1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
1R24B 4H8HA 2CR6A 2F58H 2JELH 2M2DA 3MRGB 3VIHA 1MNUH 1G7PA 2ARWA 1F3DH 3SDYL 4WWKD 2PBGA 1OSZB 3K81A 3TZVC 2XZAL 3O8XD 3IAQA 3QO1A 4XVUC 4D72A 1IILE 4F79A 1JZ7A 3WIFB 4HUWB 5JA9A 1M71B 1KB5A 1EDQA 5J6HA 5KN5A 2Z31C 2VZ1A 2YD8A 2C9AA 2C3XA 1QVOA 4M1CC 1OM3H 4FQCL 3WUWG 4JDZB 4NOFA 5SWQA 4DKDC 1ITXA 3CPLB 3OJVC 3HI6H 3O6FA 3GSNA 3PP3H 4X6CB 5K33A 5EU7E 2P48B 2UWEF 2AMGA 4R0LA 1BIHA 3PV6B 3GSUB 4QTIH 2D3NA 4TNWK 5ESAB 1CT8B 1B4JH 2H45A 3VDCA 2E7BA 5KSVA 3CJJA 1INDH 2AQ3A 1F8TL 5C0AA 1FP5A 1MCPL 2WKGA 3MJGX 2IPKB 1C08A 1YQVH 3FHQA 5ID0A 3ZKMD 3T3PE 5IMOB 4U49A 4GI6A 3MROA 3D4YA 1FQ9C 4LGXA 4QO1A 3DXAA 5JIWA 4PYGA 2IQ9L 1AQMA 3HE6C 2F19H 1DLHA 3OAUH 4K9EH 3TJHC 4HH9B 3CFEB 2Q8BH 3UTQB 3PNWB 2XA8H 5A2IH 1WVZA 2I60H 5GJSH 4XUYA 3HE7D 4LAQL 3WH7A 3ZR5A 4JPWH 5ABHA 3HKFA 1KSRA 3UJIL 3MOQA 5GGTH 2NYYD 3BPCA 4HEPG 1FOBA 2VQTA 1I3RA 3DRQA 4C56A 2DD8H 4LCWA 4J8RA 2ZJSH 1MIEL 4LDLB 3CXHJ 2DRUA 3DGGB 2VXUL 3GB7B 4ELMF 5DWUH 1TCMA 3UTOA 5T1KA 1VBUA 4OLYL 5DJXA 3RM8A 1AKJB 2ICEA 4XMKH 2XIBA 5FB8A 2PO6C 2DQGL 5JMRA 4G6AD 5GS2D 1JDDA 2VCAA 2W65B 4DWSD 1AMYA 3BJLA 4HD9A 4L4OA 1IC5H 5CSBA 1P7QB 3FFCD 1MRFL 4RMRA 1YMMB 5CJQL 3S36H 5GIRA 43CAB 1UA7A 3WE6A 1QSFD 3H8NA 5FYLD 5EORH 2LABA 3WHE0 5JZ7D 1IAKA 1NL0H 1WEJH 5I1IH 2BDNH 3WY2A 5TE4L 3WFBL 4LOUD 4Q6IA 2O5YH 4YBQC 1JNLH 3ZMRA 3H7BA 5JR1H 2CK2A 3QHTC 3U5UA 3EOAB 5C09D 2C3HA 1I7UA 4P5TD 4U3AA 1XT5A 4F2MA 5IFAL 5DK3A 4G7VL 4ZSOB 3T65B 4KROD 4NN7B 1CD1A 4HPOH 4LK4A 4M62H 4PTUB 3EOBA 3RDTA 1BLNA 3UEZA 3IK2A 2CETA 2EJ1A 4ZPTA 2AK1H 3WMBA 2FB4H 4G8FB 3MV8B 3QDMB 2W5FA 1ADQH 1N7MH 3OAZH 3ZJ6A 5SWZA 4NRXA 1U8HA 4YX2H 3G08A 1YECH 3VXQA 3CO4A 2FJGA 5BQ7A 1VGEH 1S9YA 1IGYB 3HMWH 2JF1A 1Q94B 5AYIA 4HWBL 3QG6A 3IDXL 3QIWD 2VURA 2J8UF 3P30L 4GAFB 4GT7A 3U4BH 3KLHC 4NO5A 5FO7A 2UV3A 4HC1A 4HG4K 3GXNA 1IAIL 4XHJD 4JPIA 4F7MA 3NFPA 1IGMH 1FLTX 5FECB 5FKAB 3ZKSD 2DJSA 4JM2D 1FAIH 4OKVA 2X2IA 5LGKA 5ICYB 4V1DA 2NX5D 5T33L 1IQDA 4KQ4H 5JIKA 1J1XL 2ZUUA 3RWHA 1ZTXH 4KAQL 1KN4H 5E2WH 4EBQL 2R4RL 2PTTA 5L2KB 4H25B 4OCWH 2E9LA 1C8XA 3QNXA 5LG1A 5IB2A 2DI7A 3MLSL 2PYFA 4M7ZB 4Z95L 2DQHL 4HXAL 1B4RA 5MERA 3GSXB 2A73A 2X7LA 2WMIA 4FXKB 4MD4B 4YBLB 5DRNA 3T77A 1UKTA 2QQNL 4PGCB 4X6DB 5BXFB 4KJQC 4UT7H 2C3WA 1JNDA 1LHZA 4FQIH 2BOCB 3UJTL 3UG4A 1FG2A 4LLQB 4UT9H 5DLMH 3BEVB 3RX7A 5DHVB 1UD6A 1TIUA 4KV5F 3HE6A 4JN1H 4M48H 5C0FA 1MVUB 5B38A 1A6WL 4RAUB 4FQJL 1QBLH 2AJZB 5FHBH 3HI5H 4OZFH 3H9ZA 3FB6B 2VWEE 3TBSB 4GOSA 1YZZA 1A4KB 5TQ0L 3DV6A 2VLKE 1PEWA 1U3ZA 1GHRA 1VENA 2H32A 1OF2A 1GOOA 2A6KA 5JO5A 3U0TB 2YK1H 4HJGA 1G0YR 5I8KL 4AENB 3PHQA 1H2JA 3TESA 1IJ9A 4HV8B 4XAWL 1UKSA 3THDA 1A0QL 1DQJA 4F7TA 3BAEH 2Q8AH 1L0PA 2DTML 4I9WD 1DWIM 1DWGM 4OLXL 2GSJA 1WLHA 4OJFH 4HG4J 1QNRA 2PO6A 3QXWA 3WIHA 3BZFA 2YPVL 3MOBL 4JDTL 2OL3A 4X4ZA 5H94A 4GZJA 1Z9SA 1EAPB 4C59B 2D2OA 3S98A 1NBYB 5CEZD 5MP6L 3AHZA 4C7DA 2EEBA 5TDPA 1HEZB 1HINH 5EU6E 4LSRH 4PRDB 1WZ1H 3A22A 4XCNB 3KWWA 3O4LD 3BIKA 3O3AA 4NRZB 1M53A 4GO9A 4PJ5E 1MI5B 1LO5B 3IDIB 4PGDA 4I2XA 3HG1A 3MV9E 4L3EE 1FZMA 3IDUA 1FHDA 1C16B 4Z77B 3RL1B 3BDYL 4XPAL 3JWOL 4A4AA 4Y2DD 2ZCLH 1XGPB 5A6BA 4ZODA 4GRWE 1UVQA 3KL3A 4NKDA 3WLBA 4LCUB 3IDMA 4KZDL 3MU7A 4ZXOA 3TT3H 4KRTA 4ATDA 2DPEA 2C7UB 3ZYIA 5KAQF 1A5FH 3JVGC 4JVUA 1LO3L 4Z7NE 3L3OA 4PB0H 4G6JH 1JGEB 2P7TB 1MCNA 1MFEL 2ZXDA 4JHOA 3QJFB 2YBUA 1TETH 1X1NA 2V2XB 5C7XH 1T2QL 1U95B 4Z7UE 2GHWB 4GG8A 4EK7A 3L4TA 1WCQA 2R1WA 3PL6D 4PJAB 5SWSD 1JWSA 3C09B 3FT2B 3L3GA 5K9OB 4ZAKD 1D5BA 4OZHB 4ONGL 3OKOA 5LCVH 4PP1D 2FJHA 5D1XC 2AJ3A 4LP4A 1CF8L 3PZVA 3HZVA 3TBYA 1OGGA 2PTUA 5D8JL 2VZVA 4CVXA 4NQXA 4W6XB 1QA9A 4N90E 2YR3A 5CEYA 3W37A 4K07A 5ISZD 1ZE3C 2ERJC 4XI5C 2IPUG 1J12A 5DF0A 5JW4N 5ELIA 1B3WA 3TV3L 1T0NB 2DQCH 3TBTA 2HT3D 5DXWA 4EUPG 1EJOL 3NN8A 5CZKA 5HDLA 1IL1B 3LVEA 4LGPB 2G60H 1B6UA 1AY1H 1HDMB 4AD1A 2EC8A 2FWOB 2UYLB 2P8PB 4XXCC 2XYLA 5KSAD 2D9CA 4OCSL 2H41A 1TR1A 2VCCA 4PRPE 1AD9B 5FO9A 4PTMA 1N64H 1BQSA 1VACB 3V5HB 2YD3A 4UQ3B 3QIUA 4IS6A 3VXNB 3RWDB 3S4SB 5HI5C 2APWA 5D5MF 4NXSA 4B41A 4HZ7A 2JJWA 2X9XA 3QHOA 5D6CA 4JFPA 4YDKL 4WF7A 4LEOA 4QNPE 4P46B 2WVSA 3DX1A 3U7VA 5LA0A 3RPMA 5JOPE 4HJJL 5CEXB 1MWAH 2GUOA 4JPVH 2FYVA 4NKMB 3LCYA 5JA8B 4S1QL 4WW2B 4M7LL 1JZ3A 1KIRA 3EYUL 2V9QA 1LP9A 3CSPA 1BZ9B 2X41A 4P3CH 4RFOH 4MNHB 4HU8A 2XWTA 1N59B 2HVKA 4PJEA 5IM7A 1KIUA 4JB9H 4QRPB 2LVEA 2GITA 2NY1B 2OJZH 2DTSA 4LQFL 4KK5D 1DQTA 4MLIA 4UTAL 4K2UL 1NEZA 2YN3A 4HPYL 4XVTL 7FABH 3VIMA 1MHEB 1KULA 3QSKB 2AVGA 3MRBA 4YDLC 3U9PH 4YBHA 3H9SE 5CBAB 2R8SH 2N7BA 3T0EC 5L7XL 4Z7WA 2FX7L 4N0CC 1O7DC 2JJTC 5E6IA 1FE8H 5E1AA 4R6UA 5EU4A 2GEEA 4Y5VB 1HHJB 3F12A 1LO2H 4O9HH 4X0VA 5FYKL 3W2DH 2XQBH 4ZUUB 5IB3B 1RUKL 5E94B 5GNYA 1PQZA 1TJGH 3FQUB 2H1PL 2VDLH 3G5XA 1NGXB 5IXEA 5A95A 4HWNA 3PZQA 4PJBB 3VKKA 4JFEB 1OD9A 3CD4A 2QKIB 3JWOC 3KPSD 5CD5D 4B3KA 3KPMB 1PSKH 5F71A 1GOMA 1A14L 1VFAA 4FA8A 1YHTA 4AD4A 4Y89A 1WAAA 1EUUA 5AAMA 1YY9D 4BH7B 5KZCD 5C0EB 1D5XA 4FTVB 4PJGA 5F6IB 2ZCKH 1A1NB 3RRQA 1L4IA 3QOKA 4P4KC 4DUWA 4KTDL 4PRNA 4B0MM 2J6EA 3UXFA 1GORA 4XPHH 2Q86A 3W39B 1V05A 1BFVL 3NIDF 2M1KA 1T03H 1FZJA 2G2RB 3K4DA 3JVGA 3VFMB 5KW9L 4JG0L 2UWEB 3PGFL 4CKQA 4M61B 5DI8A 3WEXA 3JUYA 3PZIA 1J1PH 3ARFA 3FJTA 2Y07H 3D2UA 3W53A 1SYSB 4BH8B 4XMLH 4LCCB 2AEWA 3QXAB 4J3OC 4DK6A 1UQYA 3BZ4B 4LRIA 5F3HA 1HI6A 3SHSA 2C3VB 5D1XA 4KMTL 1W3LA 5FK9A 1XGYL 4QHLB 2DEPA 3C60D 2DYPD 2EE3A 4OLVH 4JHWL 3UJJL 4UQ2A 3U7YH 2Q8XA 2W61A 4POZD 5L8LB 1MCIA 5J56B 1KJ2B 1OAZH 2L7UA 3Q48A 5GGRB 4KJPD 5E2VL 4CRPA 3MTRA 1EUTA 3PGDA 3U0PA 4KRPD 1PFCA 4EQ2A 3BUBA 1FO0L 3WLWC 3VWKC 4JY4B 4J4PA 2H2SC 3PF2A 4TVDA 3SCNA 4XNYL 2G75A 3H3KA 4XXCA 2ADJB 2RFXB 3Q6GL 2DQUH 3BZDA 5C8JB 4F58L 4DO6A 1JWUB 4J1UA 3CLFL 5DEZA 4RISL 1TQCC 4P99A 2EDHA 3QO0A 4DZBB 4DKAA 1AJ7H 3SCWA 3OG6B 4GJTB 3S37H 4A3HA 1WZMA 2NXYD 3MRCA 5CKGA 4EJ1C 1XD1A 3QUXA 5D9SB 3VGAB 1GQJA 2ZZUT 1KEMH 4MAYC 5LAXA 1H3UA 3DX7B 2YFNA 1QNOA 2YDSA 4NF7A 2CR3A 4UV4L 1R3LA 4W7VA 2MHAB 1CGWA 4CMHC 1KT2A 1OAYH 3RY4A 5BV7B 3V5KA 4Y4KB 2ZICA 1PY4A 4AZHA 5FEBA 3FO2A 4WO4D 3BVTA 4JCLA 2DB8A 5EO0B 1JD7A 5TFSH 1U8JB 1FAKT 4KI5D 5DFVC 3ESUF 2X4PA 1I85A 5SX5H 2I07B 3BGMA 2DKUA 1SVCP 1VRXA 1M7XA 4PGEB 3P4LA 5JPNB 1OGSA 3U46B 1Q9WB 1ZGLP 1K6QH 2YXMA 3H9HA 4MWFA 2FGZA 2JJTA 5CJBA 4QGYA 1LEIA 5GRJH 5BCAA 5IGXH 1HHKA 4PY8I 5CJOH 5CP3H 2VOTA 5EZIL 2H26B 5IR1A 4HBCL 2EYRA 3EYVB 1WCBA 3DROB 1G0XA 3BPLB 4P2OD 3UG3A 3GMPA 4KC3B 4U1GC 4Y19B 2E9WA 3QDJB 4FZEL 2RGLA 1RURL 4YJZL 3NZ8A 4N5ED 4OLWH 1OTTD 5EOQH 1P84K 5TQ2H 3LN5A 5LA2A 4OCNC 2XIIA 4ELKA 4ZXBC 2ALWA 3VPLA 1ORSB 6FABL 2P5WD 3U4EB 1J9CT 3H42L 1FCGA 4FG6C 3DX6A 1BM3L 2EKSA 1XIWB 2JKXA 1JGLL 1Y7VA 4QFUA 4ZFOL 5FV2A 3T3PF 4U0QB 2HRPH 3LKOB 2IPTH 4X0KB 1D5ZB 1UYWL 2APXA 3NPZB 3W6MA 3PJSB 4NNXA 1VFFA 3H55A 3TJEL 1TTGA 5L88L 3WS3B 1HXYA 3LPPA 5JIHA 1ITCA 1QHPA 3QPQD 3CVHL 5HY9B 3SKUD 5C0NC 2YLLA 3VNZA 3AMLA 1B0WA 3WNLA 4PMUA 2EEDA 3CZJA 4V28A 2N7AA 4UOW1 3VX0A 1OAXL 5FOBA 4MXQD 1WUNT 5DURD 4TNVK 5T1LB 4EEEA 3MLPA 5A3IC 2ESVA 3OLEA 4M7JH 4XMPL 2EXOA 3RVWC 1PVHA 4NUJB 4U1MA 4YXLL 1A64A 4KUCF 2VDKL 4ZDHB 1UB6B 4F7CA 4G8GD 3SDDB 3INUL 2EIEA 3IKKA 1BFOB 4FLRA 2ZSVA 3BN9D 1VGKA 4G43A 3PUCA 3VU2A 1HKFA 3X3GH 2RAMA 1S7VA 4U1IA 4ZG1A 2XHYA 3HUJA 2XXCB 2VCBA 2X4NA 3EFFB 4UTFA 3IJ9A 3P40A 1A3LH 4GG6B 4C57C 1UB5A 1WWBX 3B2VH 4RGOL 2AEPH 5DRWA 3OZ9H 4OGAD 5EOCJ 3MPCA 5IB5A 1P84J 4YPJA 1GONA 1P1ZA 2EDTA 3REWB 1HH6A 1GOGA 4R90H 1G7JA 3CMGA 5C0AE 4K3HA 4G80A 4Y16C 1CIUA 2D3VA 4XCEA 3D6GA 4MVBD 3FFDA 2H3NB 4TUJB 5E8NB 4Z76A 1F58H 2XWDA 5FCSH 2DH2A 1YPZA 2ED9A 4X99A 3DIFA 2A6JA 2YPKB 3DXAE 1EQPA 4PJ9C 3O6LH 5IDIA 3BAWA 3ULUD 5TPWH 1A1OB 2OTUB 3X14A 4GPNA 1Q72L 1S7RB 3WY3A 3FOLB 4Z5RB 2CO6B 3IDGA 1BQHA 1BREA 3DMMB 3RPKA 1S78D 4P2RA 1G0CA 3SUWA 3O11A 1G6RB 2XN9B 4GI8A 3DYOA 5A2FA 3ALPA 3ORJA 1M4KA 4C56E 4LCWE 4JAMB 2GSIA 4ZFGH 4ZFFA 1MREH 4JZNA 3UPAA 1QRNB 4M43H 1W9UA 1E6NA 5E08L 5J57B 1NCCH 5E00A 1E27A 4JFFA 4HKBB 4DAGH 2DLIA 1BWMA 1EHAA 5TE6H 3LRGA 2NZ9D 3LPWA 4TTDC 1DQDL 3LB6D 5LVEA 4WJ5A 4NRSA 4YHPB 2DSKA 3L4WA 4UINH 3RGVC 3MBXH 2VKXA 1IC5L 2J25A 3C6LD 5A16B 4B9ZA 1RZKC 4LLYB 4FRWA 3MNZB 1EEYB 3UCRA 4GW5B 4AD0A 4MJ2A 1MIML 4B15A 2ZP0T 5C0DA 3IFOA 4AIZB 1SQ2N 3HZMB 3ARDB 4G8EB 1TNMA 3MSDA 3OZPA 1NL0L 4OD3L 2C0HA 4K94H 1NC4D 1A2YB 1AXTL 2VSCA 4RNRB 3VRIB 2BDNL 3VXUD 3WBEA 3I50H 4P9HC 1AE6H 5E03A 2HMID 4IJ3B 4D6CA 4PJ7A 4MB5A 3SE9H 2Q76B 1QW9A 2EIBA 5JQ6L 4XNUL 2PF0A 4P9ML 3HR5B 2CK0L 2Q3ZA 2YPLB 1W2KT 3VRLE 4FFWD 5GRWA 3FAXA 1RI8A 4G9DA 5C0RL 3D87B 4HS6B 2D7NA 4UQEA 5J6GA 1CWVA 4F37K 3H0TA 5D2LA 3BHBA 4M62L 5HYSG 5D93B 5MI0B 2A2QT 3AXIA 4M4PA 4ODXB 3O3UN 1RZ8A 3V4UL 5MEND 4UFLA 1UWEH 5AYUL 5J7CC 3LMJH 1MHCA 1IGCL 1Q0XH 4LPYA 3SGKC 2WPGA 3F7RA 5SWZE 5D5MB 2CXGA 4POUB 4EZMA 5EO1A 3RX5A 5EA0L 3MLUL 4PMNA 3WN5C 5DEGA 3RWIB 3X17A 2A77L 2ZUWA 1UKPA 3WSUA 3MX0A 4OUEA 1B6DA 1C8YA 1HHIB 1HQRA 3BP7A 5JW5A 5E8DL 2P1YA 4B9YA 4HKZA 3B9AA 4PBWD 4NJ9L 4RDQG 4PS4H 5D72L 2VC2H 1N5AA 3S9DB 4PRWA 1U3JA 5F7DA 3VDHA 4TVSa 4PP2B 3I9GL 3VFVB 1FO0A 1JNEA 4V1DE 5EOTA 1C5DB 4ZO8A 2LE9A 1IFHH 3BVWA 4UT6L 3VXMA 4TPRH 1RQ5A 1BAFH 1QZ1A 4JO3L 2XG4A 4PRID 2ZUMA 4ODUA 4GAGH 1MQRA 4HS8H 3TH2T 1QRKA 1K2DB 4ALAL 4BUHA 5I9QC 4UQ9A 4GRWF 4YQXL 3GSOA 4G3YL 4L8CB 1NJ9B 1U8IA 4Y4FC 4LVNB 3GSQA 4P5MA 3WUGA 1I9JH 3D5OF 4LCIH 2GK0A 1RSFA 4JHAH 3IJSA 3GMOB 2G5BA 1SMDA 4M81A 2GJXA 4Z7NF 4DVRL 2WQ8A 3UTPE 4UT7L 4OLZH 1IAOB 2YUVA 1BVNP 1WDPA 3D3VD 3TN0D 1B2WL 4LMQE 1CXKA 3MUAA 4Z7UF 4PJ9A 4ZPVA 3QA3A 5EOCH 5TH2B 4HWEL 3DDGA 4U1LA 2Z35A 1GQKA 3HRPA 5IMLA 3GUTB 1KGWA 2DGAA 5KTEL 3DVGB 1RZFH 4U1JB 1QEWB 4U3CA 1TENA 2B4CH 5FA3B 4W7UA 4YR6A 2V3FA 1KLGB 5B39G 2NNAA 3E6HB 5DJ0A 2OYMA 1N8ZA 3WUZA 1FVEB 1A6AB 5KAQG 5FGCB 5LGHL 5L9DH 1W72H 4M6NL 5JDJA 3X11A 3WF1A 2F5AH 3T2NH 5T3ZE 3SJVA 5AYBA 4AIXA 2AGJH 3N1QC 2CUHA 3RGVA 3A5VA 5D1ZA 2NW3B 3S88H 5TF1L 3G6AB 1M01A 4QXTB 2O93L 3AYSA 1KBGL 1DWFM 1TQBC 1BVLB 3C5SA 2VI0A 1QLEH 4JRXD 2C1OA 1LL6A 5JHLL 1DLFL 1E4LA 1PJ9A 1FGVL 1E6OH 3LMYA 3BZEA 3MGAA 4NCDA 4I2XE 4QNPF 5I75B 4YAQA 3HG1E 3OKYA 1WITA 3TO2B 3IGAB 1FL6A 3HAEB 2ZSWB 2CKBL 3QUZC 1PBGA 1OWWA 3SCMC 3QBTB 1FGNL 3RTQD 4W8AA 1Y6NR 3PTQA 2BNQA 1ZHLA 1EV2E 3CVHA 3V6FB 2VE6B 3LHPH 4RQQA 3VFGL 5LA1A 4LVEA 2AQ1A 5IFHL 4GQPH 3GM0A 1BMGA 5C0GA 3QZWB 4LARL 3SDDD 4EN3B 5KOVC 3QNZB 3BP4B 1KC5H 4PY7B 3BGFC 5ENWB 1GPOL 4H8UA 4M4RA 3EOTH 4M82A 5EO9A 1U8LB 4F8QA 1I9IH 4Y1AD 1PYWB 1FC2D 4OFYA 4OIAA 3SGKA 1GIGH 1R5IA 4PFEA 3OKDB 1HVXA 4QRQB 1W3JA 2IMNA 4LLVA 2IFGA 1MH5A 3WN5A 2YA0A 5IW6A 4HLZH 4NQED 1RVFL 4R3SB 3HLAA 3P9MB 1EMTH 3F62A 3CFDB 4MQXC 1XZ0A 4N8VB 1AGDA 1YYLL 1LK3H 3P73A 5FYJL 4H8WL 3UYRH 2AJXH 1G7IB 3GIVB 2WUCL 1ERNA 2XVGA 5BO1H 5I6SA 3VXOA 5DR5H 4NSKB 1W0VB 3V4VL 2RR3A 3MREB 8A3HA 3N04A 4IDLA 1FZOB 4TX8A 3P11L 2FZ3A 1ONQB 1RUAH 1YNTA 4M9PA 1MJUH 1EEQA 4KWUA 2CGRH 4CNIA 5JUVA 2R23A 2I9TA 4Q9RL 2HN7B 5CMAB 4LKCB 4MS8C 4MNQD 2WIIB 1RIVL 3L95A 5E1HB 2DI9A 2YXFA 3WHXA 4LIQH 4Y4FA 4S2SB 2YOCA 1DVFB 3VI3E 4LEXL 1U2YA 3BO8B 5DJZB 1LP9E 1UR8A 1J05B 3CFKB 1L0QA 2VXSL 3ZDYE 3O45B 2ZX7A 5I5RA 4PJEE 1F4XH 2R1YA 5GS2H 5J0BA 2LAGB 2NMSA 3GBML 3WXVL 1T04A 1RJYA 4JLRB 2WHMA 4TVPL 5JORA 3RY5A 4YHOH 1HQ4B 2QPUA 1T2JA 2J7CA 3F7QA 5FYLH 3RDKA 4P23B 4OAWA 1MSPA 4PV9B 4BZ1L 4YEEA 5DJYA 3ULSA 4Z7WE 2X4OA 3VJ6B 1HP4A 1WICA 5DUPH 4UV7H 3SO3B 1HYRC 4YE4H 1A6PA 2X4SA 3JSSA 4WEBH 1QSZA 4NKQB 1JG9A 3EGSA 2FDBP 2HTLC 2WUBH 3QFJB 4KJYB 1JGDB 1E4KC 1UASA 2AV1A 1G9NL 3L3JA 2D4DA 3U7WH 3RHWK 2J74A 2XZZA 2Q20A 1CL7I 3KLSA 2MFNA 5AZEH 1O7SA 4WTXA 2E27H 2IALA 2VERN 4XWOD 3AXLB 4TUOB 1ZHNB 3OGCA 5IK3B 1UJTA 4PJHA 3NSNA 3GIZH 5IVOA 4GAJH 3WBAA 5A8NA 1QKZH 1K3ZA 4HUVA 4XNXL 5M5DA 2W60B 1NMBH 3OKMA 4ODTH 2PYED 5AUMA 2W07A 1BOYA 5A69A 1P53A 2OS7A 4XVJL 5GZNC 5IROC 2Z91B 3F58H 4GUPB 2OSWA 3MR9A 2CQVA 4NN7C 1IKFH 1M05A 1WAAE 5T1MB 1NGQL 3G04B 3HAEG 2VQ1B 1NMAL 1PZ5B 2DLTA 1BYDA 5I79A 4PJGE 1GZJA 1TCRA 2BJMH 2GY5A 4N8PA 3REVA 1MCRA 1EVTC 1GCFA 1INQA 1X4ZA 3MOAL 3QUZA 1XRVA 4HUKB 1K4CB 3WNNA 3SCMA 5GGVL 5ID1A 1GVYA 3LN9A 4NPYA 1P6FA 4DGVH 5KVMC 3NUKA 1FLRH 3AROA 1KN2L 1YMHA 5BMFH 1OD0A 1XC6A 5DDHB 3I02B 4UQAA 2DKSA 2PR4L 1JI1A 1TTFA 4ETQA 1CICD 4YDIH 3LKNB 1E4XH 4GMTH 4PJDA 3CPUA 3IS1X 1F45A 4HXBL 1K85A 3GMLA 4H8WC 4PJFA 5D9NA 4MJIA 4YHNB 1HHHB 4Q74A 2QF8A 5GS3A 5CSGA 1LD9A 2Z8SA 4CMMA 3VIIA 1OAKL 4RBPK 4RE4A 1ZLSL 4I3RL 2ORBL 4JVWA 4AMWA 3LRSA 3P4OA 1V3LA 4D9QD 3T4AA 4M24A 1LK2B 1PW3A 2Y5EA 3LRMA 2HFGL 2LTQB 3PV6A 3GSUA 4G6KH 5F9AC 4Z0BH 1CT8A 1XSJA 3E1F1 1TG7A 4X83A 3A6OA 5I66A 4YBLC 1DTUA 1T1ZA 5DHYB 2XFRA 3BE1L 3OR6A 5IMKA 4PB9L 5J3HD 4H04A 1J18A 1NUNB 1TJHH 3U30B 4EI5B 1MUJA 1HKKA 4M7KL 2JFEX 2YIHA 2P8LB 1YEEL 5I3DA 1XH2A 1UR0A 4BZ2H 4HH9A 1LQSR 3UTQA 4FQXC 4RMWA 5TF0A 1RZJH 4ZYKB 4UTBH 3BP6B 3FB8B 2FHCA 1NWSA 3EUUA 2VAAA 5DA4A 4R2GB 1DL7L 2CJUH 5CSYA 3B3IA 5DHXB 2HISA 4KK6C 5CIPH 2MANA 2WWKO 4OZFA 3TNMA 4A6YL 3PZ9A 5D96B 5C2BL 1QFUH 4FQ1H 4WHYG 3MRFB 4NHUB 5D1QD 4JFXB 2YN5A 4IMLB 4JKWA 1OP5H 1KXTB 3AM8A 4I4WB 1ZS8B 2HFFB 1EO8L 3AU1A 4GRLB 5CEZH 5IQ9B 2BS9A 3P2TA 4JFQB 5MHSE 3TTOA 2X70B 2WINA 3VFOA 3VXRD 1KJ3H 3ARYA 2WMPA 1G9NC 1DQMH 2VXVH 2IAMB 5FGSA 4JCMA 4XRCA 1YMMA 2ZPKH 4DCQB 1GGUA 3VD9A 5DTFB 3TO4D 3NCCB 3SO5A 4PSPA 5T1DH 3JBG7 2ID5A 1GGYA 2I5YH 2VDMH 1E4KA 1EEUA 1N82A 4B7IA 2A9NL 2VLKB 3CZNA 2UY2A 4OFVA 2Y5TA 5CINL 1CLXA 4OB5H 1T20A 5TQ2L 4YK4C 3EOAA 3CVIL 2B0SL 1QNSA 5AWNL 1H3XA 2CKBA 3TC9A 3QULB 4ZSOA 3MXVL 2GFBA 5FF6B 5IROA 4P48A 4O5LL 5C0BD 4CDHA 1ZA3A 3MV7D 4U6HB 3ZL4H 1I8IA 2IPTL 43C9B 1AQ0A 3PGCA 2BNRA 2AOSA 3NCBB 4XAKD 1YQ2A 4WFHE 1V02A 1G7LB 3L5XL 3C09C 4NM8H 2CO7B 4G8FA 5EU6B 1U3YA 2J62A 3HC3H 4GMSH 4TQEL 4UUJB 1JAEA 3QHNA 1S8DB 2O5ZL 5GRUH 1XGZA 3MV9B 4IRSB 4L3EB 3TGXA 5C86A 3O6MH 3R0MA 3M8OH 2YDQA 1OPGL 1GOWA 4GRWB 2NTFA 2ESVE 5IVXB 5MEOB 4XB8A 4PRAB 2AEQH 4JQXC 5F7EL 4HPGA 2HT2D 3N1PC 1JL8A 4Y8AA 3UBXG 3VWJB 3VINA 1B9ZA 2FATL 3BKYH 5JHDB 2R15A 4WI7A 5ICYA 3J7HA 3CFJB 1SYVB 1W9PA 4LAJH 2WWKT 4JO1L 4LNRB 2J7GA 1KJ2L 3HN3A 4NN5C 4Z2JA 4L9LA 3KPPA 3HNVL 4Z7UB 2WMKA 4DVBB 1HKLH 3C9NB 3F7YB 4X5XA 1GOIA 1UM6L 3FT3A 1E70M 5IBUB 4K55A 5IOPB 4D8PB 3HUJE 4L8BA 3OXSB 4P46C 2Y25A 3UERA 2XXMB 4QAWA 3IFNL 2PI6A 3OF6D 1A3LL 3BPOB 2FO4B 3B2VL 4FXKA 2VNCA 3KPLB 3HI1A 2FH8A 3BN3B 2YSSB 4WW2C 3ROLB 3A23A 3GZAA 1EXUA 4PRHD 5BXFA 3MLYL 3BKCL 4OT1L 4QCFA 2A3EA 4NGHH 4F9DA 2ZX5A 2EE6A 5IW1B 2NY3D 3ARGD 3MCLL 4R90L 5F6HI 1JF5A 1D9KD 1EDGA 3VRLF 1NDGB 3QJHB 1MWAA 4TRPL 2NY1C 2O9OA 1EAJA 1F58L 1YPZE 3MRPB 4KVNH 1MVUA 4L29A 3GNML 4RAUA 3HG5A 1S5HB 4FQXA 1ZVHA 1MOEA 4HGMA 5BV7L 3QG7H 1M04A 4LDEB 1TXKA 2C26A 2HT4D 2CRMA 1PG7H 1D6VL 3L3IA 2X09A 4PRPB 5I1LA 3VXSA 2WSKA 5DRZB 2DQTL 2JLLA 3QRFM 4ORZC 3P9LA 3TA3C 4X9GA 3KXFB 4EXKA 5ILTH 5ABFB 4Q2ZA 4P2RE 5D6DC 3O3EB 1EERB 4GKSB 4Y5VC 3RIAK 4HFUH 3VD5A 2WVTA 4NQCD 3QIBB 1U8NA 2XWBA 4O2FA 4HV8A 5DGQA 4MD0B 3BPNC 3QQ4B 4FXGB 4XCFH 2PB1A 4HMCA 2YL9A 1JF1A 2A6DB 5GS1B 3MBEB 1J5OH 4JFFE 3HMXH 4I48A 4BQCA 1ED3A 5CILH 4ZUVA 1FN4A 3AB0B 5I16B 3FQNB 1EAPA 3TVMA 5FL0A 3NFNB 2W92A 1MLCA 1NDMB 3SY0B 4PRDA 1DBBH 4XCNA 2PW1A 4PTWA 4I18B 5E1QA 2P45B 2JB5H 3H9SB 3IDIA 5CJXA 3WQ5A 2C1PA 1U8KA 3DHMA 4DM1A 1UJ3A 2E9IA 4ODHH 1YY8B 5FXCH 4C83B 4DOHE 1H0GA 4ZO9A 1LO0L 1NAMB 2OTWB 3LV3A 3WNOA 1S7XB 2EO1A 1VBRA 3VSVA 2BMKA 1KNOB 3RWGB 1FJ1A 5F9OL 1AE6L 1NGPL 4PJ7E 3KYAA 2VABA 1FH7A 4EUPH 4RBPH 3O2LA 2P7TA 1EFXB 5DRXA 2Y06L 3VXPB 2ICCA 1YYML 5T5FL 3STLB 1BX2B 5JNYB 2A1WH 1N4XH 1ZLVK 5D2LE 4PJAA 3VIGA 4HGWB 5K9OA 1CU4H 1TJIH 1H5VA 1ECEA 2HLFC 4OZHA 5IVNA 1BOGB 5I1KL 3AVEA 4K7PH 2PF6A 3BAIA 3V0WH 2QQLL 4JM4H 1BGGA 2X4QA 1UA6L 4OCRH 2WZPD 3BVNA 5TE7L 4G6MH 5CPSA 1QO3B 3N1AA 2Z1SA 3W4RA 1FIGH 3L3DA 1T0NA 4YXKH 4N0YL 3LQAH 4JQXA 1UM5L 4WU5B 5ALBH 1CK0H 1FNAA 1YEGL 4BQ8A 2R56H 4LFHG 5DHVH 4XXDA 2OMBA 3S35L 1F3RB 3U9UB 5F97E 3BQUC 5ECJE 1HDMA 3UZQA 2CITA 4JG1L 1T5XB 1TVHB 2UYLA 3P77B 3FB5B 4ODWA 1TZHA 5E6ZA 1GUVA 1W91A 1AD9A 4TULH 3MUGB 3CV5A 2GJZB 4OSUH 2R69L 3N85L 3LPOA 3WY1A 3V5HA 2F8OA 3EJRA 4YC2B 1IFHL 3VXNA 3BEWA 3S4SA 3VXME 2D7MA 1YDPB 3GRWH 1CXEA 1IZKA 2FBJL 5E4EB 2NY5L 4JZ5A 3ULVL 2BVPA 3MI6A 4RMTA 2QADB 1I1AB 4G5ZL 2I9LA 5DGRA 3LX9A 3N12A 3V5DA 4WI8A 4NP4L 2CCRA 2Q1EA 5BV7C 4R7NB 1H5BB 2V3DA 4U6YA 1TVNA 1XMWA 4WI9A 1RUPL 2D7OA 4KVCH 4MNHA 4HS3A 2IGFH 3OKKA 3QCVL 4XP5L 4XVSL 5CCKL 3WS6C 1OGAA 3LOWA 4UNTA 4Y88A 2AJVL 4JGUA 4ZTOL 3CCHA 3D52A 5INDB 4A6YA 1NKRA 2AXFB 4M1GH 4R4ND 4HAGA 3E2HC 5CBAA 5JMOC 1FFQA 1G6RL 2DBLL 4MXWH 3MLZL 4XCCH 3LKRA 3WF3A 4TUKH 3TA3A 4OLUL 1CL7H 3LD8B 3VFRA 3DI2B 3GHEH 5D6DA 3RCNA 3OR7A 4Y5VA 2B4CL 3K7UA 3CLWA 1A6VL 4N0RA 1UM4L 3BPLC 3C5ZB 2EQDA 1FFNB 3HFMH 1FYTA 4BSWB 3CX5K 4XBPA 2MPAL 4KKLC 4IUGA 1XYFA 1NGXA 5L9DL 2VDNH 1SJEA 1UXWA 5DMJB 4HIHA 3FO1A 4X0NA 3B9KB 3SJVE 1FFOA 3MGOB 3KPMA 1FH5L 3RWEB 3S7GA 2NR6C 1XIWC 2BVYA 5IF0A 4K3JH 4JY6A 2WCSA 3G9VA 4K94C 1QLFB 2Z1KA 4BH7A 1IM9A 3N1MC 1CBGA 1W1TA 5C0EA 5ITFB 4FTVA 4D0DA 1H9VA 2FSEA 4UDUB 1G01A 1A9BB 1A7NH 1Q1JL 4K23H 3A4WA 1RMFH 4PJ5D 4PG9B 3G5VB 4YHKL 2V7HB 4IRSD 3AMKA 1E5JA 3VI3F 1FFRA 2QEJA 3VFWA 3GK8H 1T0MB 3M17B 4HEME 3QXTA 3VFMA 5C8BB 1YN7B 4M7LT 1LP9F 4NNYB 2K7PA 5CBEA 2BNQE 3MQIA 3ZDYF 3OPZL 4JN2B 1YEIH 4PJEF 4R4FH 1K4DB 3QCUH 1JHLL 3QNYB 4PUDA 5IHBA 3AHYA 3D1MC 4D0CB 3L4YA 1OWQA 3HZYA 1SYSA 1KXHA 3DO3A 5A6LA 5GJTL 4LFHD 1KC5L 5F6HJ 3P0VH 3HPJB 1WF5A 4QHLA 4Z7WF 4QRRB 4XBGA 5ESQB 3OKNB 2UZIH 2YFOA 3K8KA 4ZS6D 2HJFB 2B1HH 4PJXB 4UDTB 1HYSC 2A3HA 2WMHA 4OQ1A 1BVZA 3FMGH 4ZQKB 5IBLC 3BUIA 4RE2A 1M1SA 3HC4H 1S3KH 2LFGA 2ZOKB 4HFWA 1GPFA 4KY1L 1U91B 3BQUA 3AIEA 12E8L 2IQAA 3GSRB 3CDCA 3ULVC 5AEAA 5IFJB 4OF3A 1VAHA 4JRYA 4GQ9H 4YO0B 4LX4A 4EE9A 3HTLX 1G7PB 1WFNA 3AXHA 1MCCA 5J8OA 3RVVC 5HBFA 4G9FD 5CPQA 3ULUH 1WAAF 1UKQA 4OGYL 2K9UA 3DYMA 2EYTB 5FDYA 3SCRA 1DBKL 3FO0L 4PLJC 1KB5B 2EO7A 5J6HB 2BCKA 4PJGF 5KN5B 3X12B 4H7VA 3CX2A 1UT9A 1YEHH 4ZUTA 3QEGH 4D3CH 3K2UL 3CMOH 1QVOB 5LXGL 5I1HL 2MHAA 5F7YC 5K9KA 1JAKA 4EIZC 1ORQA 4JZOA 3C8HA 3B8YA 5SWQB 1MCSA 2GKIA 1RULH 1E4WH 5ACZA 3DMMC 5D9OA 3ZJKA 3TFKD 3HNSH 3O6FB 3GSNB 2WKLA 5EO0A 1MCFA 2NY2D 4NNPL 3NH7H 1OHQA 1ZHBA 1NARA 3GSWB 1MW0A 4R0LB 3L1OH 3RILA 5DMIL 4GZEA 5BRZA 4TSBH 2B4CC 4YH6A 1QFWH 1EBPA 3SDCB 5JPNA 3E3QE 4AIOA 5HHPA 3S34L 1Q9WA 1U8OA 1YEKL 4M80A 4YHOL 3OGOE 5IT2H 4NX0A 1BYCA 3NIYA 1KCVL 4DN4H 2W62A 2D3LA 3MROB 3MLVH 1K5NA 3UZEA 1CLVA 3BWUC 5CGYC 4E41D 3BRGC 4PPTA 2H26A 4UV7L 4I1NB 4WCYH 4Y19A 1TPXC 3QDJA 2CIPA 5BVPH 1KCSL 4LRNH 2RHEA 1PGRB 2APFA 3BPCB 3JWDH 3LY6A 2MKWA 3WH5A 1I3RB 3DRQB 4C56B 1B88A 4J8RB 1ZEAH 1SZNA 2WW8A 4PJHE 4ACPA 3GHBH 1XIWA 2J8FA 5HHOA 4GAJL 3II1A 4DKEL 3UMTA 1A3RH 1R3IL 2EPOA 5JXAH 3N11A 5DJXB 5I15H 4EAMA 3K1DA 3KLAB 1B3VA 4GW4A 3RJDA 3O2WH 4ZS7L 5FB8B 2AK4D 4H1LG 5HPOA 4WWKC 4JZJC 5D93C 3WS3A 2OQJA 4H20L 3LRLA 1HIML 5EWIL 1I1FA 3D39D 5KOMC 1HNYA 2FEDD 4G7YL 2N56A 1QD0A 3BT2H 2JIXD 4HUNB 4NC0B 3WE6B 2EDBA 1Z5LA 3B9DA 4YHLH 4QCIA 3IANA 4CD6A 3IB4A 1NC2A 5T1LA 1IAKB 4HK3N 4O4YH 1CTNA 4IRJA 4AZIA 1U93B 1KFAL 3IFLH 4S1SL 5DQDL 1KIQA 2R0LL 4AT6A 3WFDL 4UQDA 4WTZA 4P8UA 1IBGL 4Q6IB 3H7BB 5FYKU 3C5JB 2OLDA 1UB6A 1N3NB 4HIJA 1BBDH 4LLAA 4PJDE 1I7UB 4XPGH 5J89A 4YDVA 2DMBA 4XTRD 5IJVB 5F96L 3BUPA 3SDAB 5DD0H 1XR9A 1HIZA 4Z2LA 2W63A 4GI9A 6A3HA 4PJFE 5E2TH 4MJIE 3EYFB 1WO2A 1M7DA 2YD7A 5DZNA 2HJKA 3RDTB 1BLNB 1RU9H 4FMFA 2CNCA 1GAFL 1HWWA 3ZKMC 1EIBA 4ZPTB 3W0KA 1EZVY 3ARED 3QUYD 3EFFA 5DSCB 1NEUA 1T1WA 2XVLA 3MJ6A 1XSIA 5SWZB 1U8HB 4GG6A 5F7MC 3G08B 1MFBL 4UQCA 1DDHA 3B2UC 2FJGB 5BQ7B 1D6EB 2ADFL 1S9YB 4M8VA 4Q0XH 2GDUA 3C2AL 4LVNC 3LEYH 3QG6B 1J0ZA 4Z0BL 3PWJA 1P7HL 3NABH 3WIIL 4D0BA 5FO7B 3MSGA 1KGXA 2XVNA 3KR3H 1NFIA 1I7TA 4AY1A 3H7LA 3QWRD 4F7MB 3NFPB 2FNBA 1G0DA 1JD9A 4JANA 3UTZA 4HUXB 4XGZA 1JGUL 4ORGA 4KH2A 1OIMA 4V1DB 5D71L 3MRNB 3UO1H 1BWWA 3DURA 1S7RA 5I0DA 5TGBB 3RWHB 3RMEA 1X5GA 4HMDA 4OIIL 5F88B 3SKOB 2PTTB 4FQLL 3DX8A 3FTGA 3DMMA 2F54B 5E5RB 1G6RA 4OUUB 4MNLA 4WHTB 3ES6A 4L4TB 2B1AH 2QSCH 2PYFB 1I3VA 4HULB 4CCCA 3DETC 1RPQA 4NJAH 1KF9B 3WFZA 2WMIB 5JZ7C 1EZVX 4XBEL 1KACB 3EYSH 5DRNB 4WUUA 3T77B 5C70A 5FUCE 1J88A 1U41A 1HSBA 1X44A 2XFYA 4NZCA 4YHPA 4M5YL 5B3NA 1UD2A 4ZTPL 3F6IA 1NOFA 1H49A 4JFOA 5A16A 3HE6B 1LO4L 3QDGB 4GW5A 1NCUA 4AIZA 4LLMA 1CXLA 1L7TL 3HUJF 5I75C 2C7FA 3DV6B 2DIJA 1P6AB 2AS5M 4LHUD 4FNLH 4S1DC 4WGWB 35C8L 1ZVSA 2H32B 1OF2B 2FIKA 1KPVA 2A6KB 5AC5A 1S5IL 4HJGB 3FL7A 4KPHH 2NXZD 3PHQB 2DLFH 4FFVC 2B31A 4LU5L 2VN4A 5LBSH 4LLDA 2AJYL 3UTSA 1E6RA 4KJWD 3KLKA 1GGBH 3EHBC 4ZSOE 3SGDI 3RZCD 2OCFD 2EH8L 4NYLB 1YPZF 1R34A 4XP4H 3QIWC 4EN3C 2PO6B 3BZFB 4WWKA 3QEQB 4JZJA 4QHUA 2BNRE 2J7EA 5TJWK 2OL3B 5DMGD 5H94B 1V02E 3TBWA 5T3XL 3O8XA 4LGSB 2BRRL 4U33A 1OW0C 4W87A 5TDPB 4WFEE 4JM2C 4WVRA 3UBXI 3RJYA 3EW3B 1V7ML 4UCFA 2DT2A 3BIKB 1IM3B 2EDXA 2WBJD 3O3AB 4GMSL 4PGDB 2DM2A 2WMJA 5D4QA 2BX5A 2KH2B 4NCC2 1FZMB 4M1DH 3W25A 2WCAA 1HHIA 3W29A 2E4TA 1LG1A 1UVQB 3WLBB 5BYWA 3IDMB 3VD7A 4UIKL 3BH4A 1R8LA 5DZLA 3BRFA 4PMXA 1LWHA 3EDDA 4OQTL 2D7TL 5DUBA 3TT1L 1JGVH 5D7LD 1KTRL 4NQDB 2F8VA 3GBNH 3VFVA 2H6PB 3P9WB 1C5DA 2OM5A 4F9LC 5FUZH 3W0WD 4GRMA 1KB9J 5EN2A 3KGRA 1XF1A 2P47B 5KANI 4F7EA 5ADPL 4GG8B 5DK0A 3AOFA 1TVPA 1JWSB 3L3GB 3ROOA 1E56A 5K9JH 1LE5A 4LPXA 5HI3D 2FJHB 2AJ3B 2WHLA 1K2DA 4W5UA 3HZVB 1N0XL 1ACYH 2E5EA 4C4KO 3TBYB 2CLZB 4MHHI 3BP5A 4UOW0 2HKHH 3RL2A 1DVFC 3HE7A 4NQXB 4CVXB 3H6JA 3KPQA 5CEYB 2DSUA 5C07D 4HBQA 3PP4L 2D22A 5C08B 3GMOA 1MPAL 1QSEB 1SEBA 3BSZL 3N0PB 3TBTB 1IAOA 3CFCH 5EBGA 3NN8B 4UILH 1HKIA 2E7LC 1NANI 5H37G 1E6ZA 3ZQ9A 5C0AD 3KYKH 1OD8A 5JBFA 2AI0L 5D2LF 4Z2IA 4KVNL 5FM8A 1F97A 4I3SL 4MCZB 2EE2A 3GJFK 5FO9B 4P23C 5CWSB 3DXAD 3VO0A 3NAAL 3VXSE 4MZ3A 4TVPE 3P0YL 3QIUB 4I0PD 3GXIA 5A6JA 3SO3C 1KLGA 3E8UL 4JFPB 1F2XK 3L5IA 2VLRD 1QSFA 1NFDE 1CEOA 1CDBA 3SURA 5JW3L 1KELL 1UXSA 4WI3A 1JDCA 3WD3A 2ZCHL 2PXYD 1Z0NA 5ACMA 1CFQA 2P24A 4LCWD 1JZ6A 1LP9B 1RUQL 4HCRH 1MCEA 2XWTB 5B38G 1JYVA 1M6OA 5IM7B 3KNBA 3LIZL 4KTEL 5T1KD 2AERT 3QRGL 1KBKA 5C09A 2DQEH 5F44A 1H3WM 4UZGA 3VFSA 2FLRT 1NEZB 4GXVL 1X4XA 3DX2A 1JPFA 4QHMA 2Q3AA 4YHZH 4KHXL 5GZOC 4ZNEA 4NHCH 1EHLH 3N18A 1V6UA 4Z7WB 3TO2A 4KDTC 3OB0H 5E6IB 2GK1A 5E1AB 1QG3A 3PL6C 2MQ0A 3EJJX 5GRYA 1VPOL 5DC9B 5EU4B 5JXED 4RMSA 4BELD 1FV1B 2A83B 3L6FA 3WCYA 4OCYH 2IH3B 1BZ7A 4MMZC 5EUKA 3LH2H 2Q7YA 4NZRH 1E6JL 3WUWA 3RI5K 1PQZB 2KZWA 3G5XB 3QIWA 4MD5A 4EN3A 4FQ2H 4C4KT 1FDLH 5HJ3B 2XVKA 4A3YA 5ENWA 2YKKA 3NDZA 3KLDA 1OW0A 2A1WL 2NY0B 4Q6YA 4MNKA 1VFAB 2CH8A 3ZM8A 1FRGH 4JM2A 4OZHE 4HA3A 1BFSA 3PHAA 4KK8C 3OKDA 2L7JA 4U2ZA 3NIGE 4IRZL 4C55A 1UOKA 5KSAC 2YRZA 5H35A 1T66D 5FM4A 2EZ0C 4CVUA 4PJGB 2OR9L 1LDSA 4XX1E 1B30A 4O2CA 3IXTA 2CKSA 2XI9A 1C3FA 3P9MA 1BQLH 5F3BA 4NWUH 3T3ME 4N8VA 2BZDA 4PRNB 5F7WC 1XF4A 4NFBA 5IB4A 2Q86B 4NBXB 4ONFH 3MFFA 2QLYA 1FZJB 4RCAA 1WWAX 4GLRI 4PJ8D 5DVNA 1Y6MR 3HB3C 3TZVD 5C6TH 4NSKA 4K8RL 4YFLI 1Q6EA 5GGQH 3ZHKA 4EANA 4P5KA 3CDFA 4XVUD 3MREA 4F9LA 4JPKH 3WEXB 1F90H 1FZOA 2J8HA 3MYZA 4OGXH 2GJ6D 4J28A 4BFEA 2YA1A 1ONQA 3U30C 3WUEA 3ARFB 4OCLC 3NGBB 4E0RA 1KCKA 1G5AA 2Z31D 1VADA 3UESA 2G4FA 3QCTH 2X9YA 2XZCL 5IQ7L 1FH9A 4IOIA 5CMAA 3F7VA 5F3HB 1HI6B 4M1CD 5JIPA 3MUY1 4LKCA 5D1XB 5FK9B 2XKSA 4X9HA 1SJVA 3QXDB 5I74C 3AHVA 2XPGA 3S3PA 1HJXA 2CUMA 2D0HA 2MCG1 1DVFA 1W3KA 5K9QI 1XSKA 2R2EB 3WKML 2CPUA 2ERJB 1HVQA 3PWPD 2GDVA 2FR4A 1VKXB 5EDXA 3O45A 5I8EA 1OQXA 5D96C 1LDPH 4HZAA 5ICXA 2Z4QB 1DEEA 2E7LA 5I8OL 1OGAE 1X9QA 4YIQB 3DVIA 3QT2A 3M45A 5BJTB 3FB7A 1CE1L 5CIPA 1HQ4A 2G75B 1IQWH 1EOMA 2VDRH 4P23A 1X5ZA 3KJ4B 2Y24A 5EZOL 4J1UB 2IAMC 4MXWL 3VJ6A 3F5LA 1SFSA 3G5ZA 5CD5C 2QMKA 4OZOA 4R8WL 3MRCB 1NWTA 3Q0HA 3QUXB 4TXEA 2RJMA 4MJ6A 3QFJA 5LAXB 5IVZA 2AABH 1FYTE 1JGDA 32C2B 3IU3A 1R3LB 4MA7L 2R29H 1UWGH 2VRQA 1KT2B 1MF2H 1IEAA 4Y2DA 4BQ6A 2GW5A 1O5DT 1MFVA 4YUEL 3MACH 2WK2A 3G6JB 5FHAL 3C08L 4GKOA 4TUOA 1V6XA 4PBGA 2W60A 5SV3A 3NCMA 2X4PB 3R1GL 3BGMB 5T3ZD 2DS4A 5FM5O 4GUPA 2X1XR 1QOKA 4PSRA 1JBJA 4YDLB 4FQHA 1PZ5A 3ZT7A 1LVEA 1OOAA 1DWAM 4MWFB 4ML4A 4KDTA 1BYBA 3SCOA 3LDBC 1LEIB 2ICWI 3PL6A 5SWSA 4NO2B 2BSTB 4NC2B 3HG1D 1UWXK 5HHVH 5GRXG 5IR1B 2EYRB 1EO5A 4JO2H 4MDJA 2QV2A 4CBPA 2W9EH 4HIXH 1CYGA 3GMPB 4JR9L 3U57A 1SVZA 4YBQD 3BIBX 3VILA 1BBJB 3GI9H 4JQIL 4M00A 4JFTA 3NZ8B 5CUSH 3MMDA 2Y6SC 3LN5B 4JO4L 3V2AR 1HJVA 5EC1A 5ISZA 2DQJH 4ELKB 1KR1A 2UWFA 4WIQA 1R5WA 2R0KL 3A6CL 3LKNA 2OP4H 3KYMA 5FUOH 3RWJA 3GXFA 3VWJC 4DEPB 2XTJD 2EKSB 3DX6B 2FLBT 1U3HD 2DI8A 4YHNA 1HHHA 3LQZA 1LF1A 2HJLB 4OQTA 3LQAC 4F57L 5TDOA 5I24A 3GYCA 2N4IA 4NNXB 5KSAA 2ED8A 2VRAA 5IG7A 2E6JA 5M03A 4K8RC 1WNOA 3G6DL 1X5XA 1W9BM 3QUMH 2GJRA 1DFBH 4ZD3H 1GNXA 1N5YH 3DBXA 1VFMA 1KWGA 2NXYC 3OMZA 3OTTA 2GFTA 3STBA 1AI1L 1F6AB 1JPSL 5FOBB 4FNSA 4FNRA 1H09A 3GJFH 4RMUA 3O2DL 4WHYH 5DHYA 1A7PH 4PJHF 4JRYE 4X8XA 3TYGH 1CD0A 4NDMA 5JOFA 4F7CB 1EJ6A 4GSDH 2ZIDA 3IVKB 5CQ1A 2PWDA 3EYOA 3VIKA 5JDSA 5A2AA 1KOAA 4LSTL 4G43B 4XP1H 3WFHB 4BK5A 4U3XA 4D3CL 5HYJD 1DWHM 1KJVA 1H0IA 1S7VB 4U1IB 3VM5A 9CGTA 3PQYD 3MJ9L 3WKZA 3A4AA 3HUJB 3NFSL 1FHLA 1RULL 2X4NB 4BQBA 3KYNA 5KSUA 3QGVA 3QIBC 4OCXH 1UB5B 4JKPH 1PX3A 3D9AL 3WMSA 5DRWB 1H3VA 4P2OC 5ITBH 4KJQD 1DANT 1KXTA 4PR5A 4R9HA 4B5EA 5IB5B 5GS0L 2CKRA 5DQ9A 5BRZE 4ACYA 3VFPA 2Q7NA 1P1ZB 4OLEA 1HH6B 4JFQA 4OTXH 5FYJU 4PJDF 4N5EC 1G7JB 2X70A 2DIBA 4D6HA 1R3JA 2QR0A 3AB0C 1P4BH 2IAMA 2J2ZA 4PJFF 4Z76B 1TQCB 4LSSH 1YPZB 1QI0A 3CUIA 3KPSA 4X99B 2A6JB 3HMXA 5DTFA 3MKKA 2UY7A 3BMVA 1UKOA 4UR9A 4I18C 5A3HA 1R3HA 1J1OL 2RCSL 3H3BC 4JJ5A 4NN6B 1AR1D 4Y19E 3X14B 4CL7A 3QDJE 2YL6A 1A21A 2ZX8A 4APQD 4CMHB 4BA0A 2EKJA 4O51A 3KJ6L 2B7DT 3SGDH 1TMCB 3IDGB 3F5WB 3S6CA 2FGLA 4P2RB 3O11B 2Y4SA 1OP3K 3FKUS 1W1PA 1FVCA 5F1IA 1LJYA 2GSIB 4ZFFB 1SBBA 1J9YA 4JZNB 2WAHA 3QULA 1NAKL 5E00B 3GHBL 5HHOE 1JNHA 1E27B 4MXVE 4JFFB 5JPMB 3NOIA 5BZWA 4F33A 3GO1L 4RAVA 2WHJA 4ODVL 1MHPL 2EH7H 2ZOLB 4FNUA 4WJ5B 1NLBL 1BEYH 1BVKA 5J1AA 5LQBL 1NGYA 2D03H 3BI9X 2ZXAA 5D70L 4MX7A 4X7SH 3AHTA 2KPNA 1H0DA 4Q9QL 2MQ3A 1DSFL 4P59L 3GNOA 1SEQL 3ZDXF 2OX5A 3MV9A 1MXGA 3C60A 3IFOB 2DYPA 4HDIB 5IVXA 4LLWA 4JKKA 3SKJH 5MEOA 1RUMH 3T1FB 3QI9D 4LPVA 4D9RE 2DT0A 3OGVA 2E9JA 1U2CA 4TYUA 3DHUA 3RIFF 2Z8WC 5D7JD 5JHDA 4PJ7B 1F13A 5DD5H 3SE8H 3CFJA 4JL2A 1I1XA 3AISA 4LNRA 3CHFA 3D2UD 1CENA 4LYRA 4G9DB 2XSAA 4H88H 4DTGH 5J6GB 4ZFMA 3R4DA 5I19H 4I13B 3POHA 4YC2C 1EEZA 1ZLUH 1EA9C 5CP7B 4U6VH 3S35X 5IOPA 1AHWA 2APTA 4UFHA 2DJUA 3WD5H 2XNAB 3OXSA 1FNEB 1YEJH 3CU7A 4YHEA 4L1DA 3CXDH 4GG6E 1I1AC 4JFDD 4UB0H 3ULUC 5EO1B 1JIBA 4R26H 3SE4C 3UTTD 3B9VA 4QEGA 4RGNE 1WISA 1HQRB 5IW1A 1IGIH 3BP7B 5JW5B 1UZ6E 3DGCR 1KB5L 2C8NA 3L4VA 5J06A 3QJHA 3WQ6A 3NABL 3WIJA 1T80A 3UCQA 1N5AB 4AEIL 1CE6B 2FX8H 4XNMA 5F7DB 1AIFA 1I3GL 3VOCA 4J3UA 1VCAA 2WCGA 3ZT6A 4H41A 3FO9B 1ZT1B 5E2JA 1RIUL 5HI4C 5JUEL 5EOTB 2MNUA 1NWUA 4I77L 4PJBF 5IBTH 4ISVA 5DRZA 4HQQH 1E9LA 4P0DA 1OGTA 1CR9H 4RA3A 5GS0C 2V2TA 4QHKI 3VXMB 3LB6C 1CBVL 3KXFA 5ABFA 3LD8C 3V7AG 4GKSA 4ODUB 3MRJA 3QIBA 3ARTA 2ICWJ 1ULVA 4TNWF 1ZWIA 3GSOB 4P2OA 1M7IA 4UFKA 1U8IB 4L4VB 2IAND 3CK0L 4DN3L 4WK9A 3GSQB 4XPFL 4P5MB 4XP6L 5I1GH 1CLYH 3CSGA 2Z8VC 5JOEA 1U8QB 3OLDA 2GK0B 4KRNA 4WUUE 3BOVA 3OLGA 3IJSB 2G5BB 3D0VA 2GJXB 3WJLC 3U6RA 2P5WA 4M3JA 1YNLH 2FECL 3EJYC 3PP3K 5MHSD 1UWIA 2HMIC 1UCBL 3T4YA 1NCAL 1A7RL 4PJ9B 1UQZA 2UY3A 1NLDH 3T0ED 4MNMA 1DWJM 3QA3B 1HZHH 4N0CD 2VLME 2OYKA 4IDJH 3RBGA 2XJ7A 4U1LB 2Z35B 3I6KB 4DGIH 1BQHG 3QXVA 3NCJL 1CNVA 4TSAL 4C83A 3KDMA 4GRWH 4G6FB 2NY7L 4CU6A 1HNFA 1S7XA 4YR6B 4ZOBA 4KTYA 3NTCH 3IKCA 2NNAB 4P3DA 3OQ3B 1KNOA 2CLVA 5IHUH 1N8ZB 3JTSA 3A0OA 4DW2H 4NFCA 1UWSA 3B5TA 3UTSE 1QFPA 1EFXA 3MNWA 4M1RA 4BM7A 3AS0A 2A9ML 2VIRA 1BECA 2VVSA 4GO6B 3X11B 4AMKH 4OFKA 4PLKC 1P2CB 3SJVB 2W0FA 3WD2A 1JUFA 5D1ZB 3MODL 5F7FA 2CDEA 2ITDB 1BOGA 3WSQH 2EDOA 1PDKA 2J4WH 4WFHD 4K3DH 3N15A 3CDGB 3C5SB 2IC2A 4FZ8L 4DUXA 1LG2A 2C1OB 4P4KD 3WN6A 2W66A 1IGJA 3BZEB 1F3DJ 3R06A 4GLRH 4YAQB 4FNPA 1HP5A 1JCKA 2DQIH 1J11A 1FL6B 5D7IA 4WY7H 2G3MA 3DVFA 1D2KA 4L5FH 5HGHA 4J2XA 4OFIA 4WU5A 3GH5A 3IDYC 4LYQA 3L2MA 2E8YA 4GW1A 1U33A 4FK9A 2YD4A 1C7TA 1TLKA 1FL3B 1OAUL 2ESVD 3OKLB 1ZHLB 3CVHB 1QWUA 2G41A 1FBIL 2XGBA 2HWZH 4RQQB 3BLKA 5I1AA 2FYYA 5DUML 5C0GB 1QPKA 1KGCE 2GJZA 5ALCH 2HA1A 3WYRA 1NCWL 5EUOA 2NY6D 3O2DA 2R4SL 1L7IH 1BPVA 1GZPA 3AMCA 4J6RL 2IBGA 3D85B 4ZUWA 3M7SA 1LEGA 1CWYA 2FL5A 4TOYH 4X80L 2C4FT 3EBAA 1R5IB 2V5CA 2QSTA 3MXWL 1RJLA 3WKNA 1NBVH 4HWZB 4LLVB 3DJ9A 1PKQA 3THCA 3SE4A 4XB7A 2VDOL 4DQOH 4HC1L 4NRYA 1QX1A 3WN5B 4HOXA 3CIVA 5IW6B 2YL8A 4R7NA 3HLAB 4RGMB 1MCWW 3VWKD 2CIKB 1XZ0B 1X6LA 2YRLA 3O6FC 4HW6A 3P73B 2X2YA 2CESA 1MCKA 1A02N 2Y7QB 1Q9LB 4R0LC 4KRMB 5C0CD 3MJ9A 1KPUA 1EXPA 3VXOB 5LKNA 3SDCC 4PJAF 1VEPA 1J0KA 4HKJB 1HOCA 4OZHF 4NQSB 1YNTB 3NIGF 2IBZX 1VFOA 4PLOB 4CNIB 4MAYD 3QEUA 1AQDB 2P5ED 5HDQL 2I9TB 5GHWH 3FFCE 1W8OA 3C6LA 3RA7L 4P8XA 1A6UH 5HGAA 1EX0A 1S7UA 1FFNA 3T3MF 1QSFE 1I3UA 5E8EB 5FYLE 3L95B 2YMXH 2EO9A 2ENSA 1DBAH 4Y4FB 1ZLWH 1EGJH 3MJ7A 4CU8A 3I6LE 3SQOL 2DJ4A 1MCWM 2FHFA 4LF3A 2VUYA 1NC4A 4XPBL 2QJDA 1PLGH 4XC3H 3WJLA 3VXUA 1PZ3A 3RTQC 4JFFD 4MA8H 1R0AL 4AMXA 2F61A 4TSCL 5FYKD 5C09E 3VFTB 1T04B 1RJYB 1SMAA 3LEVH 3N9KA 1RFDH 4BFIA 1TFVA 4AL8H 1CLZH 1F02I 3CUHA 1MRCL 4LASH 4EDWL 1HF6A 1PEZA 3TPKA 4DKFH 5ITFA 4ZNEE 4OAWB 1F4YH 3DTXA 1A9BA 1GOQA 5DJYB 1EGZA 3ULSB 2X4OB 3MUZ1 1F6FB 3GKWL 2X4SB 1T0MA 4WW2F 4XC1L 3EGSB 5GRVK 3RVUD 2GTWA 3HZ3A 5J1TC 3WIHL 2IFFH 4ZXBD 1G9MH 2AV1B 1YJDH 2FGWL 1JTTA 3ZTNH 1K4DA 3APGA 3QNYA 5IKCA 4G8IA 5KVFH 3GMQB 3A6BL 1RZ7H 2R0ZL 4FG6D 2OWCA 2J88H 3E6FA 3OAYH 2IALB 5F9DC 3F6LA 1Q0YH 3OGCB 4PJHB 3WL1A 5I1CH 3MLRH 4MB1A 4HUVB 5E70A 2JE8A 3OKMB 5KVGH 4WV1C 4B7LA 4NRRA 1RK1A 2HH0L 3LS4H 3SDAC 3HPJA 4P7QA 4NZTL 3PWVA 4QRRA 2A0LD 5EBMA 3MR9B 3FN0H 3OKNA 2OK0H 2BVOA 1P4IL 2YRPA 3VMNA 3D69A 5DFAA 4YWGL 3WEOA 1REIA 4PJXA 1TCRB 3PV7A 4WFGD 1INQB 3MFGB 3QUZB 1MJ8H 3O9WB 4PMOA 4QHKJ 3SCMB 2J7HA 5FD0A 4QXUL 2NTSP 4XPTL 5A3ID 5I73C 1IC4L 1U91A 1F4WH 4NPYB 3OA5A 3U0WH 5INCB 2YZ8A 3O6KL 2ZWYA 1BYAA 5DD1L 1KENL 3CXHK 3RVWD 4BJLA 4UZSA 3WH8A 3MLWH 5IFJA 4EOWH 1YMHB 4YO0A 1DBJH 3ALGA 3HA0A 5C71A 3EO0A 5C6TL 4ETQB 3CZGA 1A6TB 4HMEA 3BGFB 1F90L 1S7QA 3AS3A 4P8VA 1FZKB 4PJDB 2EYTA 3ILQC 4DO4A 1BGXL 3D3VA 5MEQB 1QQDA 3GMLB 1PBYA 5D7KD 4XNZB 4PJFB 3X12A 4MJIB 2WSPA 3WD1A 1FNLA 1GGCL 2Y36L 3TCLA 2EXWC 2AAVA 4QLJA 5GSVA 3Q6FB 1LD9B 4CMMB 1MCOL 3HG4A 4XCYA 3LRSB 3P4OB 1GVIA 4R7DB 3T4AB 5KJRH 2DKMA 1KTDA 4QXGH 4M5ZH 1E6PA 1FPTH 2DWEA 3GSWA 2J8GA 1G7QB 3RVXD 1WAWA 4U31A 4F66A 5JBEA 3VW3L 1J01A 4Y16D 5I30L 2JIEA 3SDCA 4XHQA 5I66B 2IEPA 3BFOA 1MEXL 1T1ZB 3OR6B 5IMKB 1KCRH 1LMKA 1P4LB 4I9WE 1V6VA 4OKDA 1SMOA 3WFEH 5FO8A 3RAJH 1MUJB 4XWOC 1YEFH 3AIUA 4H1LH 4YHML 1T7ZA 2X8RA 3UDWC 3CZEA 1XAUA 5D7SL 4WHDA 3T0DA 3VH8G 3QHZL 1IE5A 1AQKL 3QFJE 1MQKL 2VAAB 2WAGA 3MLXH 3KZSA 2ZUNA 2JF6A 3B3IB 5HYSA 1I4FA 3QOMA 1EBAA 4Z7VB 3Q1SH 4OZFB 3TNMB 3VGDA 2FEEI 3RTQA 2B2XH 4QY8A 4I8DA 2DLGA 2P46B 2XWJA 1WQVT 3EO1A 1ODAA 3AU1B 3KLAA 1WIPA 2BHYA 4L4PA 3ISWA 4OM1L 3RGVD 4MQSB 1WWCA 4L3AA 2WINB 4ZOAA 1SHMA 3VFOB 1IT9H 2IG2H 1CICC 5EU3A 1KTLA 1OB1B 4E8DA 5FKYA 4KI1A 4AK1A 4XRCB 4B50A 3N9GL 3MRHA 1DUZB 3V4PH 5SWSE 3NACH 4Y1AA 1MAMH 3KPTA 1QNZH 1W2PA 1QR1A 3RVTD 5T3XE 3MV01 4ZUSA 1CDJA 5D8ZA 1BPLB 1INEH 1I9RH 1U93A 4MA3A 3DO7B 4CCDA 4NQEA 3DX4A 1Q9KA 1SY6L 2Y5TB 5EMYA 2BNQD 1T20B 5ISZE 2W1NA 3X3FL 3C5JA 4F8TA 3F7PC 1N3NA 1BD2D 1JNNH 1JFQL 5KSBA 3P3YA 2CKBB 3UAJC 4WV1A 4N8CL 2R2BA 5IJVA 2VDQH 2WNGA 3SDAA 4X7DC 1MVYA 2GFBB 3EYFA 3T2QA 1QNQA 1ZA3B 5E8OB 2V2WB 1I8IB 1Z0MA 2J6EL 1OVZA 3PGCB 2AXJA 2BNRB 3RKPA 1OCWH 4CD4A 5IESH 1GSMA 4KZEH 4MSWA 3MRKB 3IJ7A 2DN7A 3VG0L 4U0RC 3GSNH 5DSCA 3PBGA 1IKNA 2ZKHH 4UBDC 4C7FA 1J87A 3QUML 4QDMA 5BS0B 4MNQA 4N0FB 1NOUA 1D6EA 4WSJA 1MFAL 3K4AA 2WC3A 3BKMH 3NCYP 4ERSH 1LWJA 2QBWA 2VX7A 1DE4B 1MJ7H 1WIOA 4X5LA 4KUZH 2NTFB 2APVA 2FD6H 1MCJA 4MXVF 4Z78B 1R33A 3F4VA 3MSPA 3EYQC 3KPNB 4PJCA 1MFDH 4HUXA 4D6GA 1W2VA 4N1EA 3IJYA 5D1QC 3HNTL 1DEDA 1ZHKA 3MRNA 4N0UB 4BKLA 5L0QB 4IPLA 1NCBH 4P2QD 3SKNA 2VDPH 4FABL 5TGBA 4L9LB 3L5HA 2R0WL 3GMMA 3KPPB 5F88A 4AEHL 3GZKA 3SKOA 4X5XB 3HRZB 4RL3A 3QIUC 3FT3B 2F54A 1SBSL 4OUUA 3L4XA 4OOZA 2BXYA 4WHTA 4L4TA 4L8BB 1L6XA 5E56A 5HYFA 3NA9L 3U1SH 3UZVB 1CDCA 2JJSC 4KKAC 3HI1B 1HT6A 1FG9C 1EXUB 3DWTA 4RFEA 3ARWA 3GH7A 4XH2A 2QMJA 1N6QL 2W9DH 2DQDL 4FOMA 1S9XA 5I1JL 5L2JB 2GCYA 5AZ2H 3EO9H 3NYDA 1MWAB 2MSPA 5A94A 1E6XM 1KWKA 1UYQA 4BF7A 1RJZA 3UDWA 3KPSE 4L29B 1NSNH 3QDGA 2PYEA 3MA9L 4FQXB 5I1EL 1QBMH 5F7HA 6TAAA 4XX6A 2EDNA 1TA3B 5DJAB 1DN2A 3L3IB 5I1LB 3NZHH 4LPTA 4Q9BA 1GYAA 4QYOA 3VXSB 5IV2A 2AJSL 3AS1A 3DSFL 3O2VL 4K7PY 4O58H 4HF5H 2MTPA 3SE3A 2YJQA 3P9LB 2EADA 2VH5H 3DX0A 1UR1A 4GG6F 5E6IC 1RH9A 2Z93A 3BUYA 4LSVH 1XV8A 4Q2ZB 5CHNB 3WDPP 1ZANH 3ULVF 1NFDB 4NKIH 4NOBA 1YC7A 3FQXB 1U8NB 2XWBB 4HUUA 4O2FB 4Y4HD 1UZ6F 5E9DD 3SBWC 1OAQL 1W9DM 4QOKB 1JF1B 1GC1H 5F93C 1TQWA 1GHFH 5L6YH 4I48B 4NYLA 4NM4L 3KPRD 1U36A 1ED3B 3IU4L 3QEQA 2F53D 4ZUVB 1Z9OA 1FN4B 1CICA 4HP5A 4DK3A 3BCFA 1OARH 4M9OA 2JALA 3TVMB 5FCUL 2YBRA 1OTUD 2NY0C 4MJ5B 1MLCB 5A43C 3MCG1 4S1RH 2EDRA 2F5BL 4FP8H 2PW1B 2D03L 4OZ4A 1H3GA 1IM3A 2ENYA 4X7SL 3FONB 5SX5K 4OUOA 2OLHA 5ICZA 2FIRT 3ZKXB 1QP1A 2C1PB 1U8KB 3M6DA 1UJ3B 1WZAA 1I1YA 1I7RA 1YNKL 4NUGH 3WDHA 1A47A 5IVXE 1NP2A 3LV3B 4AWEA 2V17L 1TZGL 4YK4B 5I18H 2BMKB 2ITCB 1XF2A 3BMWA 2Y23A 1QPXA 1FJ1B 5JHDE 1OWRM 4NQDA 1V3KA 2CBUA 2VABB 4YNYB 1QYGL 4KQ3H 2H6PA 3PHOB 5DRXB 5H37H 4YXHH 4LHJB 3AICA 1S7SB 3ARSA 3AC0A 1HILA 3ARFC 4ZFZA 3NGBC 1JXJA 2DIAA 5EZJA 2MJWA 3TWCH 1D9KC 2HKFH 1X5YA 7CGTA 3W6LA 4LRIC 3UR7A 1OT1A 4OFDA 1GJIA 3CIQA 4TOQA 1A7QH 1QLRA 4P2YA 2GJPA 2CLZA 1CVRA 5HGBA 1Z32X 4TNVF 5DT1L 1NUDA 2X4QB 4U1HB 1VEOA 3VA2C 3KHOA 1C5CL 3BVNB 4OM0H 5BVJB 5C08A 4FFZH 1QSEA 5LWYL 1B3JA 1CDGA 3L3DB 7TAAA 25C8L 2QLVB 4D9LH 3EDKA 1HNGA 1IAMA 2XRAL 1M03A 4XXDB 4J4PC 3FRPA 1EQCA 5D9MA 4FFYL 5D1QA 4OZIB 4LYPA 4HH8A 5KVDH 2E3ZA 15C8L 4LKXB 2QHRL 2X44D 4MCZA 4ODWB 1TZHB 4HJ0C 2Y8KA 5KVEH 4NN5B 3LZFH 5CWSA 2MCPH 3KJ4C 4ZE4A 2L4OA 3VXRA 3WXWH 4CUCA 3BEWB 4NZJA 4J3WA 3A67H 3K80A 3KXFE 5JW4M 4JFZL 3ZKQD 5IWLC 4HU0A 4RWYH 2AJUH 1EO7A 3QUXC 1UACH 2BVPB 4U6TA 2ZUQB 1H11A 2DDQL 2I9LB 5MEPB 4NQVB 4LSQH 3BSHA 3V5DB 4NZUL 1AFVL 3CLEL 1OT2A 2JJSA 4WDIA 3H3PH 4JFHD 1P69B 3ARBB 4MDOA 4U6YB 2VXQL 1HJQA 1CDYA 3BKJH 4HS3B 5DFTA 5T3ZH 5I1GL 3RM9A 5EZLA 3OKKB 2OL3H 4WIWA 4DGYH 5GISH 1AKJD 3Q3GB 1CFVL 1OGAB 5HHXL 2P5WE 2ZNWA 3OIHA 1MRDL 4UAOB 1UD5A 1I85C 1A22B 2D73A 3BAJA 1JHKL 1WC7B 2GIYA 4Z8FH 4RFNC 3CCHB 4ODSL 4A6YB 1IC7H 5CXPA 4NWTL 1P7QD 3MV7A 1IC1A 1DQLL 5HYQA 2Y8VA 3UYOD 3GSVA 3U83A 4MQTB 1YMMD 2QQKL 1FHGA 3LKRB 3TA3B 4N1HB 1D5IH 4OD1L 4LSPH 5GPRA 1XCXA 2DDXA 1B31A 1KLFA 3VFRB 1C1EL 2DSVA 2HTLD 3MMUA 1FV1A 2A83A 1JMXA 3OR7B 3QFDA 4U5KA 3EJTA 1KCUL 1JPTL 5E99H 1K8IA 2IH3A 3LSOA 3A4XA 1F4AA 3X13B 2XIDA 3MCKA 3TNNA 2X0HA 3BPNB 1FYTB 3SBWA 2R9HC 4XBPB 3SCUA 1CGTA 1IGFL 4AD2A 4AZ8A 4ENEC 2D1ZA 3BH8A 1XFPA 3D25A 3MLTB 4W86A 1SJEB 1UXWB 5HJ3A 4HIHB 3FO1B 4LP5A 1X7QB 3BD5A 1AC0A 1AD0A 1FFOB 5GZND 4DEPC 1SY6A 2F8XC 2PNDA 4NSBA 3SDYH 3H2WA 5E5MA 5M94B 1WBYA 4G8GE 1P5VA 4WTWA 5IF0B 2YKLL 4JY6B 3V52L 4HT1L 1JXKA 2EPNA 5KS9E 1IM9B 2GT9A 4D0DB 3U7AA 3MV8D 3U2SA 5I6XB 3QDMD 2FSEB 4FQQA 2WM0A 2XGIA 2AXHA 1VJSA 2QQQA 1V7NL 5ANMB 3EJSA 5D7IE 1VF8A 4FQCH 2QV4A 2LAAA 2LU7A 3SUVA 2FX9L 3VFWB 2DICA 3T0VA 3QWQB 4OF5A 1WWWX 4JAWA 5CBEB 3D0LA 5F1SA 3OF6A 2RGMA 3TH4T 3C8KB 5HYEA 4KRUA 4KK9C 3QUMA 3QUKA 3I2CL 1WFUA 3UYPA 4PRHA 4F37F 3BCDA 4W7WA 5C3LD 2A6IA 5L8JB 3KVQA 3HZYB 3PDDA 5FYJD 1NWRA 5EUOE 2APBA 3L7EA 1D9KA 1F8TH 3GJFA 1MCPH 4QRTA 3CZSA 4XX1G 2XACC 3OGRA 1J10A 3CUPA 4WJXA 3QXDA 5L2KD 3CUFA 4XBGB 3U5YA 1CFTA 3TEUA 2IQ9H 3RZWA 2OBGA 3SOBL 3ULUE 1PKQE 1CGSL 2R2EA 3BWAA 2ZX9A 2JEPA 3W9DB 1VKXA 2MQCA 4LAQH 4AZCA 4PGZA 1UZ1A 1WV7T 2CMRL 4Z0XA 2Z4QA 3UJIH 4HFWB 4NQCA 3VSUA 4YIQA 1ISYA 5KG9A 3PZNA 1X5HA 3BQUB 5BJTA 2IQAB 3S8WA 4HPHA 1JYXA 4UNIA 4JRYB 1MIEH 2D4FA 2WWMD 3S4SG 4ATWA 3IAPA 2VXUH 3CNKA 1T4KA 5M3WA 1U9KA 2V3GA 2E7CA 4JM2F 2XZQL 2ATKB 3NIFE 4OLYH 3D51A 1R6VA 2X4RA 4MAUL 3L3KA 2D7PA 2DQGH 2MMXA 5IWLA 3GGWB 3B8SA 3IAGC 3AHXA 4YPGA 2BCKB 1H3PL 4TVPD 2J8OA 1H8NA 4M3KB 4AYSA 4ZUTB 3EOYG 1MRFH 4RRPA 4U1SA 4NN6C 32C2A 4KK6D 1CLOL 4W4OC 3BAXA 5A6MA 1S9WA 2XQYK 1T0PB 5HBBA 5K9KB 3VX1A 1ORQB 4JZOB 4NCC1 5ACZB 2VLJB 3G6JA 3GXMA 4FQPA 1T22A 1ZHBB 3VXUE 5DQJB 4XC3L 5TE4H 3WFBH 4HTYA 3NCEB 3AJ7A 5E2UL 5BRZB 1X4YA 1K8DA 1CZ8L 3FOMB 1MAKA 3PWLA 1IT0A 2OXHA 5HHPB 5F1NA 1C5BL 3DOSA 1WBXA 3E2HB 4FMVA 4AL8L 1U8OB 2OTPA 3RJXA 4XWGL 4X4MA 4S0TD 1FNGA 4R96B 3WO3B 5IFAH 4G7VH 4ONHA 4DKFL 4RWHA 1JWMA 3M07A 1NQBA 1Q38A 3D18A 4NO2A 1K5NB 2Z0BA 3RU8L 1MI5D 3HZKA 3UBXA 3EDJA 2BSTA 4POYA 5MENE 1ZB5A 3CZFA 4FMKA 1CDHA 1UADC 4GBXB 2BFVL 1A1MB 1WZKA 1XF5B 2YZ1A 1BBJA 1NOWA 1FCCA 3WNMA 5CJ8A 4Q7NA 2DWDB 4BA8A 1RZKL 3O0RL 4HWBH 2BSSB 2KDGA 2F7QA 3IDXH 2G5RA 4N9OB 3P30H 1B3XA 4K3EL 4MYWB 5HHOB 2ZG1A 3MLRL 1ZS2A 5BXPA 1IAIH 2HJLA 4QRRE 4GW4B 5GRZA 4BSJA 2RB8A 5CLTA 2OK0L 4P9HL 1J8HB 4PJXE 4U7MA 2OQJB 4MDIA 4NO0B 1I1FB 5T33H 1J1XH 1QFOA 4KAQH 4EBQH 2R4RH 1Z5LB 4PRIE 4QCIB 1F6AA 4M6OL 5FGBC 1AR2A 1NC2B 3DX3A 2UY5A 4IRJB 3MLSH 3DUHA 4MGXA 1PY9A 1C91A 5BROA 1FNSL 4Z95H 1KIQB 4GXUN 2DQHH 3T8XA 1I7ZB 4HXAH 4KKBD 4AT6B 4AXNA 5I78A 2JELL 2F58L 4Y8DC 1MNUL 5B21A 1XHGA 3TFKC 1UHVA 4HIJB 2QQNH 2ZUYA 5HHMB 4QWWD 3QQ9C 5GNXA 3IVKA 3D3VE 4YDVB 3PWUA 1XR9B 4Q58C 4CW1A 1M7DB 4HA4A 1C12A 1P6WA 2EDKA 1HSAA 2HJKB 3WFHA 1E4XI 1NGWB 1A6WH 4FQJH 1OM3L 4P46D 3P4NA 4FHBD 4UFJA 2UUDK 2D0FA 1T1WB 3HI6L 5TQ0H 1LNUA 3S5LA 2I26N 1DDHB 1HWGB 1JRHI 3BH9A 2XY2A 5DJDA 2GYSA 4QTIL 2EABA 4RGNB 5I8KH 1B4JL 3PWJB 2ZUSA 4Y5XC 4QLKA 2UVEA 4QRPD 3ZT5A 1INDL 3A21A 2NY1D 4XAWH 2PCPA 3TTQA 4D0BB 1A0QH 2X10A 2DTMH 1NFIB 1I7TB 1YQVL 4OLXH 1BJ8A 5EB8A 4JANB 3UTZB 4XGZB 4Q22A 2YPVH 4ORGB 2L0DA 3MOBH 4JDTH 1JFXA 3HPLA 4PGJA 3MGTA 2F19L 4WKAA 3OAUL 4K9EL 4RIRB 2Q8BL 5MP6H 2VXTH 2XA8L 4W4OA 3DURB 2LVCA 1GXEA 2I60L 2HAZA 1JFHA 1WFTA 2Z8RA 5GJSL 3WQ8A 2X2HA 3AYRA 3DX8B 5JQHC 1NUGA 3FTGB 4JPWL 1GH7A 3F5WA 5EPMA 3BC9A 3WUFA 3E0GA 1DN0B 3DRTA 5GGTL 1JPST 3ES6B 4X4XB 3BDYH 4XPAH 3JWOH 1AP2B 2DD8L 3NPSB 2GTZA 1QFHA 2ZJSL 4AM0A 4KZDH 1GOKA 2B2XL 1AO7B 5JPMA 4Z2KA 1EH9A 2VTFA 4JFED 5DWUL 4WUUB 2EDFA 5FGRA 3GNPA 3JV0A 1HSBB 1H15A 1IGTB 1W0WB 2PKDA 5DT5A 2ZOLA 1FYHB 1LO3H 4XMKL 5BZDB 1IARB 1MFEH 1ZT7A 1MJJB 5D1ZC 2FHBA 4JFOB 1T2QH 2NY4B 2ZWZA 1BQUA 4FTVD 4Y1AE 2A74B 3S36L 1A6ZA 2V5TA 1TPXB 2VLLB 5DJCB 5HPMB 5EORL 4LLMB 4ONGH 3TCXA 1L9MA 3RHWF 4HDIA 1CF8H 1CXHA 2OXGA 4JL1A 4NQEE 5D8JH 1ZVSB 1WEJL 1O7AA 5I1IL 2FIKB 4GH7B 1KPVB 3AREC 3QUYC 5DO2D 3T1FA 2O5YL 1JNLL 5JR1L 2F74A 1PD6A 3DV4B 4U6XA 1QW8A 3QEHB 2D20A 1V6YA 5KSBE 2F7PA 4LLDB 3TV3H 3UTSB 1MW3A 4QF1A 2OW7A 3ECBA 4W89A 5DD6B 5H8DA 3LEXA 3DUUA 2HLFD 4HPOL 4WWKB 4JZJB 3VIFA 4QHUB 4G9FA 2YC1B 3TBWB 3WJJA 1AC6A 3O8XB 5CP7A 4OCSH 1IEHA 4UMGA 1KPRB 2X89A 2XNAA 1CECA 1FNEA 2AK1L 4OF0A 4HHAB 2FB4L 1DUYA 1ADQL 3FNDA 1N7ML 4MCYA 2YWZA 4MNQE 5FGBA 4MNGB 4YX2L 1ESWA 1VSCA 1YECL 4WTZG 3T0AA 4YDKH 1VGEL 4PBXA 3DUSA 3HMWL 2VZTA 4OJYA 4RGMC 3PTKA 4K3GA 4HJJH 4W8BA 1CDUA 1GGIH 3U4BL 4M6MH 2FD6L 1B90A 4S1QH 4M7LH 4U1KB 3EYUH 4D6JA 1J0HA 1CE6A 4PJCE 5DUBB 2EXYC 1IGML 2VX4A 4WSKA 1FAIL 3FO9A 1ZT1A 4QRUA 5IJKC 4MADA 1T6WA 1RK0A 4UTAH 4LQFH 2WB5A 2R39A 4K2UH 4GRMB 4HPYH 4KQ4L 2F9BT 5EN2B 3GXPA 4E2OA 3OGSA 4F7EB 1ZTXL 2O61B 1KN4L 5DK0B 5E2WL 1GW1A 1NCNA 3TA9A 2F54E 1BLIA 3QH3A 2WBGA 3ROOB 4OCWL 1LE5B 1FSKC 4UZUA 5L7XH 1FP8A 2FX7H 4L4TE 4LVOC 4Y4KD 2P44B 1ZGLM 1GGTA 4WEUD 5IVXF 1UWQA 4D1JA 3BP5B 2EYSB 4L4VA 3RL2B 2XTLA 3HE7B 1UD3A 3WQVA 3KPQB 3ARZA 4Y5XA 1U8QA 4K9EC 5I76A 4PGBA 5FYKH 1CXIA 1SEBB 3ETBF 1RUKH 1RHHA 3ZIZA 1VESA 4FQIL 2H1PH 1WP6A 3O81A 3IF1A 2NXZC 3EO9L 4UT9L 3ARUA 5DLML 1QI3A 1WTGT 1XGUA 3E3QC 3QDGE 5GRVL 2PYEE 3PDOA 4JN1L 4KJWC 4M48L 3W27A 2VZSA 3I6KA 4W81A 1QBLL 1CG9B 3RPIB 2BERA 3RZCC 1A14H 3GMRA 5DD3H 1RP8A 4IOSD 5FHBL 5A2LH 3HI5L 4TX6A 2AK4A 4R4BB 2ZXBA 4DWSB 2ICWA 3FN9A 3D39A 3MNVB 4Y19D