1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
1UWIA 1MHEA 4AL8H 1MJUH 3QCTL 3TNNB 2BSRB 1NBVH 1I9EA 4R96A 1V7MH 3L3JB 1NBZB 3WH8A 4PJCA 3CCHA 1WVZA 2AABL 2OJEA 3QXWA 4NQDD 4R2GC 3SQOH 1B3YA 2WZIA 3RILA 1E4WL 3FFCA 5EU3A 4E8CA 2BFVL 2VISB 1DBAH 5C0IB 1QWUA 3RL2B 3SCMD 4NO0A 5ENWA 1L7TH 5KW9H 3T04D 5J13C 1KYOK 3T0AA 1RZJC 4H25A 5C2UB 5JA9A 5KVFL 1RV6X 4PJIE 5CP7B 5IBUB 4R6UA 1VFUA 3W39A 4Q9RH 1F58L 1K4CB 4LDEB 1OQOA 1SMAA 5ACMA 3AIRA 3ZJ7A 1T80A 4TX8A 2EDQA 5GZOC 2EE3A 3ALPA 3Q3GB 2R69H 2E5EA 1LO5B 1A6WH 1B0GB 2C7UA 2J4WL 2I07A 5A2KH 4LSSH 2DI9A 3RUGF 3OAYH 2ADGA 1FORH 1MRDL 4Z8FH 3WF3A 1S7UA 4ZNEE 3BWAA 1JFQH 3CXDH 2G3MA 1FV1B 4P57B 2W0PA 4DZ8B 3MBED 1A4JB 4F33A 4X80H 1V0MA 3GNRA 4KKLC 3O0RH 3MUIA 2GJJA 1JE6A 2CKBB 2LTQC 5JHDE 5SWQA 3WN6A 3E6FA 4M5YL 3VD3A 1VFFA 1OP5K 3C87A 1XGTB 1LEGA 4ZUUB 1LE5A 1IGYB 2P4AB 1MLBB 2D7TL 1WPCA 1Q9OB 15C8L 1PZ2A 3RTQB 3CFDA 1NLBH 1UXSB 4NN7C 1UKPA 3DVNA 4R2GD 2GSGB 3O2VL 1ZA6A 3X3FL 1LO2L 1A3LL 5EH1A 5IIEB 4WDIA 2QJDA 3OL2A 1CDYA 4NWTH 5JW4N 2D2OA 2W4XA 3T1FB 5C92A 4LSUL 3D87B 4OUEA 5CSBA 3GO1H 2EXWD 3THML 1QFHA 4X4MA 1P84K 4GKSA 1A2YB 1U41A 1ITXA 3WQVA 4NC2B 3T0EE 2PXYC 4DW2H 4L4TE 3FRPG 4PN2A 5KTEH 1T7YA 3BZ4B 3UDWA 2EBNA 1YY9D 3G6DH 4K8RC 3K8KA 1F4XH 1WAAF 1TENA 1T22A 2F1BA 3AI0A 5C09A 5JQHC 4RIRB 1OGSA 3PJSA 3LXCA 4JN2A 5IFAL 5DJ6A 3IKKA 3HNSL 5D1QB 4H0GA 2ZSVA 2ORBL 1E4IA 2Z91B 4PMQA 5DYOB 3QAZB 4R9HA 5T33H 3ZOAA 1M7DA 2VDOH 4G8GE 1SJHA 4M7LT 4KI1A 1QLFB 2VCCA 3QDGB 3WDQA 5E0QA 3LMJH 1LP9F 4U3XA 4M81A 4NO5A 4MQ7B 4F3FA 3WENA 2UWEA 3AIWA 4BSJA 3D9AH 3TH3T 2YBRA 5IVXF 4XP1H 2X9YA 1ZHBA 4CVXA 1Q9OA 2R39A 2DYPA 3WD5L 4FQXA 4FXGB 4ZUTA 2DIJA 4LSRL 3S6TA 5GSVA 3ILQD 1R3LB 4URIA 1E71M 3QRFM 1A3RL 5EZJB 3TTYA 1Y6KR 2WNWA 2J75A 3CZFA 2CIPA 3SCNA 1FO0L 4LYRA 1I3GL 4K7PY 3OB0K 3T0BA 3NIYA 3REVA 2AJSL 1YYLH 2OQJB 4L4VB 2FZ3B 4NN5C 4WEBL 5FCSH 4DTGL 3BC9A 3WL9A 3OZOA 4N0CC 3GJFH 2W0FB 2WVTA 5A95A 4R8WH 4GKSB 1XSKA 3TVMB 2A3AA 1OTTD 2ESVE 4M1RA 5IVXE 4KUCF 1I1YA 2M8XA 3VH8A 4FF5A 1BFVL 3F8UB 3SOBL 3ROOA 5FKPA 3EDEA 3VIKA 3H9HA 4JHOA 2BNRD 1G0YR 4J3TA 5BW7A 4JY4B 3QDHA 4NDMB 4JO4L 3SDXF 2M26A 2PB1A 4NZTH 4U1LB 4AD0A 2DICA 5DK0B 1A47A 4GXPA 1D5IH 5DHVA 1JHTB 4X6DE 4A6YB 1J1PL 5FYJL 3H9SB 4GSDH 1KJ2H 4JJ5A 4TVPH 5GRWA 4I77H 4O2FB 3VJ6A 4JANA 2RB8A 1HXMA 1A9BB 3UR7A 4KRPB 1DQJB 4G5ZH 4OLWL 1ZS2A 3G6DL 4OFYD 3CUJA 3ARGA 3F7YB 3N17A 5DZOA 2VLJA 3WKMH 1NMBH 4KRNA 3IJ8A 4L8SB 4TVPE 1J7VR 4WW1A 2BVPB 2EDRA 5J1AA 1IBGH 4P2YA 1W1YA 4ZODA 4P4KB 4F2MB 3FQRA 2Y36H 3DLQR 1OT2A 1TPXC 4LCYB 4FFZH 5GGSB 1TZGL 3KPLB 4XMLH 4CKVX 1BLNA 4PMOA 1JTPA 1KQZA 5A8PA 5ICYB 3GRWA 5FHBL 4U6TA 3GGWB 2UYLA 4N90D 4JM4L 4F58L 1CLOH 4DO5A 4MD0B 3AB0B 4U3CA 4DFHA 2AGJL 5EC1A 3QPXL 3V79C 3ARGC 4X99B 3BLKA 1PDKA 5D7JC 5T3XH 3DX9B 4QRPB 1KCUH 2CRYA 3ARED 5GRVL 2EPOA 3CUPA 2VDNH 4IDJH 5J6GB 3A24A 3JWDH 2D1ZA 3KWWB 4FFVC 1IGYA 4LVHC 2X4OB 1BYBA 1TIUA 3K2MC 5GGUB 2O5XH 2VN7A 4OQTL 3RDTB 3ZL4H 3CXDL 4YBQD 1DQML 2OSXA 4H5SB 3BMWA 3QUYB 2X4QA 3OKEA 1T7XA 1UD4A 4D6GA 3KXFA 4U1GB 1XIWC 3QJFA 3MLZL 3NAAL 1P2CA 4HK0A 2AEPH 3EO0B 2HLAB 4EDXB 3CZGA 2B1HH 2DLFH 3QHZH 1QLRA 4TSBL 2A83A 3RWJA 3MOAL 3IDMB 4ISVA 5E9DA 1T89A 1T04A 4OIBA 4WUUB 1A1NA 5EMYA 3M17B 1IL1A 4WU7B 6CGTA 2CLRB 4AD2A 1UM5L 3WN5B 1EZVY 4P48A 1NCBL 2BFVH 1AQHA 2FJGA 1IQDB 1N5AB 4MVBD 4PJFF 3X12A 3JV4A 4KHXH 5EU7C 4H1LB 4L3ED 5A94A 3U46A 2EAEA 2XTJD 2XVPA 2OL3A 1M1SA 4RSVA 3ES6B 4Z78B 2Y25A 1YEDA 2VSDA 3SE9H 1B3VA 5CP3A 2DQHH 5H35B 3FQTA 4JQIH 1FH7A 4I0CC 4LVHB 3WFHA 5C0GB 3BCFA 5J3HD 3HE7B 1M01A 2AJZB 3PL6A 2DWEA 4NM8H 3BUYB 4H8HA 3WIJA 4MVBC 3LKSB 4NKDB 2DWDB 4F57L 5SWZD 3HMCA 1IAMA 2P24A 2WVSA 5J4MA 4LQFL 1KULA 1G7LB 3JUGA 2IPTL 43CAA 4PJFE 1ACYL 4LEOA 2XN1A 3OQ3B 1J05A 1WP6A 4OLZL 3NYDA 1C8XA 1AD9A 1QKZH 4UAOB 3MXVL 2OL3L 2YEZA 4EDWL 4PJGA 4BSWB 1EA9C 2DJSA 3D39A 1GOFA 2DJUA 4ZNCD 2P5WA 3KS0J 1OGAE 4O51A 4OJFH 2NY6D 2X9XA 2XXMB 3MLVL 3MUHL 4G9FD 5EO9B 4ACZA 4BH8A 4IRJD 2MSPA 4MNHA 1AXSA 4OQTA 3S5LB 3CZFB 1FNAA 4GRWB 3MUJA 2A3BA 4WRLA 2IAMA 4LMQI 3RVXC 3T65B 1B0RB 2H8PB 2WUCL 5BROA 4G42A 3TNNA 5DO2C 1OCWH 3GH4A 4U0QB 5TPWL 4PRHE 4TUKL 3QQ3A 4QCIA 2H2SD 5CZXD 1G7IB 4KKBC 4A2LA 4PBGA 2K9UA 3NTCH 4RL3A 3SHSA 5HOSA 3QFDB 1WEJL 2R23A 2VZUA 4X7SH 3QG6B 5T3ZL 3SPVA 1D5XB 2E3VA 4Y1AD 4J1UB 2D4FA 2BSTB 4LCUB 5KSBF 2VDRH 4N1CA 3T0EB 1UB6A 5TDNA 4QHKJ 2QTEA 1CDBA 2Z9TA 5DD3H 2XPKA 2RCSH 4ONFL 2JE8A 4QRPD 2HFFA 5GZNC 3GIZH 4OOUA 5B39G 4IOSD 4JRWA 4P5KA 1G9NH 4U1GC 3UJIH 3CH1B 4WWKA 3IJYB 4JZJC 4NGHL 1Q0XH 5HI4D 3BKYH 5CD3B 1YN6A 1XGRA 4XC1L 4KROD 2QQNH 1QSFA 4OZIA 1ODZA 4JKWA 4YIQB 1FHGA 5F3HB 1I9RL 3I50H 4FQ1H 4KVCH 4L29B 3RU8H 4YHYB 1HKJA 1S3KH 3QWQB 3EJUA 3IB4A 5A2IH 3QR2A 4Z7VF 3NCYS 4DZ8A 1GUVA 5CWSB 4J3XA 1NDGB 3MRGA 3NCFB 4WW1B 4K3GA 1L0QA 1TQWA 4UQ9A 2JK5B 2LTQB 4JPKL 4KC3B 1E56A 1XGTA 4Q6IA 3MRMB 1ZA3B 3OLDA 3TTSA 1IGCL 4F2MA 2BSSB 3NIGF 1RZKH 2OXGA 1V5JA 2UY3A 1QQDB 2XNAB 1MWAA 1YEHL 3VI4E 3LMYA 3LEVH 4CVZA 3V52L 4IMLA 4U6XA 4NRXA 4XVTH 4Z5RA 2ED7A 3ARPA 2AOSA 5C7XL 3CLFL 1D5ZA 1MUJB 3MRDB 1P9MC 4L5FH 3ZKXC 4J23A 3DX9A 4KMLB 5DMKB 1GJWA 2XN0A 2EZ0D 4QNPE 4ZXLA 2IH3A 3FFCD 4AEIH 2H9GB 4OCWH 2ADIA 3OKKA 5CBEA 1FFNA 4HIEB 4XVJL 3VM5A 2I60L 2IANA 4Y5VA 3TBSA 2R23B 4MB5A 1S46A 3LD8C 2AK4E 3CLEL 1F3JB 5T5FL 4DEPB 2WQ8A 4PGBA 5FKYA 1IC1A 4S1SH 3E3QE 3TH4T 2WCGA 1UWTA 2FDBP 2ILLA 4F7CB 5T1LA 5JW3H 4S3JA 3TV3H 1B3XA 4IJ3B 1JPTL 3T08A 4TUJA 3V4PH 4W5ZA 1DSFL 1NGZA 2A38A 3BVNA 2EICA 1PY4A 4GBXB 5CEXA 1ZJBA 1CR9L 2EH7L 1GOKA 2C7UB 1V3JA 4KKBD 1TDQA 3TN0B 1R5WB 1SJHB 2VDKL 4HAGA 3VXPA 1ZMYA 3GHBH 3QQ4A 1WT5A 5I19L 4NO5B 1FZKB 4U6VH 2E27H 4F3FB 4P2QB 1UZ8B 3IDYB 3RRQA 3TTQA 2FGZA 5F1NA 1IAIL 1NEZB 1EEYB 1P6FA 4OIAA 5E8NA 5HHQB 2XZAH 5I6XC 4FQXB 4YQXL 1A7NH 3QQ9C 4XPAL 1HHKB 3WFHB 1FL3B 1QRKA 4FQIH 4N5EC 1YNKL 2OI9C 4M3JA 4MNQB 4YR6B 1CFTA 2OR9H 5C3TA 2FB4H 4DGIH 4CU8A 5K9OB 1OIMA 4C56A 4MXQC 4GG6E 4NKOA 4WWKC 4OF3A 5CZKA 3V5HA 3RY4A 1NUDA 2B5IB 2WZEA 4NQDE 1UR4A 3IF1A 2W1NA 1CIUA 4CN6A 3X11A 2BV9A 3S4SB 5I1HL 3CSGA 3RIFF 5J11B 1E4XI 2JJTC 2J6EH 2Z93A 4U1MB 5BVPH 3BVXA 3WF4A 5AYBA 4M7LH 3CK0H 1R0AL 1UR8A 3ARFA 5DRXA 2BY2A 5E9AA 3AISA 2W61A 1EHLL 3ALWA 4D72A 4WLCA 3O2DA 3WIHL 1E4LA 2R2HB 5IVZB 5BOZG 3K1KC 1Z3GL 3BQUB 1UHVA 3F65A 3QO1A 1NOWA 1JGLH 2IQ9L 4P8UA 4JFUA 5A2FA 4R2GB 3D25B 4FQHB 3CH9A 2FECI 3V95A 5I1JH 2PN5A 3UTZB 4UQBA 1X5AA 4G6KL 4OZGF 3BEWA 1QD0A 3ZJ8A 3DBXA 3FRPA 3P73B 1B4RA 3WELA 2Z31C 4M02A 4S0TD 4JRXA 1XIWB 5TE6H 1R5IA 5F6HJ 3WIFB 3MLXH 5FM4A 1NAMH 4OZHA 1L4IA 4EI5D 4M1DL 2EYRB 1CTNA 2XPGA 3LS5L 5F89A 1HP5A 1C5BH 3GHEL 1V03A 3FQRB 4FN0A 5HHMD 1W91A 2V2WB 1U92A 4PUEA 1A14L 1TMQA 3VGFA 3FO1B 4HIIB 3C8KA 3MXWL 4Z7WF 1K8DA 2V5TA 2HJLA 4RISH 4XB7A 4PB0L 3FONB 3P4MB 2CRMA 3MSGA 1UVQB 5CS7A 5FL0A 1EH9A 1FH8A 1INQB 4B50A 2IC2A 1XF4B 4KUZL 4YEFA 4LKXB 5EU3B 1JMZA 2GW5A 5J6GA 3DX6A 5CD5D 1E6QM 3DSFH 4JFYB 4QHNB 1K9DA 1QW8A 3VILA 4HAFA 4FZEH 1BIIB 4PG9B 1NP2A 4RISL 2NY1C 4QNPF 3S97C 2PW2A 1KTDA 5DK0A 3T2OA 4WI4A 4A6YA 1AR2A 1N64L 4HUMB 4J3WA 4DOHE 1SVCP 3C6LD 4M1DH 3POHA 3TCXA 2GDVA 4WO4A 4KRLB 5EUOE 3O3AB 1XR8A 4OZIB 1JF1B 3VFGH 4I48B 4LCCB 3BX7C 3INUL 3SE4A 1D5BA 1WE5A 2YXMA 3OX8B 1B31A 2VLJD 2O9PA 1ED3B 1DQLH 4L8SA 2EO1A 4QRRB 4HZ6A 3STLB 4CW1B 2H6PA 4OJYA 3HPLB 2R9HD 4DKEH 3U0TA 4WENB 3CZ8A 1IGJB 4QXUH 4G8GA 1N6UA 3MI6A 3AFLA 1NC4B 2FL5A 1J88A 4KROB 1SY6L 1YDPB 2JJTA 3JV0A 3TN0D 3MOBL 1KXVA 2H1PL 4EUPG 4TX6A 3WBEA 4PJEF 1H11A 3IXTA 2QL1A 5BVPL 5BZWA 3W2DL 4NWUH 4NSKB 5TQ2L 1HHHA 3ZM8A 1KPVB 3ARQA 4UFHA 1FZKA 1DBJL 3C6LB 4JRYE 2JF6A 4U05A 1RMFH 5HGDA 5TH2A 3T4AA 2JIWA 1LDPH 5AD0A 4JAMB 4EQ2A 1NFIB 4PS4H 3TWCL 1IAIM 3WFZA 5HHVH 3M46A 1BIIA 4M43H 3TP4A 1C7SA 4LSQL 3RWCA 1YMHA 4AD5A 4HX1A 4ODHH 3KPSE 1AHWA 1X1NA 3BVVA 4ONHA 3KPRB 4M48H 4N0CD 4EDXA 4FQXC 3KL3A 5DD5H 1NFKA 4JFQA 2HFGH 5DVNA 2HJKA 3TO2B 1OAYL 5DQDH 2D31B 3RY6C 1UD6A 1D6EB 1KPRB 3FOMB 5ECUA 3CVHH 2AXHA 3QXAB 1IQDA 5F7FA 4XWOC 7A3HA 1LWHA 1Q6EA 2YD4A 3MACL 1FZOB 2BSTA 4HWBL 5DURB 1YUHA 3S36H 4RCAA 5CUSL 1C92A 4HFUL 4JFEE 3QNXA 5LCVL 5J12B 4WU5A 2F61A 2ZXAA 2ITDB 5J6HB 1U93B 5CJXC 5LGKA 1ZWIB 2H3NB 1UWGL 1FGVL 4G8FB 4AEFA 5JORA 2EE9A 2ZSWA 1KEGL 1B4JH 1F4YL 3W6MA 4DO4A 3QISA 4X98B 5JBEA 4DN3L 1X44A 2ICWI 3DHPA 1KLGA 2ZUTA 4G43A 3VG9C 1MCOL 3PHQA 5D9NA 1H3PL 4DUVA 2X9WA 3D25A 1B0GA 1U58B 1A4KA 3VXUE 5F7YC 5E6IB 4C56B 5B38G 4R7NB 4X5XA 1ZE3C 2DPEA 4D6FA 5IUSA 2D24A 4TSCH 2DKUA 3S37X 4N0RA 1JNDA 3ZE0E 4DAGL 5GS1B 3VI3F 2C3HA 3U6RB 4YFLI 3IK2A 2EPLX 4M4PA 2PF6A 5ABEA 4TUOA 4XNZB 3ULVC 2RIKA 4P46B 4LCIH 2DH2A 1F6AA 3APGA 4F79A 4NBXB 3HE7D 1OVZA 3OAZH 1RZGA 1B30A 4NKMB 4POUB 4L9LC 4ZSOB 3IKCB 3GBEA 1XMWA 8A3HA 2KZWA 1IGTB 2J7GA 4KXZI 1K8DB 1EVUA 1JHTA 3D2UB 1UZ6E 3C9NB 4NWUL 4Z0XA 1RUQL 2Y5TA 4Q9QH 4MLSA 1H8NA 3SDAC 2JEPA 1TTFA 4I9WE 4UNVA 4NQSA 3MOBH 4G8IB 1KSRA 2Z92B 4OLZH 3L9RA 2G5BB 5D7JB 2JCCE 3QFDA 1I9IL 3QXAA 3ECBB 5E8EA 2Z8RA 3D39E 3CHCA 1XV8A 1CL7H 1RJCA 3C60A 4F7EA 4LPUA 5EU7E 1M7XA 1BYDA 2F19L 3E0GA 4ZO8A 3D0LA 4DVBB 4QF1B 1DQQA 1KLFA 1JCKA 5EOQH 4GZJA 4Y5YC 3U2SB 1JZ7A 4KK6C 2GSIB 3HJEA 5I9QB 1G9NL 1CLYH 1Y7VA 1PKOA 3LRSA 3GNOA 3VFGL 3VIOA 3CMJA 1CT8A 2ZG3A 1I8KA 4JFOB 4ODVL 1HXYA 1BX2A 4APQA 5FYJE 4Z7OF 4CADB 4N0YL 4MDIB 1X5KA 3MRQB 1T2QL 1A64A 5CSYA 4OFDA 2VL5B 4UV7L 5ELIA 4F9LC 1NEZG 4LHUD 2B2XH 4JVPA 5ILTH 5IEHA 4R4BB 2BSSA 3QDJD 4XC3L 4PTVA 4JN1L 1CD8A 5HI3D 1NC4A 3VI4F 3OKEB 1AFVH 5C8BB 4GUPB 3I84A 4FFYH 5BV7C 2VAJA 1WZLA 3C2AH 2X8RA 1V0KA 1U8LB 2IBGA 3CPLA 1CF8H 5C6TH 3REVB 4M6OL 3I9GL 4TSCL 3MV9D 3ZL4L 3L3JA 2DDQL 3RX8A 1HVQA 5H37G 1TJHH 2BSRA 3RWJB 2K3TA 4ODVH 1NGYA 4PJAF 4Z7NF 5A6KA 2GYSA 3MXVH 1LP9A 1H09A 4LP4A 2GUOB 1ETZA 5JMOC 1WFNA 4GS7B 4PV9A 2DAVA 2DQGH 1F3JA 4GRWH 3QP3A 4H20L 4B16A 1DZBA 2WBJA 2GCYA 2NPLX 4QEGA 4XBPB 4UFKA 1I3RB 3S96A 3BP7A 5C9JB 4IUGA 1MIEL 2JCCA 1BJ1H 4MJID 1ZLWH 3LQAL 4DZBA 3VNYA 5E5RB 5D6CB 2VABA 4OLYL 1F4WH 1CL7L 5KSVA 4UZGA 1T1XB 1KT2A 1WWBX 3QXDA 4G9DB 1W1TA 1A6VH 5KSBE 4CMMB 2XFXB 1HH6B 3BQUA 3LRHA 4X8JB 1Z3GH 1MQ8A 2PYED 4N0UA 3WKML 5GPRA 5FF6A 1KJ3L 1AQ0A 1E0WA 3H7LA 4Q9QL 3WDJA 5DD5L 4K3JH 5GGRY 2Y24A 3R0MA 1A4JA 3B8SA 3IDXL 4HS6A 2VLKA 5F93C 3TOPA 4AD4A 3W25A 1II4E 1J0YA 4GQ9L 2N56A 4QTIL 1A6UH 4CDHA 5EUKA 1LL4A 5GRXG 2MHAB 5HDOA 1EFXD 2BXZA 2NY4D 3NCJL 1CE6A 3MJ9L 1D5IL 2XICA 1KCRL 1PZ5B 1BZ7B 4HWBA 2YA0A 3E3QC 5F70A 1SY6A 4K94L 1T20A 2XG5A 2A1WH 4KTYA 3CPLB 5CSUA 1HKIA 1AQDA 4EK7A 2UYLB 3CDGA 5INCB 1V3LA 3OF6A 1ACZA 4PMXA 3MCG1 4XHJD 4DGIL 1FNLA 2IH1B 4FQQA 2VI0A 4K3DL 5D9SA 2VDNL 1BFOA 2D23A 2FX9H 4X6EA 2H1PH 5ESQB 5GS2D 3QG6A 1DBBL 1MRFL 3PGFL 2W60B 4IRSB 1A7QH 1JIBA 3QDMD 5I2UA 4MJIA 4HWZA 3GRWL 3L3DB 5HYSB 1B6UA 5E2WL 2PWFA 5B4MC 1A3RH 2QHRH 2QQLL 5LBSH 1CDGA 4NC0B 2BXYA 1E4XH 2ZCKH 4NRRA 1DQLL 2PBOA 2E40A 5A1AA 5EU5B 5HHXL 1ADQA 3OR6A 3O3AA 4EN3A 3O81A 4AC1X 2DT3A 4E42B 5IF0A 4LLUB 1OAYH 3CD4A 2C4FT 3LVEA 1CD9B 1FNFA 1MVUB 4Y2DA 3LMJL 3OSKA 3LN4A 4MAYA 1MRFH 1BFTA 1OSZB 1W72B 3O8XB 3PGFH 4ZYKA 4G5ZL 4OLWH 1MCPL 2E9BA 2FJGB 1C12A 1Z6JT 1T0MB 3CMGA 2V3EA 4G6MH 2IG2H 4M48L 4PRIA 4Y5VC 2OL3B 1HHIB 3QEGH 3MREB 2A6DB 2V2XA 1F2QA 1JV5B 5DVKA 3U2SA 5AYIA 5DD0L 4Z7VB 2XIBA 1TQUA 5B4MD 3LS4L 4LLVA 4PGZA 4UDTB 2EEXA 2WP3T 1QFOA 3WNOA 2LFGA 1VFMA 1MFBL 2OQJA 1HIMH 4L4VA 2P5EB 2Q1EA 1KCRH 3D2UA 3HN3A 3NCJH 3QUMB 2UVFA 2JJSC 3ABZA 2NXYB 5C7XH 3UBXB 4CDGC 2KBGA 1XCTA 5DS8A 1BFVH 1J9CT 2AV1A 4LP5A 2H9GA 5CBEB 3GSQB 5EBLB 1GGTA 4C7GA 3V5DB 3THMH 2E9WA 3FT3A 1SY6H 1C5BL 3GHEH 5ERWB 2LV4A 1FYHB 4R7DA 2WZPD 3B4NA 1BD2B 4QYOA 4RMTA 2MKLC 1C16A 3BAEL 3L5WA 3W0WB 5FECA 5MHSE 4X4ME 5I8EB 4DVBA 1OHQA 5I1GH 4PLOB 1GVYA 3T1WA 2DTMH 3AREB 1KG0A 1NCAL 2JJUA 4RMSA 5DSCB 1GOHA 1AGFB 4HJGA 4JG0H 1K6AA 3OJMB 3FMGL 1I7TB 5DJ2B 5C08B 4AYSA 1TQSA 2WBGA 1KTKE 4JCMA 1R24A 1U8JB 4OZFG 4LIQE 4NGHH 1ZHLA 2HLFD 4OFIA 1G9NC 5FKAA 1GZPA 2ADFH 5A6AA 1W72L 5DQJB 4BUGA 4H20H 5KG9B 3UJJL 5DEGB 1PVHA 2RCSL 4ONFH 1U8QB 3F7YA 4U4BA 1DEEA 1F4HA 4G8GD 1GOQA 1ADQL 4PJIB 5L2JB 5T33L 5A6LA 4OF6A 3HC4L 1TJHL 1INEL 5CXPA 4HBQA 4L1HA 4MGXA 1DL7L 4BSVB 1KLUB 3UG3A 5E5MA 2BY3A 4AIUA 3C5JA 2EYTB 1FL3A 4WI7A 4QXWA 3QB7C 4Z7QE 1YMMB 3VRLF 5CHNB 4WO4C 5CEZL 3RM4A 2QQKH 2B7DT 4YPGA 5EU4B 1HWGB 1WZAA 4WDIB 3KPSD 2GQHA 4OZFA 2JF1A 1PQZB 2O92A 1S9YB 4MNQD 3HUJF 4HUUB 1NCCL 2AV1B 3J8F7 5HGDB 1U8HB 5D2NC 2B2XL 4NZUH 3ZMRA 3PIQB 4IOIA 4L4TA 2Z31B 1R3HA 1A14H 3MLVH 3GMQA 4EUPH 1R3JB 4OZGA 4K55A 4WO4D 3IXAA 4KI5E 2HKHL 4OD2B 2YLAA 3PWVB 4HIJB 4YQXH 4RE3A 3LS5H 2NW3A 3WF1A 5IBLC 5KN5B 4MQTB 3QCUL 4KKAD 1A7RL 4PRDA 5TE6L 5FA3A 1WF5A 3IU3B 2XN9D 3FJTA 1XD1A 4BCEA 3ME0A 2UVEA 3EOAA 4KI5D 3WLWD 3BH8B 4QXGH 5D8WA 1ZLUH 3OLGA 5JMRA 4X0KB 3CZEA 5CILH 1RD6A 4MXWL 3GXDA 1XH3B 4W86A 3MRIB 4I13B 5IHLB 2F8XC 2G60L 4C57C 3F7VB 4M5YH 4WI8A 1NDMA 2EQDA 4IMKC 2VWEC 2OCFD 5FO8A 2RFXB 4X7EC 3PABA 4X5WA 2R8SH 4WEMB 1MRDH 4MQ7A 4Z8FL 3NSMA 4OLVL 5E6ZA 3CGTA 3ECQA 7CGTA 1DE4A 1AC6A 5E1HB 2J2ZA 1D9KA 1R5VB 4JLRB 1AHWC 5IB2B 1BVLB 5BQ7B 1FC2D 2GJXB 2Z0BA 4LARL 4CCEA 2AI0L 5ITFA 4L9LA 2J7BA 5CEXB 5D2LB 3GXNA 3WXVL 1CGWA 4QRUB 5GIRA 2BNRA 5FD0A 5F88B 2ZZUT 3HTLX 1C3FA 1BGXL 3RKDC 3FZUC 3T0XA 2AJ3A 4UI2A 4GXUM 2FRGP 3V9FA 1ROWA 1ECEA 4JFOA 3EYOA 5IB1B 3GXFA 4EANA 3NPSC 3QI9C 2OR9L 5D9SB 1G84A 4BF7A 3V52H 1O0VA 2DM2A 4FQIL 4ZUVA 4XXDA 4OQTH 3I02A 2YL5A 1KB9J 4J4PA 1SQ2N 4ZFOB 5DUBA 2K1MA 3VVGA 4KGJA 3QPQD 3BP6B 3I2CL 1M53A 2IF7A 4HUWA 3O6FB 4NQSB 2FJHB 1CI5A 1KBBA 2WBKA 2V17L 5IMKB 2G5BA 3MA9H 2IPUG 5DXWA 1R75A 3EJQA 4PLJC 4AWEA 3RTQC 12E8H 5L0QC 2GJ6B 3PHOA 3VXRA 3VD7A 3QIWA 3P0GB 4L8DA 1ZT1A 3T3ME 1UB5A 5DJ8A 4F7MA 1X5HA 2CIIB 2ED9A 1S8DA 4B3LA 1HL8A 3NFSH 4Z6AT 5DD3L 4MA7H 5DQDL 3G5XA 3HRZB 1UB6B 5TDNB 3S35H 4D8PA 5JW3L 5IDIA 4BUHA 5FYLE 2HFGL 1AGDB 2ID5A 1KCVL 3FQXB 3L3HA 3F6LA 4N9OB 4P46D 3VFVB 1SVZA 1FFPB 4X7SL 5F3HA 5T3ZH 3RM8A 4XV0A 1S9VB 5TGBB 5EFDA 1C5DB 4UFJA 4GSDL 5EIIB 1I8IA 2YPKB 5TPWH 5T1KB 3WD0A 1CICC 5F72S 3GUTB 5IQ9A 2HT2D 1DWGM 3MJ8A 3ILQC 4KGLA 3QOKA 3HZMB 1DUYB 3T4AB 4WCYH 2WWCA 2F53B 2QSVA 4KHTH 4XVTL 5EZLA 5IVXB 1TZHB 1G7HA 3QWRD 1GPOH 3BO8B 3AYSA 4YXHH 1EUUA 3DTXA 3QEQA 3W2DH 1KGUA 1RZKL 5J8OA 2YUXA 3UYOD 3NFNB 4JREC 4PJ7A 1EGJH 4BZ2H 4JFZH 1OTTC 3PDGA 4EE9A 3VWKB 1DWJM 3VG9B 3ARDA 1JNHA 1Q6CA 2VE6A 3HRPA 4JDZB 1H0IA 1C5CL 2OJZH 5C07B 3MCKB 2F7PA 1CE1H 3P0YL 1IAKB 3C60D 1OGGA 3FB8A 2BHZA 1L7IH 3A6BL 3LEYH 4PJGE 4XCEA 1Q9LB 4UNUA 1BFOB 1JWMB 2JB5H 3VXRD 4Q6IC 4WKFA 2EPMX 4P5TA 1JP5A 3MV11 1IM9B 2AXGA 1A7OL 4MDJB 5T1KD 3DGGA 3A6CH 5LGJA 3UEZA 3AHVA 4ZMAT 4PTWA 5DJ0B 3W0WD 3AUVA 4KK5C 3VXRE 3AAZA 1DUZA 4KK8D 3VXUA 3DSNA 4DQOL 4PRHA 1G7PA 4QWWC 1LG2A 1TITA 3O6ML 5HI5C 5DO2D 1ES0A 3V0VA 4EIZC 3WHXB 1UM5H 4A2MA 5GNXA 3SCUA 4LSVL 1J0HA 5C0EA 2IQAB 5C0RH 3GUTA 1CXEA 3HG4A 1MHPL 3QUZA 1H3UA 4GI9A 5EBMB 4UQAA 5KAQF 3B9KA 5C07E 1FLRH 4ORGB 4PD4J 1CDIA 1IV8A 3U6RA 4PRNB 4LLWA 4PJ9A 4I0KA 4Q7DA 3QJHA 4YHKL 4HC1L 2VR4A 2VR5A 3DVFA 2EABA 1JRHI 4C83B 2F7QA 3SKMB 3FT2A 3A5VA 1F2XK 1DQMH 4L3EE 1UD5A 3EO1A 4YBQC 4DW2L 1HNFA 4YHGA 2MQCA 2ZE0A 1VESA 5C0NC 1KB9K 3HZ3A 4I0PB 4YHNA 1OTSC 4UTBL 1CENA 3KPQB 3FCTA 1CD1A 3THDA 1G5AA 3HZKA 5IK3B 2Y5TB 5IROA 4ZAKD 3U5UA 5JW4Q 2VITB 4MD4B 1Z0NA 2W91A 1H8SA 1GORA 3X3FH 1RUKL 2R56L 3U7WL 4POZC 3SY0B 2D3LA 5D7LD 3HZVB 3GJEA 3RDTD 1T4KA 1UACL 3BXNA 4K23H 3TESA 2YL6A 1WBXA 5D8JH 2DQUL 3NIGE 4WHYG 3I02B 4YDJA 3CIVA 1DEDA 5FDWB 3WN5C 3RIFK 2Q3ZA 2NT0A 1G9MH 4HX1B 1JN6B 4O2CA 1PKQB 2E7LC 1R46A 5CZVH 5DJ6B 1KNOA 3WIHH 3TPUB 5B39A 5JW4R 4JFQB 3OXRA 2J4WH 1TCRB 1QSFB 2WKGA 1TVBA 5JDJA 43C9B 4ZAKC 2CLZB 2GK2A 5FIEA 5TDPB 1QHZA 1F6FB 3ARDC 3BWAB 4OQ1A 1R24B 3TEUA 4Q9RL 1LWJA 2DQIH 3HUJE 3MUGB 3DBXB 1J1XL 1A6TA 3CZSA 3OLIA 1N3NB 4QCFA 5HSFA 2WUBL 1YUHB 2WP3O 3CSYA 4ZS6C 1DEEB 1YC7A 2BC4A 3MLZH 3SKMA 5CLWA 4Y88A 1QFUL 1GGIH 3HU7A 4G7YL 5DC4B 2JELH 1KGXA 4B5EA 2R0KH 4ZO6A 4BKLA 1GSMA 1BGAA 4F15B 4F7TB 4KZDL 4Q9CA 3TBVB 5IT2H 2XTLA 4HU0A 4XPAH 1CLVA 3B9DA 3QCTH 4Y4HC 5SWZA 1FZMB 5DJXB 1VDGA 3RM9A 5C0JB 1SEQL 2ITCB 4KY1H 3P11L 1NJ9B 4JY6B 2ARWA 4Z95H 1JXKA 3NIFF 4GAGH 1KV3A 4JFDA 4JM4H 4B15A 1FO0H 5DRNA 3REWA 1QSFD 2CIKA 1C8YA 3MRNB 2X4PB 1RK1A 5BXPA 1MWOA 5GS0D 2QKIB 1CWVA 4X6DB 3ULVD 4JDVB 5JPMA 1TG7A 1KWKA 2ENYA 5AWNH 3KPSB 2Q7NA 4JY4A 2GTWA 1EBPA 5I76A 4ERSL 4NOBA 2Z35A 1VACA 2X4TA 5FB8A 1MAML 4M00A 1ZGLM 1NMBL 2E6PA 4NI3A 3VFVA 3O9WB 1G6VK 3WH7A 1BLIA 1N6QH 3U7VA 3NFPB 5CAYB 1JUFA 2C1OA 3ULSA 3V5KA 1G7JA 2D9QB 3IT8D 4S1SL 2X0YA 2NLJB 1T83C 2EXYD 3TBYB 3UG4A 2A6JB 4JFHE 1FH9A 4XBGB 3VG0L 4Z76A 3PWPE 1BQSA 3FT4B 1QBLH 4KH2A 4NQXB 4R5EA 1YEEH 4QY8A 1MHCA 2CDEA 1U8OB 2E8YA 3U4AA 4BSVA 3BGMA 2MHAA 2W9EH 1Q9KA 4MJ5B 4C7FA 1GHSA 3CLFH 5F44A 4ELME 3M6DA 4XNUL 1WC7A 2M2DA 3PWPB 5I71B 4L3AA 4IJ3C 1QI0A 2VLLA 1TZIB 3PF2A 4LRNL 4YDKL 1RULL 4LSUH 4LGXA 1AI1L 2EKSA 5IM7B 3GSXA 1BHGA 4GAFB 1ONQB 2IPKA 3KVQA 4E41E 4PMZA 3W5MA 2W63A 3V6FA 3FQUA 2FATL 4JHZA 4PCSA 2YN3A 2QEJA 3TA9A 1A5FL 4Q9BA 2P8MB 1CECA 4OCLC 4XHJC 4W81A 2ARJB 4BK4A 3BD5A 4YGVB 1GZQA 4U1LA 4U3HA 2WCSA 5J12C 5KS9A 35C8L 3KXFB 4KUCD 1KCSL 1HTYA 1I7ZB 1CU4H 1R3IL 5EN2A 2N1KA 1BJ1J 1MEXH 4NZDA 4D0DA 2WANA 5MP6H 4AIEA 5EB9A 3TO4C 1P69B 1XCXA 1Q0XL 5F96L 1AY1H 3L5HA 3VPLA 2D31A 4KJWD 1U8KB 2HTKD 5MERB 4PLNC 3OPZL 3PZGA 2NW0A 1HF6A 2GUOA 2VDRL 5TE4L 5FA4B 5BRZA 3VFMA 1HKFA 4WFHE 5HGHB 2J8UA 2A6JA 4PV8A 1WLHA 3D2UD 4WWID 5F71A 1DBMH 5DJZA 1US2A 4JRXE 2L7JA 5C0BE 4TNVF 1DBAL 3G5VB 3GIVA 1ODUA 4OM1L 1RH9A 4L4TD 5KTEL 1AC0A 1ORQA 4NZRH 2Q7YB 3ULVH 4UINL 4DVRL 4LPWA 2QADB 1FCGA 1UKTA 4MNQE 3SGEH 2Z8VC 1WZKA 4FXLA 2YL9A 2DQEH 4JGJA 4PJDF 3LSOA 3QUXD 4NWTL 4GMTH 1OM3H 4ODSH 4XX1G 4YO0A 4D9LL 4IISA 1X7QB 1V8HA 2P8LA 2Z31D 3ESVF 4P2QA 4ZTPL 3ULUD 2XQBL 3NH7H 5FCUL 4MZ3A 3RI5K 2P7TB 5J3HC 1FFQA 5T3XD 5FIPA 3GH7A 3HC0A 4RFEA 3OG4B 4NHUA 2D7TH 1ITBB 1NEUA 5EZJA 1TVPA 4Z2IA 1MJ7H 3KYNB 4P49A 3IDJA 3TBVA 3VXMB 1KB5B 3GMRB 4ZXBD 4PCTA 3EDDA 3RUGB 1PAMA 4GG6A 1RZJH 4WW2C 3KDMA 1B3WA 4PJ8B 5FUZL 5FGRA 4AMKH 1ZHNB 4LLQB 1E40A 1J01A 4HA1A 4OSUH 4LGRB 1GZPB 3KPOA 5IJVA 3ZJ6A 2A0LC 4MLIA 1HQ4B 1TJGH 3DC0A 4GKZB 2DBLH 3W29A 4HWZB 2B5IC 3ZKMD 5A3HA 3AY4C 5KVGH 5IB4B 3PP4L 1L7TL 4UQEA 4ZUTB 3P0VL 1HKLL 2PTTA 3DO3A 4X6CF 4YAQB 5CG0A 2QSCL 2VZ1A 3JTTB 3OGCA 5C0DA 1KCLA 4YC2B 4UR9A 2NW2B 5AYUH 2AABH 1FAIH 4RWHA 3SQOL 2VLJE 3QIUC 2AXFA 5E09A 5I15H 1OAZL 2YKLL 4XPFL 3FB5B 4UTFA 1KN4L 2ICWA 2HP4A 4PEEA 2Q8AL 1MJUL 1RUML 4BQ4A 3PZVA 2J62A 2Q86B 3U9UB 4IDJL 4NUJA 2X0HA 5A6BD 3DHJA 1CGUA 3ULUL 3VFWA 2CLVB 4FMVA 2CKSA 2Q8XA 3HNVL 5JUEL 5I1EH 1VEMA 4MJ5A 1JTOA 4LGSB 3SO3B 2GK0B 3V6ZB 1F5WA 3SUTA 4FLQA 3DVNB 5LGHH 5ICYA 2NY1B 4GLRI 1IEAB 2XKSA 4NXKA 3IJSA 4ZENA 5IIEA 2WWMD 4MJ4A 4KRTA 3KJ4B 4GW5B 1NL0H 1FP5A 2R1XA 1XGZA 3GSUB 1QTYT 2AJYH 5J0BA 3UTSA 3ZR5A 3X14A 3EDKA 1GQJA 4UQ3B 4YPJA 4YWGL 3SPVB 1JRHL 1MQKL 5I1CL 2H32B 4KPHL 1MFDL 1U95B 4DFIA 1N7ML 3U36A 2UY5A 3EOTH 4YDJB 1BYCA 1MCFA 4XBGA 2R4RH 5EWIH 1E6OH 2XKNA 1C16B 4YHZH 25C8H 1SJEA 3WHE0 5MEQA 1WCGA 1H5BC 3K81A 1WWCA 1ZANL 3QXDB 1UM6H 1E43A 2EZ0C 3AU1A 3X13B 3T3MF 1CQKA 4XPBL 3JTTA 4K3EH 3FB7B 3MA7B 2CESA 1BLNB 1KLGB 4BFGA 5HHOD 5EO0A 2VLLB 4XNYL 3QPQC 2UWEE 1OGBA 1Q6FA 4MNGE 3WFCH 3WQ4A 4NN6B 3QWOA 4OTXH 4ONGH 5DRZB 4EVNB 1WDPA 1MAKA 1MELA 3B2UC 5ALCH 2YD7A 3O3EA 1R6VA 3EYOB 1WZ1H 4UQ2B 3B2VL 2XFFA 1WTLA 1JHLL 1RHHA 4L3EA 4V1DD 4LASH 5GGRA 5E2TH 3WNLA 1JNNL 2YMXL 4K7FB 5FYKD 3RMEA 1U8MB 4BZ1L 4DTGH 4GMSL 3N15A 4FXKB 1AQDB 2BX5A 2FX7L 2QADC 4HXAH 5C09E 4R90H 4ZS7L 2XG9A 2BNUA 3ILPA 3WBDA 1CBVL 2D20A 2X10A 3D3VB 2R1YB 2WINA 3IAQA 2F1AA 3LKQA 3LPWA 3W28A 3VXUD 2Z92A 5F7HA 4JFDB 4M7KL 4YDVA 3FXYA 5HDRA 1AQKL 3PZNA 5ANMB 1I1RA 2XGIA 3PWLB 5E00A 1U91B 2V5MA 2YFOA 4ZUSA 5L9DL 4X6DA 2B0SH 3M8OL 3MJ7B 5T3ZD 1HSAA 3O4OB 1FQ9C 1LDSA 3HG1A 1ISVA 4KJQD 5A3ID 5LVEA 1SJEB 5FA3B 5BXFB 4MQXC 3ARZA 2HYMA 1GGUA 2WIIB 3P9LB 1NGZB 3BVNB 3W9DA 4TVCA 4LHUA 5IMLB 4M6ML 5DD6A 4JO3L 4PJFA 3G5VA 3MGTA 4GIAA 3NJ3A 4ODTH 4L8CB 3HE7A 2GUYA 1OLZA 3RZCA 4OI7A 1BZQK 2X42A 3TIEB 3V8CA 1MOEA 4XH2A 1F4XL 4NQVA 1OAUL 1DQDH 2CBJA 5C0AA 3I6KA 4PY7A 1KIUA 4F66A 1NSNH 3ARDD 4PJ7E 3LKPA 3U7BA 4MXVE 4XI5D 2VZSA 4PYSA 2CITA 4QRTA 5FHAH 4JO2H 1MHCB 1NEZA 3LQZB 5F3BA 1T1ZB 4ZS6D 5I18L 3SBWC 1CGVA 4HT1H 5CPTA 4FQ2L 1FRGL 2WV3A 1UQZA 4X7TA 4U0RB 2V7HB 5IMMB 5KZCB 2GAZA 2VUOA 4OUOA 2G2RA 2V2WA 5ID0B 4XXCA 2NY1D 3O4OC 4I3SL 4HU8A 1VJZA 4LSPL 1U58A 4UB0L 5GRUH 1PG7X 1YNTA 4OZHF 3OKMA 3RIKA 4DKFH 4RA0C 2DM7A 1CTOA 1EQPA 1V3KA 4M6NL 2VO5A 1NDGA 5EZIL 1MQQA 2NX5A 3ZO9A 2HISA 1OT1A 1GGCL 4LCWA 3WEOA 3UTTE 1T7WA 2R0ZH 3D1MC 1MFVA 1NAKH 3FQWA 1V02A 3BPCB 5JPNA 1FORL 3DRQB 4DGVH 1TVDA 4JN2B 1A6WL 4OIIH 3VSUA 4HF5L 1JFXA 4CCDA 3RWHA 2EE6A 2XTJC 4PJHE 4XNZC 3ZDZF 2FJFB 5CPQA 1WK0A 1Z0MA 4PFEA 4YDIL 1U8PA 1XGQB 1HKKA 3GMLB 1HHJB 3MYZA 1KR1A 5C0DB 1OWWA 3GI8L 2A77L 3HCVB 2V2TB 1P4BL 3MGOB 4QRQB 2XVNA 1MFCL 1XCWA 2YJQA 3QUZB 2X05A 4WW2F 3SDCA 5KJRH 4Z76B 1JPGB 2WB5A 1XSJA 1BAFH 4FTVD 1ND0B 3P3YA 2ZCLL 4YE4L 3MCLL 4H1LA 3ZDZE 4ETQA 1V7ML 4NQEA 1ZOXA 3A6OA 3MRMA 4M93B 4O9HL 1M7IB 3MGAA 5A43C 4Y19D 4YZFF 4DKAA 2XQYK 4P9MH 3CMOH 2E6JA 2AEIT 2FGLA 1QP1A 5CIPH 1U8IA 4MB1A 4K8RL 4LPTA 2P24B 3RJXA 1MCEA 3IS0X 3WD2A 1ZT4B 5GRZA 4NZFA 4P2OD 1QR1B 3N85H 1I8LA 4NCC2 3HE7C 1RIUL 3AHZA 1X7QA 3BUQA 1UENA 5EZLB 5I24A 5FOJA 2LE9A 3R1GL 2KZ1B 3MLUH 1HINL 1QYGL 5FAAA 1TJIL 1QRNB 1FSKB 1UA6L 4OD2A 1JD9A 1TFHA 3AJ7A 4QLKA 3AHYA 4NQCD 4P7RA 2XZQL 3DMMB 4R90L 3SDDA 3UO1L 4HGWB 3WFEL 3DO7A 2FX7H 5IHBA 2A9MH 1H1NA 3AROA 1FH5L 4W6YB 4TNWF 4PRID 1NC2B 4MB3A 3GMLA 2BVQB 3C2SA 3JVGC 1H15A 1S7TA 3WD1A 2VNCA 1INDH 4TPRH 5F1IA 3WUEA 1I4FA 2MKWA 2P45B 3VDHA 1NDMB 5FA4A 2PO6D 2VB5A 4FNTA 5F6HI 3KLSA 4OF8A 4HA3A 5E6IC 1WZ1L 2A9NL 2NQCA 5LA1A 4ZYKB 1EOMA 1RIVL 1V0NA 4OLEA 2NY2D 3WSUA 1NCDL 4PJDB 3VFOA 5ACLA 3K2UH 2BC4B 1OWQA 5DGRA 5A69A 3UC0H 3LDBB 4OGXH 5HVFB 4R26H 2Q6WA 1FVDA 5DRWA 1LD9A 4DWHA 1OPGL 4Y19A 4AH2A 2YN5A 1S7QB 3ARBC 3QDMA 1ZA6B 1BREA 1URLA 4PJEB 4X8JA 5DF0A 4AMXA 2IQAA 3OKLA 4P9HL 3D0VB 5E70A 2O9OA 2WAGA 4KDTA 3HI6L 5DJXA 1N7MH 3C5SB 2WMHA 3BPOB 5T5NF 1E9LA 2FIRT 4UOJA 1ZB5A 3MPCA 4G9FE 4P2QD 2PBGA 3BIKB 2NSXA 5I75B 4TUFA 2MPAH 4JAMA 3WLBA 3ARRA 4JFFB 4Y0GA 2X2JA 2DQFA 5I8OH 4EI5A 5ERWA 3QZWG 3MC0A 1BD2A 2BNQE 4Z7QF 2J8GA 1BZ7A 1W2KT 3JWDC 1U0QA 3KPRE 3MRBB 3BVUA 3KPQA 3CPUA 1RJLA 5I3DA 4M7JH 3ZO0A 3HI6H 3TZVD 4P9HH 1EIBA 3BDYL 1FNGB 5D9PA 4NNYA 4GKOA 5GS1C 5I30L 1NOUA 3LPOA 2ZOKA 3BN9C 3NA9H 3M45A 5H8DA 3VXSA 5KEZA 1HILB 2VDQH 1F00I 4GZIA 3QZWA 8FABA 3U48A 1AE6L 2EDHA 3BE1H 1KIRB 1MI5E 3EGSA 5D1XB 1FYTD 4OF0A 4YH6A 5EU6B 4OAWA 1F4AA 1QSZA 2CKNA 5DHVB 1GPFA 1U42A 3SCRA 4X6CB 1YECL 5HDBF 5K9QG 2DQTL 4RGOL 1WWAX 2D0HA 2WWDA 3IAPA 2GJRA 3AIQA 4WKAA 3PP4H 1DHKA 3SDAB 1K3ZA 2A74A 4NM4L 3GJFB 1I8IB 3L95A 4Z77A 1C5DA 4N1HB 3ARXA 4PMUA 3BGAA 3EYQD 1EGZA 5A6BA 4LSTH 1LE9A 2VQ1A 2V5YA 3MROB 2R29H 3QYCA 2AJUH 1FP8A 2P49B 3TVMA 1R3KB 1UWXH 4JG1L 1IQWH 3PGCA 3D50A 4ELKA 2QMJA 3K4ZA 3LEXB 3DYPA 3KYMA 2A0LD 1QOKA 4NO3A 4N9GA 2VLRA 1OP5H 1IMHC 4W8BA 1CD0A 3OWEA 4PTUB 1M7IA 5D1ZB 1MCLA 3ULUC 4D9QD 1B9ZA 1CVSC 4QHLB 5FCZA 3MODH 4OD3L 3CDFA 4PJCE 1JNHB 2DQJL 5ISZB 5HPMB 1KGCE 4MB4A 5D1XC 2FSEB 1QI3A 4M03A 4UB0H 5GRUL 1VGKA 1HHJA 1QA9A 4HPYL 2XSBA 7TAAA 5BV7H 5ABHA 3RWDA 1DFBL 4PJXF 4O2FA 4P23C 2XSAA 4PJAB 3QIBA 3L3OA 2ZWLT 4LLDB 4CU7A 5HPOA 2Y2WA 4LGPB 1JG9A 4KTEL 1JGUH 3UJTH 1SM3L 1K4DA 4NN5B 4FP8L 4DGYH 4AZBA 4DO6A 4MJ6A 3ZYIA 5FO7B 3V4UL 5KVDH 1XCQB 1YHTA 5FK9A 2KUTA 1XH0A 3ULVL 4ETQB 1F90L 1PPIA 5KOMC 1OAUH 2YOCA 4ZFGH 2CETA 2JJSA 5FYKE 1XR9A 4OGAC 1ISWA 3WV0A 2ZKHL 5L8JB 2I07B 1DVFB 4C4KT 3L4TA 1H0GA 3OJ2C 2AK4A 5E03A 3GZAA 4C58B 2X1IA 5EULV 3BDYH 4YXKH 5INDA 3T3PE 2FIKB 1CG9A 3TCLA 4M7JL 2DRUA 2GVYA 4G6JL 4XWGH 4IPNB 3GBMH 2CBUA 4PMDA 4NQXA 3L1OL 2Q6WB 1V6WA 5D1QC 1TVHA 3G5ZB 5K9JH 3WMSA 2E7HA 3ARBB 1A6AB 4MQSB 1WICA 1QWNA 2YK1L 4LU5L 4TOQA 3QIWD 4ZPTB 4IEFB 1EEZB 1JWUA 4GJTB 1Q72H 2Y6SC 1IC5L 3NMEA 2IGFH 4UMGA 5HY9A 2DD8L 5CEZD 3AIVA 3CFCH 1EHNA 5F8QC 2I9LB 1FIGH 1A5FH 1AO7A 1BOGA 1BEYL 4JM2B 5DT7A 5JIWA 2L7UA 4PP1D 4HULB 1OP3H 2GCYB 1HQ4A 5EIQA 5SV3A 1E3ZA 1HSAB 1RULH 2OM5A 2DSZA 4HBCH 3PJSB 5FK9B 5JIHA 4P3CH 1QVOA 3EYFA 3G6AA 1CGYA 3K0WA 3LZFH 2I25N 2C9AA 1D2KA 1MWAL 5B3JF 3I3DA 2DL9A 3MRCB 3GXTA 1JJUA 2OSLA 4OF7A 4WNQA 1QRNE 32C2A 5DD6B 3RVWD 5FEBA 4H7VA 4NF7A 4AZCA 2QLYA 4L8BA 1DQDL 3ZYJA 3T0DA 2VXVH 3U9PL 5JIPA 4V1DA 5DUPH 2VX5A 4UV4L 3MZTA 4DCQA 3FL7A 1F97A 2VOTA 3LN5A 5L2KE 1QSED 1S7RB 3BKCL 3H3PH 1TXKA 4IRZH 4M61B 4PLJD 5C0AD 3FO2A 4AW7A 4HDIA 2ICWB 2E3ZA 4AYFA 1MVUA 2XIDA 3SDCB 1G9EA 1LHZA 4MNGA 5HYJD 1WJ3A 1JZ6A 1QSEE 2C1PB 4YXLH 4HH8A 5EB8A 2O9RA 4D6IA 1I1AC 1MFAL 2B0SL 3M8OH 3QDGE 4HLZG 2GT9A 2QR0B 1DANU 3QEQE 5GSVB 3WEZA 1R3LA 2P5WB 3BDBA 2AXJA 1PZ5A 3RVVD 1FPTL 1BZ9B 3IDNB 3HPJB 1VFBB 1ISZA 3B2UD 1JGEB 3KPNB 3CDGB 4PY8J 4AJ0A 3MCKA 2HVJA 3GKWL 2CKRA 3Q5YA 3HAEB 2ITCA 1WWWX 4ZS7H 3VFUB 1FZMA 3MFFB 1AO7D 4IS6B 3T4YB 3BEVA 5IMOA 3CX5J 4PJEE 4AXNA 5AYQA 4M3KB 3FN3A 5AAMA 3MRJA 1JWMA 2DIBA 2WHMA 5AC5A 5FKPB 3BPNC 3CMOL 3DXAD 1ZKAA 2PWGA 4BZ1H 1BFNA 3VDCA 3BMVA 1NFDB 4IRSA 3Q48A 4NYLA 4YXKL 5A16A 3SUVA 3EFDH 2CDGA 4AIOA 4KQ3L 1QPPA 5L7XL 5F9WC 3PTQA 4QXTA 5D2NB 1M05A 3CVIH 4ZG1A 4HK0B 3MFGB 4V1DB 4UZUA 1UR0A 1XGRB 3G04A 4DCQB 3PZMA 3TLRA 2DH3A 2A83B 2FO4B 2N4IA 2ADIB 3OKKB 4J4PC 4L29A 3O2DH 3MNZB 1MCSA 5DRZA 4ODXB 4K3EL 4OCMC 4E9LA 5DEFB 5FL1A 2G5RA 4UBDD 1M6OA 3MLPA 1FFOB 1IL1B 4WU7A 1JGUL 3UJTL 1LL7A 2WHKA 5TF1H 1YQVL 5DQJA 3HE6A 3KPTA 1A7PL 1HHGA 4YHZL 4XAWH 4JRXB 1RHFA 3Q2CA 1FBIH 5F7EH 2W66A 1RZ8B 4P3WA 5BJTA 2MWCA 4DGVL 1MHHA 1W3LA 5F7MC 3RTQA 4ZDHB 1MQKH 5D5MA 2DD8H 1LD9B 3QQNA 1ZU8A 3A4AA 1XR9B 5CJXA 4N0UE 4HMDA 1VEPA 5DHYA 2E0PA 1NMAH 3BZFA 4HUNB 5HGAB 5TFSL 3KLAA 3EYVB 5DVLA 5EC1B 4I9WD 1BBDH 2OI9B 3X17A 3OKLB 5T1MB 2A73B 2ZUYA 3BUDA 4GH7B 3MFFA 1KN2H 3T4YA 2CR6A 3G5YA 4KRUA 3RWDB 1QHOA 3GSXB 2Q86A 4I3SH 5EUOB 1ETZB 1RUKH 2R56H 3BJ91 3DYMA 3IFNH 3MRLA 4JFWA 1EHAA 2X4RA 3BRDA 4NYLB 1V6VA 4RRPA 1CFSB 1FRGH 2V7NB 3NH7L 4MSWA 3HNVH 4E41B 2CRIA 4UOZA 2PYEE 1G1YA 3WE6A 4UIMB 1UYWL 4GRWE 3P9MA 2XZCH 2UZYB 4YHEA 3MRRB 5GS3A 2QPUA 3DV4B 5E4EC 1DVFC 2XTJE 2MCPL 4QDMA 2EDXA 3W6LA 3T65A 4AG4L 5D1QD 1RZ7L 5HI5D 2PO6A 1N4XH 4LYPA 1CCZA 3V0WL 4PUDA 3CCHB 4HZ8A 1GAFH 1QHPA 2OJEB 1ULVA 7FABL 3F62A 2XA3A 4ODTL 2GJ6D 3VGAC 3VXQB 1HKLH 2C3WA 1EV2E 3BT2H 2VISA 2X4SA 4EXPX 4MA1B 3IGUA 3PABB 5E7FA 3V8OA 3QDAA 2ATKA 3JV5A 4GKNA 3TTOA 1DBML 3KR3H 4W7WA 3ES6A 4MQXD 3ZE2E 1LO4H 2DQDL 1DFBH 1Q8MA 4HPYH 4AZCB 4BK5A 2GJXA 4QHMB 2XY1A 3RIAF 4AZ8A 1U9KA 3OAUH 4HKJB 5CSGA 5HDLA 4DK6A 4XZBA 3RQ3A 1DP0A 2A73A 1OD7A 1PSKH 43CAB 4HUVA 1E0VA 2D7NA 5E08L 4MXQD 1KGWA 3RNQB 5HPCA 1LWRA 1R3HB 5ESQA 4ELMA 1JPSL 1JNJA 4MAZA 1L7IL 3A6BH 4UTAL 3FY1A 4DWSD 5FCUH 4FQJL 4HGKC 2XQBH 2OR8A 3T2PA 1K9TA 2OJZL 1UWQA 4CVWA 5I76B 3C60C 4ODSL 4LVNB 3WFBH 3MRCA 4YHYC 5C07D 3TZVA 2XWBA 2FEDD 3VRIB 3NZHL 4XMPH 4N8VG 3H54A 1MUJA 5GISL 3AIBA 1Y0LA 4KTDH 3VIHA 2Y8KA 2W67A 1GL4B 1PW3A 4WCYL 1FFNB 3OZPA 3ESUF 4M62L 4PJ5E 3QEUB 3E8UH 1TTUA 1G6RB 4JFYA 2VLJB 1ZJAA 1WFOA 5JOFA 1IARB 4G8EB 5JNYA 2FGWL 3JV6A 1CIDA 2CDFA 1MF2L 4KJPD 2OYKA 5FECB 2DTSA 1UJ3C 4C55A 1PKQA 3WJLA 3BAJA 2YBUA 4PGEA 2LQRA 2ZSWB 3KHQA 2FECL 5L6YL 3H3BC 3DWTA 3OXRB 4G9DA 3T2NL 1SMDA 1A3HA 2A9ML 3WNMA 3RJQB 2PTUA 1EUTA 3MNZA 4NQCA 5GSRB 3Q6GL 1ZHLB 4MA8H 4Z7OE 3O2WL 3OGSA 3MRPB 4YFDB 4NQUA 2IPKB 3I6KB 2Y23A 4PB9L 3SDYH 1JPFB 2HVKA 3MNWA 2F15A 2IBBA 2YC1A 3BH9B 2AJVL 4PJIA 4E5XA 5L2JA 2JIXB 4I3GA 1HN1A 4WHDA 3LQZA 5F3BB 4GQQA 4GAYB 5EUKB 5DJYA 4LFHD 3AZRA 3OB8A 4JFEB 4JZJA 2BNQD 4CVZB 2VXTL 4QHLA 1TTGA 4WHCA 3O45B 1HQRA 4R4FH 2FATH 1TCMA 2PF0A 3OF6D 4D0DB 3VGBA 4D0BB 3VD9A 1W9DM 3GSVA 5EU6D 3VX1A 1WDRA 2DN7A 3LX9A 5DC0A 1NCWL 2W0FA 5F1IB 5EO1B 5ICXB 2Z4QA 3UYRL 1RI8A 1OQXA 3MRKA 4NKOB 5BS0B 1WCQA 4JFDE 1JHKL 5JDSA 1NBZA 2Y9RT 1NCDH 1AJ7H 4JM2F 3O4LA 3EJTA 5CIPA 4GAJH 1IKNC 3WLWC 3VCLB 4HEME 3QUYD 2K7PA 3EO9H 5FUOL 4P5TB 2RJMA 4CW1A 4EZMA 4O2EB 4WUKL 5D96C 1QFWH 2XN9A 4PRBB 2P42B 3CV5A 3E2HC 3L3DA 5HYSA 5E7BA 3EOAB 3AAZB 3VXUB 2EXYC 2IJ0C 1NGPH 2OSLB 1TJGL 3TJHC 3G6JF 5D7IB 5E94B 2Q7YA 2FR4A 5LXGL 5TQ0L 4TULL 5F1KC 4D6HA 3BUYA 4OIIL 1I8KB 1RFDH 3LKSA 1X4YA 3WFEH 4Y4KC 3ULSB 2OW6A 1XH1A 4JVUA 3W5NA 1U6AH 1BECA 1D3CA 3RNKB 2LVEA 1MJJA 2R0ZL 2ZX9A 3R1GH 1RU9H 1FG2B 3OXSA 3EJYD 4MNGB 3U30B 4UT9L 4OD1L 5HGGS 4M6NH 4WU5B 4NJAL 4XNXL 3WS6C 1MSPA 3G5ZA 1Z9LA 4NNXA 5DJYB 3BKMH 4OZHB 2FH6A 3HC0B 2BVOA 4MJ2A 3G6MA 4MNHB 4PUBL 3VXSD 2GSGA 1EPFA 1RVFH 4PJ5A 3P11H 1Z5LB 2RGSA 2FLRT 3DV4A 1U8IB 4X7DC 1K9FA 4TVSa 3JVGA 1LILA 4O9HH 5GGVL 3HLAA 4JZ5A 4G7VL 4JHWH 1ZLWK 1NCTA 2MNUA 4LEXH 4J8RA 2F54A 4M93C 1NGQH 2AW2A 1YJDC 4FRWA 1YN7A 1OP9A 3VXQA 3VXTA 4Y5XC 3EYSH 3RKPA 1S9XB 5FUCE 5DK2A 2R1WB 1MRCH 3ULUE 1MH5A 3AS1A 3BGFC 5BV7B 1T22B 1P2CB 3BI9X 1HZHH 5I74B 5CJBA 3TBWB 4DM1A 3TVMD 4JO3H 5E1AB 1QVBA 2ALWA 4X0VA 4PJGF 4X8XA 5D2LA 1JNLH 1WAAA 3QGVA 1NANH 4FNQA 4JKMA 3VOCA 1KELL 1CFQA 3LIZL 2PXYA 43C9A 5I1KL 5C3LD 4PSPA 1WBYB 3GSOA 1P53A 4M7ZC 4ODXA 4XH2B 1SYTA 2QPSA 1R34A 4ZXBA 2ERJC 4NP4L 5DA4A 4U3AA 2VIRA 3MRGB 1VADA 4WHTB 1NUFA 35C8H 1EHXA 3BP5B 1VF8A 1YEIL 1A7OH 1AKJB 4TOYH 4JG0L 1V7NH 4DKDC 1MXDA 3QIBD 1RK0B 3K3QA 4K23L 3BH4A 1H41A 4ZDHA 1OSEA 4Y19B 4MHHG 4AIXA 3ZHDA 2V5DA 3U7WH 2UWEF 3IDGA 3BAEH 4HXAL 1ZBWA 3LKNA 3PDOA 1CE1L 1PD6A 5E2JA 3WKZA 1I1WA 3PTMA 3DX8A 4HKZB 3CZJA 4CADA 5ADOL 3BLPX 4RZCB 2D03H 4GW1A 4P2OB 4BZ2L 3ZKSD 3PXHA 4HEPG 1C08A 2O5ZH 1T4KB 3BXNB 3O6KH 4AMCA 6TAAA 3REWB 2Z31A 5IOPA 1K4DB 2IBZX 4L8DB 4PG9A 3VXOA 3I75B 4Z7NE 5E8PA 1OGTA 1RVFL 5J56B 1PX8A 1XF3A 2CUHA 4ACYA 4YNYB 1D6VL 2OTUB 4EXKA 3JXAA 1K8IB 3KLDA 1L6XA 3CLWA 1T03H 4ZOCA 4XPBH 4P7NA 2W07A 3VG0H 3BKML 1HP4A 5EUOF 4M6MH 2C4XA 2BZDA 3LPPA 4PJ8A 2DF3A 3SGKC 5BYWA 3MYJA 1E6OL 4QCIB 1KQYA 1JGVL 1HXYB 1CICD 1ZXQA 2DSUA 2C4FU 3VINA 1DQJA 1ODAA 3V6BR 3A23A 1YEKH 3VD5A 3H3KA 5AC4A 4O2EA 1UADC 3R4DA 1E6JH 2D7QA 1GOOA 1UH2A 4HWEL 4F7PA 2YD6A 4ELMF 3IJ9A 4PMRA 4GG8B 2D7PA 4YHML 5IVXA 1UWEL 3ZT6A 4GAYA 4MNLA 1P4LB 3D48R 2IUZA 4W6XB 5GJSH 5LBSL 3K80A 2JB5L 2HT2C 5JXEC 1QFWL 2F74A 2YD5A 2BNRB 4WUKH 1ZT7A 4D0BA 4MA1C 2J7HA 2UWFA 1G0XA 4NSKA 3AS2A 3DX8B 1IC4L 3RWFB 1NJ9A 2ZUXA 4PJ7F 3CFKA 3FB8B 3QR3A 1JNNH 2Z4QB 1AO7B 4YUEL 1AJ7L 1ONQA 4KVNH 3ULUH 5JDSB 3QXVA 1OP3K 4NFDA 1BWWA 3LKRB 3S34H 4W88A 3G6JB 5D7IF 4AIZA 1K3IA 3DXAE 3SE3C 2HKFH 3W53A 3AZTA 5ALBL 2J6EA 1KFWA 3NUKA 2WBJB 4N1EA 2CD0A 4IOFC 3F5LA 4U1MA 3BP7B 5C9JA 3TJEL 4XCNB 5I73C 1A1OB 1KJ2B 1BQCA 1CK0L 1T20B 4WIQA 2AAVA 2DI7A 2WUBH 4G6AC 1UZ6F 1T5WB 1OM0A 3BSZL 3KPMB 2XUCA 3B3IB 1J1XH 2Z8SA 1HJUA 4AY1A 6A3HA 3O6FA 1A6UL 4NQDB 1EJOL 2GY5A 2ZPKL 4PTXA 1JYWA 1KENL 3ET9F 3S36X 3L3OB 1TFVA 1YMME 1P4IH 4XP5L 3C8HA 1UYQA 5C0AB 4MMZC 4IHOA 1JYVA 1KYOJ 3EOTL 3F7PC 3PHOB 3WJJC 3DMMD 1HJXA 1CGSH 3BEWB 3RAJH 3S35L 3GB7B 2C3XA 1ERNA 1ZBKA 2XRAL 1MH5B 3OKYA 2ATPB 1TQBB 3ORJA 5GRJH 3SGEI 3FOLB 3CFEB 1B3ZA 3MQIA 4KK9C 3KG5A 5HHOB 3VX0A 1NGXA 3TYGL 2YFNA 4OLYH 3ZLQC 4TVPD 5FM8A 1S7QA 1A4KB 2FGWH 4JZOA 2VX6A 3W27A 1MJ7L 1J8HB 1CT8B 3FCTB 1WBYA 5H37H 3VWJD 3IFLH 5SX5K 2JFEX 4X6FB 5IESL 2VITA 4MD4A 1NGWA 1YEFH 3HZYB 4CNIA 4EI6B 3B5HA 1RQ5A 3U4EB 4WTXA 5BRPA 5IHSA 3EMZA 1OARH 2R2CA 2B4CH 5E9DE 5ESAA 4PJGB 3K4AA 4BSWA 4FLSA 1JWSB 3GM0A 5FGCE 2VLME 2Y07L 3BH9A 1RURH 4E5XB 2YIHA 4ZEPA 4GRLA 4NDMA 4K9EL 5HJ3B 2F2HA 3EMQA 1I9JH 1JVKA 5ABFA 3WJLC 4GKLA 1T5XB 4L3CA 3V6OC 1F3DH 5ECJE 5EOTB 3QUXC 1NC2D 3EZJB 5CLTA 1I7RA 1B0RA 5FYLL 2PYFB 3LPFA 3SKOB 4PJ9C 3A4XA 4HUKB 4V27A 1CLXA 3DECA 3SDAD 3UTTD 3MRNA 2X6MA 4LSVH 4E42A 4TSAL 5JW5A 4EI5C 4NKQB 5IOPB 1JZ5A 2NY7H 3MOQA 1EAPA 3LN9A 1IGIH 4I4WA 2EE2A 3O6MH 1ZSDB 4MA3B 4U5KA 5ISZD 2ZG1A 1HSBB 2OTUA 2VKWA 3NVQA 3MR9B 4P7QA 2VDML 4KAQL 4H1LG 3A6CL 3S7GA 4EN3D 5M95B 1LNUA 2A74B 5C71A 4M1CD 2HJFB 2PR4L 3U0PA 4OFVA 4RDQG 1JUFB 2J7CA 1OTSD 4LQ1A 4XX6A 4FFWD 3VD4A 3FO2B 4X99A 4Y4KB 4QXGL 5E4IA 3MROA 5FYLH 3GMNB 1W0YT 5I1GL 4MJIE 1KIPB 1I9IH 5EPMB 3GNMH 4PYHA 1IAOB 4ODUB 5C0CD 4HS3B 4FZ8L 5I5RA 3VFRB 2VX7A 2P8LB 3O3DB 1KIQA 2VX4A 1QFWI 2UUDK 3NGBC 3UTQA 2VLKB 4Q2ZA 3BRGC 5CEYA 2CH8A 5ETUB 5D7JD 4P5MB 4GRLB 2XPGB 3HFMH 5J57B 2GK0A 1OGTB 1QG3A 3FO0H 1YMMA 4NZUL 3SCSA 4PRPE 2XYLA 2ENSA 3FO1A 4HIIA 4NZRL 4U6XB 4Z5RB 2W5FA 3BAIA 1X6LA 3HZKB 3WD4A 1YEFL 4HUUA 2G75B 4HJGB 1ZTXL 5F7NC 4OUUA 4OFKA 4F9PC 1SEBA 3S4SG 4XCYA 1QBLL 1MFUA 1DTUA 4JE4B 2R2EA 3SY0A 3FOMA 4JKPH 4KJQC 4DK3A 4U1JA 1NFDA 3L3KB 1BOYA 1REIA 4J3UA 1CN4A 4U1NB 1UWSA 1E27B 5KSBA 1ADQH 1OAXL 3W9EB 4J7RA 3N1FC 4D8PB 1PX3A 1XCQA 5J06A 4WV1C 1XF2B 3UESA 2VLKD 4XP9L 1LEIB 3O9WC 3G6JE 4CMMA 5HVHB 4NQDA 1P4IL 1MY5A 4XP5H 5D7KD 2EC9U 5CSZA 1KENH 3RCNA 3MO4A 1YQVH 5A2AA 3QRGH 5HYFA 3KL5A 1I1XA 1M6OB 3BESR 2DJ4A 2QHRL 5LYRA 1K5NA 4JPIB 3OXSB 3O3BB 3QUXB 3WL0A 1KIQB 2XACC 3UTQB 4E4PA 2V5CA 6FABL 2BVPA 1KC5H 4BH7B 3F4VA 2P8MA 2IAND 1FN4B 1W9PA 2MFNA 2X2IA 1UD8A 2BVOB 3IU4H 2DEPA 1Y18B 2OTWA 3C09B 4N68A 3U79A 2JKXA 3TT3L 5I66B 2OMBA 4PJ5D 1DDHB 5HHMB 5KVEL 4K3DH 4U6HB 4UDTA 4MNQA 2IGTA 4D6EA 1UJ3A 1E6SM 5L7XH 4OI8A 2HMID 4PYGA 4KQ3H 5IBUG 4GPNA 4JQXC 3BISA 3BH8A 3WS3B 3EFDL 3W26A 2A6KA 3GSWA 5DDHB 2V5SA 3OV6A 3B83A 2A1WL 2F54B 1HIML 1MY7A 3LRLA 2P46B 4JY6A 4YK4C 1YEEL 3IF1B 3L2LA 1BGXH 4P2OA 5C0BA 1D5XA 5E8EB 4RGNB 3GKWH 4E41A 4GQ9H 5I1IH 3TF7C 1KXVC 3HG5A 2YPLA 2XKNB 5F9JA 2IG2L 1ZLSH 1RUAH 4DUWA 2DT0A 3MJ7A 1QVOB 3PZQA 1MCCA 5IB2A 3PTKA 4QF1A 5D6DA 2J8FA 4X9HA 4OLVH 1VGEL 3IAGC 3LRSB 2X09A 4NT6B 1CEOA 1WB0A 3QHMA 2G60H 3SDDC 1HL9A 3TIEA 1G7JB 3S3SA 4A6YH 1CL7I 5EBMA 1F4WL 1KOAA 4JPIA 5AZEL 1C12B 3B5GA 2AAAA 1T21B 4JCLA 3LSOB 4MA3A 3RDTC 3PV6A 5E2WH 1OIFA 3ZTNH 2AMGA 1U3ZA 2F53D 5I73B 4QGYA 5F9OH 4QT5A 5AUMB 3QCUH 1DBBH 4FNRA 2KL6A 2QV2A 5EIVA 4XAKD 3RWGA 1YZZA 4M8UA 1FVEA 2F5BL 3SDXE 1XYZA 2R15A 2F53E 5D71H 1BG9A 1A0QL 4YPGB 5EU4A 3GSVB 1X5YA 2FEDC 2J88L 4NJ9H 3GMPA 3DSFL 1MJ8H 3LKQB 3PUCA 2G9HA 3EBVA 4KZEL 3OIHA 2ZNWA 4KKCC 1VKXA 4W8AA 3T77B 1YNLL 3V6FB 1N8ZB 1DWAM 5EBWA 2WLZA 1J87A 4TUOB 3LKRA 5CEZH 1EDQA 2JTDA 2XWJA 5IQ7L 4UQCA 2DQIL 1RY7B 2J5LB 4QP0A 4F8XA 3NSNA 1JGIA 1S8DB 4O2CB 4UV7H 3U4BH 1XEDA 2P5ED 4KDWA 1QLEL 2HH0L 3ARDB 4GRWF 2EEAA 1I7ZA 4I2XB 5KSVB 3TZVB 1PLGL 4Y8AA 4UUJB 1QBMH 1T5WA 4PJ8D 5C70A 2G75A 1W72H 5HDQH 3MLXL 5CZVL 2FEEL 3P4NA 3HI1B 4GINA 1U8JA 1CICA 4N0UB 2YPVH 3A67L 2D7MA 4K2UL 5HBFA 3SCVA 3SCMA 4ACPA 1X5LA 2EIEA 1UZ4A 4U2ZA 3RNKA 5EA0H 3DPBA 3AM8C 3CNKA 2WKLA 5DA0B 4NO0B 3KPPB 1ZS8B 5C08E 3W9EA 4QRTB 3QUKB 2ZKHH 1MIEH 5BJTB 2X41A 1JGLL 2IQ9H 2X7LA 4Q2ZB 3PBGA 3LEYL 3QXUA 5KAQG 4P5KB 4KKCD 5JO5A 2GK1A 5K9KA 3OKDA 2H2PD 5IFHL 5D9OA 1C5CH 3LRGA 5HGAA 1AD0A 1QEWB 1OD0A 4Z2HA 2BHYA 3T8XA 4PJ8C 3SGKA 3VWKC 4XRCB 3ZDXF 3FB6B 3T0ED 2AJ3B 4HK3J 4UNIA 5D1XD 4J27A 2ZX5A 3C6LA 1FL5A 1XGUA 3TPKA 4MXVF 5DZNA 1KPVA 4YHKH 1R8LA 5JQ6H 1EZVX 4M7ZB 1AR1C 2VYRE 4PUBH 1FLRL 4HFWB 4K7FA 4JN1H 3IGAB 2VT0A 1QSEA 4G80A 4BM7A 5C0IA 5IFPA 2PW1A 4KQ4H 1FVCA 3K74B 2FB4L 3DGGB 4PGCB 5T3ZE 3D85B 4XNXH 3MODL 5DJ0A 1UJ3B 5E5UB 1AHWB 3MV01 4UOQA 1JNEA 5I8CB 3QCVL 4HW6A 5I74C 1CDJA 4KK8C 4Q0XH 1NFDF 1YEGH 5JHDD 1HNYA 3TJHD 1ES0B 3V0VB 5E2VH 3GSRB 3VWJC 3LXAA 2XHYA 3LH2L 1UEYA 4F9LA 2B20A 5DMKA 5MI0C 5EO0B 1HXMB 5D2NE 2ZXQA 4HPGA 1IQWL 1MI5A 3OKOB 3UYPA 1HCFX 3MV8B 4O4YH 1G7QB 1FLTX 3H9ZA 4YX2H 1FGVH 1E72M 5C09D 2WNGA 2JF7A 1KPUA 2HG5A 4U31A 4MJ6B 4HA4A 1W9BM 1N5AA 4J3VA 4AY0A 3ZKND 3F12A 1CGTA 2V17H 3WYRA 3GRWH 3MACH 4HHAB 1KTCA 4ZE4A 2IADB 1B6DA 5K9KB 4Z2GA 1A7QL 3DXAA 3RPMA 2WSKA 1KT2B 2ZSVB 3AMDA 1JPTH 3T8XB 1AGBA 2BOBB 3C8KB 4JRYD 5C0AE 1G0DA 3BPNB 3WDRA 4CGTA 3DI3B 5DQ9B 4S1RH 2BVDA 1MQRA 1XD0A 1INQA 3NA9L 4Y16C 5T3XE 1BM3L 1QX1A 2EJ1A 3W37A 2ESVD 4WSJA 4OCWL 4AEIL 3DX6B 3FT3B 1X5FA 2VXTH 4JFFA 5FYJD 4NIKB 4Z7VE 4L5FL 2OYLA 1DCLA 1DN0A 3MJ9H 4KJPC 5EFIB 4NKMA 2GTZB 4F8TA 4JAWA 1UQSA 5SWSB 1JMXA 4ZPTA 1T7ZA 1S7VA 2X4UA 3KAAA 3EO0A 3GM8A 2UY7A 4XPGH 3SDYL 3M1BB 5TQ2H 4LF3A 4TXEA 4S1RL 3AYRA 3N18A 2BS9A 1S5IH 3LOWA 3O6LH 4GXVL 1KJ3H 4FG6D 2AK1H 4K71C 3UTSD 3P4OB 4NRYB 5DK3A 4YHLL 1ISXA 1N8ZA 2HTLD 3NFSL 3EOYG 3QUML 4JFED 4FMFA 1B4JL 1F4YH 2BOCA 1RPQA 3VXTB 2VZVA 3RHWK 2J79A 3SJVA 2C3VB 1HHGB 4CCCA 2IMMA 5CUSH 5JOFB 1F3RB 1MF2H 2D3VA 2O61B 2VRJA 4P8VA 1JGDA 2DM3A 2GJ6E 1OPGH 3BHBB 2AQ2A 4I2XA 4HIHA 2MJWA 5CILL 4P4KD 1T1WA 3SUSA 1LNUB 5FV1L 4LVEA 5D9MA 3IJYA 2AP2A 3E8UL 2YZ8A 4Z7UB 2DQGL 4P59L 8CGTA 4X9BA 2J12B 4D2NA 3DIFB 4UOW1 3V5KB 1LO5A 4TRPH 1BX2B 4APQB 3OMZA 4OZOA 3CZNA 1SZNA 2HKHH 3QHTC 3SJVE 4PSRA 2NXYC 3NTCL 2VVNA 5B38B 1XGYH 4P2RE 3VGDA 3DRTB 5CEYB 3D4ZA 4R4BA 1I1YB 4FZEL 3A3HA 3UROR 5M7QA 5GGRB 1ZHKB 2EDYA 4GRMB 3KYKH 4N9GB 3TWCH 1MLBA 4PS4L 4RMWA 4PJ7B 1YMMD 2N7AA 4PP2A 1L6ZA 3AGVA 4PRDB 1CFBA 5I9QC 5I1DA 3AS3A 1UT9A 4FFWC 4P5TD 5I6SA 5JQ6L 2QQKL 4PJAE 2H26B 4M6AA 4ETYA 3BUBA 5I2IA 2X4TB 1AH1A 1J1OH 3QA3A 3HB3C 2I5YL 2HVJB 4GG6B 1DL7H 1CLZL 4LAJH 4JKLA 3GSWB 5DDHA 3U57A 3DX7A 3TFKD 4AT6A 2GJZA 1ZT4A 3PWNB 3VIGA 4WVRA 3WSQH 3ULUF 1AGEA 4EEEA 5BS0A 3KXFE 1DVFD 3KPOB 3FO9A 5JZ7D 1MREH 4X5WB 2Q87A 3G9VA 2IPTH 4Y8DC 4FLOA 4IRSD 3VCLA 3PL6C 3PN8A 3G6LA 2X4QB 5DT5A 1WQVT 2XN9B 3EGSB 3QDJE 4PRBA 1N0XH 4PJXA 3QUKA 2G8ZA 3KR3L 1XF2A 1RPKA 4NQEB 3D3VD 2HWZL 4PJ9D 5D6CA 1KNOB 1GGYA 5E9DD 2RGMA 2DTML 3BT2L 3WUWG 5HD8C 1BSIA 5ABGA 4HQQH 5JZ7C 5MERA 2OYPA 2ZCLH 5I71C 1K9EA 3MLRL 5GGQH 4Z77B 3CHDA 4UFLA 4KHXL 4XCFL 1RZFL 2CLZA 1MFEL 3VFMB 5BRZB 1OY3B 4AQ1B 2X89D 3MU7A 1OAKH 1K5NB 2LU7A 3KS0H 3MLWL 2ZOXA 1TA3A 5DEGA 5JR1H 5C0CE 3U4BL 3ZE1E 2H2SC 2FX8H 1JI1A 4D1JA 1N26A 2MOVA 4YEEA 5J1SC 2YBRB 3FT2B 2CBIA 2ZUWA 4RAHA 4D71A 2B1HL 2DLFL 2VKXA 2XNAA 1TVHB 3O11B 4PTTB 3GXPA 3VWJB 1GOWA 1XGPB 5DMJB 2NT1A 1PZUB 4TTDD 1K2DA 5JOPE 3PHAA 2WC3A 2NY3B 1CDHA 1I1AB 1OTUC 4JFXA 1KN2L 3QH3A 2R4SH 2WPGA 5A3IC 1W3JA 2NXYD 1NAKL 1RAMA 2G9HB 4DOHB 3MXWH 4KJWC 2VURA 2F5BH 4U1HA 3WLBB 1ZGLB 3QHFH 4XMKH 1MCPH 2FEEI 5F21B 5DZLA 4E41D 5CJOH 1JD7A 3DHMA 3WIIL 4H1LH 4HD9A 2FO1A 3MO1A 5J9PA 4OOZA 1KPUB 1UWGH 1IM3B 3IDIB 3HA0A 1GCFA 1BYAA 3ZTNL 2G3IA 4HFUH 3EFFB 4LKCA 4XAWL 1C1EH 2L0DA 3G08B 3LCYA 3MR9A 5HHXH 4XZUB 5F7UA 2AJXL 5JHDB 4Y4HB 5SX4H 1E4XL 5TF1L 3MV9A 1K4CA 4A6YL 4WI3A 1NCAH 2OP4L 2GITA 1JFHA 4TYUA 3CVHL 3KDMB 1P5VA 4LLAA 1RJZA 1AGBB 3O2DL 1HKMA 1E4MM 5BXRA 2EXOA 3QO1B 1A7BA 3GEWB 4B41A 3TV8A 1CZ1A 4F33B 1T0MA 4HH9B 4AEHL 4L9DA 5LAXB 1G94A 3VUPA 1RUAL 1AD9B 4M7LL 1R0AH 2VTFA 2ZUMA 4K7PL 2A6DA 4PR5A 5A8QA 5FO9A 1U8MA 3BVWA 1JZ8A 5FDYA 2ICES 2YUWA 5HHVL 2H45A 4GUPA 5EO9A 4F37F 4ACZB 2G3NA 3BUTA 4RGND 1BZ9A 4K94H 1MFBH 1J8KA 4NX0A 3GJFA 1WTGT 1VRXA 3LS4H 3N1MC 3MS8A 1DBJH 3O8XD 1SYVB 1NFDE 3SEPA 5DD0H 5EBLA 1HXKA 1E73M 4QTIH 4Y4HD 4EI6A 5GS1A 5CJ5A 1IGML 4K7PH 5E2UL 1KB3A 3RX7A 3PWUB 1DANT 4DN4H 3LQMA 3UDWC 1V6XA 1XHGA 2VLRD 4NC1C 4U1IA 4RGNC 4OBSA 3ZHKA 3NPZB 1MNUH 4I1NB 2A6IB 2B8OT 3U83A 4YNYA 3TC9A 4Y5YB 2NNAB 3I75A 4X4XB 3RWEB 1H2JA 3ZIZA 3KLKA 4BFEA 3RL1A 3GSNA 1T1WB 5HYSG 3GH5A 4LVOB 5HI4C 3SKUD 3QRGL 3PNWA 1EDTA 2YMXH 4CL7A 5I1AB 2QQLH 3PQYD 4BYHA 5IMKA 4OBRA 1MW1A 3GSUA 4WTWA 3DURB 5EU6E 3DIFA 1JHLH 4JM2C 1I75A 1X5GA 4OLXL 4LBEA 2BNJA 4LCCA 3T2QA 4WUUA 5JW5B 4HCRA 5DJDA 1FNSL 4ZFZB 5DUPL 4W5UA 5CINH 3O3BA 5DFVD 3RPIA 5A2CA 1S7WB 4FNUA 4XNYH 1OAXH 1C7TA 4F7EB 2JK5A 1GNXA 3F58H 3WHE1 1YPZF 5FUCC 1V3MA 4GRMA 2DDQH 3O9WD 3WUFA 2IFFH 2CYGA 1ZANH 1XYFA 2MQ3A 5C6TL 3MV8D 5EORL 1NQ6A 4EAMA 5E5MB 2G2RB 4GO9A 1S9VA 1IE5A 1HWHB 2EDJA 4Z7WE 1PQZA 1H0DA 2R4RL 1MXGA 1YNTB 1QZ1A 1FIGL 2J1KA 3OKMB 2CUIA 2YPKA 1CQYA 3CX5K 2ZXBA 5IR1A 2VCBA 4FABH 2IH1A 4HLJA 4WI6A 4H8VA 1UC6A 3CFKB 5HD8D 4QLJA 4TTDC 4UIKL 1YPZE 4Y5VB 3TBSB 3D5OF 1WBXB 2EDBA 1NL0L 4N0YH 1GQKA 2NY5H 4PLKC 4XT1C 3RL2A 5IHZA 2NZ9C 3DDGA 4QRPE 5EFIA 4OM0H 4FA8A 1MFEH 1WGOA 3FFCE 1E4KC 1BD2E 2BNQA 4MPKA 4EBQH 2AV7B 4FZ8H 3VGHA 2V9QA 3O2VH 1S7VB 1KJ2A 4RAUB 4WTZA 3VGGA 3VIIA 3K8MA 1KF9B 1ZVSA 3VFPB 3WEXB 5I1EL 5JUEH 1S3KL 3KPMA 3RKDD 3GK8L 4G42B 3AS0A 2F19H 1CVRA 4LFHG 1I9RH 3LQAH 4U1HB 3N1AA 1PS3A 3KJ6H 2Q8AH 5IG7A 1D6EA 2E7MA 3PWLA 4MZ2A 3EW3B 3SE9L 2BJMH 3GIZL 4HTYA 4LSSL 4KKLD 3HG1B 2PKDA 4B0MM