1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
3FB5B 3PUCA 2FL5B 4PLNC 2E7BA 1IGMH 4GRLB 2DB8A 5HVHB 2FE0A 3RZWA 1EHLL 5CJ8A 3BXNA 3U82B 2EYRA 4JO2L 2D9QB 4GRWH 4BH7A 1W9VA 3A6BH 3VXTA 3QCUH 4DK3A 3MNVA 2C8NA 4OV5A 5E94A 2JFEX 4Z5RB 1V3HA 3JWOC 4XTRC 4LLYB 3QXDB 4P3WA 1R46A 2EDNA 3DC0A 2R4RL 3P40A 3O45B 3WUEA 4FQCL 3MSDA 4CGTA 4XXCC 3BGAA 2WMFA 5C0BB 1CBGA 3QEGH 2GITA 2D73A 2E9IA 2EH7L 3T08A 3QRGH 2A9MH 4P9HL 3SGKC 5L7XH 3VH8G 1R3KA 4GRWB 5I71C 1QQDA 4OZIB 2AEPL 2CLRA 3BD3A 4J6RL 3L2LA 4G8IA 4U33A 1FL6A 5AZEL 1W1PA 2WCAA 4FA8A 1GHFH 3KDMA 3AMLA 4P5KA 4OZGF 4BZ1H 4BZ2H 5BXFB 3CV5A 3S36L 3TPUA 1RZIB 3U1SL 5K9KA 1TNNA 1X44A 5FYJL 3LEVH 4W5UA 2HH0H 4XX6A 5DO8A 1EXPA 1OWQA 4D6GA 3U7VA 5C0AA 3WHE1 3CCHA 3U57A 1XGTA 4MNQB 3NCYP 1M7IB 4B3KA 1NUDA 4E2OA 1HDMB 1BZ7A 4PJXF 2PXYD 2VXUL 5FA4B 5IHUL 2MWCA 3D39D 1U8IB 3KLAA 5L2JB 2AAVA 1IC1A 5CZKA 4IRJA 4G7VH 3LEYH 4JL1A 2WAGA 1NPUA 5JXEA 5DRNA 4NO2B 4NN5C 5I17A 2FGWL 3VU2A 3T4YB 4CVXB 1TFHA 1LDPH 4UDTB 3DI2B 3PGCB 2EYSB 2BNUA 4X98B 8FABA 4HC1H 1CLVA 3MA9L 3BSHA 4ZOBA 4QNPE 3VIFA 4S1QL 4WV1B 4LLVB 3TNMB 2DTML 2V3DA 1A3RL 1U2CA 3CSYB 5IROC 2GJ6B 3BT2L 4ODUB 2ITCA 1T5WA 5GRVK 5DQDL 1HN1A 4W8BA 5HHVH 1IEBA 2IBBA 1A6WL 4LHUA 3KPOB 4WUKH 3BZFA 4HJJH 2YK1L 1YPZB 4XC3L 4K71B 4ESKA 1CDIA 3NACH 1KXQA 1A6AB 4V27A 1Z6JT 5HD8D 3OKNA 1I9EA 3KJ6H 3MX0A 3WQWA 2FLRT 4TOYL 4GAYB 1U8NB 1UZ1A 2BNRD 5DD6A 1E6QM 4Z9KB 2IADA 2Z31A 3I02A 2FX9H 4QRRE 4K3DH 3H9SB 4NRYA 1EDTA 2PB1A 4JFFA 3LH2H 2ZOKB 4F9LC 4JFZL 4PV9B 2QPUA 4GBXB 5T1DL 2GTZA 5I15H 3I50L 5E1HB 2AABL 5H35B 5GISH 3LAFA 3T0AA 3Q0HA 1MCDA 4ZFOL 3FRPA 3WDHA 1T7YA 3ARDC 4D71A 3WJJC 5D2NA 3GMPB 3BI9X 2NY6B 1IM3A 4M6OH 3SDXF 5EBLA 1FYHB 1WAAF 3MLXH 1I3GH 1E4XI 1NWTA 4JFQA 4KDWA 1MOEA 2F53D 4CVWA 5C70A 1I8IB 1RZFL 4I0PD 2ZG2A 4OQTA 3IRPX 3RVTC 4PB0L 1S5HA 1OD9A 1FFNA 1A7PL 3BCDA 2O5XH 1GHRA 4NKMA 3NH7L 5IFPA 4O5LH 1JWSA 4L1DA 1AO7A 4PB9H 5CIPH 3CFBB 1FZOA 4NQDD 2XG9A 1YECL 2EIZB 4FQQA 3P4NA 4KI5F 3T77A 1MJJB 2C1OB 4GKLA 5HGDA 4PSRA 4YXLL 3DUUB 3CUGA 1RZJH 3WHE0 5I19H 2JEQA 4LSRL 3L3OB 1J5OL 4PRAB 5D6CA 3AU1B 4ONGL 3MGAA 1QHOA 2GTWA 1LWHA 4M61A 5CIPB 4B7IA 1P2CA 1MY7A 3DHJA 4XC1L 2BC4A 1U3JA 5I71B 2JJUA 2WCGA 4P8XA 2DPEA 4M1DH 1HSAA 4DFIA 5HHOE 5DQ9A 4JG0H 1ETZA 4PMXA 1PLGH 2AV7B 3AIBA 5A3IC 2YBRB 5J1AB 1ZHBA 4EANA 2FATH 4U1IB 2CJUL 1G7HA 1G7JA 1ESWA 1NFDE 4KTDL 4C7FA 1H3PH 3UTQB 2CD0A 4LRIC 3KS0J 1JDAA 2EACA 4H26A 4XNXL 2VLRB 4ETQA 3E0GA 1KIPB 3G6JE 2DN7A 1SJEB 3O3EA 5MHSE 5D9SA 1ISVA 3PGDA 1XF4A 1M6OB 4MX7A 4PJ9A 2Z4QB 5A2KH 2F5BL 1H5BA 5GS0L 3AFLA 4XXDA 5I8KL 5EPMB 4NN5B 3U4BL 3FY1A 4X6BA 1GGYA 2JELH 3ZJ6A 1VACA 5IW6A 3WE6A 1KC5L 3MGOB 1N5AA 4PP2A 4HF5L 2DL2A 1F6AA 4P2CG 5E2VL 2OJEB 2Q8BH 4PBGA 3QUYB 3WDQA 1A14L 4ZSOE 4LEOA 5T3XH 2NY2D 1QSEE 3IU3B 1V8HA 4UUJA 3HMXA 5L88H 4X7TB 1NCUA 5J0BA 3OAZK 4JHZA 3T2NH 1FL5B 5E4IA 1MFAH 2NTFB 4GKSB 5JORB 3GMMB 3A23A 1EAJA 1P1ZA 4WTWA 3F5LA 1IAOA 1RJYA 1INDH 5FUZL 4KDTC 4KPHL 1WBXB 1K2DB 2ITDA 2YD4A 4XHJD 1US2A 2YWYA 4WDIB 1PDKA 1D6EB 1MVUB 1LO0L 4LP4A 5BZDB 2FJGA 3WF1A 1E27B 3QEQE 3GBLA 1QX1A 1TXKA 5H94A 1A7QL 4XCEB 4Y4FA 2BSRB 2PYED 2V2XB 3K8MA 4U6YB 4XBPA 4YO0A 5DD1H 4RZCB 1KTDA 3IDGA 1U8QA 3W9EB 2R9HD 3DETC 5E4EB 2X7LB 5BS0D 3DGCR 3VGGA 1XIWA 35C8H 1QO3A 1FL3A 4OZGB 5IFTA 4RBPH 1NAMA 4PUBH 1YNLH 3VH8B 1KSRA 4EBQH 3ARFD 4QXTB 2VH5L 4AZHA 3ARDB 4ZFGH 4W7WA 3FAXA 2XHYA 4LLAA 3WFHB 3FOMB 2E27H 5C07B 3W4RA 2H32H 4PJXB 4R6UA 4NRZB 1JHLL 3H3KA 3DDGA 3BIKA 4JFED 2ZG1A 3O8XB 4G9DB 4OSUL 4O58L 4EIGB 1HI6A 3KE0A 4EI5C 3B2VL 1TQCC 2Z8VC 3PGFH 4KGJA 5HHMD 3A6CH 1MHCA 3VTRA 4LVOC 3L4WA 4WFED 1E4LA 1F97A 2WBWB 4PRIB 2XG5A 1T1ZB 1JHTA 2ZUNA 3F5WA 1PQZA 3O3AB 1I8KA 2IFGA 4R3SA 1WBZA 4PV8B 5IBTH 1JBJA 2NSXA 2H32B 3ILPA 2Q76B 3T2OA 4LNRB 1U8OB 4J2XA 1ODAA 4WFGE 3DRTA 1UWRA 3QIUD 1GAFH 4EEEA 4UMGA 5JMOC 5E08L 1VB9A 3RKDD 4DZBB 1A02N 3V52H 1CNVA 4MNGE 4N9OB 2YD5A 3NIYA 4AMKL 3QFJB 5DZNA 1GQLA 1P5VA 1N64H 4V2CB 2LTQC 4F2MA 5I0ZA 1DUZB 5ACLA 5KW9H 1YNTB 4NCC2 1GZQB 3RL1B 4ORGB 3T8XB 2BOBA 4Z8FH 2HT3C 4PJGF 2CRYA 4W70A 1KEGH 2WBJD 5JO5A 3T0DA 1CLCA 4PRPD 4U1GC 4UTFA 2OQJA 4P99A 1NGXB 1A47A 4ZUUB 3S34L 3F5KA 2D7MA 3BE1L 1KBGH 3W37A 2QTEA 3EOBA 4HKJB 4M7KH 4G5ZL 1SFSA 3Q5YA 1NGPL 3KPSD 4EN3D 5CLWA 1R3LA 1CFVL 2FX8H 1WP6A 3ZOAA 2OWWA 5EO1B 2VE6B 1GGTA 1ZHLA 4HWBA 5AWNH 3ROOA 5DDHA 4I77L 3HZKA 1JNEA 4JO4H 1QNSA 4LLWA 3I6KB 5F7LB 3VXSD 1MHPH 1IL1B 3DX7A 4NZTH 4PMQA 1UM5L 2PYFA 3O2DH 1RUKL 4ZG1A 1JWUB 2ZX6A 2CIIB 3WFCH 2HTKC 5C2BL 3R4DA 3JBG7 2GI7A 3NAAH 3MJ7A 3BVUA 4Q0XL 4Y2DB 1FSKC 1G7LB 1YJDL 3QG6B 5AYQA 4XNMB 1AFVH 1OAQH 2ZNXA 5DMIL 2I24N 2IPTL 5HHXH 3VGFA 4PJHF 2MNUA 2B0SL 5K9JH 5I73B 3PZMA 3NFPB 5ADPH 1VEOA 5DJ2A 1CK0L 3C6SB 4R97B 3LX9A 2GSGB 5J6HB 4UT6H 5E5MA 2BNRA 2YMXH 1IAIL 3PTKA 5I2IA 3LQAH 4Z0XA 2WZIA 3PE9A 4BFBD 2FNBA 3NPSC 3GZKA 1FDLL 1XF5A 5ALBL 2I60L 4XCNB 4GO6B 1P4BL 1FBIH 4EE9A 4DUVA 5HDQL 1IRAY 1RPQA 3S35H 3TT3H 2WSKA 3MLWH 4F7TB 1SHMA 5EULV 2ARJB 4PJCF 2EKSB 1KNOA 4J4PC 3GXFA 2VCBA 1YY9D 5I16B 4JQVA 2FBJL 5CLTA 5CSBA 5E8OA 4HTYA 3WH5A 3PV6B 4MGXA 1L7TH 2P45B 1XGYH 1VRXA 1EMTL 4OCNC 4PG9A 3FMGH 4DN4H 4Z2GA 4JREC 1RIUL 1B1YA 4HZAA 2O5YH 1J87A 4WFHE 4JZOA 3RM8A 3VINA 2Z91A 4LIQE 4F15B 4PUEA 4RMWA 1LD9A 1NEZA 3H8NA 4RWYH 5AYUH 1FC2D 1PG7X 3ZO9A 4EIZC 3FO9A 3R8QA 4WWKC 4GZJA 2XQYG 3SBWA 5AAWA 1W1VA 4FG6D 3QPXL 4ONHB 3ULUF 5SWZB 1M05B 1R3HA 3QIWC 2BVEA 2YBUA 4JQXC 4NQDA 3DI3B 4UQDA 3X11A 4AIUA 4QLJA 4UV7L 5I9QC 2ICCA 1KTKE 1T22A 3FB6B 3ZDZE 1FG2A 1GZPA 2JEPA 1NCAL 3Q1SH 3IVKA 2CGRL 4MA8H 1P7HL 4H5SB 2A0LC 3VNZA 3D69B 1YQVH 4D9LH 1D5IL 4LVOB 1A2YB 3A0OA 2YD9A 4XRCA 1EZVX 1JXKA 2QSCH 1GCFA 3I84A 3I85A 2H9GB 2YEZB 4IIQB 1T21A 4PYHA 4U1LA 3LV3B 3QDJD 1RHHB 1ZVSB 3DVNB 4M48H 1XF2B 1OQOA 3G6LA 1ITXA 3D50A 4XBGA 4HA3A 1QBML 4YX2L 1I3VA 1ISYA 4OIIH 5TQ2H 5TFSL 1B4JL 1XCTB 5C0AE 3MXVH 3RWIA 1UQYA 4HCRH 3ARPA 4JHWL 2XKSA 3GUTA 3L4YA 3V6FB 4KQ3H 1JN6A 3UTZA 1G6RH 1DQQB 1R5VA 2UV3A 3HB3C 3JXAA 1JTOA 5C6TL 1UACL 3P77A 5HHQB 1AGCA 3KYNA 3VKKA 3SDDC 4Q9RH 1DQMH 3G08B 3BWAA 1MCCA 3NFNB 4R4FL 3RA7H 1H2JA 1T20A 3GSUB 2Y23A 4JHBA 5CXPA 2GKIA 3U83A 2G75B 5J56B 3T0WA 3U7AA 4LMQI 4F7PB 5D7IA 3RWDA 5HYSA 1N7ML 2ZSVB 1QLEH 4U1GB 4OM1L 3QCVH 2VSDA 4NO0B 4WFFD 3BPNC 4NDMA 5J3HC 1JIBA 1MCSA 1KB3A 1G6RB 4NM4L 1QFPA 5IFHL 1Z5LA 4M3JA 1DBMH 4D94A 3RGVC 4G8FA 2WSPA 3MROA 4LQ1A 4WIQA 1UOKA 1IGTB 3AHXA 4UFJA 1WZLA 1KTLB 2F58L 2HKFL 3OAUL 1TZ7A 2UZXB 2VDPL 4HIHA 4AIXA 2BSED 5A2AA 4JHOA 1F4WH 1HJSA 1YEKL 4IOIA 1TVBA 1WBYB 3GMQA 3LN5A 3N15A 3MV9B 3H0TB 3TBVA 1YN7B 3QYCA 3NFSL 1UH4A 3WN5B 4IBLT 4ENEC 4B9ZA 1VA9A 4P2RB 4B0MM 1HHIB 2MQ3A 1FSKB 4OZHF 1LEGB 5HNNA 3FT4B 4IOFD 3GJEB 4JFFE 3KNBA 4YK4C 4NNYA 2BDNH 1XT5A 2PF6A 2Y6SC 3RJQB 5I6SA 1B2WL 5B3NA 4N1CA 4LVHB 1DSFH 4PTUA 2DJ4A 2GDVA 1G9MC 2FX7L 3RVTD 4PGZA 1Q9KB 1MCHA 2D0FA 5GZNC 4OM0H 4XGZB 2G4FA 1YMHA 4YHEA 2DBLH 3CVIH 3QAZC 5EORH 2PYEA 3RWFB 5D2NE 4RISL 4BQ4A 3L5HA 3U0TA 3VDAA 4HEPG 3SO5A 3BHBA 1ZLWK 5JLZA 1Y7VA 5JBEA 4NZUL 4Y2OA 3UJIL 3L3JA 5KG9B 2WMJA 1GGBH 2UY6A 4C4KO 4UT7L 4HGKC 2HKHL 2FEDC 4P4KA 1YEGL 4H20H 2V38A 3CHFA 3HPLA 1CTOA 4OZIA 1CU4H 1U8JA 3IGAB 4PJGB 3KPNB 2R1YA 1NKRA 1AO7E 3CUJA 2MQ0A 4OLWH 2DQJL 2VRAA 4CD8A 4TPRL 3GNMH 4M56A 3NSNA 5DHYB 4KRLB 1O0VA 3FCTB 4LLDA 1R0AH 1HHKA 4YH6A 3BPOC 2I9LB 5IV2B 2YRLA 4GS7C 1RU9H 3JVGC 4WEMB 4AYGA 1S9KC 3RM4A 3O4OC 1IARB 3RTQA 1ZHKA 3L3HA 5I3DA 2XGIA 5T5NG 1A1OB 3GGWA 1MREH 5GGVY 1U3HD 4P57A 1MFEH 5IVNA 1FVEA 3T0XA 1XGUA 3VXPB 2DLHA 5ID0A 5BJTB 5IW1B 5BO1L 3PHSA 4CL7A 3D0VB 5FYKD 4OLXH 1XCQA 1MAKA 4OQTL 4RGNE 5T5NF 5HVFB 1HQRB 3CFKB 4TNVF 4ZOCA 3PGCA 2X4SB 4LSPH 2J7BA 1T89A 4X98A 1IAIM 5HGHA 1V6YA 1EJ6A 5E7BA 5KZCB 3D2UA 4FK9A 3W24A 4B7LA 4WV1A 4EXPX 4LLVA 3TNMA 4PGJA 2F19L 4PJHB 1MHHA 2XN9B 4AIEA 2XWJA 2ICWB 5HYJD 4UIKL 1AHWC 4B53A 3GSQB 1TNMA 4ODUA 3LD8B 1I8MA 3QXVA 4HHAB 3TN0C 3VXOB 5IF0B 4LKCA 1Q9OA 4L8CA 1RJZA 4MCZA 4RIRA 1ACYH 4OD3H 2GJXB 4AZCA 3I6GA 1UVQB 3ZHLA 1ND0A 1WITA 5J6GB 5D9PA 4ZFFA 2ZUMA 3ZE1E 2VN7A 5FB8B 4XB8A 1GJWA 3KPPB 3LRSB 4I4WA 5LWYH 4G6MH 1T1YB 2W0PA 3UO1L 3HI5L 2QPSA 3MBED 5D9MA 4L5FH 3KPSA 3LS5L 2X1QA 3ULUH 2OS7A 1BGAA 4RMTA 3SKNB 2F1BA 2DQUH 3VXSA 3ZHKA 4ELMF 1JVKA 3BH8B 3BP7B 4OJFH 5LXGH 2BSTA 3PP3H 4N90D 4H7VA 5I1KL 3BOVA 1AGEA 1IM9B 1S9WB 4ZPVB 1S7TB 5C08D 3CBWA 3HE6D 2UY3A 4FNSA 3WY3A 5ANMB 5TDPA 1FYTB 2XY1A 3HRPA 2VXVL 4LHJB 5TDOB 3BP6A 3WIFB 4NO5B 4XVJL 4WLCA 4FNQA 1J01A 3RAJH 4TULL 3IXTB 2JIXA 3PDOA 1F3JB 2FGLA 1DR9A 1WO2A 2BJML 1U95A 2XWEA 4APQD 2BFGA 3QH3A 2D7PA 4LXFA 1F13A 5D7IF 4ODXB 2E0PA 3GK8L 2BRRL 4ZPTB 5IOPB 2R1WA 1JFXA 3O6KL 2B31A 2BY0A 3VCLB 4XCFL 1YYLL 2HJLA 2AK4B 4FFZL 1Z0MA 3FTGA 4OTXH 5F89B 1I1RA 3TGXA 4QLRA 3GKWH 4XP5H 3D3AA 5AAMA 4R2GB 3I6LD 3D6GA 1VEPA 1K4DB 1F8TL 2A77H 3F7VB 4H8WC 5I18L 5JMRA 4RE3A 2EEBA 5DS8B 1RULH 5B3JF 1CEOA 1E4IA 4NBXB 3GI9L 3ZMRA 4XXCA 2Y36L 4FTVD 5MEPA 1UM4L 5CIPA 4S11A 2OZ4A 1TVPA 5ESAA 5I78A 1QKZL 3SGKA 4KHTL 1Y0LA 3SKMA 1HWGB 5E95B 4KHXH 3ZR6A 3SDAD 4RGOH 2AXFB 4Y8DC 3TH3T 2H26B 1G1YA 4DO5A 3U7WL 4AYFA 4YWGH 4QOKD 5BYWA 3FB7B 5B8CC 4Y5YB 1JWMA 3BVNA 4XNQA 1K4CA 4OLZL 1RZ8B 1EGJL 2VXQH 3RPIB 3LSOB 4L8SB 4P2OC 2J8FA 2FO4B 1UM6H 3NZ8B 1A8JH 3SUTA 3RWEA 1VADA 2GT9B 1U8HA 1MAJA 3EYPA 3B9AA 1CGUA 2FRGP 4HJ0C 4JPVH 3MLUL 5HBBA 1AY1L 4LARH 4HGMA 1WGOA 5EU7E 2ICWJ 3CZJA 4JHAL 4LCIH 1UA6H 2IFFL 2VYRE 1CQKA 1CZ1A 1UWIA 1QR1A 2A6DA 2ADJA 3BRDA 4BQ6A 1BQLH 3U4EA 2QF8A 4OZHB 3QNYB 1QA9B 1MELA 3D39B 1NL0H 2R1XB 1LO3H 3F58L 1FORH 1RUPH 5IJVA 5IROA 3BDXA 3GI8H 5E03A 3H9HB 1ZTXH 3V0AC 3TN0B 2P7TA 2CDGA 1PS3A 2L4OA 3WV0A 4JB9L 2B4CC 5E2UH 3BZ4B 5F9WC 4PRWA 4JM2F 3HMCA 1YY8A 3HC4L 1Q1JH 3ZL4H 5KVGH 1MVUA 2N56A 3O4LD 5EBWB 4NF7A 4ODTH 5HYEA 4JL2A 3MOAH 2C4FT 3QSKB 4ODSL 3DXAE 5JDJA 3AXLB 4L29A 3HS0A 3QXAA 1KQZA 1YEJL 4H88L 5GGQH 2A2QT 2VXTH 2QR0B 3LQMA 4KZEL 3CLFL 3VW3H 3BH9A 4QHLA 2J8HA 1UWEL 5FKPA 4P5MA 1H5VA 2X9WA 1JPGA 2C4XA 3DGGB 5C0RH 1UEYA 1KENH 2XWTB 1ZS2A 4MNKA 3JWDH 1FCGA 1F4XL 1RURH 1I1AC 4O2EB 4BQ3A 3QO1B 1BJ1J 1ZWIA 5DJ0A 5FGBC 4RQQA 2XN1A 1L4IA 4L4VD 5ICZA 3SE3C 2BNRE 2XUCA 4G6JL 3CFJA 3IXAA 3DNKA 3UTSD 4WWID 4BKLB 3BLBA 1W1TA 3BZEB 4I3GA 3HI6L 2X4QA 5B39G 4OFIA 1JGUH 2APWA 2ZCLL 2ADFL 4LYQA 1TTFA 1GIGL 3LS4H 1U3YA 1YYML 1OOAA 3RHWK 5DFVC 3QIWD 2I07B 3IKKA 3QA3A 3NPZB 3TIEB 4NYLB 2HFEB 4FQJH 1XSJA 1ZHNB 4HAFA 4WU5A 3WFEH 4KRPD 5EOQL 3M17B 1NMCC 3V8OA 3WL9A 4N1HB 1X5FA 1EHAA 5IBUG 3ARGC 3D3VA 3NABH 5F72S 1IGYB 1KXHA 4LEXL 1EOMA 2YRZA 4I0PB 2IH3B 2ZOLA 2F54A 4GMSH 1DWFM 2X2IA 5C3LD 1XEDA 3VXMD 3UJJH 5EZLA 4X5WB 4OF0A 1I75A 3BSZL 3C6LD 1BFVH 1SYTA 1L6ZA 4FXKA 4QHKJ 5TDNB 1JZ8A 4JDVB 3CVHH 1U6AH 1CS6A 4QXUH 2VMFA 4WW1B 2A83B 3IRZA 4I1NB 4P0DA 2A6IA 5CBAB 4JJHA 2NY4C 4Q22A 4DKEL 4M3KB 4F8QA 4Q2ZA 4D0DB 3RVWD 1U3HA 1KB5A 5FF6B 4L8DB 3V5HA 1G5AA 4I2XE 2CETA 32C2A 3GSNA 4ELMB 5HYQB 4I8DA 6FABH 1WWAX 5E2WH 5KOMC 2JF6A 2G5BA 1WEJL 3CVHB 2UY5A 3O6ML 4UAOB 3E6HB 1CXEA 3MRHA 3T4AA 4P2OB 4EDWH 3QNXB 1AQMA 4HQQH 1UD4A 2VE6A 3H42L 3MSGA 1SVZA 3IJYA 4ATLA 4DGVH 4FQ2H 2P47B 4QRQA 1XF3B 2MPAH 3RIFF 2X2YA 1RY7B 2YZ8A 5DLML 2ZG3A 2B4CH 4Y16D 4N5UA 5DA4A 2NLJA 5D1ZC 5IT2H 3ROLB 1OWRM 1NOFA 3B3IB 3EFFA 1BBJB 1N0XL 3KVQA 3MA7A 2YPVH 5LGJB 1FNFA 2BNJA 1E6PA 5MP6L 1US3A 1MFCL 4PLJC 4S1DC 4YBQD 2BVPB 4HFUL 4LSTL 5DYOB 5EU3A 3X3GH 2A9NL 3ULVE 4YDKH 3QBTB 2D4DA 2KZWA 3NA9H 1E0WA 3CAFA 4P46D 3VFUA 3OX8A 2NY7L 2WQ8A 5IR1A 4ENED 2YJQA 1N4XL 1DLFH 1MRFH 3NCYS 4WI6A 3BCFA 1J0IA 1LO2H 2AV1B 2F74B 1OB0A 3OF6D 4KDTA 4OGXL 1OT2A 4HZ8A 3N9KA 2J6EA 5JHLH 1LO4L 5FO8B 1SEBA 1JYNA 3C8KB 3LKNA 2QSVA 4S2SA 4Z0BH 4PY7B 3EIFA 1ORSA 1CL7I 2OSLA 1FV1A 1T0OA 1TQVA 1DLHB 5DMGC 1TCMA 3QHOA 3JV6A 5D8ZA 1S78D 2CUMA 5GZND 2VL5B 4LQFL 5IHRA 5KS9F 4OFYA 1QRND 4OCXH 1II4E 2OYKA 3ZYZA 5E1AA 3ULVL 2JJTC 4YZFF 5EBMB 4R7NA 2Q3AA 3L4XA 1UR4A 3EFDH 1OF2A 4JRYD 5I8CA 2YKLH 3N0PB 4KMQA 4P7LA 2JB5L 5GHWL 1JJUA 1FJ1A 2VKXA 5C0FB 2PN5A 4DWSC 3QQNA 2JIEA 3EO1A 1IC7H 3NN8A 2CKRA 5A3HA 2GCYB 3O3DA 2WZHA 1OP9A 1SJXA 2PYEE 4XWGH 1U36A 2E9BA 4PGCA 3WIHA 3L7FA 2VABA 4Z7UF 3AMKA 3EOYG 3HZYA 3MRNA 2ARJQ 5DO2C 4PRHD 5DZOA 3RNQB 1FZKA 1QRKA 2D2OA 1J8HD 1TQBC 2V5CA 3GHEL 4PJ7A 4CN6A 4R8WH 4UOW0 2OXGA 1AGFB 4G9FA 4EI5A 4V2XA 4AD0A 1KT2A 4WF7A 1I7ZA 4XZUA 5C0CA 1FRGH 2R2CA 4O2FA 5FECA 1YEDA 4OZIE 4HOZA 3SKOB 1OLLA 1A6UH 5B4MC 1IVLA 3DSFH 5EFFA 2WHMA 3S96A 5AG9A 2YL6A 1ZA6A 4FTVA 5GGTH 3PBGA 3G5ZA 4XNZC 3HPJA 4JFEB 1FFPB 2IMMA 2J47A 2Q1EA 1CGXA 3HCVB 3WY4A 5DWUH 3GXPA 3BISA 3G5VB 2LQRA 4P23C 5HHMB 3SDAA 1LEIB 4PJ8C 4D8PB 3AFBA 3VFNA 1JMZA 4MDPA 5C8BB 2OI9B 4MJID 4MNJA 4JM2B 4QOKA 2HYMA 3UTPD 5FGCE 1IGML 1YC8A 1UA7A 5FAAA 2W66A 5ERWA 3WD0A 2QKIB 4URTB 3QUZD 1GGIH 3N9GH 4M4RA 1M7DB 3QCUL 5TD4A 3OLGA 3WEOA 3KEHA 3BAEH 2VZTA 5TPWH 3QIUB 1S9XB 1VCAA 1ZVHA 5IMOA 6TAAA 1HKFA 1IQDA 4HK3N 4M1CC 4OT1H 4JDTH 4L3EA 2VSCA 5C0GA 4NSBA 3UZEA 5M94B 3F7YA 1CD8A 2JIWA 1S7WB 4WHTB 5F3BB 1BD2A 4A6YA 1Y6KR 3HLAA 3OGCA 4TUOB 2CLZB 4V1DB 3QEGL 3P11H 3I75A 3GSRB 1PSKH 1YDPA 4AM0B 3QRGL 2A9ML 4NZRH 4LYRA 1MJ7L 3EGSB 4DM2A 1HEZB 2WBJB 1H8OA 4UT9H 5E8NB 5A6KA 3NIGF 1T4KA 4NP4H 4NN7B 3MJ8A 4OD2B 3OKOB 1GHFL 5IEKA 1Q6GA 1M53A 1LGVA 4JFTA 4QP0A 4BZ1L 3TBTB 1UWGL 4KFZC 3DYPA 5ID1B 1KEMH 4AD5A 3LEVL 1A9EA 2HH0L 2CBIA 4BSVA 5DJ8B 3W6MA 1JPSH 1OWWA 2OR8A 1A4JA 4EN3B 3F4VA 3RI5F 1LEGA 1M7XA 4PJBB 4G3YH 1KELH 4BS0A 5FYKU 1K9DA 3VXSE 5F7MC 5B39B 1IC5H 3MYZA 2RAMA 2YFNA 5HVWA 2AK1H 1NANH 2F2HA 4N68A 2H3NA 4P4RB 5MI0C 2QV4A 4WVRA 3D0LB 3HI1B 4UQAA 3FFDA 3HR5B 3LEYL 4XAKD 1AMYA 3RY5A 3MCLL 3SCMD 5CS7A 4DN3L 5D7LD 2XVLA 4NC1C 2EDBA 2M1KA 1E43A 2DLIA 4MA3B 3MBXH 1X9QA 4ZUWB 4LLQB 1LDPL 5I75C 2P8PB 1LVEA 4NWUH 3ARZA 4CMMB 2C0HA 2ADIA 1BM3H 5LCVL 5FDWB 3M45A 1IGJB 4HC1L 1C5DB 2KZ1B 4MXQD 5T1MB 1LEKB 1NCTA 1MQRA 3A4WA 4WU7A 3GMOB 2BVQB 4AMXA 4O51B 2DDQH 2KBGA 4MNHB 4J4PA 5BW7A 3TFKC 4M4PA 2YUWA 2W9DH 4F3FB 1OGAB 1UWQA 3IGAA 1WK0A 2A6JB 3UTSA 4WUKL 4JAMB 3EW3B 2GK1A 4DKFH 2DWEA 3C60B 3THMH 3N12A 3ME0A 2D3LA 4CNIB 5GXBB 1AKJA 4KVCL 3KJ6L 5BQ7B 2EKJA 1KLFA 4JJ5B 4OUUA 4GZEA 2DIAA 4KK5D 1M1SA 4WWKA 2YDRA 3V0VA 4CDHA 1QOKA 3QIWA 3E3QC 4JQXA 4QRUB 1X7QB 3INUH 2FX9L 1IZJA 4K3DL 5D7JD 4JRXD 4TVCA 1DQTA 3RDTC 4KMLB 1U8LA 3LH2L 5JW5B 5CEZD 3LRLA 5EZOH 4HS3A 5I15L 1UD6A 5ETUB 3WSUA 1L8NA 1IFHH 3HRZB 5DURD 1IT9H 5DRWB 3B8YA 2KQMA 4TXEA 2GVYA 4EKXA 2J1KA 5DVKA 4FQHA 3C6LA 4XNZB 3VXQA 2DM7A 5DQJA 1QOXA 2W1NA 2J7DA 1GQJA 4TVDA 4ZYKA 1PAMA 2EPKX 3VFOA 3S5YA 4U0QB 4M6OL 3WMBA 2IBGA 4XCYB 2W65A 3MLXL 2H1PH 2LAAA 1I3GL 4W8AA 3O2VH 1EXUA 3ZKMC 3VXOA 1MWAA 4P23B 4POYA 1HHGB 1MCBA 2ED8A 4LKXB 4PJ8B 4KRMB 4IDJH 3QHFL 4EZMA 4GI9A 2O5XL 4YHYC 3EOAA 5DD0H 3SDDA 4O5LL 2XSAA 4PB9L 4EQ3A 5C0IB 3QDJB 1LMKA 5GGRY 3TT1H 4OOUA 2GUYA 2XWBA 3GBMH 4HFWB 3VFWA 3VRLF 2IANA 4OB5H 3S5ZA 2XOTA 3D25B 4KRNA 2EH8H 2UZIH 5KS9B 2NX5A 4NO3B 3X14B 4LP5A 5I19L 3EYQD 1FH9A 3L5JA 1HHHA 1P53A 2XVPA 1HH9B 1QBBA 3RGVA 3NCOA 1SM3H 3CZFB 1V7MH 4K9EH 2UVFA 3AZTA 3OMZA 2IQAB 1J0YA 4YGAB 4Z77B 1QNOA 5JUEH 3UTTD 1GOMA 1OGBA 5IBLD 3MJ9A 4M1DL 2PO6C 3UJTH 1JZ6A 4UFHA 4JG0L 1B4RA 1A5FH 3AHZA 4Z7UB 4KKCC 2TAAA 1PLGL 5GIRB 1IEAB 2DIBA 2X4TB 4NZFA 5CHNB 1I1AD 1HJVA 2FATL 1KXVC 5B22A 5EC2A 5IFJA 4BA0A 4GLRH 1H3GA 2N7BA 1KV3A 3WLWD 1HKKA 4MAYD 3P4OB 4ZPTA 4WO4C 4U1NA 1DN2A 1DN0A 2R2EA 3BYTA 3FT2A 3Q5OA 3T65B 2DT3A 1AQHA 3B6SA 1QR4A 1NGZB 2AK4A 5CP3A 3TA3C 5MI0B 2OLHA 3SHSA 1FCCA 2HFFA 4L4JA 3BP5A 4I18B 4YHOH 3R0NA 1P4LB 1UWSA 1HOCB 4NI3A 5DFVD 1QRNA 2CKSA 2HLAA 4JAWA 1W72A 4X0KB 4AT6B 5KN5A 3V5KA 4S3JA 2Q8BL 2VOTA 4D2NA 5EDXA 5CPTA 4WCYH 5T3XL 2X4PB 1DL7L 1J9CT 4MLSA 4JKWA 5IQ9B 2EE3A 3L3IB 4GQPH 1RAMA 4YC2C 2JF1A 2HA1A 3O9WC 3QIBD 4NQCD 1P7QB 2AJ3B 1T04B 1NLDH 2V9TA 3KPMA 4FLOA 4LFHG 4PP1D 4DAGH 2EE6A 1INDL 5ABHA 2DIEA 4HU8A 5C09D 3BIAX 1NP2A 4U6HB 4PRDB 1CFTB 1J8HA 4OZFH 1OCWH 1B3ZA 3ZYOA 3IGUA 2E7MA 2C1PA 3D3VE 4NGHH 5C0NC 3EDFA 1KGCE 3KPRB 3N1QC 3JVGA 3BN9C 3ZLQC 4DKAA 5EOTB 2F54E 3UG3A 1CXFA 4N0UA 1WV7T 2YDQA 3RIAF 4Y1AB 4ZDHA 5DD1L 4XVUD 2QQNH 5FV2A 1FHDA 4PGDB 3BO8B 2YLLA 1MVFA 2VCAA 1JNJA 35C8L 1VKXB 4M1GL 1U93A 1DEEA 3TBYB 3BKYH 4OZFB 5K59E 4PUBL 1HVXA 1YNLL 3RZCD 4L9DA 4CRPA 5EB9A 1AP2B 3UPRB 1MRCL 4EBQL 5IKCA 1RVFH 5HPMA 5HGBA 2FYYB 1X5IA 1DBBH 4NKOA 4ZFGL 1E6OH 1W0WA 3T0VA 4MJ4A 2YN3A 3RNKA 4LDEB 3PIQA 2CBVA 1LP9B 3BPCB 5MEQA 1XR9A 1IT0A 1AHWA 5FYKE 3H9HA 3BVWA 3MMDA 4GXPA 3TN0A 1ITCA 4WW2C 3ZT6A 1HT6A 1QUNA 3I2CH 4HX1A 1XD1A 4AD3A 2V5TA 1T66C 3FHAA 3A6CL 1QPPA 3EJZC 1G94A 3D52A 2YKKA 3CDYA 3P30H 5IBTL 1WAAE 1CGWA 4MJ6B 12E8H 5HYJB 3FQNA 4PREA 3CLEL 3AXLA 2VISA 3G9VA 4KMTH 2EZ0C 3MRLB 3BP4A 5TE6H 1GAFL 1G7MB 3DGGA 3TO4C 5B21A 1UENA 3V52L 5DK0A 2H2SC 2YLAA 5L6YH 2V6HA 1N64L 1JV5B 1R5IA 3S97C 1UADC 3MBEB 1HSBB 4GG6F 5KW9L 3WLBA 5F1NB 2CQVA 3G5XB 4Q74A 3RWJB 4Z8FL 4UFMA 3HKFA 1H3VA 5GRYA 3U0WH 1KEGL 1TZHA 4KTEH 3MNWA 1MAML 4DQOL 3Q2CA 3UPCA 4UFKA 5AD0A 2GAZA 3P73A 2VRKA 3VE0B 1KBGL 3SQBA 2IAMD 5TQ0H 5JIPA 1AQDA 4NHUA 5KSBF 4WO4B 4IDLA 4M7KL 3MV7D 4KK6C 5C08B 4X4XB 5A2IH 4X0NA 2XM1A 3HE6B 4JLRB 4OZ4A 4KXZH 3MANA 2FX8L 4MTVA 2GFTA 3HN3A 2L0DA 5AWNL 4TSAH 4BQBA 1VFUA 3OGOE 1J1OH 1UB6B 4WNQA 4KWUA 1MHPL 4XMLL 2BHYA 4W68A 1YC7A 5I66B 1B31A 2YD6A 3O2DL 4CN1A 4M7LH 4APQB 5I1EH 4CMHC 3E2HC 3M07A 3CNKA 1KXTB 3WFCL 1UUQA 1GHSA 5EWIH 2G3NA 3E6FB 2EDXA 4WK9A 4U6VH 1E6XM 4D6DA 2BNQD 3MXWH 3T0ED 5TDNA 1OAQL 1WIPA 2HRPH 4GJTB 3KPQB 1D9KD 5HHXL 3J7HA 1QFUH 4AZGA 5K9JL 4PJ7E 4WW1A 5KEZA 4ZOEA 5ADPL 1Q8MA 1Q9LA 4ZUTB 4CJ1A 4YNYA 3U9UB 4G9FE 4CKQA 4N9GA 1WKYA 3I6LE 2M2DA 4UT6L 5C0CE 4HBCH 5L0QC 2VC9A 4WI8A 1TTUA 1UKTA 4JM4H 3LPWA 3EZ8A 3BD5A 4FTVE 3EDEA 5B8CA 5IDIA 4F79A 4JCLA 5FOBA 1B2YA 2FJHB 3S35L 3TT3L 1YUHA 3VGAC 2W62A 1JNLH 3C8HA 1EEYB 5FYLD 1CI5A 3LB6D 5C8JA 1RH9A 3AB0C 3KXFA 2NR6C 5CWSB 1C90A 1NGWB 2DQIL 1K9TA 4RAVA 2CR3A 3DROA 3EO9H 4IMLA 3FMGL 2CKNA 3IDMB 4DN4L 5E99H 5IMLB 4QAWA 1XGRB 5HHNA 5J11C 2O5YL 2R69H 4QCFA 2ENSA 5F7DA 3QDGD 2HVKB 2XGBA 2VLME 3WNNA 4ZXBC 4Q9CA 4RWYL 5BOZG 5CJQH 1PX3A 5C9JA 5AYUL 2AXGA 2DQDL 3W81A 2WMGA 1NDGA 3DO3A 2B1HH 4ACZA 2VLJA 1B88A 1K8DB 1X4ZA 4L3EE 3W0WA 5MERA 4IJ3C 1HYSD 3WKNA 1CLOH 4X6DA 3C5JA 5ECJE 4HXBH 1KCUL 1BD2E 3DX1A 4WW2B 3EMCA 3E8UH 3Q1SL 4MA8L 2GY5A 3CFIC 1WIOA 1NCNA 1ZANL 1WICA 1V7NH 2CKBA 4D9LL 2OTUB 3TC9A 3ZYJA 1EFXD 3QQ9C 4P3DA 1EEZA 1N8ZA 3L6FB 5E9DB 3QWRA 2BCKA 5FOJA 1PKQB 4M48L 3KLKA 5T33H 3D18A 1W9UA 4OIIL 4FMFA 5TQ2L 4YHML 3MUAA 5EU4A 4E5XA 1N3NA 3PQYA 5DRZB 3MXVL 4HCRL 5I2UA 2IF7A 2CO6B 4NKDB 3H7BA 1CDBA 1ZS8B 3CZEA 3TO4B 4YHPB 1NBVH 2G2RB 4I3SH 2YPKB 4ZS7H 4Y5XC 2COQA 1D5BB 1I1AA 1JRHL 1HXMA 1KCLA 3RO8A 3O4LB 2H8PB 4Q9RL 1DQML 4XPAH 3FT3A 3RA7L 4TVPD 2IBZX 1ZV5A 2PF0A 4QHMA 4JFHD 4GPNA 4D0CA 5IMMA 1OAKH 1Z3GH 4K8RD 5A6JA 3D85B 1UZ8A 5FCUL 1KQYA 3QCVL 1SYSB 3LXCA 4HMEA 1OTSC 4I3RL 1H3WM 2W0FA 1I7TA 4LVNC 4OUOA 1CFSB 4MLIA 4C54A 1DBML 4KU1A 4LSQH 3TCLB 5TF1H 4WSKA 4GKZA 5CP7A 4BQ9A 2WUBH 2GK2A 4MA7H 1LHZA 3BGMA 3UTSE 4KKAD 5DT1H 3C09C 1E0XA 4OCLC 3RCNA 4NQTA 2XXMB 4HS6B 4PD4K 3ARGA 3FW6A 3PP4H 2LU7A 1F4WL 1XSIA 4QRSB 5EO0A 5IB1B 1H0DA 2VVSA 3HAEG 3F6IA 2FZ3B 3ILQC 1BOGB 2YWZA 4KVNL 3QIBA 5JIKA 3G5VA 4FRWA 1QHPA 3L95B 2FB4H 3HG5A 4G8EB 2D0HA 3QFDB 1RPKA 2ARWA 4CADA 1NBZA 3OQ3B 4KRPB 4R0LA 3KYKH 4Q6IC 2BDNL 1AR1C 2CDEB 3SJVB 2QKIA 3BEVB 2NXZC 1HXYA 4RBPK 4NKIL 3IDUA 3TO2A 5D1QD 1DSFL 4WUUB 3L3KA 5I76B 2D31A 4OM0L 3WY2A 1A6VL 2XIIA 1MQKH 2DBLL 5EORL 5INCA 1RUMH 1UR9A 1RZ7H 1DBJH 3VXMB 3VNYA 1I4FB 1DDHA 1FGNH 1CIDA 1S7QA 5ENWA 1SJHB 1V0LA 1CPUA 4PJFF 5I1AB 4QRTA 1B3YA 1ZBWA 43C9B 5IGXH 3GSRA 3CPLB 3G04A 1BVZA 1TCRB 5EB8A 4YDIH 1E6JH 5A8MA 4QHUA 4H20L 1JYVA 4GG6B 2DD8H 1RIVH 3BMWA 3X12B 1CU4L 5JR1H 1A6ZB 1E15A 1JTPA 3EYFB 4OFKA 3WKMH 1UT9A 4N0YL 4JFXA 1OTUC 2DKMA 5D1ZA 2WIIA 3GNML 3VI4F 4V28A 4ZUVA 3TBSB 2IANE 5T3ZD 2VITB 1R0AL 3PZGA 3V5DA 5CGMA 3MS8A 5KSBB 4S1SH 1UWXK 4KJQD 1QVOA 1RU9L 2NX5E 2PO6D 5F8RC 4PJBA 5GRXG 2AEQH 1CDJA 3HNTH 5DJZA 2GUOB 4IJ3B 2PW2A 2OLDA 4QHNA 3VVGA 2E6PA 1MREL 4CKVX 2XQBH 3MRDB 4P4RA 1MFEL 4AISA 1RP9A 4JPWH 5EN2A 1I9JH 1URLA 2DT0A 3L5IA 4BZYA 4Y16B 5CSZA 5I1LA 4Y4HD 4OLXL 1BPVA 2FEEI 5JA9A 4F33A 2XFXB 3CGTA 2V3EA 2DF3A 1HINH 3IDXH 4LSPL 1LDSA 2EABA 4NPYA 5T1MA 2AJZA 1MCKA 2P5ED 5DI8B 1ZGLP 4P46B 2NZ9C 4MNHA 3SN6N 5DD3H 3CSBA 3PDDA 3R06A 3N17A 2ZWYA 5F7FA 2JJTA 4L8BA 3TNNB 4QF1B 1LL6A 4KDVA 5ESQB 5CEYA 3RWCB 2OK0H 1ACYL 4OD3L 3TYGH 2AK4E 3B2UC 2FR4A 4DWSA 4NUJA 3JWNC 3THCA 3LKOA 3VXUD 3CH8A 5BQ7A 3K8KA 4HKZB 2IAMA 3IU4L 3T3PE 3ZTJG 2Q3ZA 5LWYL 4G6ML 2PTTA 4NFBA 4G6KH 1V6VA 4L5FL 2R39A 5D6DA 3ULUL 1YEHL 3MZTA 4QRPA 2AOSA 2X4RA 1ZA3B 1J88A 1RZGB 2DQUL 3OKEB 1OCQA 4LBEB 1DQLH 5CZXC 2AW2A 5JHDD 4C56D 3WUGA 4OJFL 1YEFH 3BN9D 5LXGL 4M9PA 4M7JL 1CXIA 3BAYA 3DTXB 3FB8A 1CZ8H 3WQ4A 1HJUA 1UCBH 1MCEA 2QADD 1GW1A 5HJ3B 3C09B 3VFGH 3WY1A 4MJ5B 4HDIB 2BNQA 3FQXB 1I7RA 1QI2A 4PRHB 4XPBL 1J8HE 5JW4R 1A4KB 1G9ML 4P5TD 1D9KA 5E8PA 4NJ9L 5LBSH 1NGYA 3ISWA 4XCCH 3RAJL 1TR1A 4OGAC 1I7UB 4KKNA 5JPNA 1QWNA 2WLYA 2O9OA 1BLNA 4MXVF 2B5IB 4LKXA 2ESVA 4N0UE 2XTJC 3PZNA 2EDKA 1G7IA 5DA0B 3B8SA 3LEXA 4Q6IB 1MFDH 2NXZB 3P0GB 3MRQA 4LLMA 1Q0YL 2HG5B 3FO2B 4HXAH 1BGXH 2FH8A 4KKBD 4OTXL 4U4BA 2EPOA 3GKWL 4XP5L 5DJDA 3SGEI 2Y7QA 3MRGB 3VFRB 5ISZA 4F57H 1GXEA 1RULL 1FLRH 3TCXA 4LLUA 3O41A 1GOGA 1F6FB 3MACH 2J25A 3DVIA 4MJIB 5C6PB 4O9HH 4X4MA 3TP4A 4NQUA 4L4PA 4X7FC 3PTMA 3VFVA 5GS1C 4OF8A 4RFEB 3QUZB 3QUXD 4H1LA 3U30B 3TESA 1MCNA 1ZLUH 2BVUA 4KHXL 4IM8A 1L7IL 4RGOL 2A73A 5IVXA 1P6WA 1ZL1A 2I26N 3DRQB 2ZKHL 5D7SH 1YNKH 1PGRB 3HG1A 4YWGL 4LCYB 2MFNA 4C83A 1CF8H 2F5AL 3UESA 4HH8A 2WINB 4EUPA 1O5DT 3K0WA 3EJQA 2CESA 4UILH 3VWKB 4OQ1A 3VFMB 2IG2L 3RQ3A 2IGFH 3HAEH 4IM4A 1OP3K 2VZ1A 1XGQA 4NWTH 3ARBC 1AH1A 1DHKA 1JGDB 1UM6L 1JAKA 4IRSB 3CZSA 1P4LA 3VJ6A 5EUKA 4JPVL 3QDMA 4HKXA 5IB3A 3BUYA 1EVUA 4LARL 4TYUA 4NQEB 2C3WA 3PWPD 4M5YH 5LJYH 3QI9C 1UA6L 4W4NA 3HAEB 1BQLL 2CRZA 3BQUD 1TQTA 4PMVA 5A6MA 4ZQKA 3M8OH 1LO3L 1UFUA 1RUPL 2R2BB 2IMNA 3FQUB 5DRXA 3GI8L 4LSUH 5CZVH 1MF2H 3AZSA 3CK0H 3SCMB 2DQHH 3W9DA 4XPFL 2QHLA 3C9NB 3AREC 3LOWA 3RJXA 1WC7B 4PGEA 4HPOH 5E6ID 5TH2B 5E2UL 3WCYA 1R34A 5KSAC 4KZDH 2J77A 3Q48A 3SCOA 1Q1JL 3PNWA 3MV8B 2YS4A 1SEQH 5KVGL 4ODTL 3MOAL 4PJFB 4PJIB 3D48R 5EOTA 5HGAB 5SX4I 2W60B 3GDBA 2HLFC 1L0QA 1QLRA 4HWZB 3OKLB 2OYLA 3RDTA 1UB5B 1QNRA 5GGQL 2WHLA 2AKRA 1CT8A 3GO1L 2CERA 3VW3L 4MD4B 5D93B 5CEZH 4JG1H 3LKRB 3EO0A 3FFCA 2F15A 4ZAKC 5C0RL 1KENL 4UIMA 1NKOA 4OZFA 3JWDL 1RURL 4UDUB 5DC9B 1T1XA 4OLYH 2HT4D 3W82A 1T1WB 3O6FC 2YD8A 3GMNA 3QULB 4UU9B 4FNPA 3WF2A 1H11A 4QRRD 1MLBA 1GC1C 2JK5A 4WTXA 5D7JB 3L3DB 4JRXB 1C91A 2A6KB 1D7FA 3U46B 1EGZA 1PZ5A 4S1RH 3GJFH 1INQB 5D5MA 2VZ3A 5FK9B 3CFEA 4IPNB 1F4YH 5JW3H 5D1QA 4NT6B 3OZ9H 3GSOA 1JGUL 4W84A 3SEPA 2GK0B 5DURB 3LS4L 4P9MH 2OBGA 4G6AC 3KXFE 2MANA 3OKDB 4KC3B 2WW8A 4CVUA 3GH5A 3MRCB 4K3JH 4FQJL 3QUKB 1WFNA 4HSQA 3WFEL 5EUOF 1I85A 3OB0H 3C08H 5I8EB 2OP4H 3NABL 5D8WA 4G8GB 4YHIA 1ZT1B 3GJFB 4YGVB 2P5WA 1CE6B 5CKGA 4M8QA 3T1FB 4GMSL 2G60H 1XR8B 3X13B 3WQ5A 5GSRA 3ZTJH 3CUIA 3UJJL 4NQVA 1G7PB 2VLJE 3W0WE 1CFNB 4FLQA 2AGJL 4X6DE 3W39B 4ODWB 3RX5A 2UUDK 5DGQA 5GS1B 4EDXA 1U6AL 2K7QA 3ZT7A 5IQ7L 2ID5A 5F1NA 1H49A 2P46B 1EDGA 4RMUA 4MD0A 2PO6A 1HIZA 2NY1C 5F7EH 1I1YB 1IBGH 5BRZB 3LKSB 4HMCA 3F12A 5HYIA 1B3WA 1H8SA 1D5ZB 2NXYC 3QDAA 4M93C 4HIIA 1KXVA 1X5KA 2V7NB 1YMMB 1UKQA 5GS0D 1BZ9A 2C7UA 4Y4HA 2VJXA 1HQ4A 2EQDA 4WO4A 3VI3F 5E2WL 5EG6C 4U1MA 4PLKC 3R0MA 3PQYE 5AUMB 1T0MB 2P24B 1AQKH 1ES0A 1NAKH 5DJXA 3UTTB 5CILH 2XN2A 4HQQL 5D9NA 5HHOD 1AXIB 3QHTC 3TA3A 4LX4A 3QO0B 3HE7C 3G6AB 1E5JA 5ABDE 1B90A 2CMRH 5CBEB 4ZFMA 4DGVL 4FQ2L 1TJHH 2VURA 3K46A 1NARA 1JFHA 2ZUXA 5BXRA 4HZLB 2C26A 4DTGH 3ZIZA 2B4CL 2F7RA 1SYVB 2KUTA 1W9DM 4CCEA 5I1IH 4HUWB 4PRNA 5IT2L 2CKBL 3QI9B 4MAYB 4IS6B 1LO5B 5MHSD 2O26U 2CIPA 2BZDA 1F42A 4MS8D 3KYOA 2RCSH 2QV2A 3QEHB 3AAZA 1OB1A 4YFEA 1AD9A 1IEHA 3BW9B 2NYYC 1FIGH 3DBXB 3NA9L 1OARH 1LG1A 2DKSA 3VSUA 1BIIB 3O9WA 1A3LH 4XX1E 3S5LA 5K9QI 1DE4A 1O7SA 3HZVA 3KYMA 3U9UA 5ITFA 1DLFL 2WVTA 1RZKC 1MRFL 5JNYB 5DHVH 5BCAA 1UH3A 1V03A 4RAUB 2YL5A 5SX5H 2X09A 1LO2L 2VZVA 5E2JA 5DUBA 4ONFH 4MQXC 1DWJM 2D3VA 1QSED 5JHLL 1TUXA 3AC0A 2CPCA 4U1JB 5JHDA 4Z0BL 2YA1A 4MZ2A 5BV7C 3B5TA 2EDDA 3P0YL 2JCCA 2J5LC 1ISXA 1TZIA 4NQCB 2X41A 1ZBKA 1LE9B 5F7UA 4OCXL 5DHVB 5CUSL 1YEEH 5A40E 4EVNA 5ALCH 2DKUA 5GJSH 5CKAA 5C09B 4YE4L 2OCFD 4X9BA 4P5TA 4ZAKB 3K1KC 3EFDL 4U6XA 1NM9A 3REVB 3W0KA 3IDNA 1J0KA 2YKLL 1XGRA 5DVMA 1UASA 1LJYA 4LL9A 3GZAA 1NJ9B 1S7UB 3QEQD 1JZ2A 1GOWA 2X1OA 1IGCH 1S8DB 3O6FB 4DW2H 3B9KD 1IC7L 2IWGA 3VXNB 1CXHA 2HJFB 4MB5A 4HG4J 4ZO9A 4XWGL 5DEFA 3MLSH 4YXHH 4XB3A 3RL2A 4CCDA 3L5XH 1TTGA 1KYOK 2VZOA 43CAA 2WUCL 4POUB 1W0VB 3BVXA 1EEQA 4JZJC 4DOHE 4R4ND 1XCWA 4V1DE 1UR2A 3STLA 4QTHB 3RZCB 2N1KA 1FRGL 3MNZA 5T1LD 5F88A 4DGIH 1PG7H 2HTLC 3ABZA 3GSVA 5EFIA 5A8OA 1A6UL 5E9DA 3GIZH 3ZE0F 1V6WA 3N1GC 2X1WL 1JNNH 2HVJA 5GGTL 4Z7VA 3BN3B 3KLHD 1CENA 4OKDA 2D03H 1NWSA 4YN5A 5GNXA 2OTWB 1S7RB 3QZWA 5SWQA 1A1MB 1AIFA 1CLYL 4X5LA 2ATKB 1H3UA 2DWDB 1K6QL 1FVDA 4PJBE 3UTOA 3TO4A 5DMJB 4D6HA 2V2WB 1DVFC 1WTGT 5L2KB 5HPCA 4R96B 1OTTC 3KHOA 3MREA 3TOPA 1U8MA 1CG9A 1KLGB 4X80H 2R8SH 3CC5A 3W11D 3RUGB 4HH9B 1KIRA 3BSGA 1HWHB 1UXWA 1CIUA 4B3LA 3I9GH 4WJ5A 3VRIA 2NY1B 1NUFA 1VPOH 3WD3A 3N9GL 4HIEB 1ZGLB 5SV3A 1CECA 1MSPA 4S0SD 2DSVA 1ZXQA 5KVFL 3H54A 2NXYB 3QUMA 3BAEL 5TPWL 4HIJB 1FE8H 5ICXB 3APGA 3L9RA 4OT1L 4RCAA 4G42A 4JDTL 3V95A 3A24A 3TYFA 2DDXA 2VAAB 5J1TC 3SKUD 2ICEB 4XMPH 4LCUA 2NZIA 1AE6H 5BVJB 3IJHB 1WT5C 3P11L 1FNEB 1OGAE 4NRXB 1PSKL 3PWPA 2X4UA 4XI5D 3GNRA 4JQIL 4OGZA 4MCYA 3VGBA 4NZRL 4HPHA 4XVSH 4Y19D 3C5ZC 3OKMB 4PMDA 4J8RA 4UT9L 1DWIM 4PTWA 1JI1A 5DJAB 4NP4L 25C8H 1E4KC 4Y8AA 3SDCD 5LVEA 2XN0A 3K81A 5FKAB 1OAUH 3ZDXE 1KEML 5IMKA 1HL9A 1U91B 4EI6B 5EZJA 4LCCB 4YHNB 1TA3B 1JPSL 3MV7B 3PF2A 4Z7WA 1T0NB 2PUQT 4FFVD 2FD6L 1WDPA 5FUCC 5HI4D 5IIEA 3S4SG 4QRPE 1CICC 4G3YL 1KELL 3DURB 1BVLB 3NIDE 3PL6C 4UB0L 3SQOH 1IC5L 3FN0H 5EUOB 4Z7OF 2AK1L 1OSZB 1HH6A 2V2TA 3SUVA 1S7VB 5HI3D 3RWGB 5GGUB 4HUUA 3NCCB 4B41A 1OBAA 3EJUA 2XTJD 1MH5A 4L3CB 3MBXL 1BM3L 2UYLA 4XP1L 1WDSA 1N59B 3WH6A 5IB4B 3T0EB 1ZT7A 2Y8VA 3DV4B 3EYVB 1PFCA 3L7EB 1CLXA 4K2UH 5FYLH 2LVEA 3D9AH 3ARWA 2J5LB 5C6WH 1P7KA 1TCRA 1UZ6E 2DDQL 5DK2B 4HWEL 4HWUA 4EAMA 2W9DL 2XPGA 4K94H 5F6IC 4HUVB 3NSXA 4PG2C 2ESVE 1VGKA 3WS3B 4NJAH 1T2QH 3CH1A 1C08B 5ESVA 4JGUA 3KG5A 1R3IH 4GUPA 4RMSA 4DKFL 3THML 4H8VA 4N8VG 3OG2A 5BWFA 3FRUB 5T5FH 3VFSA 3LN4B 1XC6A 3WHXA 4ZXBA 3TBSA 2Z0BA 3SE4C 1NC4A 2VL4A 3VMOA 3WH7A 4Z78B 1A6TB 4K23H 4FLSA 5ISZE 3NYDA 4FN0A 2ALWA 1T83C 2YC1B 4QCEA 4FQXC 3IETA 4OKVB 5A2BA 2ZUVA 4X4ME 2X70A 4JANA 5LYRA 3DSNA 4WFHD 5LGHH 2MHAA 3MFFB 3QDGB 1NQBA 2BMKB 4RNRA 2CK0H 2Y07H 2EPMX 4D6CA 5CD3B 1IFHL 3CJJA 2L7UA 4RMQA 5JPMB 1C12B 2BSSA 4PJDF 5IVXE 5IESH 1FH7A 3MYJB 4PJAF 4JZ5A 2J3SA 1F2XK 4B5EA 3HG1E 4BFIB 2VIRA 4AH2A 4LCWB 1TVNA 4AEFA 5JZ7C 4GFTB 3L4UA 2O93L 3JTSB 1B0GB 1OP5K 3DMMC 2H1PL 3MMWA 2A3EA 1DUYA 3TNNA 2A38A 2D7TH 1RUAH 3CMGA 3MRPA 4IDJL 4JFDD 2E9MA 4Y5XA 1EFXB 5CGYC 2WZEA 1P5UA 3NDYA 5DD0L 1A0QH 3WQ6A 1A1NA 1IGFH 4TVPH 3Q3GA 1CWVA 3TONA 3OR6B 1MCOL 3TT1L 5E8DH 1HXJA 2X4NA 3GEWB 4NC1E 3QDME 3VRJB 3PWVB 1TZGH 1I3RB 3GMLB 1CGTA 4K8RH 4DZ8B 5IK3A 4OB5L 3MLVL 5C0AD 3ALWA 3AGVA 2DYPD 1XGPA 2EH8L 3HUJF 4P59H 4HBQA 4XH2B 5IB5B 3ULSB 1MQPA 2FSEA 3REWA 5JIWA 2G3JA 2XFRA 2JTDA 3MLRH 3B9VA 3FQTA 4TTDC 3CFDB 2AJSH 2DJSA 1JRHI 2R29H 1CGSH 4IRJD 4JFVA 4W6XB 1MW1A 1BX2B 1SM3L 3VGHA 1RI8A 1V7ML 3JUZA 1ADQA 3RU8L 3EOTH 4JFHE 2X4OB 3VWJD 3C5SA 3GRWH 5FO9B 4HDIA 3C5ZB 5JUEL 3MLTB 5EU5B 3UBXA 2H45A 1S7SB 3UJTL 1A5FL 1ACZA 3TZVC 4QY8B 2F7PA 3IDJB 1WWWX 3ARTA 4ZFZB 2MKLC 4K7FB 4C4KT 3KPRE 3VILA 1GH7A 4HK0B 3E3QE 2QHRH 2VDMH 1K5NA 2OYPA 4LHUD 4UNUA 4Y1AE 3DX6A 3OGVA 1FZMA 2R0LH 5CEXB 3ORJA 3STBA 3TIDB 4PMYA 3A4XA 4Q6IA 3DUSB 3PL6B 5FL1A 1TVHA 1JG9A 3FFCE 4AIZA 1C5CH 1JF1B 5GGVH 4RMRA 4H25B 4YHOL 1JNHB 1TE1A 3WEXB 1PIGA 4MSWB 3IFOA 4OF5A 3KJ4B 2EO7A 2VN4A 2Z1SA 5CSYA 2VC2H 3V6OC 5FA3A 3H2WA 5AZ2H 4P3CH 4WCYL 3HA0A 4JFFD 3AY4C 3DX9B 1BECA 1VF8A 1LP9E 3FO1B 1HJQA 4UQ3A 4PS4H 1CR9H 5D5ME 1BEYL 3PWUA 1KJ3H 3IJSB 4PTTB 3IF1B 4XPTH 3PWNA 4XWOD 3B9KA 1GQIA 4UV4H 1BMGA 4MPKA 3ZE2E 3AS2A 2ZSWB 1NLDL 4NFDA 4L4TA 4HUKB 3OXRA 4QNPF 2Z35A 1BQHA 4ZOAA 4HMDA 1OCWL 4GRLC 1BP3B 5T3ZH 3W5NA 3MU7A 4NGHL 3UDWC 3ZJKA 3PHQA 3KR3H 1X5ZA 4W4OC 3RVXC 3BXWA 1FAIH 4CVZB 2P5WE 3N50A 4NQXB 1GJUA 4FQXB 2VX7A 4E42B 1Q9WA 2VLKA 4MXWH 4Y5VB 3ZDYE 2ZXBA 1MI5B 1TQUA 1AO7D 3QNZB 2QQNL 2DT1A 3BESR 2PI6A 4X5XA 4OF7A 2VDNH 3BVTA 1KPUB 2IXUA 1JDDA 4H0GA 5C0JB 4AD2A 2OL3H 2P8LA 2Q6WA 4UNTA 4Y4KC 3QWOB 1DBBL 2YOCA 4N42A 4I0CC 1U8KB 4ODHH 5ADOH 1E6OL 2BOCB 4POZC 4V2BA 1EAPA 5EA0L 1J8KA 3AHYA 5ILTH 1YEIH 2UWEA 4K3EH 3CSPA 2AJXH 4LPCA 3VXRB 4CD4A 4RGND 5J8OA 1PY9A 3S4SB 4TSCH 4U0RB 1QNZH 4I5BB 1FO0A 2R56H 1P6FA 1X6LA 2WCSA 3OWEA 1JUFA 5JOFA 1QLFA 2OL3B 1JGEB 3U79A 2DQCH 1SY6H 4MVBC 2P5EB 1BSIA 3GSXB 3OAZH 5F3HB 3AICA 2K3TA 1HNYA 2DQTH 4I0KA 1V5JA 12E8L 3ELAT 3TTYA 2VAJA 5C0DA 2DQFA 2CDFB 3EKCA 4J23A 4KMTL 3V6ZA 4Y19A 3NCEB 2Y5EA 1J05B 1N0LA 5DR5H 3BDBA 5HI5C 5TE6L 4PJ9D 4FABH 3C87A 5E8EA 5A2JH 3SCNA 2RR3A 4J7RA 2MTPA 4FNRA 2XFFA 3VXUB 1R5WB 4YAQB 2F7OA 1LK2B 4BH8B 1QEWB 2JF7A 3B9EA 4LSSH 5L6YL 2HN7A 3U6RB 1NOWA 1FVCA 5EIIB 4N8VB 2PWHA 5IHZA 1J1XH 3L3DA 4K71C 1EX0A 4U1HB 3TZVB 3O2LA 3U0WL 4W88A 5EU6D 4KTEL 1NP0A 1EHLH 5JHDE 4C56B 4CBPA 4FQLH 1PJ9A 1IKFL 5E0CA 3MRKA 2JCCE 3WL0A 3TH4T 3HG2A 2DGAA 3EHBC 4MDOA 1UJ3C 2IPKA 3QEUA 5D1XD 1TVDA 3OJDB 1V3KA 1G0DA 2R4RH 2VRJA 3QUKA 4ZODA 4PJDB 1MHEB 4PJAB 3RP1A 1NFDF 2YPLD 1GL4B 2EH7H 4R4BA 2B39A 3G6JF 2V5MA 4TN9A 1UQSA 3BKCH 4M7LL 3ZKND 2YXFA 1MLCA 4TOQA 5I1EL 1U92A 4KK8D 4EOWH 2AEPH 4N0FB 4Y4FD 5DJCB 5EWIL 4E41A 4HW6A 4JE4B 3WUWA 1IKNA 5EOCH 2WB5A 5HXMA 5HHPB 4O2CB 3VX0A 1IZKA 3MRIB 3MXWL 4P2QB 5EC1A 3W39A 1XIWD 2YUVA 2HRPL 4M1RA 5J9PB 3FQWA 1QFUL 5SWSB 4HIXH 4TUFA 5IG7A 5GRUH 1C5BH 4FOMA 2EDJA 1J1PH 3ZSSA 4MD5B 2WWCA 3MQIA 3LKSA 1A7NL 3BKMH 3O11B 4YDLC 2B8OT 1E71M 3HUJB 2PTVA 2C3VB 4JM4L 4K7PX 5E9DE 2DLEA 3BFOA 2X10A 4X6FB 2KKQA 4BFGA 3VD9A 4QT5B 3UG4A 5GGSB 4Z7VE 3OB8A 4X6EA 1TQWA 4NSKA 5FYJE 3MRBA 1JNLL 1PEWA 1D5XA 2FJFB 2Y5TB 3QUXB 4OI8A 1D5MA 3ARBA 4AZBA 1B3JA 2QQKH 4X99B 3LRKA 2EEXA 4I48B 4LF3A 4NZJA 5B38A 4KY1H 2DOCA 4ZO7A 4PR5A 4GRMB 3VIPA 4XP4H 5FHBL 2CIKA 3VD3A 5I1DB 4UQ2A 3Q6FB 5I23A 4UBDC 5F70A 5DQDH 2R69L 1H1NA 5GS2D 3ZZ1A 4F8XA 1KCSH 4F7CA 2WMKA 3GB7B 5ECUA 3HC0B 2CH8A 3VFTB 4U1KB 4Y4KB 4XUYA 4JY6B 5CJQL 3CUFA 4BSWA 4JFDA 1XH3B 3ARRA 1F2QA 3KS0H 3O3BA 2B1HL 5AYBA 4XBEL 1R3JB 1RZJC 1UA3A 4GW5A 2R0WH 4YR6B 3CH9A 1CLOL 1S9YA 4HXBL 5D2LA 1F90H 2AJVH 4TOYH 1WCBA 4DKDC 6CGTA 2KPNA 3E8UL 3GMRA 3AREA 3JSSA 4GG8B 4NNXB 2DH3A 2XVNA 3PWPE 4PN2A 2DYPA 1BFOA 5TGBB 3WS6C 5KSAA 1GPFA 1VBUA 1S7XA 2XZQH 1EHXA 1AGDB 3AVEA 4RA3A 4YDVB 3MUGA 3IS1X 2D22A 2PW1A 3DPBA 2PNDA 4LU5H 5T33L 5FGRA 3B43A 3BEWA 4NZCA 1V6UA 2V7HB 3QPQD 4E0RA 4PGBA 3QJFA 1ZU8A 3VWJA 1UR8A 5J89A 3A6OA 4Z7WE 1AD0A 3QUYC 3QUML 3LKQB 4KI1A 3OXSB 1M03A 2VR5A 2H6PB 4HP5A 3L5WB 4FFYH 4XV0A 3LPOA 4ZAKA 3SCQA 1CQYA 1JNDA 2ZICA 1NBVL 4ZS7L 4C7DA 1BBDH 2IALA 4BCEA 1AGBA 2P49B 3OR7A 4R7DB 3DXAD 3O6FA 4XPAL 4WUUE 3VIGA 3WXVH 4KROD 1JK8B 1A7PH 5IVZB 3B5HA 4FXGB 3QOMA 4QCIA 3IFNH 2CNCA 4GMTH 4ZFOB 1Q72L 3MUIA 1U8PA 3U5UA 1XZ0B 1EERB 2XNAA 3RVUD 1K9EA 1ZT4A 3EYOB 1E28A 3IDIB 2O9PA 3RPMA 2H2PC 3IFPB 3F7PC 4YXLH 5DUMH 3WJLC 5F7HA 2EXWC 3TBWB 1R33A 4LSQL 1FA2A 1UJ3B 1F11B 4YBLC 2PBOA 5TF1L 3ZO0A 1CFQA 4LSRH 1EO8H 1OAYH 2WUBL 1RK1A 4MA7L 2WANA 4QRRB 3IT8D 3GSWB 5DT1L 3QJHA 3VSTA 1MCPH 3PP4L 4QWWD 5E4EC 4D0BA 1UR0A 4G80A 4P49A 1GOOA 2VDQH 3BLPX 3BUDA 1H41A 3ZM8A 2GJRA 1R8LA 4MDJB 2FB4L 2BK8A 4HUXA 4A3YA 1C16A 1EK3A 2XTLA 2V9QA 5BZWB 4KKLD 2IC2A 1UEMA 5F1IA 3RUGA 5F96L 3RX8A 3O8XC 4HH9A 1X6NA 5EOCJ 3LKPA 1B0RA 2NNAB 2DLTA 3MOQA 3GNOA 1MCFA 4JN2A 4YDLB 1F4HA 1M71A 3TVMD 4X8JA 4ZTPH 1MQKL 5CGYD 5A6LA 1RZ7L 2SEBB 2WKLA 2DLGA 3P2TA 2ATPA 1FGNL 5I8KH 5IHBA 1V6XA 3U4BH 1HILB 1T3FA 5GNZA 5CCKL 4FNTA 3UAJC 1CXKA 2YSSB 4KK9C 4OD1H 5IGXL 3ECBA 4PMUA 3UZVB 3MLYH 1A14H 4YDIL 3AXIA 1NFKA 3JV0A 1E6JL 3FONB 3D4YA 3HE7A 2X9XA 1RIVL 3GXTA 5JR1L 1R24B 2FBOJ 4TTDD 1CL7H 3KWWB 5FO7A 5IB2A 4U3HA 5H2BB 3WKML 1KIQB 5ICYA 3ZTNH 1VFAB 1HHJB 4N5EC 4J3XA 2HJKB 4CW1B 4YHNA 1CXLA 3LQZA 3QG7L 1KPVB 2Q86B 5FUZH 4DWHA 5KVDL 4W81A 4S1SL 5HHOB 2VVNA 2GSIB 1NCBH 5K93A 2AEQL 3HNTL 2I25N 1JZ7A 3PABA 5IHSA 1KBKA 5IM7A 4QLKA 1A7RH 5AEAA 2XQBL 4JPWL 1NFDB 4FP8H 3GIVB 1PBYA 2GJZA 1MW2A 2IGTA 5F9OH 3G6JB 4PCSA 3H9YA 3LZFH 3MMEA 2O61A 3NDZA 4CU7A 3UERA 4D9QE 4RRPA 3VFPA 1HINL 4OFDA 3PJSB 2JALA 3NIFE 3ULVD 2QSQA 4P48A 1BTCA 1H3TA 2A74B 4TNWK 3ZDZF 4JIEA 2QJDA 2G9HB 1KPRB 3DV6B 3ES6B 5E00A 4OI7A 1HJXA 5A6BA 1FNGA 4MNLA 3U7YL 1JHKL 1U58B 5D8JL 4ZSOB 2MJWA 3DYMA 1P69B 4Y2DC 4FFWD 5DTFB 1QSEB 3AIRA 5EU6A 5DJ6A 5E5UB 3PN8A 2OK0L 5DEZA 4HGWB 3TYGL 3WNKA 4JFPB 1ZLWH 5I1CH 2D7OA 5I73C 5IJKC 1ADQL 4KI5C 4R97C 1JZ5A 4X7DC 3AS0A 1UXSA 5C71A 2HFGH 2FIKB 4G6KL 3W26A 5D1XA 4CJ0A 3MRRB 1EQPA 3PHOA 3M1BB 2XKNA 4JZJA 4PIRF 1FNSH 1W8OA 5GS3A 4D72A 5A2CA 2YPLA 1P9MC 3FL7A 2HMID 4JPIB 5DEGB 1DQLL 5INDA 1KWGA 3FOLB 2NY0D 3QEQB 2Q7YB 3U36A 3AZRA 4YIQA 2RFXB 4YBLB 3FZUD 3N1FC 3N13A 1CZ8L 4JFOA 2GY7B 1UCBL 2QMJA 3MCKA 1MIEL 3BC9A 1LE5B 4MQSB 5L8LB 5E08H 4MB1A 4L4TE 3VFGL 4U49A 5CJ5A 2D9CA 4LHUG 4BFIA 4G43B 3LQAC 4ISVA 1UR1A 4UOZA 5LBSL 2BVOA 4YPGA 4Z2JA 1HKIA 1I3UA 4AENA 4F15C 3CX5J 3QR2A 4H8HA 4P4KD 5ABFA 5KSVB 2FHCA 4Y7MA 1EGJA 1H15A 3P9MA 1ZSDA 5F9JA 5T1LB 3AMDA 8CGTA 1DVFA 2EYTB 4GW4B 2VLKE 5EO9B 4OAWB 5IWLA 2J7EA 2J7HA 3LN9A 3W27A 4QDMA 3POCA 1OD0A 3WNLA 1MFDL 3L2MA 2B20A 2W63A 1IJ9A 1HNFA 4F7EB 4HZ7A 4JGJA 3PWVA 1BGXL 1DQJA 1KF9B 4JY4B 1J12A 4LVEA 3B5GA 2R2HA 4HEME 4GO9A 1KJVB 5GJTH 3JV4A 4HKBA 1BVKA 3RTQD 3RHWF 4LRNH 3HZMA 1OW0C 1FLRL 3FRPG 3OKKA 4Q97A 5D70H 2NY3D 1N26A 1NBYA 2CLVA 3CFDA 3MACL 1UM5H 3DVGA 4IIQC 3SURA 1NDMA 1BIHA 4O9HL 4RDQG 2UWEE 3L3GB 3DX8A 4A4AA 3CUPA 4MWFA 4LDOB 3QQ4A 2YD3A 2X4OA 3FHQA 3OSKA 2ZP0T 4RSVA 3C5ZA 4J1UB 4RDQF 5IEHB 3STZA 1EJOH 3KPLA 3D2UD 4RFOH 2B0SH 3FN9A 5D7SL 4JKKA 1YNKL 3MO1A 3MV8E 4LOUD 4MNGB 3K7UA 4ZFZA 2J4WH 1CF8L 2QHAA 3P4MA 4PJIE 1NMAH 1CYGA 5JXEC 4DCQA 4NN6B 4PMNA 2P8MB 1FDLH 1CICA 3SPVA 5ALBH 1PW3A 2I60H 2IGFL 3A5VA 1LLOA 1SBBA 3MJGX 4Y19E 5KSUB 3H53A 4NWTL 1K8IB 1ONQB 1JGLL 1KLUB 4TVSa 3GXIA 4H25A 1UHVA 4GI6A 5DGRA 3SDCB 2R23B 3PWLB 3SO3C 4HV8A 3LXBA 4K07A 3P0VH 4JRWA 2FWOA 3NCFB 1FO0L 3TJHD 1BWWA 3CUHA 4AMWA 4DVBB 4M5YL 2I9TA 3H9SD 3OIHA 1U42A 3DO7B 1UYWH 2RBLA 3VM7A 4PJEA 1K85A 1RIUH 4GBXD 4GW1B 3DXAA 2C9AA 3M8OL 3SDXB 1QFWI 2Z92A 2WMIB 4PG2A 3WN5C 5CZVL 1MF2L 3CK0L 5LAXB 2XTJE 2WV3A 4NCDA 1CD1A 2DQHL 1ODZA 5CD5D 2IXVA 5BVPL 2NY6D 1C7SA 4HPOL 3DIFB 2RJMA 4KZDL 1CBVL 1LL4A 2JIXD 2EXYD 4Z18A 3EJRA 2FLBT 3MRFA 1SEQL 1T7VA 3S6CA 3P9LA 4LVHC 1OSEA 2JB6B 4QGYA 4YDJB 3H55A 1QI5A 2IH1B 1WZAA 3BAWA 2W5FA 4X7EC 1KJMB 1NFIA 1T83A 4E41E 4FQXA 1ULVA 2VERN 1FFOA 4F7MA 5IHLB 2EO9A 3QNZA 3QHNA 4NQSA 2NW2A 4MQ7B 3ZE1F 4ZD3H 1E4WL 4HT1H 5CEZL 1OGTB 3OAYK 3MR9B 4JG1L 4LIQH 1QBMH 1A9BA 4YX2H 1QSFA 4Y7EA 4NBZB 1G7QA 1JPFB 4MDIA 1KCRH 2QLYA 4PTMA 5I6XB 2J62A 4OLYL 2DS4A 4BUGA 4XTRD 1MUJA 5GGRB 1LQSR 2W38A 3IDYB 4FZEH 5HY9B 3OHXA 1S9VA 1H0GA 5CMAA 4YUEL 2J8UA 4LPWA 1FN4A 1X5JA 4X6CA 3UR8A 1MCJA 2LABA 4S1RL 2A1WH 3DMMA 1RJCA 3BXNB 3VXRA 1F4YL 5JW3L 5MENA 1N2RA 4BH7B 3OZ9L 3VXTB 1KULA 1KJ2A 2ZUQC 3IKCA 2AMGA 3TVMA 3MNVB 1FZJA 2GFBA 3CDGA 4OV5B 5E94B 4KJYB 4YQXH 5E0QA 4AJ0A 2V3GA 3WQ8A 1E1FA 3EJPA 2VNCA 2OL3A 1DCLA 3CX5K 4K3JL 2VQTA 4JDZA 4TUJA 1Z9SA 2D7NA 3TTOA 3EDDA 4ZS6C 1NCWH 1PZUB 4Q9QH 5JW4Q 3C08L 4MJ2A 2OP4L 5DFTA 3U0PA 4NCC1 2GITB 5HTSA 2VDPH 1R3KB 1QQDB 4JFDE 2CLRB 2CXGA 5C0EB 4G8IB 1FL6B 1C8YA 3HFMH 3KDMB 4P5KB 4BUHA 2XA8H 5KOVC 4I2XA 3V0WH 4OFVA 3TPUB 4GAJH 4YAQA 5K9KB 1QEWA 1R86A 5DD5H 5D2LE 1MFUA 3A67H 2J8GA 3LD8C 1DBAH 5C0AB 2NCMA 3CCHB 4IHOA 1XGTB 4GSDH 3S37X 5F7EL 1IBGL 3S2CA 1BZ7B 2ZX5A 3CXDH 4KUCD 4PJ5A 5E2TL 2C3HA 4OCRL 3J8F7 3KLAB 3PZUA 4IRJB 3MODH 4LPXA 5DRNB 3DWTA 7FABH 4X9IA 2QQLL 5JUVA 3V7AE 1RUQH 2LU3A 1X5AA 3PWJA 3X17A 2BNUB 5DSCA 8FABB 5T3XD 3F6LA 4QYOA 4B9YA 5DJYA 2WMHA 3V9FA 4E4PA 4HJGA 1TJHL 5K9OA 2PCPA 3SO3B 4AEEA 2HKHH 1TETL 4DTGL 4ATWA 4TVUA 1TMCB 2ITCB 1T5WB 5I1IL 1CDYA 5ACZA 1LG2A 1IEBB 1RD6A 4LHUB 3ZKSD 3ARVA 4LAQL 2AXJA 3AY4A 3OJMB 4FQ1H 1KG0A 1BYAA 1EUTA 2RCSL 3BD4A 3ULUC 2EPNA 3OKNB 3QCTH 1FIGL 2BXZA 1OARL 5SWSA 1A3LL 1E40A 2XM2A 3G5YA 2J75A 3AIVA 3QB7C 3ARDD 5DD6B 1UD8A 4GKNA 1NC2A 2IADB 4ONFL 1REIA 2Z31B 3I02B 3SCSA 3FB5A 2FL5A 3MRJB 4NRYB 2VDKL 4JFFB 4GRLA 3GFUA 5GGSA 1TG7A 1FFQA 3UDWA 1NBQA 3TTQA 1OL0A 1JMXA 2KDGA 3BDYH 4PYGA 4W4OA 4OQTH 2E5EA 3BIBX 1TPXB 3BAKA 4R2GC 1GC1L 1DANU 4Z5RA 3V79C 4LLYA 3QXDA 4MNMA 3FO0H 3O45A 5D2NB 3D5OF 3SCPA 5L2KE 5GJSL 1IM3B 2F8OA 4Q6YA 5F44A 2UZYB 5C0BA 3JUYA 3D3VD 5C92A 2ILLA 3RUGE 1HCFX 5EBLB 3W2DH 1KGCD 4H41A 1TITA 4JFQB 1PX4A 1FPTL 1IGCL 2DMKA 2F54D 4JY6A 1S5HB 1D3CA 1FFNB 1G6VK 4YXKL 1NCDH 4NKMB 3IJ9A 4LYPA 1JWSB 1R3JA 4YXHL 4U2ZA 1AO7B 1EPFA 1FZOB 5BXFA 3L5XL 1RZIA 4FQQB 1E4JA 1QACA 1HIMH 3P4NB 1IAMA 3T77B 5F6HI 4Y5YC 3HC3H 2YDSA 2ZUQB 5HGDB 4MNQA 1M7IA 2YN5A 4WI4A 4RE4A 2R0KH 15C8H 1HDMA 2I5YH 4Q58C 1TJIH 4JN1H 4L8SC 4DGIL 4ZTOH 5A3ID 3B4NA 5FA4A 1QNQA 1U8IA 3GIZL 5D6CB 5L2JA 3MI6A 4F66A 1JNNL 2F8VA 2GTWB 2V5YA 4WTZA 4NO2A 1P2CB 4HUNB 2MOVA 1U41A 5BROA 2D03L 4JR9H 3LPGA 3T4YA 4DUXA 2VO5A 4CVXA 2A3HA 4RGNB 4UDTA 5T1KB 2QEJA 1T5XB 2EYSA 3BAJA 1HSAB 1NEZG 3S3SA 5DQ9B 1ETZB 4NNPH 3LIZH 5K33A 2PXYC 3VPLA 5F7KC 4X9GA 1G7HB 1G7JB 3CSYA 2GJ6A 2NY5C 4X80L 2R8SL 2W07A 1NWRA 4H26B 4ETQB 2BRRH 1G9NH 3KPOA 4BK5A 3GM8A 3I9GL 1YPZA 4X7CC 2EDOA 1AQ0A 3A3HA 3O3EB 3HMXH 3NZHH 3N04A 5D9SB 4HOXA 5LKNA 1A6AA 2VDRL 3PGDB 3EJYC 1I8LC 5M3WA 1FE8L 1XF4B 4MX7B 4PJ9B 3UG5A 4HC1A 4XPGH 1BQCA 1H5BB 4XXDB 1RQ5A 3K8LA 4M62H 4XMPL 2FO1A 4GAYA 1U8NA 1VACB 3WE6B 1AE6L 1N5AB 4PJCB 4A2MA 1F6AB 4ACYA 5E9AA 1VFMA 3H9SA 3ZKXC 1CD9B 3K4ZA 1BJ1H 4XVSL 2Y36H 3TJEL 5EU6E 2ZOKA 3SUUA 4PV9A 4UUJB 3GHBL 4GBXA 1RZKL 1XYZA 5F8QC 2WWDA 2DTSA 5HD8C 25C8L 4WSJA 3RGHA 2OSYA 1IILE 1QKZH 5H35A 5F1OB 1IC4H 1OAUL 5BOPA 3M7SA 4OFYD 1FGVH 3U48A 1P1ZB 1IAOB 2F18A 1RJYB 3GMPA 3DETD 4XNUH 3SCVA 3BPLB 1U9KA 4KXZI 5SV4A 5HYSG 3IANA 1E4NA 2ITDB 4HS8H 4OCYH 1N6UA 5BV7L 1NAMH 2YPLE 2UWFA 3CMOH 2FCBA 4YPJA 1WTLA 3FN0L 2FJGB 1I8IA 1A3HA 1UGNA 2J7CA 4XZBA 5H94B 3JWDC 2B2XL 3HZ3A 3KL3A 4Y4FB 2O9RA 1P84K 4ZE5A 3ULVF 4XBPB 4YO0B 4RGMB 5CJXC 3CFBA 2K1MA 1IMHC 1KTDB 3IDGB 1U8QB 2EIZA 5KAQF 4LCWE 1XIWB 1MJJA 1ZK9A 1QO3B 5DXWA 1FL3B 2C1OA 4K2UL 3D9AL 1NAMB 4EI5D 4G9FD 4KV5E 4JHAH 2MCPH 3DUUA 5C0CD 2VR4A 4I0PC 2JKXA 4HAGA 4NJAL 1ZLVK 1T2QL 3L3OA 4Z95H 4X9YA 3HMWH 4PRAA 4R26H 3AU1A 2RQ8A 3GXNA 1HNGA 1ZEAH 1BAGA 2J8OA 1BYDA 3SE8L 5GS2H 3BIKB 5T5FL 2DH2A 2HT2C 2IPUK 1HI6B 1UQZA 1ZAGA 3VIHA 1VGEL 3TWCH 1MHCB 1N5YH 7A3HA 2AV7A 4C59B 1WFUA 2BVDA 4M5ZH 1VSCA 2YBRA 5J1AA 5L9DL 1I9IH 1JHTB 4U1IA 3F5WB 2AS5M 1PQZB 1E55A 1VEMA 1I8KB 1HXKA 1GYAA 4R3SB 1WBZB 2XZCH 4ODSH 3UTQA 3WIIH 4L1HA 1E5NA 3ILPB 2VLRA 1KIPA 1MJUH 3B83A 5LGHL 2HT3D 2VLMD 1SJEA 2CK0L 4UAOC 2Y07L 5EZIH 3DRTB 4YFDB 1BAFH 3AYRA 4NO0D 3PV7A 3I3DA 1XAUA 1M6OA 2NY5H 4BM7A 2Z4QA 4L3ED 5IESL 4PYSA 3BLKA 3EUUA 1F4XH 3H9ZA 5EPMA 1BD2D 2FYVA 2D7QA 3MGOA 4F2MB 4NOFA 1OPGH 2OJEA 5TJWK 4HWBH 3QUYA 4M00A 4OZIF 4MAUH 2BOBB 4S3KA 4FMVA 3NTCH 1J18A 1H4PA 3IU3A 5JO5B 1RUAL 2PXYB 4HGWA 1Z9OA 2OQJB 4OLUH 4X7TA 3HI6H 1R87A 2V5RA 2Y2WA 1A0QL 4N1EA 4QKXB 3SKJH 1JP5A 2ZCLH 1DZBA 1IGFL 1FL5A 2BX5A 2ADFH 1W2PA 5DUPH 2HTKD 2NTFA 4GKSA 5E8DL 5JORA 1YYMH 3GMMA 4W8LA 3EOBB 3T0BA 1TZGL 4K8RL 2E7CA 1R3LB 1WBXA 2YD2A 1K2DA 1VERA 1ZHLB 3GH7A 4P59L 3ROOB 3AJ7A 5DDHB 2XA3A 4PJEE 2NY2C 4LLWB 4WDIA 2XTKA 1D6EA 1IGIH 1AI1H 4F80A 5BZDA 3WJLA 4F37K 4X83A 1E27A 5I1GH 2AJSL 2PYFB 2R29L 1CGSL 2M26A 4QXGL 1O6IA 3EYSL 5LQBH 2XYLA 3VA2C 4XCEA 4KROB 2J4GA 1FNAA 4TRPH 2BSRA 4PFEA 2V2XA 3EOTL 3F7QA 5HOSA 4U6YA 1WZKA 3MJ7B 3ZKXB 3GRWL 4HWNA 4RZCA 4F9LA 3W9EA