1DTUA

Bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINDSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASPDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dtuA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1dtuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1dtuA01
2WSPA 4CN1A 5KS9E 1CLYH 1ORQB 3SDDA 1CGSH 1C12B 4M6NH 4Z76A 1HH9B 4B41A 5A3ID 1N0XH 1S9WB 1I3VA 1W2VA 3S37X 3MRRB 1FJ1B 3FT4A 2R2EA 4UB0H 4X7FC 4WHDA 4OQ1A 1T83C 4DWSB 2OR7A 3CK0L 3AY4C 5SWZB 3IB4A 4H8WC 3UTTE 3MOAL 1MAMH 4FQCL 5E95B 4QHMB 1OT1A 2OSLA 4RGOL 1M05A 1XF5A 1Q72H 5EORH 1A6ZA 4U6TA 3EJYC 3UBXA 4NO3A 3WF0A 1BJMA 5GGVL 1CLXA 4ZUUB 4NQTA 3QEHA 4HCRL 1PKOA 4UINL 1R33A 1HJUA 3PWPB 3BP4B 2FJGA 2DI7A 2FO1A 4LRIA 3SDAA 4M7ZC 4HUWB 1GRWA 4MNHA 1QNZL 1CDYA 1UG9A 4HIIA 1QRNA 1A6TA 4XAKD 4O58L 1UG6A 1CXEA 2BHUA 1P2CA 3CFJB 2NW3B 1JWUB 2VT0A 1FNAA 1YA5A 5C0CA 1OIMA 4WI4A 2COQA 4X6CE 2I9LA 1GOOA 2Y1VA 3HMCA 3OKOB 2VL5B 4MSWA 4Y88A 4LAJH 1YMMB 3PHSA 5IMKA 3F12A 3JWOH 3UZVB 2FSEB 3Q1SL 4QHKI 5I16A 5CP3H 1IKFH 3EO1B 1LK3L 3MROB 2HWZH 1Y0LA 3OPZL 4HC1H 4L4VA 1OAKL 4F7PA 1YEJH 3VVGA 3X3GL 1GOGA 4V1DE 4WHYG 4M7LL 3AFBA 1A64A 2BJMH 3D87B 2ICES 2XOTA 4HQQH 4JFYB 3IK2A 4XPBH 1S9XA 1CFQB 2VXUL 2P42B 5DJZB 4JDTL 5FYKE 5D7IA 4Q6IA 4FNLL 4P9HC 3STZA 1ONQA 1FH5L 2PW1B 4N0YH 1QR1A 5E2JA 1V3HA 4XNYH 2DEPA 2IFFH 2JALA 2OJEA 3DUHA 4NQCB 5E5UB 4PMXA 3GMQA 1C1EL 5E7FA 4XCCH 1IAIM 3MXWH 3QDGE 4TUJA 1CK0H 3MANA 3GMMA 3GM8A 4QLLA 2YD9A 2VC2H 3WQ6A 1LO4L 3OF6A 4POZC 5DT5A 2BY3A 3AUVA 2UUDH 1SEQH 2XN9B 2FATL 4PMZA 4K3JL 3NCOA 1MYRA 3DX9A 2BY1A 4P4KD 2D4FA 4JY6B 5J0BA 1YMME 4HPOL 5JHDD 3RIFF 5EPMA 1E6QM 3BXNB 5EIQA 1TZGL 2ICWB 1C8XA 1FVCB 5DYOA 1WFTA 5DZNA 4J3OC 2VABB 1T3FA 4OBRA 1EXUB 3CVHB 2LTQC 3FAXA 4CJ0A 4XBEL 3QWOA 1T4KB 3CFEB 1EFXD 4LHUD 2F53D 4Q74A 4LQ1A 2CKNA 2HKHL 1N26A 3RCNA 2NY2D 2B0SH 2MANA 1K4CA 4MDPA 3OKYA 4XP6L 3FTGA 3BUIA 2J8OA 1FIEA 5I8CB 2GTZB 4Q7DA 3BDYL 2EPMX 4GMSH 4QXWA 1QEWB 1TJHH 5C0BE 1UH2A 5FYKL 5F7MC 3T1FA 4C83B 5SWSB 1FH9A 5CHNA 3HHRB 1NWTA 4GXVH 2ZCLL 1QBAA 4A6YL 2XWDA 1WDRA 3RHWK 3TYFA 2EPNA 1UC6A 3QCTH 2OZ4A 3WXVH 1JNDA 4HWZB 4Z7UA 4I0KA 4ENED 2J8UA 3LQMA 1JNEA 2WC4A 1NMAL 3FO1A 5DJ8B 5D7IF 4K94H 1XF1A 1JCKA 1S3KL 1ZVHA 3CXDL 3IDJA 4N5EC 1H0IA 1NC4A 3GSUB 3NFPA 4IM8A 3QI9B 1FRGH 1NFDE 2XN9D 2V17L 3B8SA 1R85A 3JTSA 3MV01 1MWOA 4WDIB 5IHUH 3DIFB 1JXJA 1MW1A 1WEJL 1U8NB 2FH6A 5D5ME 3MO4A 4M1DH 4PJCB 4X80L 1BD2D 3N1GC 3C6LA 4HUKB 4KKLD 1S7RB 5DHVA 4QTHA 4Z7VE 1ZTXH 2R0WL 3ARYA 3GMOA 5C07B 5DT7A 2BVEA 2EDNA 3GHEH 4HULB 5F7NC 4A3YA 1J8HB 1ZVYA 3FW6A 1NAMH 1QW8A 3MLUH 3Q48A 1NAKH 1UWGL 1MVUA 2YDQA 2VDPL 3GBNL 4YDLB 3RNQA 3LV3A 3V79C 5A40E 5ICXB 4LSRH 2P8MB 1KIQB 2WZHA 4M5ZL 4DVBB 1KXQE 1EEUA 3FQUA 3G5VA 5D70L 3T3PF 1INDL 3KVQA 3O2WH 4NWTH 3U7AA 1LL7A 5J4MA 5CJQL 2EIEA 1KG0A 1X5YA 1OTTC 4PG2A 2GK1B 1QVOA 4LKCB 5DDHB 4P4RA 3FNDA 4PJXA 3ZSSA 4I18B 2C8NA 2ZUVA 3CLFH 3GJEB 1AXSA 1NCTA 1PFCA 1ZLWH 4MDIB 2JE8A 2E9WA 3TBSB 4MS8D 1FPTH 3BD5A 5D2NA 1HH6B 1F4YH 4HMCA 5JW3H 1Q72L 5EORL 5INDA 4WFEE 2Q6WA 4NUJB 5ID1B 3BVVA 1S7XA 3D39D 3HC3L 5H37G 4MTVA 4ORGA 1IGFL 3GSNL 4G8EA 1QSEE 4HWEH 5GS3A 2J7EA 3NCYS 4F57L 1P5UA 5I18H 3CHEA 4Z7QF 5HHME 4PTUB 1FVDB 3MV8E 1HP4A 3UJIL 2D24A 3K8KA 1T1WB 4JM2A 5JIIA 2KQMA 4UT7L 1JGUH 2VVNA 2DT0A 3TBWB 2D4DA 4YXLL 3NFNB 4PB0L 3O9WD 2R2HA 1X4YA 2EZ0C 4FN0A 5F7FA 3LRSB 3T04D 5BWFA 1WWBX 3CZFB 1RZKC 5HY9B 1FFNA 4Y4KB 4YGAB 1DTUA 4OLVH 2XWJA 3E3QE 3GIVB 1OGAD 1JP5A 5EOQH 5H35A 5DQJA 4XXDB 3W37A 2OX5A 1OAKH 2F74A 3S36X 5AAWA 3C5ZB 1NAMB 3PZVA 3HNSH 4X4YA 2QQQA 3HAEG 2AEQH 4BFIA 1PY9A 3O3BA 4O2FB 1MWAB 1T1XA 3B9KC 1R5WA 2X0YA 2NQCA 4YO0A 1K85A 3FJTA 4N9GB 1KENL 2P5EB 3CFCH 1CLOL 3W9EB 4AZCB 2BMKB 1L0QA 1J1XH 2VDRL 4I9WE 1U8MA 2YDSA 1FNLA 1M04A 4L4VE 3RTQC 1PS3A 4TX6A 3K81A 4G80B 2PWHA 1E6PA 5IHSA 2FH8A 4PJXF 5F1NB 3V4VL 4A2MA 4HW6A 2YXMA 3AISA 2WB5A 1MFCL 1EEZB 4PYSA 2E6QA 3BVUA 2PCPA 4WGWB 3HMXH 5IQ9B 2R8SH 4AYGA 1ZA3A 3IS1X 4MCZB 2R4SH 4UI2A 2X4UA 4JPIA 5EN2A 1A6UH 5J7CC 3GFUA 1CT8A 4WO4A 3ULSB 1EHAA 1QFPA 3KHQA 5E8PA 1TZHA 1A7NH 2AJYH 1CNVA 1TQTA 2DQEL 1IT9L 3AS3A 4Q9QL 1Q0YL 1R0AL 5E9DA 1MI5A 2OI9B 4G6MH 3V6OE 5JR1H 1XCWA 1P69B 5A16A 1WP6A 1MRCH 1SYSA 1JGIA 5A8NA 1T04B 2P5WB 2IAMA 5F7DA 4KAQL 5DWUL 4ZXBD 1TG7A 3KPSA 3CUPA 2DQTL 3D3VD 3NMEA 3PTKA 3C2SA 4HIHB 3BDBA 4G7YH 4KRMB 2OTUB 2WBJB 2Z91A 3O4OB 3FHQA 3IDIB 3FL7A 4QHNA 2AJ3A 4HLZH 4XVJH 4K07A 3KWWA 7A3HA 4WUUD 3WD4A 5T1MA 3WL9A 1O7VA 5ADOH 3PHQB 3WQVA 5A2JH 4H41A 3EJZC 1QRNE 2Z1SA 1T89C 4HA3A 1NGYA 3TYGH 2BVTA 2YPLA 3TIEB 2A9ML 1CWVA 4Q0XH 5E08H 3HCVB 5DO2C 4A2LA 4F7MA 3O6FC 4BUHA 4TTGA 2BC4A 1U8LB 3UTTB 4A4AA 2VQ1A 5E6YA 4LP5A 4WI7A 3RA7L 4PG9B 3DURB 3U0PB 1P6AB 3O9NA 2UVEA 4DZBA 2Q76A 1NUFA 5C0IA 5K9KB 3DBXB 4OKVA 1TIUA 2CXGA 2WMHA 2RHEA 3L1OL 4JAWA 1X6NA 2HN7B 4AMXA 3TT1L 4XXCC 4JY5L 3WFBL 4CW1B 1PZ2A 4YX2L 1AO7A 3QUZD 3A6BH 1E6JH 3C09C 2GW5A 1FYTD 1QLEH 1V5JA 4WW2F 4L4OA 1G7MB 4HUUB 1PDKA 4ZSOB 2E9BA 4F3FA 2YKLH 4TUKH 4DAGH 3KLHC 1IAOB 2D0GA 1AGFB 3EYSL 2HVMA 1EA9C 1UA7A 1SFSA 2AJVH 4JQXA 1I1RA 4PJ5B 4FNTA 1KJ2B 2EZ0D 1MAML 3PXJA 4FQCH 4U6YB 5F88B 2YPVL 1NGXA 3VXUB 4YPJA 2EDXA 1W1PA 5I1EL 3K46A 4Y19E 3MRCB 2F54B 3VFMB 2GIYA 3DXAE 4OZIF 1DFBL 3LEXB 4GZIA 1T89A 3BVTA 5H2BB 4EN3B 2WW5A 4JFFA 4K8RL 3MGAA 5DMKB 3S3SA 2DSVA 1LNUB 4PJCE 1RMFL 2VOTA 3DC0A 5D72H 1VJSA 3ZQ9A 2R4RH 4NGHL 3RUGE 3SEPA 4NQEB 4JZ5A 2ESVE 5A2IH 1P7QA 3OKLA 3VFWB 3P4MA 1IC7L 1H3PL 1NGWA 1JGLL 2P8LA 3S3JA 2WLZA 5SX4I 4ZE5A 4HGKC 4E41D 4RX4D 3V52H 2B1AL 4KZEH 2NW0A 3ULVE 1FFQA 3WNKA 5ENWB 1FG9C 3S35H 3H54A 2HVJA 1MCFA 3ZE1E 1Q9KA 2H41A 1MLCA 2HTKD 3MRKB 4HX1B 4IS6B 4H5SA 3VDCA 3QHFH 3UPRA 1OD7A 4F66A 3N85H 5DK3A 2X4SA 3GHEL 1UACL 2XFXB 2H6PA 3IJSA 2Y9RT 4ACPA 7FABH 5BRQA 2DD8H 5D2NE 4GKSB 5ESQB 1HKIA 3D2UD 4YDIH 2FJFB 3C9NB 1E55A 2JEPA 4X7EC 1FBIL 4FNLH 1CBGA 3OGRA 2CLVB 2CO6B 5GSRA 1WZAA 1J0YA 4M82A 1W3KA 4PJDB 2FZ3A 1ERNA 3VIOA 5FF6B 3EZJB 4G8GA 4MNQE 4QGYA 4H0IA 4Z7QE 1RK0A 5E2TH 1A7QL 3I84A 4IMLA 1WTLA 4XRCB 1N5YH 4AG4L 1BVZA 5EWIH 4G6FD 5HHOD 3SGJA 4Z2JA 1DQMH 5CGMA 1LP9F 1UM5H 3WBAA 1CD0A 3PG2A 5FOJA 2QMKA 5EOCH 5E0QA 1B0GB 4V2CB 4OAWA 1EQCA 3B9EA 4NQSA 3T0EA 2NYYC 3KPMA 3SPVA 1CLOH 3BFOA 3BN9D 1A4JA 1T2XA 4U4BA 2QHRH 4KDTC 3GMNA 4FQXC 3VXSE 3ARBA 5LG1A 5FUZL 3DSFL 1TETL 2E7LC 1ROWA 2KZ1B 4U1LA 4X6CA 3BLBA 3UG4A 3O6MH 1DBBL 4G6AC 4JZJA 1I7UB 4YR6B 3RAJH 5ISZB 3IJ8A 3W5MA 2JIXD 4U0RC 4NZRL 3RWFA 4OI8A 3MRGB 4Y4FD 5I2IB 3QCVH 1N5AB 4H8VA 1OSPL 1BLIA 1NCBH 5ESVA 1CFSA 4UCFA 1DUZB 4GAYB 1M03A 4DUVA 4J3UA 1T0NB 3THML 2WIMA 4UT9H 1BFOB 5E2VL 3WLBB 4HD9A 4P2OA 1ZLSL 4OUEA 2EO1A 5DEGB 1GOWA 1A7NL 3MV9D 4PY7A 5D7JD 5DHVH 2BSSA 3FQNB 5D1XB 5E5RB 3RWJA 4C4KT 3NVQA 1F4HA 4M02A 3KLHD 2VXQL 3SKMA 3MCG1 3QYCA 3O9WA 1E28B 1FDLL 2XRAL 1G0DA 5KG9B 1C90A 2G3JA 1KLFA 4PJEF 1JV5B 2DQFB 4OGXL 2BVYA 2GSIA 1P7KB 3MRIB 5FFLA 5IIEB 1XSKA 4RISL 5LCVL 4PMVA 1ZBKA 4EDWH 4OF0A 3EOBB 4KXZH 5IWLC 4RIRA 4YE4H 3P11L 5I0ZA 2BRRL 5L2JA 4OGYH 4ZFGH 4K7FA 5DI8B 5JOFA 1RZIB 5AZEL 3BZEB 3RFZC 3DTXA 4XCFL 3WDJA 2X4RB 2P24B 3T0EC 3IDNA 2GAZA 3VJ6A 1JD7A 4X5WB 4P4KC 3BIBX 2O5ZH 5BO1H 1MJ7H 3FQRA 3V2AR 3UDWA 5I6XB 5F9AC 1QACA 4J3VA 4JZNA 2O5XL 3G9VA 3GJFH 5FAAA 4UOQA 5IESL 4DZ8B 4WRLA 5A95A 1R5VA 1LK2B 1A1OB 2PR4H 4ERSL 2JK5A 2BY2A 5GGRB 4EOWH 4EBQH 4HOWA 4G42B 4LBEA 5L2KE 5FYJE 5J13C 5KANG 1DQJB 2Y07H 1FHGA 3VFTA 1MRDL 1CECA 4QT5A 5MEND 5JUVA 1A6AB 1GHSA 2WCGA 2P1YA 3TOPA 2Y5TA 4X4MA 4WU5A 2HTLC 3SY0B 4BQ6A 4BSVA 3PHOB 3OIHA 4HP5A 4YAQB 1KJMB 5JHLH 5BRZE 1WZLA 5EU6A 2XVLA 5C09A 5HBFA 1MHHA 1JD9A 5DUBA 1MJJA 4FQHB 3ARBD 4GKZB 1YEFH 5DFTA 2E9MA 1XHGA 3MLVL 1ZT7A 5GNYA 2CGRH 2YC1B 3GXFA 1F4YL 4YHZL 2GT9B 1AO7E 2ILLA 2CESA 4EJ1C 4Z6AT 2UYLB 3OAYH 2Y2WA 4F57H 1V03A 4W84A 3AIEA 3QUYB 1RFDL 4GRWH 4NO2B 1FIGL 1MCWM 1FA2A 5D9OA 5FM5O 4DN4H 5KTEL 4XX1G 5IJKC 4FQQB 4MQ7B 1MH5B 4UNVA 4KWUA 1H4PA 3ARUA 5E6IC 1D3CA 3K4DA 1IKNA 1AD0A 3ALWA 3HMXA 1UKSA 2WWKO 3P40A 1E6RA 2VLJE 2BY0A 1IGML 3ULVL 5C0RH 5FKYA 3QUML 2XA8H 4FXLA 4OZGF 2MQ0A 1IGYB 2E8ZA 3WFEH 3CCHB 5IGXH 1FG2B 1VA9A 2PETA 3L9RB 1PEWA 1T66D 5CJXC 5CILH 4MB3A 4G8GE 4WFFE 1MFVA 4AEHL 5D7LD 4XC3H 4X6EB 4U3HA 4YDVB 4UQ3B 5T1DH 5GRZA 4LLYB 4AT6B 1XR9B 2WUBL 4O00A 3WEXA 3WUWA 1ZT4A 4ZPVA 2QPSA 3VIFA 1TVBB 1QW9A 3OZ9H 4MD0A 5BMFH 1NQBA 4TUKL 4EKXA 5F1KC 4CUCA 4WUUA 3WELA 1TVDA 3GZAA 2DKMA 4MAYB 3KPTA 3I3DA 1QBMH 2G5RA 3QO1B 3WE6A 4YEEA 2W5FA 5C0FB 4WFGD 4DGVH 3WIIH 5JPNB 3QQNA 4XB7A 4Y2DA 4I3RL 4GINA 1XGYL 1PG7L 3QSKB 3QUMB 3P9LB 4GAFB 5DQDL 1KPVA 3H3BC 3ROOA 2MHAA 4QYOA 1I9JL 5EOCJ 2YLAA 5ICZA 2X4NB 1ODUA 3OG6B 3IRZA 4GRWB 5K9OB 1U3JA 4OCRL 3T77A 4M3JA 5JQ6H 2YKKA 4OOUA 4PUDA 3EOTL 3PL6A 5D8WA 1WITA 1NEUA 2YN5A 3WIFA 5HGHA 4MPKA 3LQZA 5C9JA 1A6ZB 3IFLL 1ZMYA 3P0YL 5B39G 3NOIA 4QKXB 2D7OA 3AIVA 2AEWA 3QQ3A 4XMPH 4ZUUA 3KAAA 2DTSA 1NP2A 2DQCH 3PV7A 4CL7A 2WAHA 2FJGB 3O4LB 3LY6A 1FGVH 1FBIH 3APGA 3VXNA 3S5YA 1A7BA 3PWNA 2PC8A 5DJ0A 2NW3A 5KSUB 2J7DA 1TQUA 1KPUB 5MERB 4DUXA 5E24E 4Y2DD 3UJIH 1PW3A 1JF6A 4LEOA 1EQPA 3KJ4C 3WBEA 3CZNA 2OXHA 4F9JA 1LLOA 4PRPB 1WISA 3PWVB 2FSEA 3CXHK 2WMFA 2ATPA 5I1AA 3RA7H 5IB4B 3DX7B 3QULA 3LH2L 3TTOA 1CGUA 3KG5A 1HL8A 4R3SA 1MFDL 1YY8B 5ALBL 5DMYA 4OJYA 2WCSA 3V4UH 3DVNB 1QLFA 3VFSA 2EE3A 2R9HC 3L4WA 3GHBL 4PPTA 4M03A 3CZSA 4P5MA 3FO9B 4UTAH 1E43A 3ULUD 3FN9A 1A0QH 3VD5A 4N8VB 3PWLA 2GUOB 3L6FB 4LLVA 3HZVB 1KF9B 3MREA 2PNDA 5FYLH 3VGHA 3I75A 2L7UA 5E03A 1JVKA 1IEAB 4OLXL 5FIEA 4YPGB 5GRVK 2CRYA 5EC1B 4Z2HA 1R7AA 3V4PL 4Z5RA 1A2YA 4TUJB 5IKCA 1Z9MA 3SQOL 2F54E 2Y8KA 4Y19B 1EJ6A 2EEBA 4NNXB 4D72A 1VFAB 2GJ6A 2D3NA 2C7UA 2PN5A 1INQA 4G6JH 5EO0B 3MYJA 2IH1A 4PJBA 1OSEA 3O8XB 2J75A 4KKAC 4I3SL 5T3XD 3PZGA 1QI5A 4QY8B 2F5BL 2AABH 1HYSC 4Z77A 5BV7L 3PV6A 4XC1H 5FL1A 2G3MA 5FCUH 2OYPA 4CKVX 5HYJD 1ND0A 3FT3B 2PYED 5HJ3B 5I19L 1CCZA 5DR5H 4HFUL 5HGDB 5IFHH 1HN1A 3VFNA 4TVUA 1CFVL 1QNZH 1EUTA 3W2DL 1LEGB 5E94B 1K4CB 1CXIA 5L8LB 1T2QH 3ZR6A 3K2UH 2FIRT 4ODUA 3SDXA 5DJCA 4I0PC 5HNNA 3IJYA 4TVPD 3BO8B 3ZKSD 4JFVA 1G6RH 1LWJA 3B5GA 3UROR 3EGSA 2GJ6E 3B9VA 5B8CC 2F7RA 2I60H 4ZFOB 4E41B 4PRHB 2CD0A 3MJ9L 3H9SB 2IPTL 1GGUA 4Y4KC 4A6YH 4IRJB 4MJID 1IGMH 3ULVH 3KL0A 5DVLA 2B1HL 4XVJL 1SJHA 3LRKA 3QIBC 1VGKB 5MEPB 4CVZB 2ZPKL 4RDQG 2NTFA 4YDKH 5ICYA 4G9DB 1ODAA 1QO3A 3UTSA 4BFEA 2V9TA 4JLRA 4F7EA 2A6JB 4JEGB 2B4CL 1ZBVA 4K55A 3OF6D 2C4XA 5IR1A 4HZAA 4YIQA 4AENA 4G5ZH 2W65A 3NACH 4WI6A 3D51A 1K5NA 3BHBB 4HS6B 1T5XA 4CMMB 4OZHE 1KV3A 1IKFL 2WC7A 3O2DH 1WQVT 2VLJA 3RUGA 3SGDI 1Z5LB 5TE7H 5D1QD 4QRSB 2R2BB 3VWKC 5IFAH 4MLIA 1V7MH 3MRDB 4PJBF 4JFFE 3BZFA 4S11A 3O6KH 4NQXB 1E6OH 1XIWC 4KQ3H 2CR3A 2EE2A 2E7HA 4HPOH 5HPCA 2M1KA 1VBRA 1B2WL 3S6CA 1QBML 4JFEE 2A3HA 1PZ3A 4P23C 4L1HA 4HS3B 4L8SB 4Q9BA 1SY6A 2VAJA 3VI3E 4DGVL 3QFJB 1C1EH 5EZIL 1I3GH 2VDMH 1HXMA 1BZ9B 1MCRA 2IUZA 4QHUB 1ZSDB 3G08A 4G9FE 5EU7E 5ITFB 4ODHH 2Z4QA 4F9DA 3Q5OA 4MWFB 3QDGB 4GOSA 1Q6CA 4UT9L 5F7YC 1GZQA 2PYFA 1O7DC 2XYLA 1CLZH 4MNQA 4NM4H 3LKQB 4M7KL 2YD5A 4XNQA 1DHKA 4HH8A 4FLRA 1G0YR 2DQXA 2FGWL 4NPYB 1BVKB 2YXFA 3Q3GA 3MRJB 4HXAL 5JIHA 4LRNL 4RAVA 2YEZB 4PJEE 5ABEA 4XTRC 1QI0A 4M8UA 1MJUH 1FFPB 4P4KA 3VXRE 3IKKA 4D6EA 2GKIA 3OG4B 5ADPL 1DCLA 1LO5A 2EDOA 1OCWH 4P2QE 4G8EB 1H5BA 2LV4A 4L8DA 3ZKXC 4U6VH 3WNPA 1XSJA 5F9JB 4YE4L 1PPIA 1V7NL 1CE6B 3RPKA 2DWDA 4XP6H 1T7YA 1GQKA 3QQ4A 5DK0B 2YD7A 5HVHC 2P49B 4FXKB 4XP9L 4Y16D 1GJIA 3K4AA 3HR5B 3MS8A 1YDPA 5IBLC 1KR0A 4YXLH 5EU4A 3NFNA 1G7IB 1YYML 1BOYA 1EEYB 4WHCA 3RL1B 4GBXC 3CZFA 1Z2KA 1V8HA 4E9LA 1ZTXL 1C5DA 1XGQB 1IAIH 2H9GA 4RFEB 3RUGF 4P7OA 4WUKH 1PBYA 4OLVL 1XCTA 3GIVA 4TULL 1NLDH 2FDBP 1I1AC 1TZGH 2PB1A 3RWEB 1MLBA 3WN5A 4LHJB 1ADQL 4GBXB 3IVKA 4P46A 4N90E 3QO0A 1CGVA 2QHLA 4TNVK 4X4YB 4ODWB 1I1AA 3V6ZA 5DGRA 4C4KO 2WMIA 1JGDB 4AWEA 3IETA 3GB7A 2BNRE 1T1XB 5E7BA 1TXKA 4PJHB 3VW3H 3RWHB 4MJ6A 4X0VA 4L8BB 5KSAC 1WCQA 4J3SA 1PAMA 5DTFB 4HUXA 1U93B 2P5WE 1MRFL 1XCXA 2EICA 1GGBL 4NT6A 3RDTA 4FZ8H 1U8MB 3Q6GL 2WLYA 4HK3J 3BCFA 3O45B 1DQLL 3TH3T 5FYKH 4HSQA 5T1LD 2WIIA 2DB8A 5I6XC 3FN0H 4BQ4A 5DMGD 1GHFL 4NJ9L 1SY6H 1KEMH 1JUFB 1QBLH 3E1F1 5KZCD 4XNYL 1JAEA 4KC3B 5GGSA 3HRZA 4LSRL 3VWJD 3MACL 1KXQA 3SDCA 1TVPA 1XYZA 3E6HB 3WHXB 2WMJA 3MOQA 5ABHA 3HMWH 3T65B 3S2CA 1RU9L 3QDJD 5DVMA 1OSZB 3M7SA 3GXIA 3S5ZA 2YA1A 2NYYD 3JZ7A 1BEYL 3GMLA 5J06A 4LKXB 2DQEH 3JSSA 2VX6A 1W2KT 4N68A 4H7VA 3LPOA 1J8HE 5C0BD 1MI5B 3D69A 5E1AB 5DVKA 1TMQA 2A6KB 5HPMA 3AAZA 4HKJA 1VFBB 3SCWA 1BF8A 2P5WA 3NCJH 2FHBA 4APQD 5CSUA 1YN7B 1JHKH 2EDTA 3SCMD 2V2TB 5FUOL 1HDMA 4NFCA 4OI9A 3UTZA 4KHXL 1FL5A 1FL6B 3CSGA 5TQ2L 2BHYA 1RZ8A 4AZ8A 4IOFD 3MO1B 5CEZL 1A14L 4JRXD 5SV3A 3C08H 4HF5L 4OIBA 4OIIL 3RI5F 1AXTL 3HTLX 1IGFH 4ACZB 4R26H 3KWWB 3EYUH 2CBUA 3VRIB 3BVXA 1UQSA 4YHLL 4NKIH 2YBTA 2EADA 1YYLH 1NCWL 5HDQH 1PSKH 2W0PA 4ETQA 4KRTA 5DSCB 1XCQB 5C92A 5ABGA 2ZSVA 4PLJD 5CEYA 4LPYA 1OP3K 3WKNA 4Q0XL 5E08L 1IAMA 2GJXA 2XPGB 3OSKA 4OQTL 2YMXH 4NKDA 2O9PA 4HQQL 3B3IB 4DKEH 1I9IL 1JTOA 2VXUH 3S8WA 4GO6B 5D96C 2Y8VA 1N4XL 3LN5A 3WN5C 4W4NA 4P57A 5H94A 2CNCA 3W0KA 3NACL 5C0AB 1S7QA 1XZ0A 2QQNH 5C0IB 1G6VK 2NXYD 4PD4J 5CD3A 4JKPH 1ZHLB 2WWMD 4PCSA 2EE9A 4XPTH 2A77L 3W39B 1U58A 3HR6A 5ID0B 1A7PL 4LLMA 2AJSL 4D1JA 3HLAB 1R3LA 1VEPA 1E6OL 2BOBB 1U8PB 4XPGH 1G7QB 4RAUA 5HDLA 3PDDA 1FAKT 1D5BA 4UQCA 4ELMA 3GXNA 4I5BA 3S35X 2VCBA 4BKLB 4HUUA 4UZUA 3IKCB 5J13B 5FV2A 2YL6A 3FRPA 4KY1L 4F7CA 3R4DA 3MUGA 2AJUH 4ZD3H 1Q9LA 4KVNL 1BJ1J 3WEMA 2GCYA 4H20L 3K2UL 4HIJB 4PCTA 2RBLA 3KPSD 2CLRA 3VWJB 3G5YB 2IAMD 4B3LA 3CGTA 3KXFE 4XZUA 2VZ3A 4D6FA 4NO0A 4WJXA 5ABDE 4U5IA 5DJ6B 5I1EH 5D93B 1YPZE 2XY2A 1CD9B 2VRAA 2AEPH 1NWUA 5H2BA 3QEGL 5K9QG 3D39E 3MJ9H 1BVLA 4H25A 5LA2A 4PJGE 1MFBL 2VDLH 5C7XL 5CMAA 1ZKAA 5L0QC 3C87A 4PJ9D 1C5BH 2AI0L 2J8UF 2AK4D 4NXKA 3OKLB 1RUPL 3LKOB 1RZKL 1JWMB 3H9ZA 4YFDB 3BH8B 5DRXB 4LAQH 3RWDA 4RGNE 1T03H 1UWIA 1P53A 4HGMA 5FUCC 2Q7YB 1BYCA 2VRKA 1OGGA 2BFVL 1X5LA 2YWYA 1Q9KB 4ZSOE 2AK4B 2D0FA 4HX1A 3BAEH 3VE0A 5IHLB 4Y7EA 4CKQA 1FPTL 5T3ZH 4EI5B 1ZT1B 1VRXA 1FOBA 2W0KA 4NNPH 12E8L 4S0TD 3QUXC 4GW1A 4K23L 1CVSC 1TE1A 4TOQA 3MMEB 2OMNA 2X4PB 4OSUL 4O9HH 3AROA 5GRVL 4EVNA 5IVXF 5A6JA 1J0JA 5FGRA 1QNQA 1G7LB 3QH3B 1MF2H 2HFFB 4G8GB 3BXWA 3LN4B 3PWPE 4YNYA 1CDUA 4UDTB 4W8AA 2X0HA 1X7QA 3UBXB 5LGJB 2XNAB 4XTRD 3AM8C 1R3KB 1B3ZA 1HH9A 3SCUA 2FL5A 3VCLB 1MHCB 1L0YA 2C7FA 2YLLA 3RPIB 4PV8A 4K3JH 2EKSB 4G6JL 5AYUH 3VGGA 1UM5L 4KPHL 3BH9B 3WSQH 3VA6A 3TWCH 3ROLB 2W59A 1EGJL 5F7EH 5HD8D 3FONA 2BERA 4QXUH 5C0CB 5ACLA 4J12A 1RI8A 1FLRL 3U7VA 1TZ7A 3FMGH 5DK2B 1YMMA 4NSKA 1IEBA 2GYSA 5CSZB 3DX6A 4JN2A 3L7EA 4JHBA 3RWFB 3MRGA 1FO0B 2ZIDA 2CBIA 3MROA 5GRYA 5IHUL 5FOBA 1AQKH 1QOKA 1T83A 1CN4A 4L1DA 4HKZA 1J1PH 1BAFL 5I15H 4S1SH 4CNIA 3D0VA 4U1SA 3EJQA 3MA9L 1C8PA 5EBWA 2WPGA 4HIIB 2OK0H 5ALCH 1FAIL 3FRUB 3AJ7A 3KPOB 1Q94B 4U1MB 4U1JA 1CFBA 2AQ3A 2IPKA 4KMTL 3S96A 4WKAA 1T7VA 2GTWA 4NO0D 5DFWH 4W7VA 4KVCL 3TO4C 1E28A 1E4KC 3T09A 2ZSWB 3QZWB 1S78D 4F7PB 4K7PL 3FQXB 1MW3A 4XBPA 3MRIA 1P7KA 2V5RA 4QWWC 4U3XA 1A3LH 1AQ0A 3IU4H 5CUSL 3CH9A 1ZS8A 1MAKA 2ERJB 3F5WA 2X09A 5LKNA 4OCXL 3AXHA 1BBJA 5IVXA 3GI9L 1DZBA 2G9HB 5I76A 3ZT6A 2X40A 3N1AA 3NH7H 4K3EL 4WCYL 1ZWIA 4K7FB 5DI8A 8CGTA 4W86A 2QQKH 5F3HB 3SKJL 1JI2A 1AC0A 4HU0A 1MRCL 2OS7A 5A43C 3CH1A 4MJ5A 1E6ZA 3KPQA 1IAKB 4CJ1A 3EJUA 3GNMH 2HT3C 1BGGA 1LP9B 2EIZA 5DD6A 3HI1B 5MP6L 1YUHA 2HRLA 2VERN 1A1OA 3P9MA 4I8DA 3FTGB 4ZTPH 2ADGB 4DQOL 5I8CA 2GTZA 1XR8B 1U8QA 1RULL 1W1TA 1N0LA 2DKSA 2FD6L 4JZJC 1Z9LA 1VEOA 3P0GB 3TYGL 4HT1H 3V8OA 3H7BB 4QOKE 1MRDH 4UTBL 3REVB 1VKXA 3W9DA 3VRLE 1R86A 1E72M 1A4KA 4G3YH 2AJSH 3TYFB 3T0AA 5DHYA 1T22B 1TJGL 3ARXA 3IF1A 3WJLC 2ESCA 5LJYH 2FHFA 4JE4B 2DIEA 5E8OB 3NCCB 1CZ1A 3VFRB 4Y19D 3ZE1F 3GK8H 3UTSE 2G41A 4P2RD 2A6IA 1L4IA 4YBHA 2VTFA 2EACA 3N1PC 3D52A 5C0GB 3L3OA 4C83A 1UWQA 3VWKB 3DO3A 1S8DA 1BD2B 4GLRI 5CHNB 1JNJA 3LRGA 4JG0L 2NY6C 2VLRB 1AGEB 2VLME 2ESVD 4QXTB 5C07A 1KCUH 4XHJC 1V3KA 1JPSH 2WMGA 2XIBA 4ZO9A 3V5DB 5GISL 4TPRL 2XGIA 4Z2IA 3RVTC 4KROD 4M3KB 1T7WA 3N50A 1BBDH 4KAQH 1NC4B 4LVOB 4XXCA 5EWIL 3ZOAA 3J8F7 3QI9A 5ERWA 4Y1AB 5GSVA 4OV6F 1S5IL 4RFNC 3DIFA 5KAQG 4Y5VC 4YLQT 2F8OA 5F9DC 2YPKB 1ES0A 1K3IA 5D6DC 1OPGH 4W7UA 4RZCA 4O51B 4ODSH 4GG8B 2XGBA 4LKCA 4NDMB 5DDHA 3FOLB 1JNNH 4PUEA 1ZHKB 4YHIA 2CBJA 1VACB 4JPKH 4IRJD 3RNQB 3QISA 4LXFA 2UWEB 4MGXA 1OSPH 1KIQA 3SBWA 1G7HB 4MCYA 5KW9H 1XGUB 5E4IA 1NDGB 1TVBA 2ADJB 2AEIT 4PTWA 4PJ9B 1DLFL 4XCNB 3W26A 3QPXL 4K8RD 3TTSA 4J4PC 3HE6C 5FM4A 4U7MA 3UJTH 4KDWA 4AIEA 2X2HA 3BAJA 4UZSA 1FL3A 2NY3C 1GZPA 4W88A 2XWTA 1XH1A 4GQPH 4D9LH 5C08B 1B1YA 3W4RA 1TDQA 3EMCA 2NSXA 4OZIA 1BM3L 4JG1H 2YKLL 5CSGA 1FH8A 2YSSB 5D2LB 5C7XH 5D1QB 3ROOB 1S7UB 5DD0H 5J9PB 4M6OL 4QOKA 1CQYA 3IFNH 1JFHA 4R2GD 4P23B 3QB7C 1WVZA 3ARFA 5ICZB 1R0AH 2G60L 3MV9E 3LKSB 2ZWZA 1NOWA 4PRNB 2C1PA 3VU2A 1NCDH 1OAQL 3DYPA 5EU6E 2Y36L 1KTRL 3T77B 4DK6A 1F6FB 4P2OC 2DQGH 5K9QI 3QEUA 2KKQA 1RUKH 3U0TA 4CCDA 3MGTB 4Z95L 5JDSB 5AWNH 2NX5A 3WJLA 3QCUL 5FUOH 4EI6A 4RMWA 5D9SB 3P77A 3N0PB 4OLZL 1FFNB 4Y4KA 3ZT5A 3ZHDA 4OIIH 3ALXA 1E1EA 2XWJB 4YZFE 2WYSA 1OAZH 1LEIA 1AD9A 1FNGB 4YWGH 3V52L 5B8CA 3LKRA 1B3VA 4QCIB 1OGAB 1XGPA 2JJSC 4K7PH 3AHXA 1ED3A 5C0EB 5TDNB 2Q8AH 5JPMB 1C16B 2FX7H 4PRID 3WF4A 1W72H 2SEBA 1F3DJ 5FHAL 2DMKA 3AFLA 5GRUL 1K2DB 1CGTA 4FQIH 4YHEA 3TA3D 3SDXE 1W3JA 4GI8A 4WO4B 2HFGL 5HGAB 4J27A 5IGXL 2BNUA 2W60B 4I2XA 5ALBH 3MLVH 4DWSD 3ARFC 4CRPA 4HBCL 4AEFA 5TH2A 4Y4FA 2H2PC 3U4EA 4PTMA 1Y6NR 1JDCA 4DM1A 1SYSB 4P3DB 1LL6A 4Z76B 3RQ3A 1QSFA 4CN6A 1MI5D 1KELL 2YK1L 5CBEB 3ULUF 2V2XB 4Q7NA 2AJZB 5BROA 5D7SL 1JGEA 4TRPH 1W3HA 1PIFA 1RIVH 5KSBF 1P7HL 5CZVH 1R87A 5IKCB 1CT8B 3ULSA 4R8WH 3MMWA 1GGBH 3N85L 3PZ9A 5MEQA 4FTVE 3LB6C 3BYYA 1NOFA 1OD0A 3KR3L 1S7WA 3RVXD 3S88H 3DECA 1NKRA 4AZIA 1K8IA 2OW6A 4L3EB 4PREA 2HTLD 3UC0H 1NMCB 2D22A 5CD5C 3VD4A 2Q86B 2X4QB 3U7WL 3KPSB 3A6CL 4OD1H 4HUWA 4MNHB 1N0XL 4NGHH 3O2VL 4PJEA 4IJ3B 4ZYKA 2WWDA 4AMCA 1ND0B 2LAGB 1QFHA 3HMWL 3VXUD 3MRQB 1MCIA 3TBYA 4OLYH 1CI5A 3RZCA 1UWEL 3JV4A 4X0KB 1KLUB 3DX2A 3BRGC 3B2UD 4XPHL 5I74B 4LQFH 4UV7L 5GRJH 3SDXB 2NY1D 4FLSA 2OQJA 2ZUWA 4W8BA 1RPKA 2BFVH 3H9HB 1C08B 4PGDB 3V5HB 1YNKL 1OM3L 1HHHA 5E8EB 2CPCA 4QTIH 3V7AE 4YFLF 4NZUH 1CFQA 4PRHA 5T1KA 2A38A 2IALA 4PSPA 1U6AH 4LLWA 4MA7L 4JFTA 2WHMA 2R1XB 4YK4C 5JBEA 3DURA 3AM8A 1UJTA 5AYBA 3HE6A 1BPLB 3MLSL 3V95A 1UHVA 1WDPA 4WFFD 4PY8J 3T1WA 5CZXD 3DMMC 4GW5A 4PJ5A 2EEDA 4NQCA 1PYWB 3FQWA 1G9MC 1YMHA 4CVZA 1U3HA 4LCYB 3MUZ1 4P7LA 1J88A 3NPSB 3BZ4A 4W70A 2RGSA 3OAZK 2J88L 1UM4L 1XGTA 5FD0A 4QDMA 1UACH 5KZ6A 4PJBE 1J01A 5L88H 3IDYC 3QEQB 5GS1C 5HHNA 1N82A 4KRPB 2VSCA 4RNRA 4NOBA 1AJ7L 4WFGE 3GSVA 2F1AA 2OM5A 5EUKA 5C0CE 1KJ2A 4HIEB 2BP3A 2HJFB 2IC2A 1UUQA 4W8LA 5L2KB 4ONOA 4KRPC 2PYEA 1AR1C 3EDEA 2FGLA 3AZSA 4ZNEA 3CVHA 3VFMA 3ZDXF 3MV9B 1T4KA 3CFEA 4MD5B 5A2KH 3SCVA 6A3HA 1KT2A 4L8SA 4TUOB 4W4OC 5F9WC 1KCUL 1BZ9A 2E6JA 3KNBB 2WINB 1JWSB 1HSAA 2DTMH 1MCCA 4NQEA 3WY4A 4MWFA 1D9KA 3KPPB 5B38B 5HHXH 1PX4A 3BN9C 1GOMA 4UINH 4NM4L 4UNIA 4P48A 4IHOA 2W9EH 1P4LB 2D31B 4Y5YB 5I1GH 2FGWH 2WZPD 4NN5C 3ARGC 4O2EB 4Q9RL 4LPCA 2OR9H 3O8XC 1A3HA 3E6FB 3SDDB 3HS0B 3PDOA 4FHBD 3U0WH 1JDAA 4I9WD 3FCTB 4PV9B 4PRPE 3U2SA 4OZGA 2J8UB 1IL1B 2J74A 3FFCD 4QHLA 1F58H 2X2JA 4Y4KD 1MFUA 4MNMA 3QA3A 3TNNA 2AXGA 2YPLE 2ARJA 1EAPA 2ED8A 4OAWB 1A0QL 4E8CA 2MWCA 4DWSA 5KSVB 4TQEH 4WDIA 3K1KC 4PJDA 2ARWA 4LYRA 1OAZL 4UAOB 3CUFA 5IMMA 1U8NA 1SQ2N 3EOYG 3CPUA 2IGFH 3TESA 4QTHB 4YR6A 3OWEA 5GGVH 1H0DA 3W27A 5CPTA 2G75A 3CV5A 2OWWA 1L7IL 1YY9C 2DRUA 5JNYA 3GKWH 3NN8A 2F19L 2DQHH 4JVWA 3SKNA 4GIAA 3SE3C 1BLNA 4OT1L 4CDHA 3I6KB 2XM2A 3ZM8A 1DUZA 4ERSH 2F7OA 2JCCF 2VITA 4NQSB 1U3HC 5HVWA 5GGVY 3HG4A 1CQKA 1O5DT 4K94L 1EOMA 2DJSA 2VMFA 3CFJA 3P4OB 1JWUA 3HNSL 4LLDB 4A3HA 1YQVH 2RGLA 1J9CT 5C2BL 4MNGB 4BH8B 3ARBB 5HI5C 5A2LH 2NY3D 2MPAH 5T5FH 2F15A 3EYVB 5DD1L 1JTTA 2VXSL 3ZHKA 4E8DA 3NDYA 4KKAD 5BZWA 2F54D 4YHMH 2XKSA 3RWHA 3WJJC 2GJJA 25C8H 1BMGA 2GK1A 4HA4A 5D9NA 5CIPB 3TO2A 4Z7VF 4ZMAT 1GIGL 3B6SB 3C5SB 4HFWB 1Q8MA 4OJFH 5FV1L 4MVBC 2J2ZA 2ZOKA 4PJDE 4FZ8L 3GH5A 3DRTB 4Q6IB 1NAKL 3WNOA 5I8EB 2CQVA 1ULVA 2HJLB 3TBSA 3FY1A 4X6DF 4TUFA 3QHMA 2ZKHH 3QIUD 4UOW0 5JHDA 2XZZA 1UKOA 3UR8A 3RWJB 3OR7A 1E27A 1S7XB 1U0QA 5GGSB 3VFGH 2D7QA 2EDRA 5DRZB 1QNSA 2DQIL 4PJAA 5F70A 2QTEA 5IBTH 1M6OB 2E3ZA 2AJYL 3OTTA 1P6WA 5JBFA 1DDHA 2V9RA 3DX9B 3RNKA 4F9LC 2AK1L 3VH8G 4GRMB 1CTOA 2ESVB 4RIRB 2HRPL 2JK5B 3RVWC 5K9JL 1RZJL 1UD2A 4PJDF 1G5AA 1B4RA 3D69B 3BKYH 4MA1C 4Z18A 3EJJX 3QCTL 1EVTC 3WXVL 1FVCA 3QHFL 3R1GH 4M48H 5J6GB 4D6DA 4M8VA 2P24A 1IC5L 3DV4A 3ULUL 2VABA 4KROB 1T3FB 5IBLD 4BH7A 2Y72A 3BC9A 1IM9A 1WAAA 1PD6A 5DQ9B 3V0WL 1YNKH 1OM3H 3M8OH 4KQ3L 3GMPA 3PHOA 1M71A 2JKXA 5GGQH 9CGTA 3WN6A 1KJMA 4K2UL 2JCCA 1CVRA 4MHHI 4XC3L 3WFHA 1DWHM 5IF0B 1GGIH 5I23A 1U42A 4FQPA 4U6VL 3BEWA 1DBAH 5GS0C 3RI5K 3D1MC 1QEWA 3UYRL 1VBUA 3BGFC 3X3GH 4W7WA 3EIFA 2FJHA 1TZIB 5DZLA 3QHZH 4XNUL 1JHTB 2OYLA 5A6LA 3UCRA 1NAML 3R0MA 5KW9L 3WYRA 2EYSB 3PQYA 4XH2A 3RDTD 3WDQA 2GT9A 2CUHA 2HH0L 4B7IA 5I24A 5A8QA 2C0HA 3WXWL 2QHRL 1Q1JL 1AVAA 2EC8A 3ZYOA 4S10A 5JMOC 5DA0B 2E3VA 5D70H 5CD3B 2VNCA 3IDJB 3CHCA 1HZHL 1JF1A 5GRXG 2NZ9D 4ZXBB 1IE5A 1XGYH 1D9KC 5EO9B 1TTUA 4MXQC 4WJ5B 1MHEB 5FOOA 1BVNP 1NCCH 3JTSB 3HUJB 1UWTA 4RWYL 1S7VA 1ZT7B 4HPYH 4B7LA 1F8TH 4CGTA 5TD4A 2NMSA 1H3XA 1TPXB 3DHUA 4NKOA 1U8PA 4U2ZA 4ZO6A 1JPGB 5DF0A 5D7KE 1UR1A 2B5IB 4PJFE 4ZDHB 4KQ4L 3IKCA 1J5OH 2ICWI 3TV3L 5EUOA 4F33A 1LWRA 5IROA 3C60D 4X6DE 1CZ8L 2AKRA 3WDRA 5DO8A 3GSXA 5EU3B 4HIJA 5I1JL 2J7BA 4GJTB 1AY1L 1IC1A 1EFXB 4NYLB 3GRWA 5B38G 3ILQD 2XICA 1YEIH 3FZUD 1W0VA 5HHOE 1Q6GA 4LCIL 3OAUH 1MNUH 3HZYB 2O61A 1XR9A 5E99L 2CETA 1V3LA 2OTUA 2Z91B 4QHNB 4NZUL 3BX7C 3IDIA 4JG0H 4M4PA 3GH4A 2Q87A 3O2WL 2AERT 4FP8H 4OCLC 4FS0A 2C3XA 3RBGA 4JFDD 3RU8L 3DVIA 1BFSA 1P9MC 4HKXA 1GPOL 4LCWD 5TE6L 4YFEA 2UY4A 2GJZA 3L9RA 3BKCH 1LE5A 5FB8A 5AG9A 3IYLW 5AZEH 1NH6A 3CDCA 4B3KA 2VN7A 2FWOA 3MV8A 1N3NA 4R9HA 3R06A 4MB5A 4PP2A 3U30C 4NKMA 4MDIA 3IDMB 3QJHB 2HA1A 2I60L 2WNGA 1MRFH 1M7XA 3MV7A 1YEHH 3RPMA 4PG9A 4XAWH 3B8YA 1JYWA 4D0DB 3C60C 1HK6A 2BVUA 1WICA 3O9WC 4KJPD 1W9UA 1EGZA 3V4UL 4FNPA 2BVPA 2VE6A 4GW1B 2BNJA 4CADA 4L5FH 4UZGA 1ZS2A 1KR1A 5M95B 4UFLA 3HNTH 5A3HA 4BQ8A 1OCQA 1B9ZA 4M1DL 4EVNB 5BOPA 3EMQA 3SCTA 4E42A 3NZ8A 2EDJA 4GG6A 2AQ1A 3DOSA 3MNVA 5KVFH 2APWA 1PSKL 4M7JH 3K80A 3ZTNL 2A3AA 2R23A 5DJXB 2A9NH 3HG1D 3H3PH 3MLRH 3A4WA 2ZP0T 3WFCL 2NW2A 5I8KH 4H26B 3EDJA 2YUVA 4B0MM 3L3KB 4QYOB 3G04B 1QD0A 1MFCH 2ATKB 2EKSA 2PF6A 3BH9A 3WMCA 1OWRM 2P7TB 3UTPD 3SOBL 3OLDA 4TVDA 1GIGH 1XIWA 3MLZH 4JO3L 3MRCA 4Y2OA 4PRAA 1II4E 4WENB 1A9EA 5SX4H 5L6YH 1EHNA 2VQUA 1IQDB 2PTUA 4DOHB 1RSFA 4HU8A 1DE4B 4O2FA 4PRBA 4IIQA 3QPQD 1MW0A 5TGBB 4LSUL 4M4RA 3SQOH 4PRPA 1HJQA 2KQNA 4IOSD 5ADPH 1HXYA 5JLZA 2BNQE 5I9QC 4GAJL 5ITBL 2P8LB 4Q9CA 5HDRA 3VFUB 1ZEAL 4PGBB 4M7KH 4PJIA 2P47B 3DVNA 5ENWA 2OK0L 3U6RB 4KKBD 4WI8A 1GC1C 4J8RB 1I8IA 2AJXH 3V7MA 1NGPH 1B0RB 2CJUL 3VXMB 3S96B 4JHAL 3HMXL 4RMVA 3ZE0F 4PYHA 4WUKL 4JPIB 3BP7A 3CFBA 5EIIB 5D7IE 5IB4A 2CLVA 5GSRB 1E4KA 5EZIH 2GJ6B 1QFWI 3D3VB 4XBPB 1MCSA 4LVHC 3QXWA 1I4FB 1XF5B 4A6YA 3WKZA 3AVEA 2FEDC 3C8DA 1GXEA 1QLFB 3VFSB 2GDUA 4UFMA 4LDEB 3H8NA 1BBJB 1ORQA 5DJ2A 3D4YA 3WFZA 3W11C 1ZANH 2QSVA 4KHTH 1HHIA 5JA9A 1I3RA 2FGZA 3QQ9C 4W5ZA 1S9WA 4OF5A 1AO7D 5BMFL 1TQCC 2XFFA 2X7LA 2VSDA 3D18B 1N6VA 4YPGA 1B0GA 1IQWL 3DV6A 1A6TB 5C70A 4MVBD 1CXKA 4H20H 4NP4L 3VGFA 2JIWA 5HGDA 3GMNB 4Q2ZA 3ZTJH 1NGZB 2DBJA 3U83A 1M05B 2I9LB 3GIZH 5TFSL 4AH2B 1KEML 3CIVA 1MFAL 5E94A 2MNUA 3O2LA 3DX1A 1NC2B 3ZLQC 5J56B 3IJYB 2F5AH 3QUXB 1I8LA 1CIUA 4OM0H 2YPLB 3PWPA 4X9IA 4L8CA 5FECB 5F9OH 3AOFA 3M45A 3UZQA 3DVFA 1CFSB 4JRWA 5I73B 4GAYA 5HHVH 1GOFA 1U2HA 1KGCD 3W9DB 3EYPA 3BKMH 4IRJA 1BQSA 3C8KA 2J4GA 2X42A 4K7PX 1T03L 3IF1B 5SWQB 2I07B 3I9GH 4KPHH 5CEZD 5K9KA 1R5IA 1NM9A 1SJHB 5J57B 2HRPH 1M7DA 2QQNL 1FAIH 5IMKB 2HKFH 1X5ZA 4Y16B 5I16B 4OD3L 3V6OA 5GQBA 3BJ91 1N2RA 4P8UA 2N1KA 4JLRB 4MX7A 1WZKA 3BP6A 1HJWA 3VM7A 4F37F 3BP5A 5IIEA 3GEWB 1K6QH 5D7IB 3DI2B 5J12C 3N18A 4DUWA 4IRZH 4UU9B 3MRNB 4JM2D 3PHAA 5FA4B 2WZIA 3ARVA 5FA3B 5HPOA 3QFDA 4NC2B 1VGKA 4LIQL 3DROB 3PWUA 4UOZA 3DSFH 1SEBA 4OCXH 5F9WB 1XAUA 3NCJL 3VOCA 1PG7W 2X2YA 1QO3B 3KLLA 4GI9A 4F7EB 2ZG2A 3QUMH 1QOXA 2CHNA 5HDBE 3JWDC 4LYQA 1FYTB 3X11B 5LA1A 4C56D 1PEZA 1RUAH 3WNMA 1LNUA 4TNVF 3I2CH 3D4ZA 3QDJB 4JY6A 3G08B 1Z5LA 2C3VB 1JYNA 3B5HA 2Z4QB 4PYGA 3EOAA 4XPTL 5F1IA 4BJLA 1SMAA 4LPVA 4GG8A 1NGWB 5DMGC 1OY3B 2BSED 1EAJA 1NBZB 3MMDA 4YHIB 4Z8FH 4LSVL 1IBGL 3GRWL 2EPKX 1QKZL 4AIOA 4HG4J 4MXWL 3KL3A 3MRJA 1I9IH 3SCQA 3SE8H 4LCCB 1J1PL 3TZVD 3QR3A 2DSUA 2VH5L 4DCQB 4KGLA 2DN7A 4BSVB 1QFUH 4L29A 1ZL1A 2BCKB 4QRPB 1U92B 5GGTH 4ZFMA 3FO1B 1JIBA 2PTVA 5JQHC 4JQXC 1CXLA 2EXOA 5IB5A 4OF3A 3L4YA 4YX2H 5A2FA 1CDBA 1I3UA 1OP9A 3S7GA 5I8KL 2VCAA 4UOW1 3SE4A 2PYFB 3DARA 5IM7B 2F2HA 2ZICA 5IDIA 4N0UA 1F00I 3MJ6A 5KANI 3C6LB 3VW3L 3QRGH 1B3YA 4LASL 3GBLA 3SJVE 3IDXH 1DVFC 2GFBB 4Q6YA 4KUZL 3U9UA 4OZIB 2XY1A 3F65A 2EDFA 4LIQE 4D8PB 5I19H 2E40A 3BWAB 2XZAH 4N42A 1EEYA 2QSCH 3RU8H 1S7UA 2WUCH 1F11B 5ESAA 2J62A 3H9SD 2L0DA 2VDKL 3A21A 5EFIA 32C2A 5ANMA 2CKBB 1KTLB 5E1QA 3SKOB 3VGBA 4G8FB 3WV0A 1HEZB 3JTTA 5HI3C 1XH0A 3T0VA 3HE7B 4M6NL 3VI4E 4XVTH 3FKUS 1MWAL 4JO4L 4KRUA 1K9DA 4UUJA 4NNPL 1OAXL 1EZVX 4BZ2H 5IW1B 2V5CA 1W0YT 1A7PH 3VIGA 3REWA 5T3XH 5D9SA 1DBJL 4PJXB 4K3DH 2DYPD 3TJEH 3RDTB 4XCFH 4R4ND 4OLUL 1FIGH 4OLWL 5SWSD 3QIUA 2UY2A 1BFOA 2HFTA 4LLYA 5L0QB 4GRLD 4APQA 1CE1L 4AT6A 1OD8A 4PY7B 1Q0XH 5KVFL 4HWBL 5JPMA 2WMIB 1EMTL 2DWEB 3MODL 2JIXB 3VRLF 4GKOA 1T2JA 1S5IH 3BRFA 2VJXA 4CBPA 4DFHA 3SDCB 4HUXB 1X5XA 4P4RB 5I30H 4U3CA 3U9PL 1HTYA 3LX9A 1U8IB 5MI0B 1LF1A 3PZTA 4GSDH 3QNXB 5HDQL 2FO4B 2GEEA 1UKTA 1BQHA 4XVSL 1E4NA 1QTYT 2F53E 1S9VB 4NZTL 5LYRA 5INDB 1CLYL 3PABB 3AAZB 3QRFM 4GQ9L 3CMOH 3VX1A 4ONHA 2VDML 5C86A 3ARFD 4ORGB 4LLAA 1I9RL 2O5YH 3QG6A 4P2RB 4Y4HB 1MJ7L 4N8PA 3W24A 4PTUA 2BVOA 1T0PB 2XSBA 2OP4H 1BBDL 2JCCE 2DT1A 4DKAA 1JRHL 3PL6B 4LSPL 3F7RA 1HNGA 1M4KA 1URLA 5C0JA 3VSUA 3TBWA 2RCSL 2F7QA 2ZOLA 1UCBH 4XB8A 1J87A 3BE1H 3WD5H 2VIRA 3QIWD 3KL5A 1E6SM 4W87A 4P2QA 4R7NB 4Z0XB 4HKJB 4YUEL 4LCIH 2YA2A 1T5WA 2YFOA 5JA8B 2X4QA 4FA8A 1HHJB 5AWNL 3AY4A 1YPZB 4Y5XB 4G80A 3ARGA 2NZIA 1LHZA 4U6HB 4R5EA 4M9OA 3VNYA 4XI5C 2XKNB 1H3GA 1M7IB 4OZFA 3L4UA 5BZDA 5IG7B 4DEPC 4NC1C 1KLUA 2PCPB 2ICEA 1MQQA 3RKDD 2Z31A 4L4JA 3WIIL 1JHLH 1MJJB 4GKZA 4OGXH 3BKYL 4P2OD 4QXUL 5ID0A 1JFQH 1G9NH 2YA0A 3HLAA 4N1CA 5EIVA 3DX7A 3QULB 2J47A 2YRPA 1WTGT 2FLBT 2X4OA 1TZHB 3PP4H 2KPNA 1D5BB 4FQJH 3LMYA 3RHWF 4BKLA 3T2NH 4GQRA 3BLPX 4XT1C 2DIAA 2R1XA 2UUDK 1J11A 2EKJA 3PWJB 1WBZB 4ALAH 1FH5H 1FC2D 1XZ0B 1KN4H 2Y5EA 4FQ1H 2I24N 4FMVA 1KFWA 3SGEH 2CLRB 3I75B 2EC9U 4GO9A 4L4TA 3QG7L 1LQSR 1H9VA 1FCGA 4X8JA 1AE6L 3JVGC 2MKLC 4M6OH 5BV7B 3TO4B 4KMTH 3VG9B 2XA8L 1R24B 2XT1B 1Q4NX 3X12A 3RKDC 1KGWA 3D5OF 4PJBB 5M3WA 4XP5H 3PP3H 5I8OL 3FO2A 5GGSY 3VXQB 3FFCB 2CDGA 3VXPB 2J6EH 3CHFA 3CCHA 4PLOB 2DH3A 4I3RH 3LSOB 3X14A 2HISA 3VXTA 4WFED 3MLZL 2P8PB 2ORBL 3AQUA 2YUWA 1T04A 4AIUA 4ODSL 1AQDB 3FT2A 3PGFL 4OGZA 5A6AA 1ITXA 4V28A 1VPOL 4G43B 2VL4A 1QSED 5E0FA 4J4PA 4UQ3A 1KYOK 3GI8H 5ETUB 3MV8D 1U30A 5HHPB 2IAND 4LSSH 1ZU8A 4XBEH 3GJFB 4DZBB 2Q76B 4U3AA 1G0CA 3BQUB 2VLRE 5CGYD 4AMKL 5D7SH 2WCAA 4HHAA 2QLVB 5GISH 1B3WA 2ZJSH 2ITDA 2EAEA 5TQ0L 4ZO8A 2WBKA 1ACYL 3QIWB 1OQOA 4QO1A 3T8XB 1L9MA 2BZDA 3OAYK 3MFGB 4FFVC 3PUCA 4X0NA 4J1UA 3GUTA 1QP1A 4BZYA 1NARA 5CP3A 2RIKA 1FO0L 4YHKH 3EGSB 3FMGL 4R97B 2XFRA 2YBUA 1UB6B 3TGXA 4S3JA 2V7HA 2R0KL 1MCEA 3UTTA 4N5ED 2YD6A 4Y5YA 2UZIH 5BXFA 4XPAH 4I4WA 3CZKA 3CUIA 5DO2D 4KROC 2P5WD 4KHXH 1SBSL 2HFGH 4NO5B 4DW2H 5IQ7L 3E6FA 4XWGL 3JUZA 1JF5A 1QZ1A 3AMLA 3C08L 3TPUB 4M24A 1FZJB 1F58L 3QA3B 3TNNB 4OUUB 2V3DA 1F3JA 1CL7L 4D3CL 4JRYA 4PRIE 1UFUA 2A0LD 4PP1C 4AJ0A 1MQKL 3MJ7A 4L4VD 1TJIL 5D2LF 4NI3A 2R56H 1G6RL 1JNLL 1IGIH 1WIUA 1HJSA 2VLJB 2HP4A 5FO7B 2UV3A 1DBMH 2HWZL 2MOVA 5E5MB 1K9FA 1MHCA 5FOBB 3QWRD 3SKUD 3QCUH 4GKNB 5INCB 3LRMA 2DQHL 1BJ8A 1NGQH 3NPZB 5CGTA 1J8HD 3VXUA 3BQUC 4ZNEE 4P99A 3S97C 4AK1A 5DJ0B 1S7TB 1MLCB 1MIMH 3MRKA 4IS6A 4CU7A 3A4AA 3EFFB 3QRGL 5CFHA 1NJ9B 1KB5H 2BDNL 4KUZH 1CGWA 1FSKB 1IGTA 4YJZL 1F42A 1I9EA 3IFNL 4JRXE 1BTCA 2FJFA 4LGSB 3S34H 3PN8A 4PP1D 2WQRA 2YR3A 1LE9B 1NBVH 3S36L 3LS5H 4Z7NE 3TP4A 1U33A 2XN0A 4JZOB 2OTPA 3F5WB 2KH2B 2Z8RA 3Q3GB 2ZX6A 5I8EA 4MAUH 3E8UL 2HVJB 2LE9A 3ECBB 1D5MB 1EH9A 1BM3H 5MEOA 3KPOA 4BF7A 2MMXA 4WUUE 3PWLB 1M01A 2XHYA 3MREB 5JMRA 3CBWA 1OAXH 2XFXA 1AI1L 5FGCB 2K1MA 3FT4B 4P4KB 5A2BA 1CENA 4Q9RH 3VPLA 3KHOA 3BUPA 3T0EB 1RD6A 3C9NA 2WHKA 3SPVB 3NSMA 2D0HA 3M17A 4JFOB 4P3CL 3WUEA 3DSNA 1AGBB 5EO0A 5HYJB 2LU4A 3MYJB 3N11A 5LQBH 3G6JA 3KEHA 2C4FU 5AYIA 1UA6H 4UIMA 4M1RA 3SUWA 1ZS8B 5DK0A 1A3QA 4HXBH 3BVNA 3EO0A 4FQ2H 4YBQD 5IVZA 3BOVA 5GRWA 3MLWL 5BS0B 1KCRL 1EXPA 4LPWA 2ADGA 2EDDA 3OA5A 1RJYA 1LDPL 4G9FB 3VFOA 2E5EA 1FGNH 3S88L 3PV6B 2B1HH 3U36B 5E2UH 4MNLA 5D8JH 3H7BA 1T0NA 1NANH 1HKMA 3FT3A 5HJ3A 4FNUA 1A4KB 1BSIA 3T2OA 1BZ7A 2DM4A 1QUNA 1J18A 5TPWH 4Q97A 5D7LA 5C07D 4KTDH 4RMRA 5EB8A 4YQXH 3ZDYE 5DD6B 1G94A 4NJAL 2HG5B 5IB2A 1D9KD 1CLZL 1YUHB 3EJYD 5KEZA 1EJOH 3SGJC 3LD8C 4IBLT 3HU7A 4NZTH 5DJCB 5HYQB 5E8NB 1VFOA 2F8XC 1WEJH 4WTZG 4LEXL 1JV5A 5DRWB 4NRXA 1TZIA 4OFYA 4OCYH 4URTB 3NZHL 3SQBA 3CLWA 5KSBA 3TFKD 4ZAKA 2AK4E 1GC1H 5JW4N 1Z0NA 2AP2A 1KEGH 4OB5H 5BW7C 1YZZA 2V38A 3MRHA 1KSRA 3EFDH 3N9KA 3LKPA 1QNOA 4WSJA 4TTUA 5ICYB 3SKMB 1KELH 2DQJH 1JF1B 4X7SL 3BN3B 2FX9L 5E8DH 2Z93B 4Y1AA 2IFGA 5EOTA 3O0RL 4E41E 4JZNB 1P4BH 4M00A 3T65A 4NWTL 1E4XI 1JYXA 2WHJA 4YHML 1NP0A 1R3IL 1BWWA 1WFNA 2ZX5A 3F58L 2WW8A 2FX8H 4LHUB 4C56A 4F9PC 1MXGA 3BPNB 4XPHH 5L9DL 3P30H 4RQQA 1RY7B 3LAFA 5L2JB 5F44A 1RZIA 2XG9A 1OW0A 1KXVC 1TR1A 4MQTB 1D5IH 3W6LA 4NQXA 3RGVB 1QWNA 3VFTB 2GAZB 4LP4A 1RP9A 4OD1L 2V2TA 5ERWB 5GSVB 3UTTD 3GKWL 4PRPD 5KS9F 2WV3A 1SHMA 3ES6B 4YXKL 3FFCE 3RM8A 2WK2A 3VH8A 1LO2L 1NBYA 4DZ8A 2FHCA 1XD0A 2CO7B 1WT5A 4LF3B 5IBTL 2DSWA 3D9AL 2VX7A 15C8H 2QSQA 4OCWH 2ZNWA 1DQLH 3L95B 3TBVA 2WKGA 3KPNB 5C6TH 3QIBA 4DVRL 4PN2A 5IFJA 1HVQA 3LXCA 5D4QA 4UNUA 4AZ7A 3Q6FA 4OV5B 1JTPA 1DN0B 4R4BA 3GMRB 3BUBA 4DGYL 4YZFF 4LK4A 1XGUA 1E73M 2AV1B 3HA0A 3UPAA 4WIWA 4RCAA 3FRPG 3RZWA 2RAMA 4QP0A 3B4NA 1OCWL 4CN4A 2NY2C 5DUBB 1R3HB 4X9FA 3V0VA 1Q9WB 4NQEE 1FL3B 2X9YA 3LS4L 3VRJB 4M80A 2XV6B 5ISZD 2OSWA 1R6VA 3EBAA 4Z8FL 1C5CL 1OW0C 3SBWC 4JQIL 3T4YB 3QEUB 5GRUH 5HGGS 4J2XA 3S37L 1WF5A 2EYRB 1LP9E 3HAEA 3NABH 1JBJA 3MGOA 4PTTB 5E56A 4UTFA 3OLIA 3VMNA 1GHFH 4NJ9H 4MYWB 4Q22A 1MVUB 3QDGD 3GSOA 1T6VN 3LV3B 3G5YA 1A7OL 2CPUA 3RTQB 4TSAH 3EYUL 3WIJA 4D71A 3R1GL 4M48L 4PRNA 1NBVL 4DVBA 3O3DB 1VIWA 1NPUA 4JKMA 4LOUD 3WUWB 4Z78A 5HXMA 1NFKA 3IRPX 5TE4L 1RUML 4HMDA 2SEBB 1DQML 4X5XA 5IMLA 2GJPA 3HZMA 3QPQC 1CWYA 5JHDE 4AD3A 1RIVL 1RZ7L 3OX8B 2WVVB 1KYOJ 1U41A 3V5KA 1V02A 4S1QL 1QVOB 4UIKL 1SYVA 7TAAA 1NUGA 4HLJA 5IVXE 3UG3A 3NSXA 5HI3D 2E27L 3HC0A 4HGWB 3ARDB 5IFTA 3GSNB 3TCLA 3ARGD 3RWDB 4YDVA 3BD3A 2W9EL 3MJ9A 4Z7NF 3QHZL 2VX5A 5HDOA 4ISVA 1F2QA 1KB5A 2DI8A 1HH6A 1MCHA 1ZT4B 4ZPVB 3CVHH 3MFFA 1QRKA 5DURD 1KPVB 1EOKA 3PE9A 2DMBA 5T3ZD 1XF2A 2Q6WB 1QSFB 4JFXB 3A0OA 1PGRB 2IMNA 3FB6B 4WO4C 2YOCA 4M6MH 4POUB 1JGEB 1OP5K 5GIRA 1PQZB 3BP7B 3CFBB 3PL6D 5I71B 2BNRB 5KJRL 4RGNC 4X8XA 5D8JL 3DGCR 3O3AA 5CSBA 4O58H 5JPNA 3WIFB 4L4TD 3ZYJA 3QUKA 4HG4K 4LKXA 5C9JB 2VXSH 4KRPD 5CBAB 4KJPC 4UDTA 1UB5A 2D3LA 5E1AA 3HRPA 1ISYA 1OTUD 4KKNA 3UTOA 3PTQA 4KI5F 4L3EA 3P0VL 4OCNC 4FF5A 4PJFF 3TZVC 4UAOC 2C3WA 2NY0D 3D39A 3ELAT 4AISA 5IP4A 2EEXA 4OF7A 4GO8A 3IDGA 3LN9A 1I1YA 2WBGA 1DVFB 1PKQA 1RZ8B 3PWNB 4O4YH 3NFSL 4X4XB 3BKJL 4PMQA 1U3YA 3U9PH 3V6OC 2EO9A 4EIGB 5IEHB 1JK8A 1UWRA 1TVHB 3VRIA 1JPTH 4LNVA 1LJYA 4N0YL 4NKIL 2X1IA 4KXZI 3ESUF 3L7FB 4OM1H 5DGQA 1NC2A 3QQ3B 3VFGL 3TJHC 4PREB 2NXZC 4CMHC 2AJUL 5D7KD 4IPNB 4L8CB 3FZUC 1KC5L 3FFDA 3KYAA 2I25N 2ZUYA 4FQLH 5EBWB 1HHGA 4YFLI 4PJEB 3BKCL 5GHWH 3BKML 5DA4A 5GJTL 4FLQA 5E2VH 3CUHA 1E40A 2EH7L 3TBYB 4JM2C 2XVNA 3WXWH 4LEOB 4UMGA 2JJTC 1PZ5A 1AMYA 1JE6A 35C8H 1E3XA 3W39A 1CU4L 1HE7A 1BQLH 1RU9H 2ZSWA 3H9HA 1D5IL 5H37H 5E8PB 2BOBA 5DD1H 1CFTB 5I1IL 1G7QA 4RAUB 4LSUH 4ZS7H 1MXDA 2NZ9C 1VADA 1Y18B 1GSMA 3IXAB 4ZOAA 4DGIH 4FZEH 3M6DA 1U8OB 2R29H 4PS4H 4BZ1H 2GUYA 5CEXB 3TH2T 4N8VA 1WC7B 5FA4A 3L6FA 3BAEL 4HH9A 1FN4B 2X10A 4HTYA 2F9BT 3A5VA 4N5UA 2HJFA 1YMHB 3GYCA 4XZUB 3RIAF 5CP7A 3LB6D 2IWGA 1A2YB 1DEEA 3STBA 5I1CL 3WHE0 1KLGA 1KPRB 2C7UB 1HILA 4LLUA 4R26L 4OZHB 1E4IA 5D7JB 1Q6EA 2VDLL 3ME0A 3OGOE 5T1MB 3RX5A 3WL9B 5HHOB 1U91B 3QDJA 4QY8A 1XH3B 5EU6D 3AIQA 1DBKL 2YRLA 1WBXB 1MQRA 1E6XM 5TE6H 1RK1A 3HUJF 2A3EA 1HIMH 4NRRA 3IDUA 3RTQD 5ILTH 4H88H 3L3HB 5C8JB 3QZWG 1OP3H 2W9DL 3GBDA 4U1GB 4JAMB 1R46A 3LRLA 2IH3A 3DUUA 2DLTA 4FFVD 2Y25A 1EGJH 4Y5VA 3UO1H 3VFNB 5L7XL 4ACYA 1EHXA 1ZEAH 3KLAA 4TUOA 1IL1A 4NCC2 4HC1L 5DLML 5I1JH 3M1BA 4GZEA 4ODUB 4MMXC 1CICD 3W81A 3U82B 5IT2H 3L5XL 2PBOA 1BAGA 4KMLB 1GZJA 5DUMH 3OJDB 4XPGL 3VWKA 2CMRH 2OZ4L 1HCVA 1NMBH 4Z7WE 1T5XB 3ZE2F 3LN4A 4YNYB 1FNEB 4UFKA 3QWRA 1UENA 4QXTA 4HT1L 4W93A 2FBJL 4JO2H 4QRSA 4KK5C 3LXBA 1PIGA 1UQZA 2R2BA 2ED7A 2ZUNA 5JNYB 3ZDXE 4CVUA 5EFFA 2ZXBA 3GXMA 4KKBC 3I3EA 5MEPA 2AK1H 4EN3D 1AY1H 2OR8A 1HKJA 2IG2L 4PJIE 1YEIL 5I78A 4ZFZA 1MI5E 4HS3A 3AMGA 4MNGA 4BH8A 3KE0A 5DHXB 3OKNB 4NOFA 1UR8A 2JB5L 4PJ5D 2DQIH 4ZG1A 5AZ2H 5C09D 1H0DB 2CDEB 2VISB 4M61B 2EH8H 3L7EB 3VXOB 4RWYH 4I48A 2D9CA 5E9DE 1CS6A 5CIPA 4NDMA 1IM3B 4PJGB 2CKRA 2EXYC 4PRHD 1UR0A 2D7NA 5BV7C 4CNIB 2XN2A 2IBZX 5ITBH 3D3VE 5LAXA 5IB3A 3QUZB 5A94A 3OB8A 3FRUA 1UD3A 1V6XA 1LO0H 1DWIM 3WQ8A 5FHAH 4AXNA 4HS8L 1E1FA 1HXMB 4BK5A 4M7LH 2X44D 4LNRA 1E3ZA 3OR7B 2FIKA 4KVCH 4R27A 4NM8L 3MQIA 1EO8L 1MNUL 2CLZA 4FRWA 1CIDA 4Q6IC 5LA0A 3C5SA 4HFWA 4U1NA 2VRQA 1GZPB 1AJ7H 4MNQB 5JOPE 2ZUXA 3MPCA 5F7WC 1OTSD 2FB4L 4YN5A 2Y6SC 5C08A 4ZFOL 4EQ3A 3QNXA 1CL7I 1FFOA 2EXWC 1MCKA 1KQZA 2BNQB 4RAVB 3BWUC 1T20A 5EBGA 4WY7L 2V17H 3BCDA 1B6UA 3RL1A 1TITA 2YHGA 3PABA 1SJXA 1ZANL 1ZV5A 1LO4H 1X5AA 5FM8A 3G6DH 1KGCE 2OW7A 4WI2A 4TNWF 1IT0A 3DVGA 1IAKA 1BX2A 4KKLC 1H5BB 3L4TA 1BYBA 4U49A 4D9RD 4BQ2A 1IM9B 2FDMA 2VURA 1LP9A 2EIZB 4P46B 5JHLL 1YJDH 1QLRB 3H0TA 4GG6E 3LPGA 4MA1B 1DDHB 4JZJB 4KV5F 3GB7B 3QNYA 4X4ME 4BM7A 5D1XC 5ECJE 5A6MA 1NCCL 4PJHA 1CF8L 5EU4B 3BEWB 3BYTA 2Q3AA 5JDSA 1UZ8B 3QP3A 4OFIA 3RWGB 1WFUA 2ZUQB 3OGCA 4P2QB 4R7NA 2PF0A 2F5AL 3DV4B 2NY4D 3SE9L 4TPRH 3WQ5A 4F15C 3BPLB 2JFEX 1HHJA 3AIUA 3AXLA 3II1A 1ORSA 3TONA 4WI9A 1I8KA 5IB1A 5I1IH 3CDGB 3K8LA 1LVEA 1H41A 1NFDA 5K33A 4QRRD 3FQNA 4HMEA 1I8MB 3U79A 1T7ZA 5IG7A 4TSCL 2ICEB 3MBXH 1DWJM 3WNLA 3VA2C 1Z9SA 2OL3L 4WJ5A 1IVLA 3TN0A 2QADD 4E5XB 3BEVA 4JFFD 5C0GA 5BVJB 3PTMA 3IU4L 5CUSH 1U9KA 2W38A 2YZ1A 2PUQT 1QA9B 4QRPD 3OGVA 3HG5A 3GMLB 4FFWD 2W92A 3BQUD 1MCJA 3T2NL 4YWGL 2WIIB 4HLZG 4KDTA 3VSTA 2JELL 3CC5A 2XKUA 1H5BC 5DS8A 2IEPA 3T3ME 5FGBC 4OM1L 1TQSA 2A3BA 4WWKD 1TVNA 3ZJ6A 3HRZB 4NYLA 1G6RA 3OGSA 2VZ1A 3FQRB 1FL5B 5F97E 3HZYA 1NGPL 5GS2H 4PB0H 3N9GL 4NKOB 3QOMA 5I66B 3PF2A 4KK8C 1OPGL 1E4JA 2X4TA 5CJOL 3P2TA 3WDPP 1EFQA 2DQUL 4F33B 2GJZB 1MPAH 5DC9B 2AKRB 1LE5B 1NMAH 2R1WA 5CLTA 1AQDA 3FT2B 3TT1H 1YN7A 5F6HI 2GJXB 1EFXA 3VINA 4NKMB 1ZE3C 5SWZE 5DUML 4ATWA 1KWKA 3CH8A 2R0LL 4U6XB 4FK9A 4K3GA 3SCNA 4NSBA 4FNRA 1T66C 1X5KA 3GJFA 4S1RL 4NZCA 3CFCL 4PJ9A 1UASA 2D7PA 4XVUC 4YC2C 4DGIL 3CLFL 1GJWA 2PO6B 2VLKD 3BDYH 3IU3B 3NGBB 4KV5E 1QNPA 1V0LA 2XTLA 4YDLC 4U1HB 3AREA 5FB8B 3QXVA 3AI0A 4WEBL 3VXRB 1QFWL 3VD9A 2WVUA 4NZFA 4J1UB 2WANA 3CVHL 4TNWK 5JOEA 1IGCH 4WW1B 2Q8XA 4OFDA 3H55A 4PTXA 3I6LE 3LN5B 4Y5YC 1A3RH 4D0DA 3KPRE 3RGVC 1A47A 3NYDA 4UBDC 5J9PA 4JQVC 5E6IA 3BIKA 4ODXA 5EC2A 4LIQH 5F72S 4FABH 5D6DA 2BFGA 3L5WA 5FO8A 1LG1A 1AIFA 3SE4C 5J12B 2ZX7A 1IFHL 1P4IL 3BI9X 1IQDA 3SDDD 5GS0H 3OKMA 2C1OB 3DRQA 2YD4A 3KLKA 3AB0B 1GCFA 3TTQA 3DPBA 1RIHH 1GQJA 3QGVA 4POYA 4HOZA 4R7DB 1Q1JH 1LQ0A 3G04A 1OARL 4XP5L 2VXTL 2XTJB 4QRUA 4UDUB 1ZLUH 2V3EA 2J6EL 5B8CB 3L5XH 1UWEH 3ARZA 3VFVB 1A6PA 1K9TA 4FXGB 3I6GB 4LVNB 2FLRT 2VZTA 1KIPA 3QDJE 5TDNA 4NBZB 3Q1SH 5B39A 3VE0B 3F4VA 1CE1H 2QADB 4K68A 3QUXD 4W4OA 1IGTB 2R1YA 4QTIL 2ALWA 2AS5M 3KYMB 1D5ZB 1OLLA 2HLFD 3UYPA 3WBDA 5A6KA 1RURH 3OJMB 1JWMA 4QLJA 3T2QA 1XFPA 4GAGL 1ZLWK 4PIRF 1VSCA 2CIKA 1A9BA 1MFAH 5DVNA 4GS7B 1EV2E 2HFFA 4RFOH 2BNUB 2W60A 5SX5K 4FNSA 5HHMB 1A5FL 5IW3A 3IAPA 3IDXL 2XNAA 4HXAH 2Q20A 2BSTB 5MEOB 3MLXL 1VHPA 2CXKA 1K8DA 2D7MA 3WFBH 3U2SB 3JUYA 3GTNA 3O8XD 4PV8B 2XVKA 4FFWC 3GSNH 2IXUA 1EAPB 1VDGA 4L9DA 4HOXA 5JTWA 4PJ7B 5I18L 2JF7A 1RUQH 5IFHL 1GORA 1HNFA 3SCPA 1B88A 2C3HA 3MCKA 4OGAD 3HE6D 2OL3B 5C08D 4UIMB 3DX8A 4K8RC 2XN1A 2I9TA 5DUPH 4DTGL 3MODH 1S7SB 3PZQA 3CDFA 3BUTA 4RL3A 2VB5A 1T0OA 5MI0C 5D7JC 5FKPB 3QUXA 4XAWL 4LYPA 4OOZA 3WO4B 1JNLH 3D0VB 4U1SB 4YUEH 1V3JA 2JLLA 3D18A 3I6KA 3S4SG 2QV4A 2J6EA 1A1NA 1VFMA 3WD1A 2VITB 2Z92A 4B5EA 2ORBH 3VFPB 2DTML 4EI5D 1D6EB 1ZHBB 5IEKB 3C8KB 2XIDA 3C6SA 4Q2ZB 4EUPH 4HIXL 1QI3A 3WS3B 3U48A 3BUYB 1RHHB 5CJ5A 4BQ5A 1JGLH 3AS0A 4HPGA 3WLWC 3OKKA 4LCUA 1JN6A 2WHLA 3ULVF 4GXPA 5D2NC 4ZOBA 4O5LL 4TSBH 5I1GL 4GW4B 3RDKA 3BP6B 3TO2B 1XT5A 4FQXD 5DRWA 1HHHB 5E8EA 3KXFD 1N7MH 2NT1A 2F8QA 3RM4A 5T1KB 4R96A 2Q7NA 4PRDB 1GC1L 4WV1B 1QSZA 4G7YL 4P5MB 1KJ3H 2IPKB 4GW5B 2LVCA 2WMPA 4ALAL 1E27B 4LCYA 4ONGH 2R4SL 4JVUA 3BZ4B 2IGFL 3CH1B 4MJ5B 2V5TA 4N1HB 3EJSA 1N2RB 4PJAB 1KCLA 3QXDA 5GS1B 4R0LA 1U2CA 3MSPA 4NN6C 5KN5A 3SDCD 3BP5B 4NQDD 1P1ZB 1JMZA 1L6ZA 1QYGL 1YNLH 3TNMB 1WSST 5HBBA 5LGHH 1MVYA 4JREB 5KSAA 1N64L 3MOAH 5SV4A 3EOAB 5F1IB 4H8UA 5C8BB 5E70A 4ZXOA 4HC1A 4AY1A 4GRLB 3F6IA 3QFDB 5IHZA 3RGVA 3T3PE 4CU8A 3HG1E 3REVA 3GJFK 1VKXB 2X1XR 1NKOA 1I1WA 3MBED 2WBJC 4F37K 4KY1H 1RJLA 1MCDA 1IGCL 3SJVA 2KUTA 1M71B 2BCKA 4KMQA 4KVNH 4QRPA 2WC3A 1LEGA 1OB0A 3I50H 4OLWH 3UTPE 3ZYZA 3VWJC 3HE7D 4M8QB 5JIWA 4GT7A 4Y0GA 3VG9C 3DYMA 3VI4F 1V7NH 2UWEF 2AJVL 3KS0J 2VDOH 2J7FA 4PG2C 1JHTA 4IHOB 2VLRA 3SDXF 4EN3C 4P5TA 3PP4L 3SGDH 3ULUH 2BNQD 3U5UA 5I2UA 3WFDL 1GGCL 1VFUA 1T22A 4DN3H 4R4BB 2YUZA 2AI0H 2BSRA 4K8RH 4F7TB 4LPUA 1PX8A 1RUPH 4WKHA 2H2PD 3VFRA 3PIQA 4G9DA 4ZXBA 1F02I 3D2UB 3MA7A 1Q9WA 1KFAL 2NLJB 4BA0A 1OARH 5F7LB 5BS0D 3EDDA 1UM6H 2W65B 4IDJH 1QI2A 1OGBA 1AGEA 1SZNA 3T4AA 1NCBL 3OB0H 2EO7A 4DAGL 3VNZA 4C7FA 1G7PA 4HJGB 5A69A 2M2DA 3JUGA 3C60A 3ULUE 1WZMA 4JFEB 5F7UA 3TVMD 1E4LA 3REWB 1E9LA 4HV8A 1B3JA 3BZFB 3TIDB 3EMZA 4ODTL 1ZHKA 1LWHA 2GY7B 1V6VA 3ARDD 3MRLB 5EFIB 4XZWA 4ZODA 1F6AB 1NL0L 5IT2L 4LLDA 3KXFA 1UYWL 4G8FA 4APQB 1ZLVH 2OXGA 1DWGM 3MJ8A 4K9EH 1C92A 1Z9OA 1ISVA 4X7SH 1CXFA 1CICB 3F5JA 1I9RH 2O5YL 1KENH 5E8DL 1G9NC 1H3WM 1ZSDA 1AHWB 2E9JA 4S1DD 1DL7L 4RZCB 1EO7A 1UR4A 3C2AH 5DRNB 5JO5B 5K59F 4Q58C 3MV7D 4H1LB 4IOIB 1RZJH 3RBSA 4MZ2A 3LPPA 3SUSA 2I5YL 1XGZA 1F2XK 5HYJE 5IHBA 2FR4A 1W32A 2QKIB 4UV4L 3U4BL 4DO5A 3RL2A 3W28A 4ZXBC 2QL1A 2YEZA 4YK4B 1H09A 4RFNB 5JW5A 1NDGA 3PGDA 3RWCA 3RX8A 5IBUB 1FFPA 1QSFE 5IK3B 2MFNA 4EDWL 2RFXA 4HF5H 5F9JA 4KDVA 1NUDA 2R39A 4M5YL 4P7RA 1MJ8L 1X4XA 1TTGA 4L9LC 4LSTH 2APBA 4E42B 1A7QH 4NC1E 4GG6B 3TH4T 4GFTB 4MJIE 4PGEB 1OP5H 5BJTB 5LWYL 5BRPA 2R23B 5DJXA 5CWSB 1HWWA 3VXSB 2O92A 5GGUB 4R6UA 2YSSA 1KCRH 5J6GA 2GK0A 3RVWD 3W11D 1C5DB 1XGQA 1AQHA 7CGTA 3AZTA 1NMCC 4PMYA 4MA8L 4TXEA 4M43H 4N0FA 3LKRB 4XPBL 2MQCA 2FEDD 3RWEA 3WN5B 4JO1H 4PGCA 3MLTA 3V0AC 5DQ9A 3BUDA 3W25A 4YHNA 3GMPB 1MREH 1L0XA 1M7IA 3ULVC 1JGDA 3RAJL 1TVHA 2QQKL 3SKJH 4QEGA 3TA9A 2A6DB 8FABA 3MGTA 4NZRH 2VZSA 1AI1H 4IIQC 5BVPL 3QIBD 3EYFB 4OGYL 4D3CH 1AQMA 1IC4L 2WZEA 2G3NA 1KC5H 3FFDB 3PQYB 3V4PH 1RZ7H 2NY4B 3S3PA 1FSKC 3L5JA 5DD3H 2XFYA 4IRSB 2J12B 4AD4A 1IRAY 4Y5XA 3CU7A 5FGSA 4Y4FB 1NWSA 4GI6A 3QFJD 3UEZA 4PBVC 3G6JF 2FCBA 4S2SB 4Y8DC 3PWJA 1I85C 2QV2A 1B31A 1I8IB 2NNAA 2W9LA 3MC0A 4OZFB 1S5HA 2R0KH 1NOUA 1PZ5B 4NWUH 5CBEA 1E6JL 5DJDA 2Z31B 4KK9C 4YHOH 4H0HB 1X6LA 5FEBA 4P46D 1H8NA 1Q6DA 2KL6A 1SBSH 4RSVA 3CFKB 3MKKA 1LILA 2ZG1A 3MBEC 4WIQA 1JPGA 4ZS6C 2AOSA 3VDAA 3LEYL 2B20A 4YH6A 4OZOA 1HXKA 5M94B 4KQ4H 1J5OL 3QHTC 1Y18A 1KCSH 2C5DC 3IXAA 5TH2B 3C5JA 4NHUB 3U4EB 2UWEE 3UPCA 5AG8A 5KSBE 4P5KA 3LSOA 1WBZA 4PR5A 1YY9D 1VFBA 1HHIB 4P3WA 5CEXA 4HWBH 1MELA 4WTXA 4HH9B 4LLQA 2X7LB 1I7RB 5E2UL