1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
1P4IH 3FHQA 4X8JB 2AK4E 3SKOA 2FRGP 2WMFA 2YFNA 2V2WA 3LQAC 3WDJA 2IANB 4HPYH 5LG1A 3VDHA 2EC8A 3CC5A 1QBLH 1DEDA 3A23A 1MRDL 3PZQA 4M8QA 4W4OC 2J12B 1ONQA 1FAIH 3ILQC 5M03A 4XH2B 3II1A 5ICZA 1LNUB 1NBQA 3EJRA 4Y16D 4H0HB 1J7VR 1OP3H 2W9LA 4TULL 2WHMA 1N59B 1TXKA 5GRYA 3VDBA 2FLRT 4AXNA 4HIXH 1SMDA 3SE4A 2Q76B 5IB3A 4S1QH 4WTXA 4S2SB 5HHMB 4KK9D 1I9EA 1IKFL 4X6CB 5DWUH 4C4KT 4BZ1H 3QSKB 3VRLE 4JFZH 1IC7H 4L29B 1F02I 5KSUA 1NQBA 3T8XB 4HKJA 3VFSB 5JIPA 1JTOA 4YX2H 1IGIH 4LYPA 2PKDA 3GSWB 5JW4Q 3ZDYF 4U2YA 5T3XL 2HMIC 1DWIM 1AR2A 3BP6A 1TQWA 1EGZA 1MCFA 1RIHL 4UQCA 1G6RA 3P4MA 2FCBA 3OJVC 3VFUB 3D3VE 1G7LB 4N0CD 2F7PA 4ORZC 4PP1C 3VXSE 1H3WM 1BREA 3DDFA 2Z8VC 3DX6A 4GT7A 4QRRE 1FO0A 1QO3B 4N1EA 4Q9QH 5HJ3B 3O9WB 2AK4D 4KDTA 3MJ8B 1HHKA 2QQKH 4KV5F 5E8DH 3BP5B 1K4CB 4CD7A 4QF1A 5E4EC 3L3OB 3AMKA 2DQUH 1C08B 1OAQH 1XH1A 1ECEA 3WFZA 1X7QA 1UR2A 1BZ9A 3HPLB 2BFVH 2HT3D 2J5LC 4M7KH 4PJFA 3WLBB 4FQLL 1T3FB 2XFXB 1K9FA 2QJDA 2JELH 2BVTA 4O9HL 2ALWA 2EPKX 3L4YA 4R7DA 2ZG3A 2J7HA 1DN2A 5C09A 2ZCLH 2RGSA 1R3LB 4Z7QF 1CICA 1YN6B 5C2BL 1QLFB 3IFPA 4P3WA 2J4WH 3FTGB 5JPNB 1QTYT 3G9AB 5D1ZA 5ISZA 5EU5A 3X11B 4PV8B 3H3PL 4NCC2 5HD8D 5IVZA 3N12A 4NNPH 4LVOB 3WDIA 1IGYB 2QR0A 1DBJH 4I2XB 3F5WA 1MFCH 2Z1KA 2DLHA 1I7TB 1VFBA 3VXMB 5C6WH 3WO3B 3D3VD 3G5VB 2JJVA 5DRWB 1MVYA 2MKLC 3B2VL 2IXVA 2BERA 3ZKSD 5CGYD 3UBXI 3WS3A 3MJGX 4LARH 3LKOB 4P0DA 4U05A 1F6AB 4JO1L 3VXQA 4FG6D 5KVDL 1J0JA 2YPVH 5FOOA 5J3HC 4U49A 3RY4A 3NYDA 2A9NH 3HR5B 3K80A 2IAMB 4JZJC 3BRDA 3JV4A 3S34L 4EIGB 1I9JH 5J1AA 4V2XA 5KAQF 4NQCD 5IR1A 2ORBH 3RBGA 2WHJA 2UZIH 3MLTB 4UQAA 4JPKL 4XMKH 1OM3H 4W5UA 5I8CB 3JWDH 5JOEA 2F1BA 1U91B 2JJUA 4M00A 3ROOA 5FHBH 3SGJA 2NY1C 1RFDL 3QUYA 1KACB 4S1DC 1K3ZA 2PETA 1LDSA 4KVNL 1K4DA 5BCAA 4JRXD 3PZNA 4ZPTB 3PV6B 3BGFB 2XWJB 4PS4H 5HNNA 5ERWB 5CEXB 2ICWB 1IAII 2R23B 1YNLL 1AGDB 3QWOB 4GKNB 3NFSH 5JUEL 4DKFH 1AIFB 5HHVL 3BPNB 4Z0BL 5TF0A 4XBPB 4DK3A 4GIAA 3THML 5BRPA 4JM4H 3ZE0F 3VD5A 5MENA 4F58H 2D7PA 4TVCA 3C2SA 3RIAK 5ANME 1AY1L 4KMQA 2YUWA 3X12B 3DXAE 3EMQA 1S78D 2G9HA 3U4BH 4KTEL 4PTUA 1R24B 2YPLE 5BV7C 1LO3H 1L7IL 2V5CA 5IJVA 3RGVA 1HKMA 4EUPG 1U6AH 2XIBA 1TVBB 4YWGL 1F90H 3KS0H 3TA3D 1QNRA 3ABZA 4QCEA 4BH8A 4G6AD 3S9DB 1I1FA 5D6DA 2WZEA 4Z7VA 4PJFF 4ELMF 2X10A 4FQCH 4UIKH 1LD9A 1QA9A 1QWNA 1K9TA 2DWDB 2Y9RT 4O51B 3MMDA 2ZPKL 4K3JL 3DO3A 3WIHL 5A6AA 5IMLA 5ITFA 1GW1A 4G43B 1PX8A 1DTUA 1T89A 1I9IH 3V6BR 4X9IA 3QEHA 4WWKB 3BLKA 2G2RB 2JKXA 5F72S 1MJ8L 1RHHB 3LV3A 4E42A 3L4UA 4KKAD 2C3VB 3WJLC 1ZANL 5KOVC 5GHWL 3IAQA 4YHMH 4YGAB 1TJHL 2BNQD 3VOCA 1EA9C 2NY4C 1UM5H 2EECA 5SX5H 1CDUA 3IDIA 2R0LL 5D1XA 3WMSA 3QAZB 5GIRB 2C4FT 2UWEE 1GGYA 3S5LA 4LBEB 3DMMD 4XWGH 4JGUA 5C0EB 5H8DA 4ZMAT 1Y18B 2DI9A 2PB1A 4PRDA 3VG0L 1OD9A 4MCYA 1FVDB 2WKLA 2X2IA 3WBEA 3S88H 2YPLD 4OZIE 3E6HB 3BD5A 1OGTB 2ERJB 4R4FL 5DMGC 2LFGA 1KJMA 2OR8A 5I17B 4U2ZA 2EO7A 2VYRE 3OKEB 4NKMB 1M7XA 3JTTA 5IHZB 1W9VA 2GI7A 4PJBE 4LEXL 3BVVA 4KKLC 3QDMA 5IHBA 5ID0B 4IRSB 3OR6A 4FXLA 2AV7B 5DRXA 3K2UL 1UEMA 4LDLB 1M05B 4R2GB 4XPHH 5FYLL 1GGCL 4KUCD 1RJZB 3KJ4C 4I3SH 2WP3T 1NJ9B 1WT5A 3C6LD 5B4MD 2PO6A 4CDGC 3VNZA 3AYSA 1B3XA 1J1OL 1DLHA 4YHLL 4A6YH 5CEYB 3C60C 2HLAA 2IFFL 1MCBA 1DANU 2ID5A 4AMKH 3EYUL 3QIBB 1MQQA 1FYHB 2KZ1B 4NWTH 3T0VA 2EH8L 5L2KA 3GUTB 1ZEAL 2HFFA 1B6UA 5EWIL 3U36A 1W1VA 3ARFD 3IU3A 5I15L 2VXTH 4M9OA 5KW9L 2VLKD 5I0ZA 5KSBA 1WEJH 3MI6A 4LOUC 1UZ8A 1JG9A 4IDJH 4P5TA 2UVEA 4DQOL 1BQSA 4OT1L 1I1XA 1GPOL 3MRGA 3MO1B 5HVGB 4D9RD 1T0MA 1IGCL 3ARBC 3CUJA 4LQFL 1IZJA 1UD8A 3BAXA 5E2TH 3QO0A 4YZFE 1V0MA 2EBNA 3FB8A 4ZOEA 3V6ZA 2J1KA 5MERA 2EDBA 5BZDB 1E9LA 3SDCB 4EN3A 3D39A 1FQ9C 5I1DA 4RA0C 2V5DA 1AE6H 3VH8A 4HEPG 3FOLB 3VSUA 2LQRA 4MZ3A 4X7TA 1KGWA 1C8XA 1L0PA 4OV5B 1NM9A 1OINA 4K7PH 5I8EB 2FJGB 4J2XA 3TVMA 2UY2A 4KXZH 1G1YA 1T66C 4KI5F 3MV8A 3BVNA 1UXSA 1G6RH 1NCBL 2BVQA 1GOWA 1E27B 2BS9A 4W5ZA 3RNKA 4LCYB 4JY5L 4N0UA 5BXFB 3CV5A 1KCRH 4UNTA 4NHCL 5CMAA 4C7GA 3AHZA 3O9NA 3SCSA 5F9AC 3D18B 5GS2H 5BJTB 5IB5A 5M17A 4AZ6A 1BYCA 5DFVD 4EE9A 1ZT1A 1FO0H 4NBXB 4OCXH 5HDQL 3VFTA 2B4CH 1HILA 3TIDA 2J7EA 4JHOA 1P1ZA 4Q6IB 1TZGH 4X4XA 2VN4A 1FOBA 4LP4A 1WLHA 3TH2T 4FS0A 1OAKL 2W9DH 1VRXA 3WNNA 4I0PC 1G9NL 3EYVB 4CD5A 1ERNA 3AS0A 1MCWW 2ARJA 4OD1L 5DZNA 2NW3A 3BW9A 3BDYL 3VXUD 1KTDB 1U58A 4QXTB 4U6HB 4PMNA 1Q0YH 3QHOA 5CP7A 5M3WA 4L3EA 1Q6DA 1MFNA 3GSOB 1INEL 2FH8A 4QRUA 5KZ6A 3IT8D 3ZHLA 3L5WA 2DQHL 3PDOA 3GJEA 4PJAA 3K2MC 1PKQB 2XVKA 5BXSA 3JSSA 1D6EB 1S7SB 3LD8C 4AYGA 4XX6A 2PTTA 3HNSL 2IPKB 4LCUB 1XF1A 1CZ8H 1J8KA 4RZCB 3CXDL 3GSXB 4B7LA 3TESA 4MWFB 1NANH 4QRSA 1U8QA 2PYFA 4R0LC 3MRPB 5K9KB 2EH7H 3CDYA 4WFGE 5KTEH 2H2SC 2G5RA 1F3JA 2E8ZA 3SQOH 4GSDH 2VAAB 3LCYA 1SEQL 3CDCA 4FLRA 4JO4H 2DTML 5AYQA 3FQNA 2CKNA 3FN0H 1SY6L 2ADJA 4I5BB 4MA8L 3ULUH 4PJIB 4XI5C 1CFTB 1NGPH 3QI9D 4MA3A 4UOJA 1UD4A 2XFRA 4XZWA 3IDYB 5CBAA 2WMPA 5EB8A 1KC5L 2EDFA 4JM2C 3QJFB 4F9LC 4MA7L 1IKNC 1A1OA 4JPVL 5D7IE 4XPFL 4FMFA 4BUHA 3IYLW 5DJCB 3EYFA 4QT5A 5H35B 3SKJL 3IJHB 5E2UL 4EVNA 3GI9L 1FDLL 3BYYA 4ZG1A 3ULVD 4NN5B 4M7LL 4J6RL 5DJDB 4PMUA 4LF3B 3BKCL 3QCUH 3VD9A 1N6UA 1MI5B 4DN4L 4XZUA 3NCFB 3BUDA 3HZKA 4BZYA 2X70B 1H49A 3P9MB 3QNXA 4TN9A 5A6BA 2FEEI 4KU1A 3N50A 5IFAL 5HHMD 3OWEA 5IVXE 1FL3B 4U4BA 1OTUC 3D9AH 1KCVL 1ZLWK 4D6GA 5DI8A 4KKCD 4WI4A 3VGEA 2XTJB 3BE1H 4FQQA 5C0CA 1AQ0A 5T3ZE 1BGAA 1OAZH 4DVBB 1GC1H 2VOTA 4Y7MA 4OOUA 2Y36L 3TO4D 2XM1A 5INCB 2MTPA 4U1NA 4LLMB 3BGAA 1IT9H 3MRKB 3P4OB 3PHQA 5B39G 4WFGD 3UJTL 1S9WA 2FX8L 2WC3A 4AD5A 2VXVL 1QRNA 1FNHA 4Y4FA 4Z0XA 4N8CH 2X4RB 5GGTA 1MAKA 5IBTL 3IK2A 1GCYA 3M46A 2EYRA 4P2RB 4MLSA 3T0EC 2RFXB 4KZEH 1JRHL 1DQLH 3FMGH 4NRSA 3O45B 4D8PB 4BQ8A 3QQ9D 3O9WD 5ELIA 3N9KA 1GGBH 3WS6C 3GMNB 3HE7A 5JA9A 1JXKA 1MFBL 2MKWA 1UR1A 1AC6A 1CD8A 4PB0L 4PJGA 2BK8A 3IJ9A 1E40A 1QFUH 1JHTB 4JKPH 2VCAA 1RP8A 5EC1B 4RL3A 5JO5A 1EPFA 4OF3A 3LQAL 3RGHA 5DT1L 4AISA 1H3VA 2BVEA 3MRBB 2FGWH 4IM8A 5IMKA 3UBXG 4HD9A 4AEFA 5C07A 4MNQE 3VXOB 1A7RL 5IQ9A 2DGAA 1EGJA 2QTEA 2DMKA 1SJXA 5I1KL 2GTWA 4L8SA 4LKXB 1BZ7B 3LSOB 1EO8H 2AGJL 4CMMB 1RY7B 3MRRB 4XNXL 5DJ8B 3PHOA 2N7AA 3IDGB 2FHBA 4XP4H 4IRZH 2YD5A 5T3ZD 5D8ZA 3QOKA 2PTVA 4YH6A 4WEMB 4OLWH 3KHQA 4HF5L 4P23D 3N06B 1HDMA 1GOKA 1AP2B 3VXMD 2CDGA 1JHLL 2PXYB 4EEEA 2AEQL 4LK4A 4BJLA 3WDPP 4BELD 4NUGL 1UA6L 1F00I 4EDXB 5GS1B 2WZHA 4AH2B 1FZJB 4BA0A 4O58H 1CNVA 4LLYA 1QEWB 5BRZE 2ZOLB 1ODZA 3OPZH 3UBXB 1XMWA 4AY0A 3NSXA 4HUWA 3QG7L 1J1XL 1GVYA 3BIKA 3KNBB 4OIIH 1CGUA 2XZZA 4NZTH 2ZX6A 5AAMA 4X0KA 4QLKA 2UUDK 3FQTB 1UJ3B 2A74A 2IAMD 5JLZB 3WH9A 1VFMA 4FTVB 3W0WE 5BOPA 4YPJA 1CLYL 1HCVA 3BPCA 1I1CA 2EDHA 4FXGB 3V8OA 4C59B 4OB5L 4EDWL 5JDSA 1KTCA 5F96H 3CZJA 3T77A 1J01A 2NR6D 1PBYA 1A2YA 1REIA 4U1GB 3BPLC 4GOSA 2B1AL 1OF2A 1KEGL 4G6KH 3BPOC 4NNXB 3SE3C 3U2SB 2FEDD 3AIRA 4PCTA 2Y7QB 4Y2DA 4HQQH 5GS3A 1DUYB 4LVNB 1ACZA 1R3KA 1JMZA 2VRQA 3MGTA 2AP2A 1DBKH 2X40A 2OXGA 1F8TL 2GAZA 2ZX7A 1MCQA 3GZKA 2XSAA 1MYRA 2V5RA 1JJUA 2W65B 5D1QB 4FLQA 2YEZB 4XRCA 4XX1G 3TPUB 3MLPA 3N1AA 1J11A 4MNGA 4MB4A 3SOBL 3HR6A 2ZUUA 4RMQA 3B9KC 4DN3H 3F7PC 3MXWH 3S8WA 5FKPB 4TSBL 5DEFB 4YBLB 4XV0A 4L4TB 5E6IC 2HKHH 3EYQC 3DO7B 4XT1C 3MCLH 5LGHH 1I1AB 3VM7A 4W86A 4YXLL 4QP0A 4G42A 5C6TH 4IDLA 1LWHA 4L8DB 1H0IA 3VI3E 3SDDC 1K2DA 4FNQA 2NCMA 1DBBH 4J3SA 2E4TA 2OW7A 2X89D 2FHFA 3WF1A 4TUFA 1L4IA 3HUJB 5GRJL 3ME0A 1QKZH 1KNOB 1WAAF 3SJVA 1MF2L 5E6YA 3F4VA 3GMQB 2BX5A 1BBJA 3O3EA 4AG4L 4F7EB 3FW6A 2AEPL 1DQMH 4UOZA 4IOSD 4AWEA 1BGXH 1XGTB 2X4QB 2R4RH 2IQAA 4YDVA 1A9BA 3LS5H 3S3SA 3U7WL 5I16A 3O8XA 3SDYL 4WWKD 5CSZB 3WQ8A 1KELH 2BDNH 2LTQC 1CQYA 4LVHC 4DWSA 1KYOK 4M5ZL 4DEPB 1CDGA 4KROB 4MDIA 1OB1B 1QBBA 1UZ6E 3D50A 1HOCB 1KLUA 4XVUC 4OZ4A 4DZBA 3QB7C 3PP4L 3IJ8A 2VI0A 1KIPB 2IC2A 1WB0A 2FIKA 1BSIA 5JW4N 3BP4A 5JHDE 1B0RB 1Z3GH 3QUML 3OLIA 1EVTC 5A8PA 3X13A 4RDQG 1S7VA 1JNHA 1KB9K 4ODVH 4Z78B 3VG9B 4E4PA 3RMEA 5CSGA 3UX9B 4XNMB 4HZ6A 2HTKC 4QHNB 2R1XA 4AW7A 5CUSH 3R06B 4BFEA 3WKNA 1U3ZA 2VSDA 4LMQI 2G75B 1HXKA 3TN0A 4ZTOH 5SWZB 1LF1A 1M04A 2C0HA 1BQLL 4E5XA 4RISL 1B0WA 3HRZA 1U8KA 1FZOB 1BFVH 2BC4A 3Q3GA 4JFDA 4X7DC 3K3QA 5HGGS 5GJSH 1NGQL 2RCSH 4AIEA 2E7MA 1JN6B 4IRSD 5BV7L 2ADGA 2BNRB 5DLMH 4R2GD 5BO1H 4PY7A 2YN5A 4GUPA 3KYMB 1E1FA 1FORL 2VZ3A 1AGBB 3WF0A 3DBXB 4WEUD 4PLJD 4X99B 1XRVA 3E8UH 3BUQA 5H94B 3RAJL 1OIMA 5DD5L 1BPLB 3QIBD 2YD9A 4LU5H 1Z0MA 5D96C 3ET9F 5FK9B 4GQPH 4F8TA 1FFPA 4PGDB 4D0CB 5CJXA 1E4WL 1WC7A 3Q0HA 4DGIH 3V52H 2EXYD 3P4NA 2DQIH 5DK0A 4LSRL 3IKKA 1KLGA 2EDWA 1INQA 5A6KA 1V6UA 1MWAB 2DSZA 4X6DA 3UZEA 3QEUB 5I30H 3L3JA 5IQ7H 1H15A 5DEZA 3LXBA 1DFBL 4HT1L 5LGJB 2AEWA 3RX5A 5FB8B 5E9DB 2UY3A 3ARSA 3SBWA 4MAUH 1YEEH 5DURD 5ESAB 1PSKL 43CAB 1HK6A 1EAJA 1JNLH 5ABDE 4WNQB 3GJFK 2NTFB 1A3QA 1RZGA 1JUFB 2V9TA 1AKJB 2A77H 1R8LA 4CNIA 4RMSA 2VISA 1DJSA 5A3IC 2Z91B 4Y8DC 2AV1A 2CMRL 2XZQH 3QEQB 2P49B 3V5HA 2HJFA 1MY7A 1Z5LB 1LG2A 1GVIA 1X4YA 3HPJA 3L3GA 3T0DA 3NCOA 3QCVL 5C0AE 1TQVA 3VIIA 2IH1A 4MZ2A 4PRIB 4ZSOB 4UFHA 3U1SH 1ORSA 5GGTH 4TRPL 3RA7H 5ICXB 2HG5B 2XWBA 1AFVH 3D0LA 1TVPA 1NC2A 1Q94A 3FQRA 2AI0L 2J88H 5LCVH 3KYKL 4CADA 2FE0A 4W70A 2PYEA 1BD2B 1E0XA 5CD3A 4AZ5A 4L9LA 3FFDA 5F1NB 3SE8L 3WUZA 3RVWC 5D7SH 3U82B 4OCYL 4UNIA 4PLOB 2FJHA 3TPKA 1FNEA 2KQNA 3N1GC 1H09A 3S36L 3HFMH 3STLB 4NWUL 3DURA 4JCMA 3N15A 1LK3L 2R0ZL 4J27A 3A4XA 5B8CB 3VFOB 3MLWL 2DBLL 3ECBB 4G8IA 4J12A 1QNPA 2DH3A 1UR8A 4GO6B 4BFBD 4MQ7A 3KYOB 4JR9H 2XTJE 3F62A 4F3FA 2VDLL 5E03A 5GRUL 5IB4A 4X6EB 3CX5K 4LSDA 5IHLB 3IDMB 3GM8A 1H5BC 1J5OH 2W59A 1ORQB 1D5IL 1R3HA 5ESVB 3ZYOA 1G7HB 2GT9A 3GKWL 2EAEA 4TQEH 4OCRH 5E6ZA 2PWDA 1C8QA 4PJEE 5D72L 2GK2A 4MJ6B 4NGHH 4WO4C 4EZMA 3DVFA 3OXRB 2XNAA 5HOSA 1KXTB 2H32A 1WNOA 4LCCC 1F11B 2IWGA 2HRLA 3DUUA 4P2RE 1M7DA 3WXWL 1HL8A 3VGAB 5F9JA 3OX8B 5FEBA 2O5ZH 4KMTL 4X9HA 1K5NB 1H3PL 4OCLC 1Q0XL 4YBHA 1Z32X 2W0LA 3NZHL 3VDAA 2YLLA 1CFBA 4PJDB 1X44A 1DQJA 3AHYA 4JDZA 5F44A 3FN3A 2VLJA 2IGTA 3MRNA 3PL6A 1H0DA 4LRIA 4X6DF 4JFYA 3KLHD 2P8LA 2V5TA 1MI5D 3EOYG 2Q8BH 3W9DA 3O3UN 3BZFB 1FNGB 1VGEH 4KKBD 1NGXA 2GJ6E 5AZ2L 4HJJL 2OR9H 2PN5A 4TPRH 1BOGB 4X7EC 5I9QB 3RDTC 1KFWA 3KLAA 3BZDA 5A2BA 3UP1A 3GYCA 4V27A 1KFAH 5KS9B 2WLYA 2JCCF 3A6BL 5C6PB 5EUOE 1I7ZB 3GNMH 5D8JL 2A3EA 1X5GA 4O2EB 2VQ1B 1I7RB 3PABB 4IHOA 3W82A 2I9TB 3J8F7 4WI9A 2XTJD 5JQHC 3HNTH 1CG9A 5E94A 3WF3A 1JWMA 1PBGA 4G6FB 1DUZB 2J8UE 1A6TB 4MXVF 3UETA 2XY2A 1DBML 3MREB 4P3DB 5HGBB 1A7PH 2H45A 2BOBA 5INDB 1KQZA 1B88A 2JCCB 1V6YA 5K59E 4P3CL 4Z7OF 3LRMA 4Y16C 1KPUB 3G5ZA 1LEKA 1B0IA 1ZBKA 3WIHA 4QXGL 1WDPA 2XZCL 1TETL 5DK2B 1MCCA 2PR4H 2H6PA 4KK9C 3Q5YA 4P2RD 3OXSA 3CSYA 4HJ0D 1WWAX 1AO7A 3DHUA 3B9AA 1KPRB 1B3JA 1ETZB 3DYPA 4Y19E 2HN7B 3QXUA 3VXPB 4XCEB 3WFEH 5IV2B 4G6MH 4MAYA 4PREA 5TE4L 4TVPH 4H8VA 2VCCA 3MRDB 4LPWA 4EIZC 3MOBH 1WF5A 2VXQH 1GZPA 3FONB 2W0KA 1S46A 1KWGA 4N0CC 2AJYH 3RTQA 4GI8A 2XG5A 1IEAA 3S37H 2CQVA 4NQEE 3H3BC 2YKLL 3FOMA 2ADFL 4Y5XB 2GJ6D 4Y4HA 3TO2A 2NY7H 3KL3A 4X6BA 1S3KL 1INDH 1NBVH 4WSKA 2GCYB 3DGGB 5D70H 3B2UD 3UDWA 3W9EA 3WIJA 4HHAB 3C5SA 3AS3A 3DI3B 1TQTA 4UOQA 3EHBD 3N13A 1UUQA 1P9MC 4IOIB 15C8H 1GUVA 1CLXA 2Z0BA 2Z8RA 3KPSB 3VJ6B 4PFEA 2XN9A 2WV3A 4Q7NA 1S7UA 3STZB 2EDKA 2W9EH 3O3AB 2PBOA 4F2MB 5DMYA 4ZFGL 5CGMA 3S5YA 4LRNL 1D5ZB 3PZUA 4X5XB 4M7LT 2PXYD 4HUXB 3VWKD 4LYRA 3S36X 3MCKB 3EO9H 5J9PB 1CTOA 1MJ7H 5IW6A 1N7ML 3W11D 5E8EB 3M8OL 4KHXL 3W81A 3BO8A 4PRPA 4QOKE 4TOQA 1LILA 3WXVL 4QY8A 4PCSA 5AYBA 1HI6B 5I8OH 4HAFA 3ALWA 3L3KB 1SVZA 2DQFA 4JRYE 4NP4H 1H3UA 5FYJH 4RFNB 1JPGB 4LNRA 3FO2B 4I77L 4BK4A 3H7BA 4N0FA 2V2XB 2Z9TA 4JJ5B 4M1CD 1JI2A 4PMZA 1U95B 3BT2L 5IHRA 5GS0D 2VH5L 3HUJE 1XZ0B 4JFQB 1US3A 3PWVB 3AM8A 5JOFB 1C12B 4HSQA 1MJJB 1FE8L 1KJ2B 2ZUQC 3CNKA 3X3GL 4HH8A 4XX1E 3FHAA 1C5CL 4XGZA 5CGYC 5FA3B 2J8OA 5E1HB 3GBEA 5CLTA 4J4PA 4Q9CA 2J8FA 5EO0B 5F7EL 1UWEL 1T6WA 1IKFH 3M6DA 5TDNA 3SO5A 3K1KC 1NGZB 4Y2OA 6FABH 4D9LL 5F21B 3C2AL 5D1QD 2BSRB 3MNZB 4JFPA 4TNVF 2K1MA 3HE6A 1MH5A 1SYSA 4UZGA 2KPNA 5E95B 2C9AA 5T3XH 5CCKL 5CEZL 3ARXA 2X2HA 1TQCC 5GGVY 5SV3A 1RIHH 2DT0A 1ZVHA 2NNAA 3WEOA 4EI6B 5KVFL 4ZO9A 5B3JF 4JHWL 5ITBL 4L4TD 1W9XA 5DC0A 4PV9A 3UAJD 3PDDA 1RZ8B 3SCPA 3SDAD 4WEBL 4G7VL 5A43C 1OPGL 2DKUA 2GSGA 3VGHA 3MQIA 1MIEL 1I1AD 1G7IB 3KPOA 1FVEA 3E2HB 1XR8B 3MLVL 5C71A 2ZKHL 3ARED 3KGRA 2D3LA 4E41E 2DBJA 3EYSL 3D2UD 4HXBL 5C0JB 2VZVA 1A6AA 5FFLA 2EIEA 4G8FA 3FQXB 5DZOA 3BCDA 5SWQB 5C0RL 1ZT4A 4GW5A 2D7QA 4P4RB 2DQJL 1WWWX 3IU4L 5LA0A 5FGBA 3O3DB 3OR7A 1MCWM 2YR3A 3L3IA 1CFQA 1HQRB 2E7BA 4RRPG 5ILTL 4DCQB 3RVXC 1QFWI 1S78C 1XGQA 4FQLH 1DWFM 3DECA 3PGDA 5DQDL 4O9HH 1T0OA 3O6FC 2YDRA 5EBGA 5EUKA 3MRCB 3SUUA 1HHJB 4YGVA 2I5YL 4TVDA 3DUSB 1W72B 5C2BH 4HBQA 3TA3C 1PW3A 1SVCP 5AYIA 3IKCB 1JNDA 4DGYL 4H04A 1B1YA 3H3PH 3UXFA 2ZP0T 1V02E 4YDKL 5D2LE 4F57L 5AUMA 3ARGB 2D2OA 1MREL 4PN2A 2ZG1A 3LY6A 3WUEA 4RNRA 1SY6A 5D93B 2V17L 3E3QE 3T1WA 2OJZL 3MRFA 4NPYA 1MLCB 3WLWC 4OLUL 1JGLH 3RNQA 3B2VH 4PTXA 3L1OL 2DD8L 1G7QA 2FB4L 3FQUB 4DKAA 3QBTB 4IIQC 4DTGL 1QSFE 2EICA 2I9LA 4KKAC 4N90E 2O9TA 4AZ8A 5D5MA 4JO1H 5SWZD 4CGTA 5KVDH 4DJMA 2E6QA 4Y5YC 3VXRA 1D3CA 3WD3A 2WW5A 3QEQE 5C0IA 2X2YA 4IISA 1ZSDB 2JK5B 3S34H 5C92A 4GXPA 1A6ZA 1NGWA 2XQBL 3DMMC 4JHZA 4N5UA 2NW0A 3U6RB 4JPKH 1BQHG 3N85L 5IOPB 3PIQB 3CZNA 4ZSOE 3CFDB 1ZL1A 2H32H 1JHKL 4RGNE 3U4EA 5D7LB 1RFDH 2Y5TB 3RUGA 4WHYG 3NGBB 4KVNH 4OI9A 1RHFA 4Y1AB 3QQ3B 5T1LD 1ZK9A 1DVFB 1YNLH 1TFHA 1EQCA 3IFOB 2XFFA 1J0IA 3C6LC 5HHVH 5GSVA 3VX1A 3SKMA 3WY2A 4Z0BH 1MPAL 2HFEB 1D5MB 5J12B 3THMH 5EOCJ 1SYTA 2OMBA 1DN0A 4P4KB 2B20A 4XP1L 4ODUB 2WBJB 3HZMA 4WFED 4A6YB 3CX5J 1AY1H 2C1PA 4POZD 4KJYB 2X4TB 2FR4B 2YIHA 2P4AB 3ARFC 1BQUA 1BQHB 2ATKB 1J0KA 4RQQA 1LP9B 1QSFD 3C5ZC 2ESVE 4KTEH 2IPUG 3JV6B 1IQDA 1SBBA 2P24A 1AKJD 1A6PA 4H8HA 1L7IH 3SCNA 4GQRA 3LN5A 3QEQD 4N9GA 3PQYE 4YWGH 1LE9A 1U8JA 3SCMA 1TE1A 4NN6B 4HA3A 2VWEE 3CC5B 3H0TB 2CKBL 4MNHA 2BP3A 3PZTA 1ONQB 3H9SE 3OKMA 2ZPKH 1MVFA 4K3JH 4PRID 3WIHH 4LLQA 4W4OA 2P8MB 5ICZB 3PHSA 1V0NA 3AXXA 1YEKL 4MCZA 1F45A 4G8GE 3JV5A 3MJ9A 4CRPA 4LIQL 5DC9B 4KRLB 5EIQA 3MODL 1P84K 4H5SB 2E3VA 4BUGA 1MJ8H 2CESA 3AFBA 4HKZA 2WZIA 1BD2D 1KTKE 1I3GL 5J6HB 1IILE 5KSUB 3JXAA 4HKJB 1ZANH 2A6JA 1HIML 1DCLA 4NHUA 5GHWH 3BVXA 3UR8A 1TJHH 1JK8A 1IL1B 4Y5VC 5L0QB 4AEHL 1FP8A 1YPZE 1XYZA 1MW1A 1U8OA 1NOWA 2UWFA 4Z7UE 2R0LH 1F97A 2HTLD 1I4FA 4LLDA 4YE4L 3AIBA 3S98A 5E8OB 3M17A 1OGAA 1U2CA 1LWJA 5HHQB 4AZCB 3LHPL 1MQKL 3TM6A 1AD9A 2QPSA 4R27A 5DFVC 3VG0H 5D5MF 3VGGA 4RIRA 2ESVD 4YFLF 3EOTL 4L1HA 3EO1A 4HS3B 5KSVA 2IPTL 4JL2A 2OLHA 1GQKA 1FO0B 1YY8A 4R4FH 3MOAL 4CU7A 1KB3A 3GMRA 1KN4L 1TIUA 3BSZL 1KWKA 1CXFA 4PRHE 1V0LA 3RIFF 1A7QL 3ZIZA 1LL4A 4P7LA 3JWNC 4LPCA 4LEXH 1X7QB 3K2UH 4B9ZA 4X9BA 5ACZA 1WICA 5FYLH 5BROA 1GGCH 2CBVA 3H9SD 1KB5B 4O5LL 2A3BA 4G8EA 1J1OH 2CRZA 4YHLH 3RUGF 3GIVA 2ZWYA 4URTB 4G8GD 1P4LB 2CIKA 2O9RA 3ZKXB 2IFFH 3MLYL 4JZOA 2Z92A 3EYUH 3V79C 1EXUA 1QACA 3QDJB 2EH8H 4JFOB 4ZAKB 1MW0A 1ZEAH 4M03A 5EWIH 1CICB 2ITDA 5I15H 4ZS7L 3WL1A 5KW9H 3RL2B 3CU1A 1Y7VA 2CPCA 3QUKA 1N2RB 2ZWLT 3GXDA 5EU5B 3I02A 4IOFD 4R4NC 5IVZB 2OYLA 5JIIA 1Z9OA 4DQOH 4OT1H 1GPOH 3DX8A 4M48L 1IGCH 4H2CA 1BEYL 5F3BA 2GHWB 3B9DA 4LQFH 1B0GA 3D0VB 4ZQKA 2MSPA 2EPNA 2D7TL 1GAFL 4PJXF 1CL7I 4QHUA 3A3HA 1NDMA 3KE0A 3HZYA 1UB5A 2F53B 1EDGA 1OLLA 1BVKA 1BLIA 4G6FD 5GNZA 1F58L 3GH4A 4XXDA 3ULVC 3MMWA 4QNPF 3AOFA 1E6NA 4PRHD 3QWQB 3WQ6A 4HIJB 4LGRB 4W89A 3VCLB 2Y5EA 3CUIA 2AVGA 4XHJD 1EMTL 4L5FL 2A6DB 2GYSA 1XCTA 5IROC 2V5MA 4XWOD 1X5KA 1ND0A 3FFCB 3OHXA 1KG0B 1NCBH 4ISVA 4P57A 3ZJ6A 2AABL 2P42B 1J8HA 2ITCA 2MQCA 3DSFL 4KKCC 3ROOB 2P44B 4JY5H 5EB9A 4NHCH 1QQDA 3P0GB 2WW8A 1RJYB 3H7LA 3V5DB 4IMLB 2Q86B 3LQZB 1VEMA 1JIBA 4Y7EA 4P2QA 1IM9A 3QUZB 5HDQH 4WVRA 1C93A 3GMMA 1MAML 3L7EA 4CJ0A 4K2UL 4LLUB 1NFKA 3WMBA 4WGVB 1GOIA 3BH9B 3QUMA 3MOQA 5A6MA 1VADB 1D9KB 3PZIA 1OAKH 4JY6B 3D48R 5JXED 2JB6A 1G9NH 1VFAB 1U93A 5IT2L 1F4XL 2EDNA 4IRJB 5E8PB 3BDYH 2X09A 3WEZA 4L3CB 3EJYD 2OX5A 4HUNB 1MNUL 2X5PA 1BMGA 4POYA 1SMOA 3MRJA 3O9WC 3QQ9C 1INEH 1BVNP 2J75A 4HDIB 3VW3L 2DQHH 1TMCB 3KPSD 2OS7A 4PTUB 4DVRL 2L7UA 2ZJSL 5DUPL 3HNSH 2ZUWA 3UTTA 5EU4B 2Y4SA 3CXDH 3RGVB 1RUQL 3WHXA 1I1FB 2QQNL 4QTIL 3S96A 4NYLB 4HA1A 1HHIB 1SEQH 4FMKA 1VAHA 1JCKA 2DTMH 3CFIC 5AEAA 1QNOA 3W5MA 5D2NB 1S5HA 2MCPL 5MEQA 1ISWA 1SY6H 4MA8H 5ITFB 3S7GA 1KGUA 2YDSA 2E6PA 1ESWA 2NY3B 1KC5H 1E28B 4D6HA 4ODXB 4HG4J 4MA7H 3VMOA 5ETUB 4JPVH 4LVOC 5DQJB 4APQB 3UPCA 5EFDA 4XPFH 4E42B 3PG2A 4LPTA 3SKJH 5HYJB 3GMPB 5E2UH 4NIKB 3GI9H 3RWEA 1FDLH 4HIHA 1UKOA 1R5VB 4PTTA 5E2WL 2OL3B 3MRMB 4M7LH 4J6RH 7TAAA 4Y4KB 3WJLA 3BKCH 2BXZA 1QLRB 3OG4B 4HAGA 5D7KE 5CBEB 4CU8A 3IDIB 1UM4L 5EOTA 4DN4H 3HAEA 4HZ8A 1KULA 4NRXB 5F7MC 1W32A 2QF8A 4JJHA 1FHGA 5JBEA 4BS0A 5IFAH 2WWDA 3MFFA 4PRDB 1KCVH 2IAMC 5CKGA 3MYJA 3VGBA 4HS8L 1RZIB 4G9FA 3GB7A 3GRWL 4MDOA 2YDQA 2VR4A 5C0BB 1CGWA 1A1MA 5HSFA 1P2CB 4LP5A 1HNFA 1HKLL 3JTTB 2NR6C 3VFVA 4YHEA 3NIFF 4PLNC 1HYSD 4JN1L 3LKQB 5IEHB 2XN2A 4AD0A 4MPKA 3UJTH 4JREC 4GAYA 2FX8H 2VABA 4X98B 3VIHA 3OR6B 1Q1JL 1DLFL 3KR3L 2A6IB 3DRTA 2AJXL 5EZIL 5SV4A 4FXKA 4Z8FL 4E0RB 3TBSA 3IXAA 5IBTH 1DLHB 4AZGA 3BGFC 1Q9KB 5GGSB 3VH8G 1JRHH 3G6LA 5CKAA 1IC5L 2F9BT 3C60A 3BGMB 1FZKA 1GZQA 1O0VA 5TGBB 4XB8A 3BPNC 1QVBA 4B50A 1MFBH 3IU3B 4PB0H 3QNYA 2GDUA 3WYRA 2ICWJ 1YDPB 2P5EB 1M1SA 1C8PA 1N0LA 1HH9A 4CD6A 1MXGA 4NCDA 3AIEA 3LQAH 4BSWB 5DT1H 1DHKA 4H8WC 4ZOCA 4QLLA 4HPOL 3S3PA 1OSZA 2NLJA 5D7LE 4P8VA 1A7RH 1X6LA 3ARBA 4O02L 4U1IA 4XBEL 5DJXB 5I1KH 3FB8B 3TOPA 5MERB 2H8PA 3PWLB 1FHLA 5E7FA 4ZTPL 4Y1AE 2WVUA 4QRTA 2OQJB 4BQ3A 2AGJH 3WDRA 2LV4A 3IGAB 4XNXH 1NCTA 4EN3B 1WFOA 4WJXA 1I8LC 1IGTB 4H20L 5I0DA 5JPMB 1OP9A 3G08B 5DJ6A 1ZGLB 1I1WA 5FO7A 4W7VA 3V4VL 5IUSA 2HLFD 1XT5A 2P46B 1H0GA 4HF5H 1JNNL 2HT2D 2NX5E 4LCWA 1JHLH 2AEQH 3MV7E 2EPMX 3GZAA 4NUGH 1UA6H 1H3TA 5C8JA 3BVNB 3S97C 2VLME 1R5WA 1FYTA 3OGCB 2FSEA 3WJJC 2YD8A 3QG7H 1J1XH 3QIWD 4HX1A 3ZO9A 3QUXD 1VKXB 5IB5B 3L4XA 5JOPE 1WZLA 4DAGL 1OQOA 1XH2A 4LPUA 3QAZC 5IVXA 4J1UA 1YNKL 3A4AA 3THCA 3HI5L 1HHGB 1HEZB 4R9HA 4X4XB 2IGFL 1CLYH 1TA3A 4OFYA 1HKKA 1HT6A 2L4OA 2O9PA 1T22A 4OB5H 3ES6A 4EDWH 3LN4A 4I0KA 1OCWL 4JE4B 4PTWA 2B1AH 4ONFL 1KEGH 4I0PA 5D7LD 1RMFL 2BCKA 3AS1A 3K46A 1YMMA 3MBXL 5IGXH 1IAOB 2ERJC 1YY9D 3KPLA 1SZNA 3CHFA 2BMKA 5HDRA 1K8DA 1CFVL 1IAKA 4Y1AD 3MZGB 3EO0A 3QXDA 1GQIA 3GJEB 4MMZC 4PJAB 2KQMA 1F8TH 3PNWB 5EU3A 1DVFD 3GXNA 1TZHB 4IRSC 1T0PB 2PTTB 4R2GC 3VD3A 3F7YA 4LSQL 1B3VA 3BSHA 3TJEL 3SGEH 3BH8A 2C4FU 1I7UA 2O9OA 1R46A 2NY2B 3W5NA 4PLJC 2NX5D 4ETYA 3SOBH 2XVLA 5BZWA 4RX4A 3ZKND 3FKUS 2YWYA 1SYVA 3QIBC 4TSBH 3KVQA 3SCOA 1B30A 3FQNB 4GG8A 2DLGA 1XGPA 3JWOC 2VUYA 5A2CA 4MA3B 1LQ0A 2R1WB 3OAZK 1EK3A 3P4LA 4IPNB 3SCRA 4NSKB 2ADIB 3SKNB 4YXLH 1LGVA 1A1OB 2EXYC 3VRJB 3HZVA 3CAFA 3FJTA 4LSUL 5JOPD 4JM2A 1NC4A 1R34A 4BQ5A 4UUJA 3HA0A 2X4NA 4F9LA 1IKNA 4S10A 3AB0B 5AZEL 4YJZL 1PAMA 3WUBA 2D1ZA 2H1PL 5GRJH 2ZX9A 3OKKA 3OAYK 1MF2H 4AG4H 1TCRA 4PJFE 1KGCE 3SDCC 2EKSA 4ELME 5JORB 2AEPH 3QNZB 1JWSB 1NBZB 1G1CA 3U7WH 4D9QE 1LJYA 1W0VA 3SDYH 4PY8I 1EHLL 4PLKD 5C09E 1CZ1A 2PC8A 1VENA 1ZHKB 2CDEB 3T2PA 2DICA 4FLSA 3V4PL 3JBG7 5ISZE 4FQQB 5BRZA 4W7UA 1F6FB 3CK0L 3PP4H 4JDTL 1IRAY 5GGVL 5C0CB 5TDPB 3TFKC 4E9LA 4D71A 3V6OC 5MEOB 3R0MA 2WVVB 3WL9A 1Q9LA 3DX9B 5C3TA 2VVNA 5I1AB 1TUXA 2YA2A 3WV0A 1P6AB 3QUMH 1VIWA 1MHCB 3ZYJA 2PW2A 3ULUE 3GSQA 5DD6A 2A9ML 1DR9A 2P43B 4UQBA 5F89B 3CDGA 3LN9A 2V38A 1V3JA 4GRLB 4ETQB 2FLBT 1ACYL 4BA8A 2Q6WA 1I1YA 2MANA 1KOAA 5GS2D 1GJWA 2V5YA 2EYRB 4LASL 4LKCA 3QYCA 4Q6IC 4XC1H 2NXYB 1BZQK 1ULVA 1FFOB 2HFGL 3GSUB 1BQLH 5CPTA 4RISH 2DMCA 4U1SA 4X8XA 4YIQA 1IEBA 3WFCL 2QV4A 3IJ7A 1NGQH 3WS6A 4YR6A 5BV7H 5D7JC 4NO5A 1FZMA 3ZJ8A 3O4LB 4NO2B 1CDYA 1JTPA 4A3YA 4WUKL 3G6JB 1KGCD 1FORH 3WF2A 4H25A 4M8VA 3RAJH 5JW3L 4D9QD 1HQ4A 3I50L 5DD5H 1GQJA 3QDJD 4ZAKD 1AQHA 1U8PB 4OD2A 1CICD 5BXTA 3WKML 2VZUA 1ES0A 1A1NA 5D1ZD 1RUML 2BJML 1E4WH 2LVEA 4HIIA 1J0ZA 1QBAA 2OWWA 1ZWIA 3A0OA 3RWGA 4LSRH 1WQVT 3OKNA 3SUSA 4NQVB 1T4KA 4U6VL 4HFWB 3IDYC 1ZHBA 2CDGB 1U3HB 4F7CA 5HVWA 5MENE 3ULUD 2OZ4L 1W0WB 3NFPB 4KPHL 5J1SC 3HAEH 4UNUA 4F7TB 4JAWA 3MNVA 1DFBH 4HT1H 4N0RA 2F53D 2I07A 8FABA 4OF0A 4CUCA 32C2A 4OKVB 1PSKH 4NN5C 1QHPA 4YFDB 4QRPA 4X0KB 1UCBL 4HWZA 1RU9L 2FECL 3KLHC 4WU7A 5GISL 1JDDA 1CGTA 5FUCE 1FBIL 5A2LH 2JF1A 2ENSA 1VERA 1XAUA 2I25N 2CMRH 5DFAA 1SFSA 4Z7VE 1A4KA 2RJMA 3VIFA 4NI3A 3UJIL 4MD5B 1NUGA 3C09B 3FFCD 3QCVH 1FLRL 1U8NA 1SJEA 4QTHB 1T7ZA 4KI5E 3VFPA 5JHDA 1LE5B 5E09A 3EYOB 3KYNA 1KPVA 2DIEA 1CE6A 1WZ1L 1LO2L 2X1WL 2WVTA 3M07A 1UACL 4TRPH 3SE3A 3BAWA 5E9AA 1PYWB 3WIFB 1OT2A 2B1HL 3W2DL 1R3KB 1T04B 1W3KA 2WSPA 2AI0H 3MGTB 3KYKH 4ACZA 3U30B 4PGBA 1U33A 2A3CA 4GI9A 3MLZL 2B5IB 4HWNA 5T1KA 1QI5A 3SE8H 2F7QA 1D9KD 1JPFB 1PS3A 3POHA 4OCYH 1X5FA 4HGKC 3S36H 2H41A 4NWUH 1VBUA 4MD0A 1G9MC 1LK3H 2R0ZH 4HJ0C 4HZLB 1TQBB 3PWJA 4JFEB 1U8MA 3MLWH 2DBLH 3H53A 3RILA 3B9KA 4U5KA 4OLZL 1P7KA 4HUVA 3ZMRA 3U7YL 3B8YA 5E6IA 3C5JA 3GBML 3CU7A 3OJDB 2VDLH 2GIYA 5GRUH 1MHPL 2YL8A 4FNSA 2FGZA 1EHXA 4ZUSB 3AMGA 2BHUA 1WIUA 1UG9A 5HHOA 5L88L 5TQ0L 3RGVD 5C0FB 3C9NA 1D5IH 1F42A 1FAKT 1UXWB 4HBCL 3GKWH 3U79A 4UQ3B 5D72H 3QDME 3ULVL 3SDDA 4HK3N 4NXKA 5I74B 1AQMA 3PWNA 4ZUUB 2H9GB 3PZGA 4HOXA 4MNMA 5KANI 1FRGL 4JLRA 3TT3L 1J12A 1N8ZA 1WBYB 4ENEC 5ADPL 4K68A 4OZGA 3WXWH 1V05A 2NY3D 2X8RA 3DX0A 5I16B 3IJYB 4KMTH 3AICA 5DA0B 5EA0L 1H3PH 4APQD 4XCFL 5JR1L 5L2KE 1Q0XH 3QXVA 5I66A 3NZ8B 1T5XA 5HYJD 1KLUB 1FFNA 1MQ8A 1QBMH 3NZHH 3WD5L 4NKDA 5KSBE 4OZ4B 2PXYC 3O11B 2EO1A 5I1LA 3UERA 5LAXB 4Y4KD 5GS1C 4PJ7B 2FIKB 4P2CG 1UKPA 3BP4B 1EEYB 3LEYL 1FJ1B 3KPRA 1XF4B 3G6DL 1RK0A 1KXQA 3RWCA 4F7PB 3OG6B 5FCSH 4B0MM 5AZ2H 4HJJH 2V5SA 4WSJA 1KXVC 5HYSB 5FYJU 4WUUB 3WFHA 1ADQL 3A6BH 1UJ3C 5D8JH 5CLWA 3AHVA 1WFNA 4M1CC 1MFEL 2R39A 3GK8H 3D39E 2AMGA 3WD1A 1IZKA 3HMWL 4UFJA 3U7VA 4OUOA 5C0BD 1JAKA 4OGXL 5JQ6L 5HHPB 3OB0K 1UWUA 1SQ2N 1V6WA 3HRZB 3TBTA 3TIEB 2CIPA 1DBMH 2DL2A 5CP3A 4U1GC 2R2BA 3D69B 4NO3B 2VL5A 4ZO6A 2CKBA 2JF6A 3F58L 2BVDA 3L6FA 1E4XL 3G04A 5DMKA 5C0GB 4YDJA 5CAYB 1AGEA 3O6AA 3DV4B 4PY7B 1O5DT 2AEIT 3MV8E 4QXGH 2XZCH 2PO6D 4LVNC 2ZUVA 2DQGL 2V7NA 1KTBA 1CGVA 4WKAA 2SEBB 3FO1B 4JPIB 4QGTA 3MA9L 4PP2A 2Y6SD 4N0UE 3KDMB 1A7OL 1BFTA 2AERT 3RZCB 2CETA 4CVXA 1OW0C 1T0NA 5D1QC 5JHLL 3LXCA 3HCVB 1L8NA 3RO8A 4M02A 4OKDA 5TE4H 2AJUL 4U6XA 5HHNA 2P5ED 4LSTL 2IH3A 2F15A 4WV1B 3MFGB 2X4PA 2QLVB 3IF1A 3NCJL 3QIUA 1II4E 4P5TD 4YBLC 3SDXF 4LGSB 5DK0B 3FB6A 4OZFA 2FIRT 3UAJC 2YKKA 2ZUXA 1QFHA 3GXTA 1SEBB 3NDZA 3ZR6A 3HHRB 4WKFA 1B4RA 1SR0A 2YKLH 2ADFH 4PD4K 1I1AC 4QHMA 1MFAL 2DLEA 4MDJB 3P0YH 4IBLT 1O7SA 1S3KH 4L3EE 2J47A 4FZEL 4PJ9A 1NEZA 1MCPL 3N1MC 5FKAA 1JRHI 2K9UA 1MCOL 2ILLA 2GK1A 1N64L 4XNQA 4EN3D 1XD0A 3PWUA 3CLEL 4OFDA 1X6NA 2DM2A 2VITB 3RWFB 3ISWA 4A4AA 1RZGB 5I76A 4ZFGH 3OV6A 3N0PB 3EOBA 4LRNH 5F3HA 3TF7C 2DQEL 4R4BB 1OT1A 4C57C 1T5WB 1IC4L 1WFUA 1N7MH 3L3GB 4BFGA 3M8OH 4OZGF 3BFOA 4KHXH 4DEPC 4KROC 5KJRL 3QG6A 3CXHJ 3T0WA 3WXVH 3L3HA 2R1YB 4DO5A 1MCSA 3DVGA 5JBDA 2RHEA 1MW2A 3QFJB 5A16A 2W60A 3FT3A 2EDEA 5DYOB 4I77H 4AQOA 1FGNL 1AXSA 1Q94B 1RULL 3DGCR 2R56L 3BT2H 1I3RB 4CADB 1YEHL 4MJ5A 1HXYB 3F7VA 1UT9A 1T1WA 2Y72A 5CD3B 5I19L 2VH5H 3VG9C 3FFDB 1C92A 2CBIA 3MROA 1OWWA 1RSFA 1ZKAA 2FJHB 2XM2A 1FNEB 1LEIB 1FE8H 1A4JA 5J1TC 3X3GH 3SUVA 1X4XA 2EE9A 1C5CH 4JZNA 4Z76A 1SM3L 2QQLL 1A7NL 2BVPA 3GO1L 4H8WL 5IMOB 1EHNA 5F7EH 1RI8A 1UWEH 1S7WB 1EFXB 4J3TA 4ZO8A 4H1LA 4ZFFA 3PN8A 4LVEA 4D9LH 5C0CE 2JALA 3C2AH 5IB4B 2VR9A 1UOKA 5C3LD 4RAUB 4S0TD 4TNVK 3KPPA 3MV01 2NY2D 3PWPA 2FYVA 1H5BA 5CCKH 5CEZH 3DARA 4GRWF 4PMYA 4AD3A 4K94C 4OUEA 4B41A 1QRNE 4ZOAA 3H42L 1T83C 4WO4A 5TPWL 2XNAB 4JHWH 5ITBH 5DVKA 2APVA 3HMXL 1R33A 1OOAA 3RPMA 5JW5B 1BJ1J 5DJZA 4WEBH 4G7VH 4AZ7A 1OPGH 1M7DB 1MIEH 3P3YA 4NQEA 3MLVH 3UTSB 3DRQA 1JGEA 2ZKHH 2J4GA 4R8WL 3EYSH 4HXBH 4W7WA 1MVUA 4PJGE 1E6JL 1FGVL 1CXKA 3SGEI 4MB1A 4JDZB 5JDJA 4OJYA 5C0RH 2VAJA 2DQJH 2YD3A 3IU4H 3GXIA 2BSSA 4JKKA 3AQUA 2F74A 2P8LB 1U8HA 1OAXL 2VLRB 3TNMA 4POZC 5DJ2A 1UKQA 2OM5A 1TMQA 1I8MA 4C7FA 5C07E 5ILTH 4OGZA 3ZE1E 1G0YR 3UCRA 5TE6L 5DQDH 4CW1A 5A6BD 5IB1B 3BQUB 2X6MA 4GKSA 5H2BB 5I3DA 4KJWC 2DJUA 5IW1A 3RDTA 4OZHF 3B9EA 2DSWA 2HVKA 5GGRB 2I5YH 4IHOB 4OQ1A 4UQ2B 1AI1L 3QDGA 4M8UA 5C0CD 3RKDD 3VXTB 5L8KB 3P9WB 1GONA 1A9EB 4DGYH 3GHBL 3WD2A 2AQ2A 5DA4A 1D5XA 1ZA3A 1UVQA 2L7JA 3MX0A 4R3SA 4JRYA 5DR5L 4YDKH 1BQCA 4F57H 4R97B 1MREH 1JF1B 4OZHB 4YO0B 1QRND 5F8QC 2OR7A 4PGEA 2V17H 4GRLD 2OJZH 4Y16A 3IXTA 3KLDA 4B5EA 4UTBL 2H6PB 3BZEA 5F9WB 5M7QA 4OLUH 3HLAA 4GQQA 5HY9B 3L1OH 2DD8H 2FB4H 1AQDB 4TUJA 4DTGH 4PJCF 2NXYD 2HT4D 4OF8A 4NX0A 4D1IA 5IVOA 4OLXL 2F19L 3JWOL 1U8LB 1BFNA 1BX2B 2A6KB 5DTFA 1J05B 1JWUA 4UR9A 1S9YA 3GSVB 3CH9A 2HTLC 5EZOL 1HHHA 3O4LD 5B8CC 1MUJB 4HULB 5TH2A 4F9DA 3MTRA 3BEVB 2VXSL 2XQBH 2WNWA 5EPMB 3A47A 4EQ2A 2XVNA 5KBNC 1F4YL 4PG9A 2EDOA 3N85H 1IEAB 2WWMC 5C07D 3NVQA 1A3LL 3OQ3B 4AYFA 4Y4HB 1JHKH 1K8IA 2XGIA 2JFEX 3ZDZF 2YA0A 2ZUNA 3PGCA 1UA7A 5F7DA 2EZ0D 3GRWA 2C3WA 4ZXBB 5IFJA 3K4ZA 3DHPA 3LH2L 1P9MA 2JIWA 1EEZA 2KBGA 4U3XA 5C08E 2QMJA 2AKRA 2HJLA 1RVFL 4MNGE 5ABFA 1JD7A 1S7RA 1MPAH 1U3HD 5JIKA 4J3XA 2FDMA 12E8L 3VGAC 4AM0A 4LHQB 4ONGL 1PLGL 1LO5A 4KDVA 4XP1H 3S3JA 4DOHE 5FA4A 3IS1X 3QR3A 5C0ND 4ODSL 4QY8B 4HH9A 2QKIB 4GG6F 5HGAA 3GXMA 4QHKI 2GFBB 4TVPE 2PWHA 1ZV5A 2XKNB 1BVLA 4LNRB 2P5WB 3ESVF 4UILL 2UYLA 4D6FA 4GBXB 4OUUB 4HKXB 2VC9A 3T1FA 4XNZB 2BNUA 5CP3H 2O61A 2LAAA 4HKBA 2CKBH 3SJVE 3AUVA 1U2HA 3BP7B 5JZ7D 3MV9A 5LA2A 1HXJA 3FL7A 3KLSA 4XNUL 5EU6B 2D7OA 3EZJB 4KRUA 5EBWB 4XGZB 5F7KC 3BZ4B 1CWYA 2WCSA 1XIWB 1I1RA 1YEKH 2IPUK 2CK0L 4LIQH 4A3HA 3NPSB 4V1DB 5CD5D 2YPKA 1U92A 4HUMB 3MODH 1AVAA 3T2OA 1QX1A 1DDHB 3A4WA 1X5ZA 3DV6A 4QEGA 3TBYA 2NT1A 3QXWA 2JE8A 3SY0A 5JNYA 4AIUA 5DJ0B 2VERN 5DXWA 1I3GH 1GOHA 3HS0B 4OF5A 3U48A 2AXGB 5K9JL 1HIMH 5KANG 5JW4M 3UZQA 1MH5B 4XWOC 2XPGB 4Z6AT 4AEHH 1EFQA 1RK1A 4NQCA 5K9OA 5BS0B 1LQSR 2QMKA 2ZSWA 3AXIA 4JFED 4MSWA 4PSRA 4YE4H 1G84A 1FCCA 4OZFH 4OF7A 3A67L 4EXKA 1A5FL 1QP1A 2KKQA 2EXOA 2DWEB 4AY1A 3LHPH 2ZOKA 1MQKH 5C8BB 4ZUTA 5FYJE 1CLVA 2AAAA 4FQ2L 5DEGA 3VFMB 4WDIB 3EOTH 4JRXA 1S7QA 1L9NA 2IPTH 2APFA 4WY7L 3MOAH 1KN4H 1QZ1A 3BSZH 4JFDE 1GJUA 2NMSA 3EYPA 3MNWB 5JXEC 3P73B 1A7QH 3G6AB 2VRKA 5CPQA 4Y5XC 3VGDA 3PZVA 3JVGC 1JPTL 3M45A 5T1MA 4LXFA 4XB3A 3QJHB 4JFXB 3BX7C 3EJYC 2Y06L 5E1AA 5ESQA 3V2AR 5HBBA 3LKNA 2R9HC 1CFQB 1CXLA 4I13B 4QRQB 4O5LH 3TTOA 3IDJB 1AGCA 3GGWA 1KXHA 3O8XD 1Z2KA 1Y6MR 3TTSA 4DWSD 2G3JA 3RKPA 3O6FA 5E4IA 1T7VA 5MHSD 4ZS7H 1VACA 1XCQA 3CFEB 2RQ8A 2EDXA 4JFFB 4QLRA 5T3XE 1KIRA 3KXFA 3G5YB 3TA3A 1JZ4A 2VE6B 3QXAB 4UV4L 1ZLWH 5AUMB 2W4XA 4JFHE 4NRYB 4X6DE 4M48H 2AK4B 3GJFA 1BEYH 4NUJA 1NCDL 2R15A 1HIZA 3OTTA 4WUUD 2A3AA 4RFNC 1Q8MA 1FIEA 1GAFH 3N1FC 4NPYB 2OCFD 1M6OA 5E5MB 1G9ML 3FQWB 5EG6C 3ZL4L 2NXZB 5C9KA 3U46A 4H1LH 1F58H 1MLBA 4HFUL 4IIQA 4NO0B 2R8SL 1QI4A 1R75A 2VKXA 1IM3A 2LABA 5FO8A 3VXRB 2EO9A 3LOWA 1C7TA 2PWGA 1X5AA 1EJOH 2P48B 2AJZA 4Y5YA 1EMTH 1A6ZB 1FNSL 2WWKT 3FT2A 4L5FH 1HX0A 1SJHA 1AD0B 4N0YL 4OV6F 4C58B 2IBZY 1XF2A 1DBAL 3EOAA 2GITA 3MR9B 2AK1L 2AABH 4XAWL 4P9HL 3DSFH 3R1GL 4J8RA 3DTXA 5HGHB 5EULV 1AQKL 5TFSL 4PJHF 4MDPA 1GYAA 1E72M 2X1XR 3D3VB 5ID1B 5I8KL 1RURL 2VDRL 2EIZA 2PYEE 3VXSB 1EEQA 1MAMH 1N26A 4GZEA 3V8CA 4JQIL 3W53A 4K2UH 3QO1A 4L8CA 2E9IA 4Z7WA 1OM0A 2A1WL 4TSAL 3PV7A 1T7WA 4QRRB 4U31A 4RAVA 4JFHD 5E56A 5IT2H 1F4XH 3C6LA 3OG2A 3E2HC 2NY5C 3WH6A 4Z2GA 2OTUB 1MNUH 4ELKB 5HYEA 3MRQB 1LEGA 1CR9L 3CFJB 3VW3H 1N5AB 3RWHB 5C7XL 4CAGA 3TLRA 4WENB 4DVRH 5T5NF 4XAKD 3ARFA 5DSCB 5DHVA 1G7MA 1NH6A 3C5ZA 2VLKA 2ZJSH 5DUPH 1IQDB 3DNKA 5T5FL 3VFNA 1NARA 4UQEA 3W29A 4KZDL 1RUQH 3P9LB 4N9GB 5FOBA 3QOMA 1LE9B 3SCMB 1G7PB 2HP4A 2QQNH 4QTIH 1HSAB 2UUDH 4HOWA 4KWUA 2MCPH 3OKMB 3U0PB 1HJQA 1WBZA 2OW6A 4AK1A 2F1AA 2EEDA 3I75B 4N8VG 4FFVD 1ZHLA 5D71L 3QFJD 5FM4A 1QVOB 3R8QA 4MADA 4U6YA 4FQXA 1Y0LB 2CR3A 4J3UA 4ERSL 1NC2D 5CHNA 4F7MA 1NCWL 2HLFC 3ARGC 3FRUA 1UJTA 2OYMA 1NFDA 3QFDA 3CPUA 1EAPA 2VLJE 5F70A 5E2WH 2Q87A 4DGVL 3W25A 5CILL 1NAMB 5EIVA 3QDAA 1U8IB 3BUBA 1PGRB 2OZ4A 3CUHA 1UM4H 4Y5VA 5DD0L 5ECJE 4QYOB 4C83B 3AMDA 1U42A 3FRPA 3NCCB 2UY4A 4IPLA 4JY4A 1T21A 3QULA 1QHOA 1BIIA 4Y0GA 5J11B 2WHLA 4KAQL 2FYYB 3QPQD 4GW1B 4CN1A 3RWJA 2YD6A 4LFHG 2CHNA 3EO1B 3GRWH 4N8VB 2EEXA 1YY8B 1P5UA 4ACYA 5ICYA 4Z2KA 1J86A 1HKLH 1MRCL 3OKOB 1KT2B 3FCTA 5DRZA 1T1XB 2EDRA 1KTRL 4JN1H 1CFNB 5DF0A 5DD1L 1LWRA 1Q1JH 1QG3A 1UH2A 1DLFH 3KR3H 3ZYIA 2W07A 3NGBC 5EZIH 2AJXH 3VXUA 4YPGA 3OKLB 4Z8FH 1WAWA 1DEEA 5B3JE 3V7AE 4HUUA 3HC0B 2PCPB 3O6MH 3TEUA 3ZLQC 3ALGA 3GIVB 1AO7E 1CD1A 3HN3A 3U4AA 3UTSD 2DQDL 3MBEA 2G3MA 5E00A 1DVFC 5EIIB 1IC5H 2CLZA 1EXUB 1OGGA 2WCAA 1HJXA 2BRRL 1X5HA 4P2OB 1OTSC 1JFQL 5CWSA 5ANMB 4Z7WF 3M1BB 2ITDB 3BUYA 4AMWA 3DXAB 3DROA 5J12C 3BLPX 2VIRA 2VLJD 3H9HB 4P4KC 2EEAA 2W0PA 3QUKB 3ZDXE 1WCGA 3WE6B 3PL6D 3I02B 1TVHA 1WPCA 2WBJC 2XXCB 2VLRD 4KUCF 2TAAA 3DI2B 2YPLB 3OGRA 1CU4H 4RWYL 2Z93B 4HPOH 5F3BB 1ZA6B 1QSEA 3CUGA 4O02H 4ODHL 4ACPA 4HS6A 5ECUA 4B16A 4XBEH 2FO1A 1FV1A 4QHUB 3SCWA 3VKKA 4ZTPH 4X8JA 2VZOA 5SX4H 1E56A 4OM1L 5GZND 1UKSA 4NN6C 4YHKL 2XN9E 2IANA 1RQ5A 4ODWB 4H20H 2FGLA 3V4VH 4X6FB 3ROLB 3TNNA 2GJZB 2J7DA 1HSBB 3MRLB 5FYLE 3WUWA 2ZOXA 3MU7A 1JNNH 2X42A 2UWEF 1XF5A 1LNUA 4ZDHB 1MCLA 2XHYA 1XFPA 2RAMA 1BJ8A 2CUMA 4PLKC 4PRPE 1JP5A 1HTYA 1ITXA 4K94L 4ISVB 2Q76A 5IROA 5ALBL 1J8HB 2HA1A 3B3IA 5I18L 1FSKB 4X6CA 1WWBX 1HNGA 4HMDA 2ED9A 5KVMC 4L29A 2VX4A 3T8XA 2EC9T 3VFSA 2F8QA 1NFDF 2UWEB 4MAYD 5L0QC 3W37A 4W8LA 1H41A 4KJQD 3PTMA 4MNLA 4MGXA 2C3HA 3ZSSA 7FABL 4PJBF 3GSWA 1YNKH 3L7EB 1CGXA 2WMKA 3HI5H 5A2AA 5E08L 1CD9B 2IGFH 1PX3A 2QEJA 2MOVA 1GJIA 2FL5B 2CDFB 4OZIB 3SPVB 1MWAL 2EACA 1OCWH 4LEOB 2N4IA 1U93B 4Y4HD 3CZKA 5E5RB 4ONFH 4H88L 1RMFH 1ADQA 5GSRB 3MBXH 4U1KA 3VVGA 4PJBB 8A3HA 3O2LA 1B90A 2DTSA 1D2KA 4NNYB 1XSIA 3AMCA 4TSCL 3SN6N 3I3BA 5HYIA 1QO3A 1CFVH 3ARDA 4ZXBD 5HJ3A 3CMGA 5IP4A 4YHOL 3U57A 3MJ8A 2XN9D 5F7FA 4DM2A 4NC1E 3BP5A 1K4CA 3L3OA 2VLLB 4LSQH 1C08A 3MLSL 1Y6KR 3TJEH 3HAEG 1W9UA 2R0WL 2F2HA 4EI5C 2Q8AL 1UD6A 5FYLD 4N1CA 3RWIA 3WLBA 2FNBA 2OSLB 3ZKXC 4YZFF 4UMGA 3RJXA 3GJFH 4P59L 3U0TB 4GZJA 4ZAKC 1UKTA 3LPPA 1CICC 3HG4A 2Y23A 4JDVB 1GHFL 2JIXB 1RAMA 2H2PD 3KPQA 1YN6A 1QLFA 5GNXA 3MC0A 5HPMB 2XKUA 3BEWB 4LSUH 4NQSB 3X11A 4Z2IA 4GBXD 4G6JL 4NRZA 3IDXL 1IGYA 4I2XA 5AZEH 3SUTA 3EIFA 1I7TA 2IBGA 2VDML 3LRKA 1G9EA 3TV8A 2H1PH 1H2JA 3SCQA 2EDQA 4TVSa 2J7LA 3G5VA 2IEPA 4KFZC 5EU6D 4WW2F 5DRWA 1XIWD 3LKOA 1VJSA 1EHLH 3MJ7B 3DX3A 5DVLA 5FM5M 3MFFB 3MSDA 1UCTA 2D0HA 1C7SA 1CVSC 3L95B 4P8UA 1VGKB 1EQPA 4FMVA 3V4PH 5KEZA 3L5JA 4G9FB 4TX6A 3GB7B 4WW2B 3PDGA 3ULVF 3CK0H 4JDTH 3QI9B 1MCIA 5GGVH 3ECQA 5J06A 3EKCA 4YNYB 2VB5A 4UU9B 1A1MB 2M1KA 5BS0D 4D3CL 2APXA 1NMBL 5FECB 2XZAH 1V7ML 1TTUA 1WTLA 5I8CA 3L4WA 1VESA 4NFBA 4DZ8B 4HW6A 1Q4NX 2JF7A 1U91A 2A9MH 5IK3A 1YNTB 2DF3A 4X6CF 1ACYH 1R7AA 4M1RA 2HVMA 3QUZC 3MA7B 4LASH 5T33L 4ZPTA 5D5ME 4ZXLA 3PV6A 1JYVA 1Q38A 35C8L 5ERWA 1FZKB 4NM4L 3UTOA 2HFGH 2ICWA 1EZVY 5CEXA 4AZHA 1D9KC 1M01A 4EKXA 3C87A 1AGDA 5GGSY 3WELA 4NZDA 3VXRE 5DHVH 2GJXB 3IJSB 1AXTL 1AIFA 3WFCH 3E0GA 1P7QB 3MUHL 4IRJC 4BCEA 4FQIL 1A22B 1LLOA 5E24E 4XBPA 1E6QM 1X5YA 4WUKH 5A2FA 5CXPA 5CPSA 1WZKA 1TENA 4N5ED 4W85A 5CS7A 1JNEA 3TO4B 3BKYL 5JW3H 4WI5A 2FEEL 3ARBB 3I50H 3RUGE 1VHPA 5D7IF 4F15B 1R24A 1GSMA 3RGVC 3WKMH 2ED7A 2DRUA 5F88B 3O41B 4GKZB 1BFOB 4JFFD 1RUMH 1B2WL 2BJMH 4HWUA 5D6DC 5F7WC 5CZVL 4HIEB 2APWA 4D2NA 1EO5A 3MSGA 1I8LA 4QXWA 3V5KB 5D2NC 4M56A 5E8NB 5D7IB 1UENA 4G80B 4XVSL 2DWDA 4O51A 4U6VH 3HMXA 1UA3A 2OZ4H 4KPHH 3QXTA 4F9JA 4G43A 1JZ6A 2CIIB 4APQC 1OB0A 4GMTL 3E6FA 2OYKA 2G2RA 1FYTB 2NXZD 2XTLA 4ELMA 1RHHA 4KK5C 1MQPA 3V4UL 5A95A 3CTTA 4C7DA 4HX1B 1TQUA 4NO0D 4M62L 3WJJA 2EYTB 4LLWB 4Y4KC 4QAWA 1UCBH 4ZPVB 1RU9H 3CUPB 3AROA 4YHGA 3VXRD 5GISH 3WFDL 3ARQA 2CBUA 3DWTA 1FBIH 4PTMA 4JVPA 5IVXB 5DUML 3MUJA 1YUHB 2OP4L 2EADA 5FYKU 4PMVA 4FNUA 3L5XL 5GIRA 3CZFB 3MLRL 3FZUC 3UJIH 3T65B 3ES6B 2G8ZA 4LBEA 1DWGM 1FLRH 5C0EA 2NQCA 1NOUA 1Y18A 3GNRA 5FHAL 4HV8B 4P23B 1WZ1H 1LO2H 4NJ9L 2P45B 5HDBF 1UACH 2F7OA 3C6SB 4OLYL 3QCTL 3R0NA 1K8DB 1OGTA 2B1HH 1IAKB 4MA1B 3W2DH 4BKLB 3VXSD 2GSIB 3EFFA 2GQHA 4NKMA 1OBAA 5EU3B 2YC1A 4YAQA 4Z77A 3MLZH 3F7YB 3X17A 5FL0A 1U36A 4QRRD 5ID0A 4IRSA 2X9WA 1BYAA 3BH8B 1M05A 1I7UB 3NIGE 1RJZA 2NZ9D 1CLCA 1LO0L 1NJ9A 2FO4B 4YN5A 5EC2B 3VUPA 4MYWB 1OGAE 4D0DB 5DFWH 1CXIA 3QH3B 3MLXL 4OLZH 4OM0L 2BY1A 3QIBA 2YK1L 3U7YH 3JUGA 1E1EA 1E3XA 3GUTA 3PXJA 4NM8L 3GBMH 4E2OA 2D31B 3VRIB 4M24A 1MHPH 5DRNA 4MNQB 4PMOA 1K6QL 3P77B 5I1HL 2E40A 3W24A 1G94A 5L88H 1EX0A 4EK7A 2F8VA 5TQ0H 1HF6A 4UUJB 3OLEA 2DN7A 4RGOL 3P0VL 3SCMD 4HBCH 3T3PE 4OZOA 5FO9B 1V5JA 1MHEB 3MO1A 3DIFA 3ULVH 5AG9A 1FG9C 3LDBB 1KJ2L 1F3RB 1HXMB 1FRGH 3TT3H 1OL0A 4EN3C 1QRKA 5BZDA 5ADPH 3U5UA 3SDCA 2DI7A 5AYUL 2GK0B 1WBXB 1ZJAA 3RPIB 4PJ8B 5EA0H 2C7FA 4XCFH 5JR1H 3GMOA 1IV8A 4NZJA 4FABL 1CGYA 2XICA 3WD5H 3BUPA 5BRZB 5HI3D 3O81A 1OLZA 1PZ5B 1E4KC 4ZNCD 4OV5A 1HWHB 3NTCH 2FJGA 3CZ8A 5EOQL 2GEEA 3LEYH 2A83B 4XNYL 3V6OA 2J77A 4KVCL 4WI8A 3G6DH 3RWDB 4GH7B 2PW2B 4TX8A 3W0WB 5DD6B 1VFOA 5BXFA 4NJAL 2C7UA 1ADQH 3V0AC 3D18A 1QSVA 2CRMA 2V9RA 5EFFA 2WKGA 4FN0A 2NY5L 4MX7B 1TDQA 1MFEH 1AHWB 2YRLA 4ONHB 3RBSA 5HGDA 5DFTA 2RBLA 3NCMA 3HMWH 4PS4L 4XPGL 4OGXH 5JQ6H 4Q6IA 1QI0A 3CX2A 1IJ9A 5JTWA 2YMXL 1I85C 1IEBB 4YIQB 1WZAA 4P46B 3F58H 1E4XH 2VC2L 3WFLA 4YQXL 4OD3L 2CLRA 3IAPA 4OCWL 1G6VK 1KTDA 5D7JA 6A3HA 2X0HA 3WN5A 4U6HA 2DQGH 3SHSA 1C3FA 3VINA 4U3HA 3WH8A 1J8HE 3MA9H 2NT0A 2AW2A 1A7OH 1HQ4B 5DDHB 1QPPA 1UFUA 4EUPB 5JHLH 3AIUA 1PKQA 1JGUL 1S7SA 4P2OD 1AR1D 4GKOA 4F9PC 1W72L 4KK8D 3VI3F 1PZ2A 4P2QE 4LCUA 2NY2C 3DXAD 2AJUH 4RZCA 4Y89A 4LFHD 3GSXA 5F1OB 1XH0A 4LSTH 3CCHB 3MRPA 4LSPL 5K9KA 3VPLA 3NCJH 1NP0A 3RWGB 1YMHB 4ZUWA 4PYSA 4I5BA 1ZHBB 4IM4A 4PJIA 1CFTA 1L7TL 1MFAH 2D9CA 2G3NA 4CL7A 2D4DA 4FZEH 1MCPH 1CT8B 1UZ6F 3LRHA 4P5MB 1MCOH 1YZZA 1N64H 3AB0C 4F79A 4W68A 5DJCA 3CLEH 2ZUTA 5H35A 1I8KA 2Z31B 3IJHA 1WDSA 3DYMA 2X1IA 1KGXA 3ILPB 2J6EL 3UTTE 1UEYA 2NY0B 4WU7B 4LF3A 5J3HD 1NCNA 4MS8D 5HVHC 3RHWK 4NZRL 2B2XH 2Y1VA 2DQEH 3C08L 1MI5A 4X4ZA 1FG2B 1NMAL 1ISXA 1A4KB 4MXWL 1XR9B 5KZCB 2X70A 1NQ6A 1IC4H 2E27L 2V2TA 3CUFA 3P9MA 5DVNA 3UTPE 1U8NB 1TR1A 5KJRH 1J8HD 1SJEB 4AENA 4CBPA 3VFPB 3LB6D 5JHDB 1NGYB 3IRZA 2BVOA 3DVNB 3BPLB 3RKDC 3MUZ1 1ZBVA 5SX4I 5FYJL 4LLVA 4NKIL 2WANA 3UYOD 4S1DD 2AJ3B 4NRRA 1FGNH 1BECA 1RULH 2R56H 4DVBA 4ACZB 1YEHH 4PGZA 3K0WA 4S1SL 4PRNB 3UPRB 3WQ5A 5INCA 3WBDA 1QW9A 2WSKA 4LLMA 3MRKA 5I19H 1RJLB 5DURB 1UYQA 2P8PB 5LQBL 4GRLC 3SGKC 4HA4A 3K4DA 5KN5A 3QQ4B 3WEMA 1T03L 1SM3H 2QQLH 1A7NH 2NXYC 1JE6A 2HT4C 1L6ZA 2Q8XA 2RFXA 3GO1H 4H8WH 4CN4A 3VNYA 2W63A 4D8PA 4HUVB 3LEXB 4X80L 1VSCA 2FX7L 4K8RC 4KRPB 4IJ3B 4XPTL 4G9FE 2FATL 4I9WE 2XVPA 1JHTA 4AIXA 5EC1A 3UEZA 3C9NB 2D4FA 5B22A 2EXWD 1KF9B 3MRBA 4PEEA 3PWNB 4HTYA 3H42H 5TPWH 1NL0L 3HMXH 5EBLB 3DHJA 3UTPD 3UTQB 1WUNT 2H3NB 4LKXA 4XPBL 3RM9A 1BZ7A 2EZ0C 2OJEB 2JIXD 4XVJL 4CMMA 5DGRA 3MRRA 1W0YT 5DJ8A 3KWWB 4PBXA 2OWXA 2CERA 4R8WH 4P5KB 4ZO7A 3L3DB 4Q0XL 1TNNA 1FFNB 4CU6A 1E6JH 4NKDB 4WJ5B 3NIYA 1FGVH 5TJWK 1U3HC 5EO1B 5I1LB 5KSAB 1S7XA 1AP2A 4O2FB 3WEXB 2PXYA 3FO9A 3TV3L 2YA1A 4ZFOB 4WTZG 4PJIF 1OAXH 4ZFZB 5C0NC 5GS1A 4AH2A 4K3DL 2WWKO 1OIFA 5DO8A 1W3JA 1G7JA 4GAJL 5TE6H 5CGTA 4HC1L 2ZOLA 4C54A 5DO2D 4S3KA 2XJ7A 2BZDA 1HJSA 4ALAL 5C0AB 1UJ3A 4G9FD 1AI1H 2NPLX 3IB4A 5EZLA 4FTVA 1T2QL 1NAKL 3PJSB 4M6OL 2MHAA 5IWLC 3GHBH 3C09C 5DMGD 5JZ7C 4FXGA 5DR5H 5B3NA 2VL5B 3GBNL 4LCWE 5DMKB 5MEPB 3NABL 1T1ZA 5I6XB 2YSSB 4NNXA 3U2SA 2J7BA 1KB5L 2E8YA 5CD5C 2BV9A 3TYFB 2X1QA 2BSTB 5MP6L 1VJZA 3KAAA 4UTBH 2Y7QA 1YECH 1FYTE 4NQXA 1DUYA 3NSMA 3U30C 3K1DA 3PP3K 1GL4B 4ZS6D 3C60D 2B5IC 3BDXA 3HG5A 1DZBA 4OLXH 2F19H 3JWOH 2AXFB 2W65A 4XCYB 1OW0A 3R4DA 2YEZA 5IEKB 2XN0A 1P7QD 2IBZX 2FD6L 2WCGA 3HC4L 3Q6FB 5EZOH 2V9QA 1TQBC 3EJJX 4LOUD 2X1PA 3QIUB 2VXSH 2HH0L 2DKSA 5FKPA 5DEFA 2R2EB 1WISA 5F93C 3AXHA 4L4TA 1A3LH 2HYMA 2XSBA 2RIKA 5A1AA 3DO7A 1YMME 3ARBD 2G4FA 3RJDA 2IMNA 4PJEB 4HK0B 2R2HB 4KK6D 1I1AA 3I6KA 3ZTJH 4PJ9B 5FKAB 3VDCA 3WY1A 3BN3B 3I6LE 4FQJL 3PWUB 4L8DA 1W9BM 4J3OC 5I74C 3LH2H 3VA6A 5I76B 2HAZA 5E70A 5C9JB 1RVFH 2GTZB 4LCWD 4F7EA 3I6GA 4I18C 1C5BL 4FF5A 3AIVA 12E8H 3INUL 2X4QA 2MQ0A 3A6CL 4ONGH 1PLGH 3TBWB 1J9YA 1J88A 4H1LG 1MCJA 1ZJBA 2Q7YA 5TQ2L 3QG6B 1FYTD 1TTGA 4ODSH 2IADB 1XGZA 3BKJL 3DX2A 1OB1A 43C9A 3DVGB 3IS0X 1HOCA 1WAAA 3EGSB 4G5ZL 1RPQA 1FC1A 2GJ6B 2W60B 5B39B 1YEDA 1KIPA 4TUOB 4NZUL 2FX9L 4CN6A 4UFLA 4UILH 1E5NA 3RP1A 3MJ9L 5FM5O 1B0RA 5EUOB 1C90A 5E0FA 2W0FB 3BVUA 3NIDF 3HB3C 3AY4C 1ZE3C 5DJYB 1GOQA 2J8UB 4XNUH 4JZNB 4XNMA 4Z76B 2W1NA 3N04A 1X3DA 4P49A 3R06A 5FKYA 3VWKB 4UT6L 3FMGL 1ZLUK 2G75A 4Q58C 3CPLA 3I6LD 4NKOB 5SWZA 1MELA 5FF6B 1GGBL 1FZOA 3W39B 3GSRB 4CKQA 3BKML 5HI5D 1S9KC 1NUFA 5K9JH 1AGFB 1JN6A 5GRVK 2BNRA 4LSSL 1WJ3A 4Y19B 1NFIA 1KENL 2YOCA 3N17A 3QHMA 3ESUF 1FH5L 4Z95L 1CLZL 3KYMA 2GUOB 5DJAB 3ZSTA 1E5JA 2C8NA 1AGBA 5AY7A 3RZCC 1PIGA 2XGBA 4RE3A 3A67H 4X99A 2H2SD 4WRLA 5DJZB 1DQTA 3ZHDA 3BD4A 1GOGA 1MSPA 3VU2A 4M3JA 5FK9A 1M03A 4XI5D 4FQ2H 4QGYA 4NQEB 1QLEL 4WV1C 4D0CA 4MNQD 1N82A 3T0EE 2DM7A 1NWUA 4JM2D 1NC4D 2LE9A 4WY7H 2WMIB 3QPXL 3WKZA 3VE0B 2OL3L 2OMNA 1JPTH 1E6XM 1MWAA 2RR3A 4M61B 3QEUA 2ZUMA 2Y06H 2BSSB 2X7LA 3BXWA 2F74B 5IXEA 3WFBL 4EJ1C 5DJ2B 5C08A 1NKRA 4WI3A 5LGJA 1I8MB 2YBRA 3DVIA 5FB8A 4PUDA 5E9DA 3OZPA 4Q9RL 1N3NB 2ZCKH 4PJ8D 5HDLA 4U33A 5IW1B 43CAA 4Q2ZB 1VPOL 1B2YA 3BD3A 1JV5A 4WNQA 2NTFA 4UZSA 1JUFA 1OTUD 1AKJA 3RM4A 4QOKB 5BRZD 3SDAB 3HUJF 1C91A 2FWOA 5IB2B 5CEZE 5GGRY 4PSPA 1D5XB 1ZA3B 4WI2A 1G5AA 5EU7C 4JRYB 1LK2B 1Z5LA 2ZXAA 4UV4H 3AREB 5BMFL 4L4VE 1UD5A 2X4SA 3W0WD 3D2UB 1HH6B 1E71M 4U7SA 5MI0B 3ARWA 4FFVC 1NCDH 4PRIA 1M71B 5GJTL 1JZ2A 4W87A 3IXTB 5EDXA 5ICXA 2WIIB 1BGGA 3HLAB 3WIIL 1G9MH 5IF0A 5CQ1A 1PPIA 2UV3A 4R7NB 3TCLB 3PZ9A 2EE3A 3ZL4H 4JKMA 2E0PA 5FCUL 2YHGA 4QRPE 1BD2A 4KGJA 3LKRB 4R90L 3ZQ9A 4HFUH 2R8SH 2XTKA 1E4IA 5DTFB 4GO8A 2CO7B 4ORGA 4P46D 1TJGL 1P69B 4UBDD 2G5BB 1F2XK 1S8DB 2VJXA 3AFLA 3STLA 3CH8A 1FNSH 1MIML 4N0YH 5B8CA 3HI1B 1S9XB 3VFOA 2YRPA 3ECBA 4N8PA 3F7RA 3IDUA 3QPQC 1QFWL 2AK1H 4FNLL 4XAWH 1V08A 4OIBA 4XBGB 4P9HH 1D5BA 2DSKA 4ZD3L 3R1GH 5A69A 1R5IB 3BIAX 5DQ9B 2VQUA 3OJMB 4LSVL 4IEFB 1AQKH 5TFSH 1GQLA 4X6EA 4CCEA 1RZKC 3IDMA 4W4NA 4KHTL 5CINL 1RURH 5F7DB 5I8KH 1JZ7A 1ORQA 2VDRH 1MCHA 2DQTL 1G7HA 2YD1A 4JQIH 3GXPA 1ZT7B 5CEZD 2QBWA 4MJ6A 1CFSA 2A1WH 4FNRA 2AKRB 1UQYA 3OXRA 5E7BA 5ABFB 1FFRA 1KXTA 3BJ91 3CFKA 3EW3B 4E41B 2C4XA 2WBWB 3EJZD 4RDQF 3AHTA 1NLBL 4P7NA 1F11A 5DT5A 4M6AA 1LO5B 4EKJA 1FVCB 5IESL 2FJFB 3TJHC 2UVFA 1K5NA 4PPTA 1VBRA 2O92A 1CR9H 4HH9B 4WLCA 3D85B 4D0BB 1B3WA 2Z31D 5C7XH 3P11L 4PJDA 2OSWA 4WCYL 4YHNB 4X4MA 3B9VA 1HP5A 4LRIC 5HHOE 2NY0D 4WW1B 1F4HA 5T5FH 2J25A 1BF8A 1KN2L 5F7LB 3N18A 4RA3A 3IFNL 1YQVL 4KZDH 3TTQA 5F7YC 5AWNL 5AD0A 4FQHB 3KL5A 3BQUC 5KZCD 3BZFA 1FNGA 5T1LB 5I23A 4LX4A 1BOGA 1OY3B 5F1KC 3FAXA 2YL6A 5JHDD 1I7ZA 4YHIB 4OZGE 2VQ1A 5D2LB 1TZ7A 1I7RA 5D71H 2DSUA 5GZNC 3SO3B 2I9TA 4AIZB 2DYPB 3WNOA 1DE4A 2YXMA 1OHQA 1ITCA 3O2DL 4ZUVA 1GGIL 4Z5RA 4PY8J 3UR7A 4PRAB 4ERSH 3D3AA 1NOFA 4MQSB 4BSVB 4DUVA 3REVB 4PG2C 4R97C 4MJIA 3TBYB 4HU0A 1A6TA 2YBTA 1NCWH 5JNYB 3MREA 5HGBA 5L6YL 4QHLA 1KV3A 1EBPA 4G9DA 4UV7L 5DHYA 5INDA 2JCCA 5T1KD 3RL1B 5CILH 4DGVH 1QSFB 2WIMA 1T2XA 1RIUL 1KPUA 1DQQB 3KPRE 3FT4B 4C4KO 1Q6CA 4GJTB 1KXQE 3VI4E 2ZSWB 5DK2A 1Z6JT 2ZG2A 1WCBB 2YZ1A 1CF8L 2F5AL 4JVWA 3RQ3A 1CI5A 1XHGA 1UWGL 1B3YA 1TQCB 4PRBB 3I3DA 1KPRA 1VFUA 1ETZA 4U1HB 4KAQH 4ZUTB 2BY0A 3UO1L 3VXPA 5K9QI 4E8DA 4KRPD 1JVKA 4XCEA 4MHHI 3TP4A 3UTZB 5IV2A 5FDYA 3MRDA 4GMSL 4RGNB 2VXUL 5HVFB 3FONA 2E6JA 2X4OA 1B9ZA 3LX9A 1MRCH 3TBVB 3OAZH 1KBBA 1JYXA 3WNKA 5JXEA 3BWAB 1ZVSA 4JAMB 5DD1H 4Y5XA 2VDQL 2C1OB 5J6GA 1E55A 1H8NA 4LIQE 2PW1A 2GCYA 3DGGA 1EZVX 4ZXBC 2BOCA 4HHAA 4KXZI 3LIZH 3GGWB 5J57B 5IIEB 5IVNA 1WVZA 4IOIA 2DQDH 2WUBL