBA 3G6JE 4NRXB 4MJ5B 1W9PA 2WB5A 5DC9B 3CFJB 2WSPA 4W5ZA 4WNQB 4IOFD 2YPVL 4P7RA 2VCBA 2QR0A 5C0FA 1DANU 5I77A 4S2SA 1MPAH 3CZJA 2EDXA 4TRPH 4U6YA 3P0GB 4P46B 4NN5C 3P4OB 4LIQL 3PZIA 4EN3C 4F7PB 3MNZA 2FSEB 1F00I 3AS3A 5B39G 5EIQA 3VFWB 4LCUB 4AEHL 1AXSA 4P48A 4JFDE 4LHQB 4OZ4A 1VFBB 4MNHA 4E42B 4PGEA 2VB5A 5E2TH 3P0YL 1N0XH 3EOBB 3TFKC 1NMAL 1QBML 3P4MA 1US2A 2YA0A 1L4IA 1WCQA 4JAMB 4ZUVA 4KZEH 1PAMA 1W8OA 2ZUXA 4NFBA 1M03A 2IANE 5IHUH 5A6BA 2O5ZH 3RPIA 3U4EA 4U6VH 1FVDA 4N0UA 4N5EC 4OLUH 3LQZB 3QQ4A 4U1JB 1JPSH 4J3TA 3MODH 3GKZA 5L2KA 3DWTA 4MAUH 1KELL 5AYBA 3REVB 2BP3A 1KWKA 1CFQA 5D9PA 5MEND 2GJXA 3BZEB 1F97A 3K8LA 4OFKA 4Q6YA 2AK4A 1I9JL 2X1XR 2NX5D 3QUMA 2X40A 4A6YH 3MLTB 4KPHL 3BPOC 5DJDB 4ZNEA 2F5BH 2XFRA 1NGWB 1OSZB 1MHPL 4ELMB 1UCBH 3OR7A 2W0FA 4PV9A 4QTHA 2XNAB 1J1OL 3V5KB 1C1EH 4M6OL 2BNRB 1UWTA 3D51A 3QIBA 2VX6A 3HRZA 4OZFH 5E8DH 2NY1C 4S1SH 2C1OB 2ZOLB 2AOSA 1JTTA 4OGYH 4Q6IB 3C8DA 4OCLC 1UM6H 2AJVL 4HUVB 1NC4D 3RI5K 5A2FA 2DKMA 2YPLD 1QFUH 4UB0L 4KHTH 2JJSA 4ONFH 2DT3A 4QRQA 1PY9A 2G75B 1BGXL 2A83A 3THML 2YKKA 2J4WL 5F3HA 3X3FL 4AIUA 1H5BB 1ZLUK 4AIZB 2XWDA 4PYGA 3B9KD 3VDCA 4B53A 5CJXC 4W84A 3CGTA 2WMIB 1YEGL 5IQ7L 2NXYD 4MD4A 1ND0A 3JV5A 4XTRC 3SDCD 5LA2A 4NQEE 3BH8A 1AO7B 2QQLL 3TZVA 2NQCA 4K7PX 1C93A 4XNZC 4N8VA 4OD2A 3IJSB 3G6DH 3QXDB 2NR6C 1KJ3L 4WVRA 2WZPD 5BXPA 2AEPL 3VOCA 1NWRA 1NUDA 4PJEB 2BJML 2HKHL 3GXNA 4OZIB 1ES0A 1E55A 5ESVA 2WZEA 4XVJH 1A7RH 3IU4H 3KWWA 1SYSB 2KPNA 1TTGA 3DVNB 1WWWX 2NY4D 3LKPA 4KJPC 1F58H 3VX0A 3RTQC 2BFGA 4KDVA 3TTQA 1VEPA 1KGCE 2JB6B 3AM8A 3BDYL 2J77A 5FEBA 1T7WA 4RE2A 4NWUH 1G7LB 5D1ZA 1RMFH 2Z91A 5FIEA 3GH5A 1OAXL 4Y4HC 3VXRB 1KTKE 3RWDA 1P84J 2ZKHL 4NPYB 5AZEH 3WKML 3VWKC 4PS4L 2XTJD 2H32A 1RK0A 4LCCB 1T1XA 1JF1B 4KKAC 2A74A 1A22B 1XCXA 5EPMB 1YYMH 5B22A 1FC2D 3EOAB 3QNZA 2H41A 3RGVD 1S7UA 4TUOB 4WFGD 3I02B 3ECBB 3G6JF 4JHAL 4P2QA 3C9NA 5BRZE 1T83A 4H0HB 2QR0B 2ZWLT 1NMBH 5KANG 4FQCL 3O4LB 2BSED 4FZ8H 4U6YB 1OP5K 4DWSD 4I18A 4J3WA 3PV7A 2WW8A 4UILH 3RDTA 3D4YA 1HT6A 3BAXA 3NFNB 1M05A 1QG3A 2D22A 3MNZB 5A2CA 4NHUA 5D6DC 3AB0B 5GJTH 4FQIH 4N0RA 1JF6A 4A3YA 3SGKC 4QF1B 3L3DA 2V5YA 2GJ6A 3S37L 3MRGA 3RFZC 4OZ4B 3BE1L 4BELD 4PGEB 2DDQL 3F4VA 3QDMD 3AVEA 3IDJA 3OKEB 3E6HA 4FXKA 4JQXC 4PB9H 3BLKA 4XPHL 4JCMA 4ZUVB 3SDAD 3NDZA 5FA3A 5T3ZD 1H3GA 5KVFL 2R2HB 3WMSA 3U4EB 3RPIB 2B5IB 1BYCA 1DE4A 4TVSa 2WC4A 1BEYL 1DQTA 2RCSH 1MHHA 1MFCL 1MRFH 3LX9A 4BK5A 3QWOA 4KKCD 1ZT1A 3MLSH 4K3EL 4ZD3H 3EDFA 3DUHA 4L3EA 4K68A 3JWDH 2KZWA 5DZLA 1CFQB 4AYSA 1R86A 4CDGC 3MMEB 3SEPA 3VRJA 4GAGL 3LD8C 2UUDH 5F9OH 4GI8A 3L7EA 1K8DB 4JFFA 3I2CL 4Q22A 2DF3A 4D3CH 4JGMA 3GXIA 4AZ8A 3MPCA 1KQYA 1CVRA 1A6ZB 5JA9A 1RZKC 3VXOB 2O5YL 3QJFA 4KUZH 4RDQF 4BQ3A 2FLRT 1S3KL 3RMEA 1IAMA 5LA1A 4JFSA 1DL7H 1ZANH 3QIBB 1CXEA 3CD4A 3BGAA 2XOTA 5KW9L 5DD3H 3I3DA 3K2MC 3Q0HA 5TDOA 5KSBA 1MREL 3RY6A 3WKNA 4H7VA 1YEHL 2VXUL 3CXHK 4XT1C 3KPSA 4QT5A 4ALAH 2ORBL 5D7KD 2A6KA 1KCVL 5IDIA 1FGNH 3GMNA 2VISA 5HHOB 3TO4D 3B6SA 2VC9A 4PYSA 1GOKA 7FABH 4CD8A 1A9BB 6CGTA 2X0HA 4PJ9C 1EX0A 4CADA 3MXVH 4FQHA 4BZ2H 5IOPA 5J57B 4BKLB 2WAHA 4Q9BA 5JIWA 4MD4B 5HVHC 4HULB 4J28A 4M8QA 4IOFC 1DQJB 2VDNL 4MD0A 3BH8B 1E6QM 4R26H 4HAFA 4YHPA 1SEBA 3OWEA 2J78A 4L9LB 5CP3H 5HYQA 1E1FA 4OD2B 1FN4A 5ID1A 4U6TA 3LRGA 3PDDA 2R1XB 4HWBL 3C5JA 4BSWA 3MMDA 5ABEA 4MAYB 2P49B 2PYEA 1V02E 5FCZA 1EEZB 2IQ9L 4QYOA 3UBXA 2DSWA 2HFFA 4CUCA 3CDCA 4JFXA 5I1JL 4BCEA 3KWWB 1QRNA 5D1QB 1LEKB 4U05A 4R90H 1MWAH 1TVNA 2OSLA 3QEQD 4KTEH 1TZIA 2NY2B 3T4YA 4IDLA 4W6YB 5MERA 1G7QB 2BVOA 1CD1A 4IOIA 1QBBA 3FRPA 4NRZB 5I1LA 1BX2A 2ED7A 3FHQA 4MXQD 4P3DA 4D6IA 1PIGA 1JGUL 1OBAA 1JFHA 5D1ZB 3OKDA 4MNMA 4U7KA 3C2AL 3KPNA 4NIKB 1RP8A 5A94A 3N0PB 4PRDA 2XTLA 4W70A 4XP5L 5JW3H 4W8AA 1QHPA 3GNPA 3V6FA 2H32B 1RK0B 4DO4A 5HHXL 1I7ZB 5C08B 4LSPL 4C54A 4PBXA 5GS3A 3AS0A 2YUVA 1MCWM 4Z2JA 4K55A 2ZX7A 4CJ0A 4A4AA 4JFOB 4Q2ZA 2ESVE 4B7LA 4JIEA 1S7UB 3DYOA 5GGTH 4XBPB 3CFCH 5JR1L 1MCOH 2XWBA 4P2QB 3C9NB 4YC2C 1ULVA 5TQ2L 5I75C 4MA8L 4Y5VB 5HHQB 4GKNA 1S46A 2D9CA 1DQDL 3WH7A 3SCTA 3RDTB 1GGBL 1TZHA 1FDLH 4R7DA 5A1AA 2HLFD 3TV8A 3MBXH 5DD0H 4M7LL 4NHUB 3QEGL 3V0VA 4WV1A 2WQ8A 2EDHA 3RUGE 2NTFA 3VFUB 3N04A 4L8CA 2VZUA 2WWKT 1IT0A 4MJ4A 1PZ2A 2VXQL 2FHCA 2NXYC 5FGRA 1E0WA 4Z2IA 4FXKB 3SDCC 1AI1L 1RUML 2OS7A 4TYUA 3MUHL 2IALB 3P3YA 4LSDA 4PRBA 4UOW1 4KHXL 3U57A 5I76A 3G5XB 3PXHA 5HHNA 1FAIL 3QWOB 3GM8A 2D7MA 4LRNH 4WFFD 5FHBL 5A8NA 1A3RH 4OGXH 5L2KD 4FLRA 2X1IA 3KPLA 2EYRA 4HA4A 3CZGA 5T1KB 2V7NB 4KDTC 2OYKA 4JFFB 3LVEA 2CIIA 4PBVC 3PG2A 2AK4D 5IF0B 3S4SG 4R6UA 5DJ6B 2DBLH 2NY4C 3V0AC 2AV7A 5TPWH 1UXWA 5LJYH 3IJ7A 5F7YC 4V28A 1UQZA 4HZ7A 4JLRB 4NQDE 2B4CC 4M9OA 3BVUA 5C0ND 4JL1A 2DTMH 3BXNB 2PWFA 4QXGH 4S1RH 2BVTA 5F71A 3MJGX 2EIBA 3QH3A 5HGHA 4D0DA 1MRCL 3WV0A 3WQ5A 3MLPA 3VGBA 2XTJC 5FB8B 2DI8A 3LEYL 2OP4H 1JPTL 1W91A 4UIMA 1LK3L 3GMNB 1FSKB 2OI9C 3BP6B 4X80L 1XF3A 2YEZB 2OR9H 4CU6A 2WPGA 4HJJL 3RGVC 2FGLA 5SX5H 5L6YH 1GHRA 1E4WH 4AY1A 1PLGH 3GIZL 1HTYA 4U1GB 1DFBL 2XUCA 3DUUB 4BYHA 3NUKA 1VKXA 3JWOL 1XR9A 2XN9D 4L1DA 4ZPTB 3B4NA 5E9DE 5TGBA 2I5YL 1MRDL 4YHPB 3RIFK 4DWSC 3TZVD 1A7PH 4MXWH 3BP4A 5ESAB 3C5JB 3TVMD 3OB8A 2P7TA 1X6NA 2E7HA 1PS3A 4JREC 4FMVA 4PJFA 4QYOB 3U30B 1NEUA 1BLNA 2Q7YB 1QRNB 4MNQA 3MUAA 4PMVA 4LASH 4HOZA 1JD7A 1UWGH 4OZGE 3LV3B 3MJ9A 3VCLB 3SDAC 1XF2A 3UR7A 4PMZA 4F80A 1G9EA 3T4YB 2BVOB 4YDKL 5I1LB 2A3CA 1BX2B 5CJBA 4WENB 3U48A 3U0PA 3QDGE 3O2DL 4GQQA 3AUVA 4KKCC 4OM1H 4YX2H 3OLDA 2VDRL 4U3AA 1B6DA 1R0AL 5J13C 3C60D 3DYPA 2O93L 1BD2A 3FN0L 4G6KL 3MANA 5D9NA 4FTVE 1IC1A 4XB3A 2C9AA 3BN9D 3LEVL 3GSOA 4TOQA 4P0DA 3ZKND 3GSUB 1M7IB 2NNAB 3KYKH 4XZWA 2P46B 4W81A 1GOFA 1AD0B 3HE7D 2V5DA 2VMFA 1ADQH 1VCAA 4Q7DA 3EYFA 3ILQD 3HZMB 4Y2DA 4BSVB 8A3HA 2W5FA 3CCHB 4WWKA 4R7DB 4GRLB 1NCAH 1FC1A 1T4KA 5I30H 1UYQA 1I1FA 1IAOA 2LU4A 3PHOA 3V0VB 4LK4A 4WV1B 1UUQA 3SE9L 1UWXK 3RUGF 4LLDA 1XF5A 3TO4C 2VR4A 3GJEA 2GJ6D 4MNJA 3A4AA 1F2XK 1V3LA 5I1CL 4BQ4A 1BYBA 2WMJA 2X4QA 3T09A 4E41B 1WCBA 5HYJA 1BBJA 4PRBB 2CKSA 3W27A 4WUUE 5DDHA 5FO8A 4JO2L 4TXEA 2Z93A 5AYIA 1ZWIA 5HHNB 4WI6A 1IGFL 3S9DB 3U4AA 4GUPA 2IGTA 3EYUH 3K46A 3KPLB 4ZG1A 4L3ED 3BRGC 2OXGA 3D3VB 3SHSA 1J10A 2I24N 3FO1B 2DYPD 3CUJA 4EIZC 3PTMA 4I77L 3KXFB 5JPNA 3SOBL 4E2OA 4N1CA 3GXMA 2AV7B 4I4WA 1ITXA 4ODBD 1XGPB 1UXWB 2J8UA 3O8XA 2WCAA 1CGVA 5FK9A 1N6UA 4OD3L 2VT0A 2GSIA 4HEPG 5JO5B 2MSPA 4MXQC 4PTUA 2M2DA 1JWUA 5DQJA 4NJ9H 3WUZA 3VGHA 2UY6A 2VDOH 1L7IH 5J9PA 4YGAB 5HGHB 2XV6B 1IGYA 2GJRA 2RBLA 3L5XH 4X9HA 5CZKA 1MIEL 1RY7B 4NN6C 4JKKA 1KFWA 3KPSD 1OCWL 5EU4A 2E7LA 3DXAA 3GRWH 4BZ1L 3RZCD 5E8OA 5F7WC 5TE6L 3LZFL 3PQYE 3SBWA 4TX6A 1GHFH 3VIMA 5CEZD 3L4TA 5A8OA 3A6BL 2ZXBA 3LRSA 3BAEL 1LLOA 4JZOB 4JHOA 4X4YB 1Q9WA 4DVRL 5C8JA 2N1KA 1QSEA 3N9KA 1VERA 2AEQL 1HOCA 1VADB 2OBGA 3T0XA 2MQ0A 2HJFA 4TSBH 5DEGA 4D8PB 2GAZB 1GONA 2HLFC 2Q7NA 3EGSA 4HJ0D 4ZOEA 1KIQA 3OAZH 2EKSB 3O9WD 2PYED 2A3HA 4FQ1L 2ZWYA 1KN2L 3QXVA 1MY5A 2FNBA 4WI8A 4M43H 1CLZL 1EAJA 3QFDB 4KTYA 1NGXB 2ZSVB 2JIXA 2GK1A 4MNQB 4PJDE 3BCFA 4KMQA 2VWEC 4OZGF 3MYZA 4OCXL 3GJFB 1XF2B 3WBEA 5A6KA 2JB5H 4W87A 3D6GA 2J6EL 2VQTA 1QLRB 1O7AA 4P9HL 4ZUSA 1SQ2N 4YJZL 1NAMH 3ZTJH 3U0PB 2OXHA 4XMLL 5BVPL 1YEJL 4GI9A 4OUUA 1JUFB 3ARQA 4IPNB 2ZOKA 2A77L 4XP1H 5GRVL 4PJGE 1S7VB 2VIRB 2X4SA 1BD2B 4G6JH 3O2LA 3IDMA 1QW8A 2AXFB 3QEHA 1FCGA 3EFDL 4M93C 2UYLA 2DSVA 4HUNB 3BSGA 4UAOB 3BIKA 1ZLWH 3IAPA 4M1DH 12E8H 4JFEA 5A2LH 2GTZB 3WQWA 1YNKH 5C0BA 5GS1B 5C0NC 4JFPB 3WXWL 4OCRH 3RWCA 4RWYH 2YDRA 2RQ8A 3PHQA 1I8IA 4Y2DB 3ET9F 4DFIA 4WWKB 5GS0D 2AJSH 1G0DA 3NACL 4LBEA 2DN7A 4MNGA 1B0RB 1I1FB 3CU7A 1CXHA 4YQXH 1E4IA 5CP7A 3UG4A 3DDFA 2VN7A 4WKAA 2ADFH 2OZ4L 1OM0A 4IISA 1B6UA 1UGNA 1IC7H 3GJEB 4ZS6D 3BJLA 1LE5B 3GMPA 1FFNA 4YK4C 3UG5A 3VA6A 2OW6A 4FXGB 2X4QB 1E43A 3V5HA 2D7NA 3EDKA 5J1AB 1SVZA 5FGCE 1BBJB 4PJXA 4PLOB 3N17A 4I9WD 4QEGA 1F4XL 5E8NA 3FN9A 2Z93B 3MV7E 3TZVC 4M82A 2GUOB 4HKJA 1SJHB 1T1WB 1UR4A 3TVMC 2VITA 5F1IB 1E6ZA 4WIWA 4GUPB 3DHJA 1KJMA 3ARDB 4AMKH 4I0PA 4RMTA 1V6VA 4QAWA 4GG8A 3WNNA 2CETA 4WHTB 1EHLH 1TZGL 3VINA 3NPSB 4ODVH 5C86A 5B4MD 4YHKH 3T2QA 4KJWD 4DGYH 1P7KA 1H3XA 4I4WB 1IGTA 1KSRA 1LP9A 2DICA 2J8UB 3U9UB 1H41A 3W81A 5E09A 4XVSH 4YBLB 3X3GL 4XNYH 4GMTH 1FZKA 4R4FH 1TQUA 2UWEE 1JPGA 3AM8C 1JWUB 4G6FB 3MCKA 5ALBL 1RZ8A 3WN5A 3BVVA 1JGIA 3FQWA 1T7ZA 5J9PB 2KKQA 3ULUD 2DM3A 5L2JA 3C60C 3FZUD 1CGTA 1WK0A 2RHEA 3ZLQC 4YHZL 1IFHL 4Y4FA 4H1LA 4XGZB 4OD1L 1I1WA 3BN9C 1KIRA 4OBRA 4M7KH 2MPAL 4QHKI 4ZFFA 1JAEA 4PTWA 4MXVE 5IMLA 3ZKNC 3WL0A 4CD5A 3GB7A 1E6OH 2V9QA 2ITCB 3NABH 3BVTA 2BNQB 2J7CA 4PMRA 2GJZA 4M02A 4ELKA 3WUGA 4PJ5A 2QQKH 3HE7C 2Y1VA 1T83C 1U91A 1W9DM 1Q9WB 1WTGT 4JZJB 5KS9B 2F54A 3ILQC 4XP9L 2OR8A 2HJFB 2DQDH 1JNLL 4YFDB 1I3UA 2EDTA 4I18C 4YGVA 5LBSH 5A3HA 1XF4A 3JXAA 4TVPD 1Q9KA 2BCKB 5I71C 5SV4A 1KIQB 3S88H 4X7TA 3EYSH 3BAYA 3WNPA 3HG1D 4JG1L 1TETL 3B9EA 5I8OH 2WK2A 3LSOA 4LCWA 3DC0A 4DKDC 3IVKB 1KIUA 1RURL 2VABA 4FMKA 4LVHC 2P47B 1FFQA 2IMMA 1P5UA 4BK4A 3GMOB 3I85A 1P2CA 1DEEA 5CD3A 4WW1B 1X5HA 3DX0A 1R85A 3UPRA 4K07A 5D9SB 5J56B 1H3VA 2Z4QB 4UTAH 1U8KB 3UBXI 1KT2B 1R34A 1CZ8H 1PQZB 4X9IA 1E56A 3VGDA 4PG9A 2X4SB 2FDBP 5DJZA 3CH8A 2CBUA 1F4YL 4LQ1A 4LF3A 4PJ7E 3L2MA 5FUOH 2G60L 3BPCA 1MUJA 3O41B 4Z7WF 1OWRM 1MJUL 2JJWA 3BIBX 3JTTB 5L9DH 1M71A 1LO4L 3BIKB 4N1EA 1HQRB 1JHLL 3ROLB 3U7YH 4JVWA 2F7QA 1XGYH 3VW3L 1LMKA 3WS6A 1HL8A 5DZOA 1S7QB 1YEEL 2KZ1B 3QUKA 4LSRH 3HC3H 5DD5L 5HHVL 1GH7A 1XCTB 1HI6B 3FONB 1N4XH 4ZFOA 2ZJSL 3UC0L 4LRIA 5T5FL 3MZGB 1I8IB 4P7LA 1R3IH 2VUOA 2JJUA 3CUPA 4QY8A 4U0RC 3MSPA 5EBLB 4U3XA 4LBEB 4WI9A 1G6RA 5AAWA 3DI2B 1XGUA 4XNMA 3JTSA 3RZCC 1PG7H 1I1YA 1ZLVH 1CENA 4KK5D 5KAQF 3LKQA 1LVEA 5GHWH 2CHNA 4ZTOH 1WGOA 1Q0XL 2XGIA 2EO1A 5E6IA 3V5HB 4WEMB 4HUMB 2WVSA 2ICEA 2P43B 5HYJD 4PJXB 1NFDA 2ITDA 2YD7A 3Q2CA 3WQVA 1UR8A 2DJSA 3PP3K 4YIQB 1NBYA 5MP6H 2VAAA 2XPKA 3BGFC 5CSZA 3UTSE 2VXSH 3VD3A 3F12B 1GOIA 4HJ0C 3CHEA 2VITB 1JDCA 4G6ML 2YXFA 4HH9B 1E6SM 3AIUA 4B3LA 4AEIH 2AJXL 3O9WC 4LXFA 1GC1L 1FG2B 4CVZA 4O02L 5GISH 3HI6H 3QOKA 2DM2A 3ECQA 3JV6B 3HPLA 3FRUB 1JGEA 3QG6A 2P8LA 3RZWA 1QNQA 3ZYJA 4WFHE 3T3PF 3VRIA 3VNYA 3Q5OA 2IFFH 3NA9L 2H1PH 3RPMA 3HFML 4RWHA 2Q8AL 5C0EA 1OB0A 3O8XD 4F7MA 1TQBC 2XXCB 3EOYG 4HZLA 2B4CL 4N9OB 3VXQA 3OV6A 1W1TA 4FMFA 2UWEF 1ZLSH 5I1EH 1T04A 3ZIZA 3WN5B 3FQWB 4D6DA 4W7UA 2WINB 1WF5A 4LAQL 1GGIL 5L2JB 1F4AA 2CNCA 3II1A 1OAZH 3DARA 4ODTH 4CRPA 1QEWA 4MJIE 1J86A 4DQOH 2JF6A 1W9XA 1UCTA 2XHYA 3DXAD 1TTFA 4ZFFB 1CBVH 5DD6A 1OTSD 3FQXA 1OGGA 3KS0H 3RGHA 3VFTA 3MOBH 4M00A 1GVYA 4K7PL 1BF2A 2D3LA 1UEMA 4IHOA 1MW2A 1U91B 4GO6B 4F33A 1Q8MA 1QSED 1VESA 3BKML 4O4YH 3S34L 3OAYH 1CGWA 4JE4B 5GS0C 2OYPA 3L4VA 3L3GB 3HC4H 1XF4B 4EUPH 2FX8L 2EDFA 2NY5C 4X7TB 4J7RA 3D2UD 4PUBL 5AD0A 2QMKA 1FH5H 4X5WA 3AYRA 4F8TA 3RWJB 4HLZH 5D70L 4ZS6C 4WLCA 4H8WH 2XIBA 3PTKA 3LSOB 3NCBB 4NC1C 5GXBB 3F5KA 4BQCA 2VABB 1WISA 2JIXD 2NLJA 5DUPL 5I1KL 3J7HA 1TMQA 3R06A 1ZBWA 2J2ZA 1N26A 1IKFL 1IGCL 4L8DA 1U8IA 2UVEA 4ORGB 1CDIA 5CD3B 1T2XA 4PFEA 5MHSE 4C83A 2R8SL 1E4KC 5C07A 3EJYD 4JPVL 5DSCB 2XA8H 4JB9L 3KHQA 4JO1H 3CFDB 2WUCH 3PL6D 4PG9B 3WO4B 3FQNB 2EZ0C 2O5XL 1U9KA 4LF3B 4PJ7F 4YXLH 3V6BR 4U6XB 4N8VG 3VG0H 4NKQB 1D3CA 4GLRI 1WITA 3S2CA 1I8LC 5B4MC 4KJWC 4ZAKA 4K3GA 4K9EC 4NSKB 2I9LB 4K2UH 5ISZA 1KXTB 1CGXA 5GRYA 5CLWA 1HXYB 4IIQB 3QUKB 1I1AA 3MXWH 4JFED 3CO4A 5C0BD 1E0XA 3IJYB 2ICWA 4LPXA 3PWPA 4TSAH 2EEXA 4YFEA 1RZIA 1LDPL 3ULUC 1DQQA 1XT5A 1T0PB 1FZJA 32C2A 3SQOH 4CVUA 2X4RA 3FZUC 3UG3A 1ORSB 3U79A 5A3ID 1XGUB 1E27A 3ES6A 1NEZA 4WUKH 2EDKA 2FJGA 2D03L 1PBGA 3AS1A 3KAAA 3AMGA 1UM5L 4ZSOB 3QDJD 4FFYL 4ZQKB 5KBNC 3NCJL 1OGBA 4H26A 3VXSA 1BFNA 1KGUA 5LYRA 1K6QL 1RPQA 2F9BT 5D72L 2QSTA 1WEJL 2ADJB 3DX8A 1U0QA 2YN3A 3N9GH 2LAGB 1P6WA 4XC1H 4XRCA 2ITDB 3NA4A 1CTNA 4FP8H 4NKOA 1E6XM 1T89A 1J0HA 3WEXA 1EPFA 4RFNC 1KB5A 5E2UH 5ABDE 5FYKH 2J88H 5D96B 1JHKL 2H8PA 2JK5A 5LCVH 1YEFL 3QWQB 2J5LC 1KB3A 2WBJA 4M6AA 4YHIB 2VZOA 3OKNA 5DRZA 4AK1A 3FOLB 3HPLB 3T77B 4I0PD 4QCIB 1OF2B 2EKJA 3MA7A 4EEEA 3QG6B 5SWSA 1I3RA 1OIFA 3QA3A 2PWGA 2WVVA 1U30A 1CXIA 3I9GH 1Y7VA 4YHMH 3A21A 2AV1A 4JR9L 5ILTH 4U1NB 1WCGA 5E2WH 4RMUA 3G6JA 2HRPL 2R2EA 2V5MA 1Z0MA 5JIPA 5BRPA 3IS1X 5J6GB 1JNHB 3ARBB 4RA0C 4D6FA 3HZ3A 5HYSB 3HPJA 3BAWA 5DYOA 4NZUL 2Y25A 3CH1A 1TTUA 2GVYA 5IVXB 5E5UB 4O58H 4MD5A 4PGDA 5BS0D 5CEXB 5CJQL 3K8MA 1S9KC 3E2HB 4LX4A 5I6XB 2R56H 2J62A 3LXBA 1ZBVA 2G41A 2VLJA 1DBMH 3FQUA 2J7EA 1X5XA 2F53A 1DVFA 4UOZA 4Y4FD 1LO2H 3MV8B 5BVJA 3S8WA 4JRYB 1HH6A 2IH3B 3FQXB 1SY6L 2P5EA 2HT3D 4N5UA 1W2PA 1LHZA 3HCVA 1IGJB 5IB2B 4UQ2B 3K74B 1EAPA 2YC1B 2OTUA 4LL9A 2VLRB 4IHOB 4PJ5D 3MYJB 4YPGA 5EO9A 1RJLB 2IANA 2ERJB 3CLEL 5I15L 4HUWA 5EH1A 2VYRE 1YC8A 2F54D 3BRFA 3OLGA 1GQKA 2W61A 1E6NA 4ZFGH 4UOJA 3ILPA 2GFTA 1CFSA 2ALWA 3DO7B 1FVCA 1MHEA 3OG2A 4OCWL 5DHVA 4X5WB 4Z7OE 3BKYL 2ATKB 5KZ6A 3T2NH 1LQ0A 1S7XA 3NVQA 4KK5C 1BF8A 1X5YA 3UTQA 4LCWD 1KYOJ 3BT2H 1B2YA 3TBSB 4M7JL 3CLWA 3CUIA 1F8TL 4ZFZA 3R06B 4UBDD 3QBTB 1DSFL 3WUFA 5FKYA 3ZTNL 2YRLA 5HI5D 4M8VA 5DHYA 2X89A 3HI5L 3QZWA 3BD3A 4JFZL 4XC3L 1R7AA 2CDGB 4E0RB 2ADGB 3EBVA 3HMXH 35C8L 1KXVA 4KMTH 2CBJA 3ALFA 1J0IA 2YK1L 3BDBA 5I1HL 1ZT4A 2OL3A 5E4EB 4UR9A 2GIYA 2DWDB 4OOZA 1P4LA 4I2XB 2LVCA 5F6IB 2ZPKH 3INUL 5KG9A 4GRMA 3AMKA 3SO3C 1CL7H 1NGPH 4OF3A 1OW0A 5IVNA 3IDYB 4C56A 3O8XC 3PJSA 4WEUD 1AXTH 2D7TH 3MNVB 5BZDB 3HE6A 1KV3A 1I1AB 1UZ8A 5KVGL 3POHA 3S96B 2P1YA 1DBKH 1MFUA 5MEPB 1TCMA 5IMMA 1R5VA 4YHEA 1FZJB 1IBGL 32C2B 1CR9L 4I3SH 2X4RB 4WI2A 2AQ3A 3FRPG 5DFTA 3NN8A 1IVLA 2CGRH 2FJGB 4Q9CA 3ULSA 4L9DA 3U36A 5C6TH 5E08L 3SBWC 1GQLA 1OTSC 5FO7B 1S9YA 3QHOA 1SEQH 3MCLL 2V2WA 5CJOL 1CFNA 5F9JA 5GRZA 1RVFH 4QRTB 2QQNH 5EU3A 3CFKB 4XBEL 5GSVB 1TFVA 2MCG1 1UYWL 3EJTA 5EFDA 2EH8H 1JFQL 1YMME 5E6ID 5DLML 5I23A 4F57L 4XRCB 5F97E 1TJIL 4NKOB 3IFPA 2MTPA 4PRPE 2LAAA 1A7OH 5ADOH 2X41A 5FYLH 3B83A 1JG9A 3SQBA 1FNGA 5ANMA 3CZKA 3U83A 1RHFA 4EK7A 4DKEL 2DD8H 3C5SB 4AZCA 4NKMB 1GUVA 3CVIL 4MDIA 2NTSP 3OKNB 4GQ9L 5DRZB 1LGVA 4H04A 1I1CA 3L3JA 5D2LF 2ATPA 2IMNA 3QGVA 1MFDL 5K9KB 1EBAA 4OLWL 3QA3B 3QIUA 3U0TA 2D1ZA 3WQ8A 1VACA 2FO4B 1ZTXL 4Z7NE 2HFTA 3DMMB 5GGQH 1GPFA 3G6JB 3LKOB 3LKNA 5KTEL 2FB4L 4URTB 3BUDA 5DUBB 4Y8DC 1KJ2A 3CMOH 1N2RA 3HR5B 4L29B 1QOXA 3IANA 1EEYA 1S9XA 5DYOB 3ME0A 3EJYC 4NBXB 1A6VL 1NAKL 3CH1B 3PWLB 2Z8WC 1EDGA 2HP4A 4PGDB 4MD5B 1CD0A 2VDQL 3PL6C 4GW1A 5EO1A 1D5XA 3HNSH 2IPTL 2VDMH 3DO3A 5JQ6L 5HGDA 5JHLL 1HSBA 8FABB 1CDJA 1JCKA 4M80A 4LIQH 3FQUB 5BV7C 1MVYA 3VDBA 1DVFB 5FYKE 2TAAA 4QHKJ 3CMGA 3C8HA 1E0OB 3ZKXC 1X5LA 5KSVA 4J3UA 4JFDB 1JK8A 3LPGA 1L7TL 2HG5A 5I8EB 3Q1SH 3SCPA 3HCVB 3SDXE 2EADA 1IMHC 4NO0A 2OTUB 3KPTA 4YPGB 4ODUB 5ABGA 2IANB 5CZXD 4AC1X 5IFTA 1QBMH 2PTTA 4MQSB 1MNUL 5JQHC 3GZKA 1KPVA 2R0ZH 4HKXA 3CHFA 3KNBA 3ILPB 2A6IA 5A3IC 3O6ML 1ROWA 5CWSA 4OF0A 1FVCB 3AU1B 4X99A 1GAFH 3BWAB 2C0HA 2EBNA 4Z7OF 1ZHNB 2XY1A 1C5DB 1KELH 1S7XB 4L4VD 4FFWD 4P3WA 1PYWB 1TIUA 1NWTA 3RWIB 2X7LA 3S35H 4PBGA 1CU4L 3SCOA 3VUPA 3QXAB 1C8XA 4NOBA 3LPFA 4YR6B 2IPKB 2A0LD 3L7FA 2ZICA 1TVDA 2RGMA 1WIPA 2BDNL 1MHPH 5IBUB 4R0LA 2LTQB 3LQAL 4PGJA 1JGLL 4CN4A 4LYPA 2EYSB 3NFPA 4M6OH 5C07D 5GGUB 1GGUA 4JJ5B 4WTZA 4I0PC 3PGCA 2D9QB 4NUJA 2AJVH 4R4BB 1P4LB 4YLQT 3QHNA 3WXVH 4RGMB 3TCXA 2DJUA 4UB0H 3C6LA 4XPFL 4Z7VA 4GRMB 4ZXOA 5HBBA 4MJ6A 1OIMA 3WHE0 4OKVA 4ZAKD 1J1XL 3BH9A 4YZFF 3WNMA 1BGXH 5I9QB 3THMH 3GUTB 3STLA 3T0ED 2J4WH 1W0WA 3CXDH 5ISZD 1J0ZA 1IQDB 5IEKA 1UZ8B 2OJZL 4NQEB 2AERT 2BNUB 3KJ4C 4P3CH 5IQ7H 1FZMA 3MRMA 4A6YA 5GJSL 1BQSA 3PWPD 1MH5A 3CU1A 1FYTE 1IGMH 5HI4D 2GW5A 2ILLA 5C09E 2QQLH 3PZGA 2JLLA 4Y1AA 1CVSC 2ZUTA 3W9DA 2X2JA 1UR2A 1AGCA 1XF1A 3GMRA 5BWFA 4N9GB 1MQ8A 1KJ3H 3U36B 1LD9B 5IHLB 2HT3C 2CIKB 5HD8D 4XNQA 4NRYB 1CFNB 3VXSD 5F9JB 2YFNA 1KR0A 1XSJA 2E9WA 3DX2A 1MPAL 5FKPB 2X4OB 5J11B 2HFEA 1Z9LA 4D6HA 2CDFA 5EWIL 2OMNA 1SJEA 4BZYA 2HH0L 4L3CA 5I3DA 1CFVH 4AZCB 3GXTA 3BDYH 5FCUH 4UZGA 1WVZA 5FL1A 4MDIB 3RJXA 5E2TL 1M1SA 2WBJD 1PG7X 1P9MC 2DTSA 3VXNA 1W9UA 2VN4A 4LHUA 2A2QT 3L5HA 1Q9OA 1OAXH 1T2QL 4YE4H 5SWSD 2ZKHH 3GTNA 4BFEA 3BKJL 2HT2D 2O5ZL 3P9MB 4J8RB 1MCRA 4OTXL 4U6VL 3U0TB 1VACB 4EVNB 1EXPA 4UBDC 4OLUL 4Z7NF 5C2BL 2ESVA 1BVLA 1UA3A 3AIRA 5EC1A 3U2SA 3GFUA 5JDJA 5EZIL 3OKMB 1JPSL 1D7FA 3MODL 4CKQA 3NIGE 4PREA 5BRZB 4EKJA 1KENH 1OD0A 3TBTB 1EEYB 1OB1B 4HU0A 1M4KA 3PNWA 1RAMA 4JHAH 1UWEL 2YOCA 4JVPA 2CSPA 5J8OA 4LSVH 3CK0L 4MADA 1HSBB 3CX2A 1E3ZA 5FYLE 1GQIA 2UV3A 3QT2A 4RBPK 3RUGA 2VLJD 1LK2A 4G8GD 4IRJA 1Q72L 4PRHE 2F53D 3CPUA 2C4FT 4XCNB 2BRRH 5HGBA 5KSVB 2DT1A 4GSDL 1JK8B 3ARSA 2P5ED 4UFKA 3SDXF 3WS6C 3S37H 2BNRE 2IQAB 3BE1H 4OGYL 4NC2B 2DDQH 4PD4J 2G3MA 5GGVH 5F6HI 4O9HL 2DM7A 1QFUL 1NDGB 1K4DA 4KHTL 4ONFL 4ISVA 1UD3A 4OF7A 5GPRA 5GS0L 5KVFH 4NX0A 4HKXB 1VFAA 3KNBB 1I7RB 1WBXB 4NFCA 3STZA 3I6LD 2A6IB 1GQJA 3V7MA 1YJDC 5E56A 4K3EH 3MR9B 1V3JA 1YQVH 5DK2B 3X12A 2X4NA 4AQOA 3A22A 3I75A 2W1NA 1F90L 1QFPA 4LIQE 5E6IC 1ZU8A 3G6DL 1HXKA 2A6DA 3QCUL 4ONGL 2JCCE 3UETA 3HZKB 3EOTH 1TVPA 2X89D 2Y07L 2PYFB 3NFPB 3KE0A 3MMUA 1D6EA 1A7RL 3IU4L 2V2XB 2DEPA 4Z9KB 1XCWA 5FUZL 3QHMA 1CD9B 2CJUH 4UDTA 1MREH 5CG0A 1F58L 1O7SA 1T21A 2VXUH 1PPIA 5I5RA 1RH9A 1Y6MR 1KJVB 2ORBH 4YNYA 5KVDL 4MB5A 1KCVH 3LS4H 4Z7UE 4OKVB 4R97B 4NWUL 1HL9A 3STLB 4C56D 5EFIB 1F6AA 3BAKA 3BQUB 1T22B 2Q8XA 3ZDZE 3HE6D 4APQB 3TGXA 4M03A 4A6YB 1KCUH 4QGTA 3VFOB 3WQ6A 4D72A 5E9DA 5HHME 4R96A 2CH8A 4M7ZC 2VDNH 5AYQA 5BXFB 3QAZC 4WY7H 3MRIA 2W66A 3GNRA 2PW2B 3W9DB 4JAWA 1S7TB 4OZFB 3DX7B 1AGCB 4M3KB 1V0NA 3V5DA 4HC1L 1N8ZA 4BQ6A 2YWYA 2VE6A 3WUWB 4OT1L 4WW2F 2IQ9H 1NMBL 1CN4A 5SWZA 2ZX6A 2DQGL 2P4AB 3FO9A 2X09A 5CZXC 5K9OB 3VXTA 3O6FA 2BHUA 2GCYB 3BEWA 2PXYD 2FDMA 4F9JA 2X70B 5GJTL 1SJEB 4FQIL 4JY6B 1M6OB 3RL2A 3QDGA 1WAWA 4JFUA 1U8OA 3JVGA 1Z6JT 4L3CB 4LDEB 4L4OA 1H3UA 1PZUB 3VFRB 1JGUH 4PTTA 4OZHE 2NY3B 3MV9A 3VXNB 2V17L 1YECH 5L7XL 4LHUB 4PB9L 4FFWC 3EJUA 2DPEA 3HA0A 3BC9A 1MAKA 4W4NA 1A1OA 4B16A 1RJZA 3QIUD 3QUYA 3BSHA 2JTDA 4O5LH 3B9AA 2G4FA 4AD1A 4OLYH 2ESVB 4WI3A 1BVLB 1MRFL 4GI6A 5EC1B 4HG4K 2A0LC 1CDUA 4TUJA 4BM7A 4PJ8D 5IBLD 4D94A 3HR6A 4R3SB 5SWQA 1PKQE 1FBIH 1U8PA 3PNWB 3FJTA 2F18A 4GKSB 5F9OL 4U1IA 4EXKA 4MA8H 4HK3J 4AZ7A 2QSCH 5KJRH 1GZQA 1I3GL 1MCQA 2SEBB 1FOBA 4ZTPH 4CAGA 2R9HD 1GGBH 4PRNA 1HKIA 3RUGB 1G7MA 1LK2B 4KUZL 4IRJB 3BXWA 2OLDA 3KDMB 1CWVA 3P30H 1LQSR 3UDWA 1GL4B 1T5XB 4ZAKC 5ESQA 3ARFA 4ELMF 3LRLA 3EMZA 2IC2A 3AIVA 3HAEH 4HS6A 2DQTH 3T0EC 5DD3L 4NO0D 3FT4A 3WD0A 3V6OA 3BAIA 1MCPH 2XFXA 3QI9B 5EOCL 1TG7A 4ALAL 1AI1H 1KB9J 3MRHA 1AGFA 5HI4C 1YN7A 2Z8RA 1VFAB 3A23A 4MNKA 3EKCA 3LIZL 4LVEA 1V3KA 4WFED 3KPQA 2F8OA 1BG9A 1FAIH 5J12B 3GSQA 2VRAA 1AR2A 5TQ0H 5HD8C 4QRRA 1FJ1A 5D7LA 5EBMA 3MRNA 1ORQA 4V1DD 4R26L 4YHLL 5CMAA 1WC7A 2RJMA 1SBSL 1BPLB 4Z2LA 5C71A 4H1LG 2FHBA 3SDYL 4AMXA 2WCGA 3RKDD 3CZLA 1UKQA 4Y19D 5FO9A 3W0WE 2JIWA 4NQDB 5CPTA 1GZPA 2F1AA 4PN2A 2DL2A 5F7FA 5FGBA 1MCIA 3W53A 5I19H 3LDBC 2HKFL 4AG4H 2WVUA 2C3WA 5H2BB 2NY0B 1KTCA 3BOVA 5DR5L 1IEBB 1O0VA 2WC7A 5C3TA 4OZIF 5EOQL 2WBJC 1A4KA 1MWAL 3FB7B 3RO8A 5KZCD 3BVNB 1OTTD 1YDPA 4UDTB 1C08B 1MRCH 4KTEL 1T21B 2HT4D 2HT2C 1IKNC 3UTPE 3IKCA 3PQYA 1JPTH 3C6LD 1EEUA 3IGAA 4G6AD 4UCFA 1LK3H 4L4TA 2I9TA 2LABA 1LG2A 1ISYA 1I9EA 2F58L 4HJJH 2QJDA 1S9WB 3ZDZF 3BGMB 1KLGA 3GIZH 2ZX5A 1OGAA 4W85A 1LO0H 4NO2A 5E9DB 3OKOB 3M07A 5JW4M 2EC9U 2DAVA 2EJ1A 4NO5A 2VRJA 2VVSA 3PZVA 2VH5H 3GSWA 1B0IA 1MRDH 3PV6A 4KQ3H 3MCG1 4Y1AD 1JYWA 1UADC 3UTTE 4MNLA 4JGUA 5GGTL 3CFCL 1BZQK 1FGVH 3MLWL 5MI0C 1R7OA 1DN0A 5I17B 1NOWA 1N8ZB 1HNGA 4HWZA 4DZBA 1BYAA 2J4GA 3G08A 3WMBA 4MWFA 2Y06H 5DRNA 3VFSB 1HXMB 5IEHA 4K7FB 4HCRA 2H3NB 1QSFA 4OZGB 1E6PA 4CD6A 3MROB 3FO9B 3O0RH 2ARJB 5E7FA 5DTFB 2BV9A 1EO8L 1X5FA 3VXTB 4G8FA 4UT6H 2WMHA 2BSSA 3MGAA 1PZ5A 2AQ2A 5DD0L 2Z92A 3QCVH 3KPPA 5I1GH 2K7QA 3QDGB 2MHAB 5INDA 4DZ8B 3O4OC 2V2TA 1ODUA 1A3HA 3NGBB 3WNOA 3W38A 3N1MC 4V27A 4WO4B 3O2DH 1QA9B 1CK0H 2R2BA 3N1GC 4WHCA 1I8MA 4ONHA 1PFCA 3U5YA 3PE9A 3CPLA 1R0AH 4FTVB 4LNRA 1XSIA 4A3HA 4Z7WA 4C56E 4W8LA 1RJZB 1E15A 4CGTA 4GBXC 4JHBA 1U3HD 1H8NA 1NOFA 2PETA 2BHYA 1E72M 2XKUA 4RMQA 2DSUA 3LEVH 3KPRA 4LRNL 3UCQA 4XXCA 3IS0X 1MWAB 2F8XC 5H37G 1NBZA 3B5GA 4GG6A 4FQQA 3U5UA 4NZFA 2PCPA 2FWOA 1IJ9A 1GZQB 1Z9MA 2DBLL 2JELL 2VLMD 2YD8A 4U2ZA 3OB0K 5BV7L 4RAVA 1E28B 2NXZB 5TPWL 1QWUA 3FAXA 1ZJAA 3PTQA 1G7MB 4UIKL 3MFFB 5F9WB 3NIYA 4LVOC 4YHYC 4MJ2A 2DMCA 5ESQB 3ARFB 3SE9H 4HS6B 3SCMB 4QXGL 2XM1A 1A6WL 1FHLA 3QPQD 3GH7A 5HI3D 3W26A 3HE6C 5DJAB 4Y5YB 4WUUB 4FQJH 2F19L 2OP4L 1N6QL 2ENYA 1LEGB 5FYJH 3MV7A 1G1CA 1YN7B 3IJ9A 3TTYA 3RNKB 3VXUE 5EOTB 2OWWA 1PEWA 3AFLA 1A3LL 2XT1B 5A16B 1IGFH 5L6YL 1ADQA 1C3FA 2AJZA 1PLGL 1NBQA 7TAAA 3TT1L 4BSJA 3ZR6A 2J74A 1FJ1B 4OUEA 4HDIA 2DDXA 3MRNB 1W0YT 1ORQB 1XR8A 4R9HA 1EDQA 1RJYA 3IU3B 5D5ME 5IQ9A 3MACH 3N13A 4FQPA 4PRIE 1A7PL 4LLQA 4MXWL 4AM0B 5TDNA 3T3MF 4AXNA 1J11A 2A9ML 4I77H 1TXKA 1JGDA 1PX4A 2PXYC 3KLAB 5BZWA 1ITCA 4I0CC 1IC5L 2UWEA 4O51B 5M5DA 4OBSA 4OD3H 2J8HA 3TIEA 2CR6A 2YRPA 2GFBB 4Z95L 4EDWL 1W0VA 3M45A 4LLMA 4R7NA 4HV8B 4HFUH 4LASL 3QDAA 5B8CC 4X7FC 3S35X 4CL7A 1O6IA 4OFIA 4X6DE 4OM0H 1LF1A 3IKCB 3LPOA 2EPNA 3PQYB 2FJFB 2C3VA 3QIUC 1KLFA 4K8RD 5EG6C 4X6FB 3C2SA 3IGAB 5D6CB 4UQBA 3MBEA 2Q6WA 2GTWB 5TE6H 3CHCA 3LZFH 3FTGB 2MQ3A 4PJ8C 5IBLC 4DCQB 4OM1L 3UO1L 1KLGB 2HMID 2D31B 1BIIA 4HJGA 2VTFA 4M3JA 3V7AG 2Y9RT 4U6HA 3LKSA 4P4KA 4DVRH 4P59H 1FQ9C 1GSMA 1U93A 2AEQH 2F15A 3OA5A 3PV6B 4P49A 3VJ6A 1MCBA 3VGGA 3TBWA 1XGRB 2R9HC 1HSAA 3FAWA 4RAUA 3CBWA 3GMMA 2NCMA 5D9OA 2UY5A 4LSQH 2P8MA 5EIIA 3G08B 3WSQH 1MCSA 1EBPA 3F6IA 2ZSWA 3L3HA 5GQBA 4FQ1H 1JJUA 4PJDB 1K3IA 1XZ0A 3RHWK 5EC2A 1WBYB 1WDQA 5GSRB 1FORH 2COQA 5SWZD 4EI5B 1NCAL 5FYKU 5C0CD 3O6FD 2DLHA 4OCXH 1PZ5B 1U8HB 1JBJA 2Z92B 4AMWA 3KPPB 4HPYL 2X4UA 5ITFA 2H2PD 2J6EH 4OIAA 3QISA 5E5RB 3L3OA 1MF2L 3IXAB 3CUGA 1WQVT 2F1BA 1TVHA 4HW6A 5JHDE 2WIMA 2IEPA 3D18B 5F7MC 4PJGB 5FA4A 2JJTA 4GMSH 1G5AA 2PWEA 4ODHL 1AIFB 1IC4L 5I73C 3MV9D 1WWBX 1RZFL 4PJ7A 4IOSD 1J1PH 1AQDA 5DVMA 1N0LA 4ZOCA 1YEIH 3VXPB 3RWHA 4GKZA 4JQVC 4ETQA 2RGLA 4CNIA 4X9BA 3QUYD 3HG5A 1NEZG 3VDAA 4WU5B 3RKDC 4M48L 2R69L 4YFLI 3ROOB 2VNCA 5LXGL 3PGDB 3V79C 5K9QG 4QHNB 2KDGA 3KPMA 4R0LC 3ZYOA 3NCMA 1CWYA 4IMLB 3G9AB 5I1AB 5HTSA 3ARGA 3SJVE 4HBQA 4PJAE 2ED8A 2R2CA 3KPOA 2DQUL 1KTLA 2GY7B 1XV8A 4N0CD 1OTTC 1C92A 1TR1A 2IADA 1GOWA 1SZNA 2CLZA 4LYQA 2HT4C 1H0DA 3H6JA 4P4RA 1DLHA 2GK0A 3C6LC 4HS8H 4AZ6A 4G6AC 4CN1A 1EFXD 4P2RD 1S5HB 5HJ3B 1MOEA 1L7IL 4LHJB 1ZS2A 3L5XL 1OVZA 5FGCB 5F6HJ 3D0VA 4IRSA 3OF6A 3VI4E 1Y0LB 4NYLB 4GXUM 1ZA6B 3SE4A 3GRWL 3QUXB 1G9NC 5DGQA 1DN2A 3CZFA 2L7UA 3D85A 3RWFA 1YJDL 1UKTA 4NQVB 4OV6F 4GKOA 4RAHA 4W6WB 4UV7L 1U8LA 4GPNA 5DMGD 4QRRD 4U1LA 5D7LD 1JNJA 1NMCB 5ICYB 1NCNA 2Y36L 1EO5A 4TSBL 1MJ7H 1NWSA 1YN6A 2YXMA 5TDNB 3WJJA 4IDJL 3H7BB 3L4ZA 1V0KA 2J47A 1JGDB 2D3VA 2X4PA 1RZKH 3GKWL 2UWEB 3F5WB 4LKCB 3TNNA 1D9KA 2ZG2A 3X3GH 5HPCA 4NI3A 1VGEL 4OFYD 1T0NB 3EYOA 1RK1A 3MJ6A 1WLHA 1LO3L 1AHWA 1VEOA 5FYJE 1CLYH 1A2YA 1F11A 2JB5L 1WWAX 1C8QA 3A24A 4P7OA 4KU1A 2BVYA 1A6AA 1U3HC 1NAML 4KQ4L 1MVUA 3VIPA 3H7LA 4DEPC 5IHZA 4Q9RL 2Q6WB 4L4TD 4N68A 1E73M 1V0LA 4QDMA 1HHKA 3AREB 3SKOA 1NC2A 3I6KB 3JUGA 1VGKA 4G9FE 3TPKA 2XG5A 5IGXH 2PWDA 1LEIA 1F4HA 5JXAH 1GHSA 3N1PC 4S1QH 1OGSA 4G6JL 4HJGB 1W1PA 1OGAD 3OPZL 5F70A 1E4JA 4G9DA 2WWDA 5HY9A 4AH2B 4P4KB 2A3AA 3V4PL 4RDQG 5IUSA 4XP9H 4OLEA 1XCQB 4GOSA 3QZWG 5CBAA 1QHZA 3QUZD 4JFTA 5IBUG 1Q6FA 1GYAA 3UXFA 4RAUB 4KJQD 1AKJD 5EIIB 2QF8A 2ZSWB 3S3SA 1TETH 4OCRL 3CC1A 3RU8L 2K7PA 3QPQC 5EC2B 5HI3C 3RX7A 5FOJA 1QSFD 3KJ6L 4DAGL 4YAQA 1RURH 2PBGA 5F96L 4AT6A 2YZ8A 3CNKA 4J3OC 5DT1L 2WNWA 2ADFL 2QADB 2D20A 4DKFL 2UVFA 3P0VH 5DURD 2NZ9D 3AZSA 1RUAH 3BHBB 1W3HA 2E3ZA 3BPNC 4PJ7B 1FL5A 4PEEA 2D0GA 5D4YA 3VTRA 2B2XL 1F4YH 3A4WA 4ETQB 3UAJD 1WICA 4LSSH 4CNIB 1QLFA 2P5WE 3UYOD 4NZJA 1H1NA 3MRDB 3BUYA 3BKCH 5MEQA 3KPRD 1LO4H 2EPOA 1R3HB 1JHLH 3KPMB 4Z6AT 3BLBA 5DK0B 4AMKL 5I1DA 4HS3B 1CYGA 4UV4L 3GZAA 5J06A 1YEEH 5HHVH 3LH2H 3ARGB 2DL9A 4V2BA 5TE4H 1EHLL 1H0IA 4LEOA 3UC0H 3D0LB 3FT3A 4YHKL 1NAMB 3MO1A 1JN6A 1UHVA 1Q0YL 3TA3A 4XH2B 1MCNA 2IGFH 4P4RB 1DLHB 4K8RC 2GK0B 4XNYL 3AFBA 2Q87A 3C8KA 5I16A 2XWTA 2D23A 2HVMA 3EO1A 4LKXA 3IETA 3KYMB 5ERWB 1HYSD 4IJ3B 3JSSA 4LCYA 5F7UA 4O00A 5EO0A 5C0JA 1B3ZA 1T7VA 4KWUA 3F65A 3MUGA 2HMIC 1XGTB 2QPUA 3WIHH 3BMVA 3E8UL 1Q0XH 3BWUC 1K2DA 3CFEB 4JZNA 1VDGA 1A21A 4OLZL 3T0DA 3MV7D 3BP7B 4ZXBB 5CZVH 3H9SA 3UTSB 3CZFB 4YUEL 2J7FA 2Q76A 3AOFA 4KI5F 3NABL 3L6FA 1R5WB 5CJ5A 1B0GA 1U8LB 4W86A 5A2AA 4G6MH 4BH7A 5D2LA 1YNLH 4O02H 3L5IA 4M6NL 4F7TB 1OD9A 3DVGA 3WELA 1MI5D 2DQDL 4XAKE 4Y0GA 2Z0BA 2FZ3A 3GEWB 3H9HB 5FF6B 1YN6B 3OBAA 2CKBA 4D1IA 1T5WA 3O6FC 3U82B 3HFMH 3S88L 5EN2A 3EYSL 2Q8AH 1F6LL 4Z0XA 2H2PC 2OJEA 4HHAA 1U8JA 2FO1A 1KFAL 1D9KB 1OGTA 3TNNB 3D69A 2B4CH 3O3EA 1I4FA 4OJFL 2DQIH 2FL5B 1OCQA 3O2VL 4GW4B 5DEZA 1V6UA 4XX6A 3KL5A 4BQ2A 2CLRA 1AHWB 3ALWA 4MJIB 1FE8L 2XICA 5GRUH 2LU7A 4NXSA 2OTPA 3OX8A 4RNRA 3EUUA 1A9EB 4KXZI 1UKPA 2O92A 1J8HD 1A6AB 1Z0NA 3QUYC 2VXTH 2XN0A 3MBED 4D9QD 1JV5B 4P8UA 4GXVH 5EU5A 4NNXB 2O26U 1CZ8L 4NZCA 4CCEA 4M1CD 3GBMH 1LEIB 2MNUA 4D0CA 4OF6A 4TN9A 4X0KB 3FB5B 4U3CA 4G9DB 5FUOL 4QRPA 5E2VL 4HFWB 2X4TB 4N0CC 2X8RA 2GITA 3QFJA 5CBAB 1C7TA 4OB5L 5EZOH 4ZO8A 5GGRB 4UU9A 3MOAH 1XGYL 3GSNL 4EIGB 3BZDA 2FX8H 3EFFB 1DHKA 3FO2B 4RGND 4H8HA 1A1NA 4X7CC 2IAMA 4PUBH 1S7RA 3C5ZB 4XPGL 4PR5A 1TENA 3UDWC 4WTZG 1NFKA 4QCFA 5E0CA 3MLYL 2OX5A 2XKSA 3GMLA 1MY7A 2EXYD 1KXQA 5D93B 3VFPA 5IM7A 5D70H 3DGCR 3DIFA 2HJLA 5DUPH 3V6OC 5ICZA 1GGCL 2IUZA 3KS0J 5T3ZH 2WAGA 4MLIA 1IGCH 3FFCE 3ZE0E 4IMKA 2CXGA 4JFYA 1PG7L 3IDGB 5E94A 1F4WL 4HA1A 2O9TA 2G9HA 1SHMA 4JPVH 3PIQB 4JB9H 1CLXA 3G5ZA 3O3BA 3DSNA 1FL5B 2WWMD 2F7OA 4EUPA 2O5XH 3HG4A 4QTIL 3MO4A 1RHHA 3VXMD 1IM3A 4HX1A 1CLOH 2VXSL 2VDKH 4YDLB 2V3DA 1MCCA 2VZ3A 1ONQA 4AEIL 5HPMA 1QFHA 5FGBC 1ZLUH 5I74C 1JDDA 1S5IL 1HP5A 1NFIA 3QIWD 2EDOA 4ZUWA 1KBGH 3UPCA 5KN5A 4MX7A 4OFDA 1Z9SA 4JM2D 2IFFL 3WDPP 1U8NB 3FCTA 2H1PL 3IXTB 1E3XA 3B3IA 2AXHA 1JN6B 4ZUUB 5FKAB 1OWQA 5I16B 3C8KB 4FNUA 1JWSA 2VQ1B 3GSXA 4N8CH 1M01A 1Q6EA 3MRBA 1UM5H 4LKXB 1Q6DA 4HUUA 4LHUG 1DBAL 2WIIA 5C0JB 5E99H 1M53A 1VBUA 5T3XD 4HTYA 3MUGB 1F02I 3VGAC 5MENE 4ODTL 1K6QH 2IH1B 1S7SA 4LGSB 4HIIB 4IRSD 4DQOL 1K2DB 4JZNB 1WEJH 5DMIH 3VWJA 1IAKA 3D9AH 2NX5E 1BTCA 1CICA 1HKLH 4JL2A 5FDYA 3GSVA 1J87A 3D85D 2FIKA 3QUZC 4MB3A 4JDZB 3MREA 4XPAL 5C9KA 2WHKA 3AI0A 1HILA 5DQDL 3WY2A 3IDXH 3PDOA 1PY4A 4XMKL 1B0GB 1JHKH 3L95A 1ACZA 4KJQC 3O81A 1YEFH 4BH7B 1R47A 2FR4A 3NCEB 5B3NA 1P4BH 43C9A 5IR1A 3S97C 1NUGA 5IW3A 3WCYA 3W0KA 2YPLE 2R0WH 5DQ9A 4W7WA 1CE6A 5KS9F 1OL0A 2OTWB 2JKXA 2E0PA 5EN2B 4YDIL 4JR9H 4MSWB 4JFHD 1XAUA 4YHOH 4OQ1A 4Z0XB 4HHAB 3S36X 3O3EB 1I4FB 3NH7H 2NZ9C 3K4DA 4NQCD 1V08A 1AGEA 5CEYA 3QJHA 1H5VA 2CLRB 4GBXB 3O3DB 5I2IB 1ZHKB 5EUOE 4KTDL 3TO2A 5CJQH 3OX8B 1EOKA 1OP5H 4RQQA 4WU7A 3UAJC 2IPUG 3MV11 4CBPA 2FEEI 2XA8L 4J27A 3HZVB 2CK2A 1KNOA 4XXCC 4JO3H 2HWZH 1NC2D 1RJCA 5IK3A 2R23A 4UUJB 4AISA 1J88A 4D0CB 1XIWB 2FE0A 2B1AL 2J25A 1FVEB 4YXLL 4Q0XH 3MKKA 3VG0L 3CLEH 5I15H 4BS0A 2E5EA 5EBGA 3TOPA 1Q4NX 1NCWH 3CC5A 1G7JB 1UVQA 3SKJH 4K2UL 4NCDA 1HIML 1A5FL 4LDLB 5LGJA 3SCNA 4F8QA 1EDTA 1A1NB 3MXWL 1WFNA 4OCWH 3PN8A 4YEFA 3MLXH 3GMLB 1M7XA 1HYSC 2Z31A 5IM7B 3VFPB 3OL2A 3UJTH 4Q97A 4V2CB 2R0LL 5E6ZA 2ZXDA 4G8IA 3OGVA 3SQOL 2XTJE 3V9FA 2HJLB 2OR7A 1F8TH 2I27N 2J8GA 5ICZB 4I13B 2R39A 1RUKH 2DSKA 4UT7H 4QP0A 4WUKL 3MRQA 3ZE0F 3ZTNH 2VXVL 4JFYB 2HLAA 4JFZH 3HI5H 5E94B 2NY6B 1P7QB 4WFGE 1DTUA 1UG9A 1FL6B 2FGZA 3CSBA 3W24A 4LCIL 4XMPH 1ZBCA 2EIDA 4NNYA 4OF8A 3TIDA 1ZE3C 35C8H 4K3DH 1FL3B 4Y4KB 2YK1H 5I1HH 1CTOA 3N9GL 4QHMA 2W65A 2I07A 4EUPB 4FP8L 4HIEB 2WMKA 4KRMB 2CD0A 2EYTA 4U2YA 4PSPA 5D7IE 1PKOA 4HX1B 5E2UL 3INUH 3T0WA 3QUMH 3VG9B 2J88L 5DK3A 1EVTC 4X6CE 1WZ1L 5HPMB 1CIUA 4OV5B 3MRLA 3QDME 4B7IA 1UG6A 5KN5B 1C16B 5KVGH 3PWJA 1V5JA 4XCEA 3GXPA 3NIFE 2Z35A 5KANI 3GNML 3OIHA 3TWCH 3FCTB 3I9GL 3SN6N 5T3ZE 4YHML 2M26A 1IBGH 1CG9B 1CR9H 3CLFL 1UB5B 1HCVA 1LO5A 4D0BA 5E2WL 3LN5A 1J0JA 3TA3D 3HMXA 1NUNB 4I48A 1V7ML 4HIHB 3TLRA 2VZ1A 6FABH 5GRJH 5IJKC 4UFHA 5EU6D 1YNTB 3OKYA 4D71A 3F6LA 1GXEA 1WPCA 4NRXA 4B50A 1NBVL 3MRBB 4MJ5A 4WW2A 3MBEC 3CFJA 3WNKA 4KRPB 4X9YA 4WNQA 4PP1D 3MCLH 1B3JA 4M1CC 5CJOH 5JW5A 1YMMB 2QHAA 2XVGA 4H8VA 2BVDA 1DBJH 4JEGB 1PZ3A 1BFOB 2R56L 4PRPB 4DN3H 1G9MC 1UYWH 2HTLD 1JFQH 1IAKB 1V7NL 3P4OA 4WIQA 1DBML 2AJ3B 1UJTA 4Y88A 5LG1A 5CKAA 4XHQA 1TJIH 3BUPA 1OPGL 4NNPH 3GSVB 2Y5TB 3H9SD 1FNSH 2FIKB 1HILB 2WSKA 1GOOA 3VFWA 3BMWA 4LCUA 1HDMA 4LPCA 4DKEH 1KN4H 3CVIH 5C0GB