1DUBA

2-enoyl-coa hydratase, data collected at 100 k, ph 6.5
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'ANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-ENOYL-COA HYDRATASE
publication title Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
pubmed rcsb
molecule tags Lyase
total genus 93
structure length 260
sequence length 260
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1996-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1dubA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1dubA01
5DUCA 2A7SA 1YG6A 4FZWA 2ZL0A 3QREA 3TVUA 4ZDBA 3LAOA 3QXZA 2WTBA 4ZU2A 1OD2A 4JYLA 4ZDDA 3TT6A 3H02A 1FC6A 3IBBA 4Q0GA 1XNWA 4F47A 3ST9A 5KDRB 5DU4A 4JSBA 4QIJA 2CBYA 5E0NX 3NJDA 4L6WA 3R9QA 1X0UA 1FC9A 5G1RA 2F6QA 3K50A 3ISAA 4U19A 2W3PA 3FF6A 3GKBA 4HNKA 3DJAA 4GM2A 3PE8A 3I47A 3TVWA 3HRXA 3HP0A 3KTGA 3P85A 3STAA 1UIYA 3BPPA 3M6NA 1VRGA 1Q51A 3PEAA 3BEZA 1FCFA 4U0GA 5DKPA 3TRRA 1N6EA 1Y7OA 4U0HA 1DCIA 3ZWAA 5E0SH 3GF7A 2J5GA 2VSUF 3KTIA 3TLFA 3K8XA 2VSUA 3IB9A 4FZWC 3IAVA 4YLHA 5KDRA 4Z0MA 2J5IB 4I42A 3Q1TA 5DTPA 3V5EA 5CTCA 1UYVA 4G2RA 4ELXA 1EY3A 1K39A 1SZOA 3H0SA 4K2NA 3SWXA 4JCSA 2J5SA 1ON3A 2ZQRA 3VIVA 2PG8A 3H0JA 3HLN1 4KWBA 3KQFA 5C90A 5FIFA 2FZSA 5G1SA 4JWVA 3PGQA 3Q0JA 4I52A 3BF0A 3T88A 4EMPA 2ZL2A 3MT6A 3PZKA 3DORA 3OMEA 2UZFA 4WZ8B 4KD6A 2FBMA 1HZDA 4IZCA 1PJHA 3HINA 2J5IA 4JCRA 4FJWD 3T8BA 2VSUE 3QXIA 3QK8A 1WDMA 4JOTA 5JBWA 3R9SA 3N6RB 2EJ5A 4FNBA 4JJTA 2A81A 2VSUC 4OMRA 2IEXA 4FN8A 3LKEA 1K32A 2VSSF 3U9TB 2VSSA 3RRVA 5G1QA 4FNDA 3GF3A 1N6DA 4B3HA 2NP9A 4U18A 5INIA 1WDKA 3P2LA 4WCZA 3M6MA 4B3JA 1SG4A 3MFMA 5E0SA 1TYFA 2Q35A 4QIIA 2ZQQA 4RCNA 4KPKA 4ELWA 2J5GD 3HE2A 3QMJA 1ON9A 3QKAA 1EF8A 3Q0GA 2BZRA 5FUSA 2VREA 1UYTA 3H0UA 5CTBA 2F6IA 3TV5A 1RJNA 1NZYB 1O8UA 4RYFH 4FN7A 1PIXA 4JYJA 4OG1A 3KTKA 5DUFA 3R0OA 4WYOB 1UYRA 2D3TA 4HC8A 3MOYA 3WG5A 5DL1A 3ZW9A 1XX4A 5DZKH 4NNQA 3QWDA 1WZ8A 3R6HA 5JBXA 3H0QA 3U9SB 4NEKA 3T8AA 1YG8A 4MI2A 3ZWCA 5MGBA 3OT6A 2F9YB 4QFEA 3R9TA 4GHNA 4ZDEA 1UYSA 4IZBA 3P5MA 2DUBA 4JCTA 3NJBA 5DU8A 1HNOA 2GTRA 4DI1A 1OD4A 2PPYA 2ZL4A 1XNYA 2C8TA 2X58A 4K29A 4JFCA 1NZYA 4JCQA 3ZWBA 4ASIA 3GLMA 2DEOA 5INGA 1MJ3A 2ZL3A 3OC7A 2HW5A 4IZDA 1J7XA 4Q1IA 2QQ3A 4OLQA 3QYRA 1XO6A 3T3WA 4B3IA 1TG6A 2PBPA 3G64A 2F9IB 2Q2XA 3H81A 5INFA 3ZW8A 4MOUA 3SLLA 4EMLA 2F9YA 3FDUA 1XNVA 1JXZA 1RJMA 2Q34A 4U0GH 3TZ3A 1W2XA 3RSIA 1EF9A 4ELSA 3T89A 4U1AA 3Q7HA 3L3SA 3KTHA 1WDLA 4EMMA 5DTWA 3GMAA 3TDCA 4KNPA 5IKLB 2X24A 1HNUA 4FB8A 5DU6A 4RYFA 4K3WA 3U9RB 2CE3A 4MXIA 4LK5A 4L8KA 2FW2A 2A7KA 1DUBA 3MYBA 2VX2A 5KJPA 1FC7A 3KTJA 2VSSE 1Q52A 4I4ZA 4JVTA 5DZKA 5C9GA 1N6FA 2F9IA 3V5IA 3TT7A 4ZDCA 3JU1A 4ZDFA 3RSTA 2J5II
chains in the Genus database with same CATH superfamily
5DUCA 2A7SA 1YG6A 4FZWA 2ZL0A 3QREA 3TVUA 4ZDBA 3LAOA 3QXZA 2WTBA 4ZU2A 1OD2A 4JYLA 4ZDDA 3TT6A 2YJGA 3H02A 3ADBA 1FC6A 3A4LA 3IBBA 4Q0GA 1XNWA 4F47A 3W8HB 3ST9A 3BPTA 5KDRB 5DU4A 4JSBA 4QIJA 2CBYA 5E0NX 3NJDA 4L6WA 3R9QA 1X0UA 1FC9A 5G1RA 2F6QA 3K50A 3ISAA 3L8IA 4U19A 2W3PA 3FF6A 3GKBA 4HNKA 3DJAA 4GM2A 3PE8A 3I47A 3TVWA 3HRXA 3HP0A 1Y64B 3KTGA 3P85A 3STAA 1UIYA 4NARA 3BPPA 3M6NA 1VRGA 1Q51A 3PEAA 4GEHB 3BEZA 1FCFA 4U0GA 5DKPA 3TRRA 1N6EA 1Y7OA 4U0HA 1DCIA 3ZWAA 5E0SH 3GF7A 2J5GA 2VSUF 3KTIA 3TLFA 3K8XA 2VSUA 3IB9A 4FZWC 3IAVA 4YLHA 5KDRA 4J2UA 4Z0MA 2J5IB 4I42A 3Q1TA 5DTPA 3V5EA 5CTCA 1UYVA 4G2RA 5HUQA 4ELXA 1EY3A 1K39A 1SZOA 3H0SA 4K2NA 3SWXA 4JCSA 2J5SA 1ON3A 2ZQRA 3VIVA 2PG8A 3H0JA 3HLN1 4KWBA 3KQFA 5C90A 5FIFA 2FZSA 5G1SA 4JWVA 3PGQA 3Q0JA 4I52A 3BF0A 3T88A 4EMPA 2ZL2A 3MT6A 3PZKA 3DORA 3OMEA 2UZFA 4WZ8B 4KD6A 2FBMA 1HZDA 4IZCA 3RQFA 1PJHA 3HINA 2J5IA 4JCRA 4FJWD 3T8BA 2VSUE 3QXIA 3QK8A 1WDMA 4JOTA 5JBWA 3R9SA 3N6RB 2EJ5A 4FNBA 4JJTA 2A81A 2VSUC 4OMRA 2IEXA 4FN8A 3LKEA 1K32A 2VSSF 3U9TB 2VSSA 3RRVA 5G1QA 4FNDA 3GF3A 1N6DA 4B3HA 3ADDA 2NP9A 4U18A 5INIA 3O4XE 1WDKA 3P2LA 4WCZA 3M6MA 4B3JA 3IRBA 1SG4A 3MFMA 5E0SA 1TYFA 2Q35A 4QIIA 2ZQQA 3AM1A 4RCNA 4KPKA 4ELWA 2J5GD 3HE2A 3QMJA 1ON9A 3QKAA 1EF8A 3Q0GA 2BZRA 5FUSA 2VREA 1UYTA 3H0UA 5CTBA 2F6IA 3TV5A 1RJNA 1NZYB 1O8UA 2P63A 4RYFH 4FN7A 1PIXA 4JYJA 4OG1A 3KTKA 5DUFA 3R0OA 4WYOB 1UYRA 2D3TA 4HC8A 3MOYA 3WG5A 5DL1A 3ZW9A 1XX4A 5DZKH 4NNQA 3QWDA 1WZ8A 3R6HA 5JBXA 3H0QA 3U9SB 4NEKA 3T8AA 1UX4A 1YG8A 4MI2A 3ZWCA 5MGBA 3OT6A 2F9YB 4QFEA 3R9TA 4GHNA 4ZDEA 3W8IB 1UYSA 4HDTA 4IZBA 3P5MA 2DUBA 4JCTA 3NJBA 5DU8A 1HNOA 2GTRA 4DI1A 1OD4A 2PPYA 2ZL4A 1XNYA 2C8TA 2X58A 4K29A 4JFCA 1NZYA 4JCQA 3ZWBA 1UX5A 4ASIA 3GLMA 2DEOA 5INGA 1MJ3A 2ZL3A 3OC7A 3RQGA 2HW5A 4IZDA 1J7XA 4Q1IA 2QQ3A 4OLQA 3QYRA 1XO6A 3T3WA 4B3IA 1TG6A 3A4MA 2PBPA 3G64A 2F9IB 2Q2XA 3H81A 5INFA 3ZW8A 4MOUA 3SLLA 4EMLA 2F9YA 3FDUA 1XNVA 1JXZA 1RJMA 2Q34A 4U0GH 3TZ3A 1W2XA 3RSIA 1EF9A 4ELSA 3T89A 4U1AA 3Q7HA 3L3SA 3KTHA 1WDLA 4EMMA 5DTWA 3GMAA 3TDCA 4KNPA 5IKLB 2X24A 1HNUA 4FB8A 5DU6A 4RYFA 4K3WA 3U9RB 2CE3A 4MXIA 4LK5A 4L8KA 2FW2A 3AJMA 2A7KA 1DUBA 3MYBA 2VX2A 5KJPA 1FC7A 3KTJA 3L8JA 2VSSE 1Q52A 4I4ZA 4JVTA 3ADCA 5DZKA 3RQEA 5C9GA 1N6FA 2F9IA 3V5IA 3TT7A 4ZDCA 3JU1A 3A4NA 4ZDFA 3RSTA 2J5II
chains in the Genus database with same CATH topology
5DUCA 2A7SA 1YG6A 4FZWA 2ZL0A 3QREA 3TVUA 4ZDBA 3LAOA 3QXZA 2WTBA 4ZU2A 1OD2A 4JYLA 4ZDDA 3TT6A 2YJGA 3H02A 1FC6A 3IBBA 4Q0GA 1XNWA 4F47A 3ST9A 3BPTA 5KDRB 5DU4A 4JSBA 4QIJA 2CBYA 5E0NX 3NJDA 4L6WA 3R9QA 1X0UA 1FC9A 5G1RA 2F6QA 3K50A 3ISAA 4U19A 2W3PA 3FF6A 3GKBA 4HNKA 3DJAA 4GM2A 3PE8A 3I47A 3TVWA 3HRXA 3HP0A 3KTGA 3P85A 3STAA 1UIYA 4NARA 3BPPA 3M6NA 1VRGA 1Q51A 3PEAA 3BEZA 1FCFA 4U0GA 5DKPA 3TRRA 1N6EA 1Y7OA 4U0HA 1DCIA 3ZWAA 5E0SH 3GF7A 2J5GA 2VSUF 3KTIA 3TLFA 3K8XA 2VSUA 3IB9A 4FZWC 3IAVA 4YLHA 5KDRA 4J2UA 4Z0MA 2J5IB 4I42A 3Q1TA 5DTPA 3V5EA 5CTCA 1UYVA 4G2RA 5HUQA 4ELXA 1EY3A 1K39A 1SZOA 3H0SA 4K2NA 3SWXA 4JCSA 2J5SA 1ON3A 2ZQRA 3VIVA 2PG8A 3H0JA 3HLN1 4KWBA 3KQFA 5C90A 5FIFA 2FZSA 5G1SA 4JWVA 3PGQA 3Q0JA 4I52A 3BF0A 3T88A 4EMPA 2ZL2A 3MT6A 3PZKA 3DORA 3OMEA 2UZFA 4WZ8B 4KD6A 2FBMA 1HZDA 4IZCA 1PJHA 3HINA 2J5IA 4JCRA 4FJWD 3T8BA 2VSUE 3QXIA 3QK8A 1WDMA 4JOTA 5JBWA 3R9SA 3N6RB 2EJ5A 4FNBA 4JJTA 2A81A 2VSUC 4OMRA 2IEXA 4FN8A 3LKEA 1K32A 2VSSF 3U9TB 2VSSA 3RRVA 5G1QA 4FNDA 3GF3A 1N6DA 4B3HA 2NP9A 4U18A 5INIA 1WDKA 3P2LA 4WCZA 3M6MA 4B3JA 1SG4A 3MFMA 5E0SA 1TYFA 2Q35A 4QIIA 2ZQQA 4RCNA 4KPKA 4ELWA 2J5GD 3HE2A 3QMJA 1ON9A 3QKAA 1EF8A 3Q0GA 2BZRA 5FUSA 2VREA 1UYTA 3H0UA 5CTBA 2F6IA 3TV5A 1RJNA 1NZYB 1O8UA 4RYFH 4FN7A 1PIXA 4JYJA 4OG1A 3KTKA 5DUFA 3R0OA 4WYOB 1UYRA 2D3TA 4HC8A 3MOYA 3WG5A 5DL1A 3ZW9A 1XX4A 5DZKH 4NNQA 3QWDA 1WZ8A 3R6HA 5JBXA 3H0QA 3U9SB 4NEKA 3T8AA 1YG8A 4MI2A 3ZWCA 5MGBA 3OT6A 2F9YB 4QFEA 3R9TA 4GHNA 4ZDEA 1UYSA 4HDTA 4IZBA 3P5MA 2DUBA 4JCTA 3NJBA 5DU8A 1HNOA 2GTRA 4DI1A 1OD4A 2PPYA 2ZL4A 1XNYA 2C8TA 2X58A 4K29A 4JFCA 1NZYA 4JCQA 3ZWBA 4ASIA 3GLMA 2DEOA 5INGA 1MJ3A 2ZL3A 3OC7A 2HW5A 4IZDA 1J7XA 4Q1IA 2QQ3A 4OLQA 3QYRA 1XO6A 3T3WA 4B3IA 1TG6A 2PBPA 3G64A 2F9IB 2Q2XA 3H81A 5INFA 3ZW8A 4MOUA 3SLLA 4EMLA 2F9YA 3FDUA 1XNVA 1JXZA 1RJMA 2Q34A 4U0GH 3TZ3A 1W2XA 3RSIA 1EF9A 4ELSA 3T89A 4U1AA 3Q7HA 3L3SA 3KTHA 1WDLA 4EMMA 5DTWA 3GMAA 3TDCA 4KNPA 5IKLB 2X24A 1HNUA 4FB8A 5DU6A 4RYFA 4K3WA 3U9RB 2CE3A 4MXIA 4LK5A 4L8KA 2FW2A 2A7KA 1DUBA 3MYBA 2VX2A 5KJPA 1FC7A 3KTJA 2VSSE 1Q52A 4I4ZA 4JVTA 5DZKA 5C9GA 1N6FA 2F9IA 3V5IA 3TT7A 4ZDCA 3JU1A 4ZDFA 3RSTA 2J5II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUC A;  2A7S A;  1YG6 A;  4FZW A;  2ZL0 A;  3QRE A;  3TVU A;  4ZDB A;  3LAO A;  3QXZ A;  2WTB A;  4ZU2 A;  1OD2 A;  4JYL A;  4ZDD A;  3TT6 A;  3H02 A;  1FC6 A;  3IBB A;  4Q0G A;  1XNW A;  4F47 A;  3ST9 A;  5KDR B;  5DU4 A;  4JSB A;  4QIJ A;  2CBY A;  5E0N X;  3NJD A;  4L6W A;  3R9Q A;  1X0U A;  1FC9 A;  5G1R A;  2F6Q A;  3K50 A;  3ISA A;  4U19 A;  2W3P A;  3FF6 A;  3GKB A;  4HNK A;  3DJA A;  4GM2 A;  3PE8 A;  3I47 A;  3TVW A;  3HRX A;  3HP0 A;  3KTG A;  3P85 A;  3STA A;  1UIY A;  3BPP A;  3M6N A;  1VRG A;  1Q51 A;  3PEA A;  3BEZ A;  1FCF A;  4U0G A;  5DKP A;  3TRR A;  1N6E A;  1Y7O A;  4U0H A;  1DCI A;  3ZWA A;  5E0S H;  3GF7 A;  2J5G A;  2VSU F;  3KTI A;  3TLF A;  3K8X A;  2VSU A;  3IB9 A;  4FZW C;  3IAV A;  4YLH A;  5KDR A;  4Z0M A;  2J5I B;  4I42 A;  3Q1T A;  5DTP A;  3V5E A;  5CTC A;  1UYV A;  4G2R A;  4ELX A;  1EY3 A;  1K39 A;  1SZO A;  3H0S A;  4K2N A;  3SWX A;  4JCS A;  2J5S A;  1ON3 A;  2ZQR A;  3VIV A;  2PG8 A;  3H0J A;  3HLN 1;  4KWB A;  3KQF A;  5C90 A;  5FIF A;  2FZS A;  5G1S A;  4JWV A;  3PGQ A;  3Q0J A;  4I52 A;  3BF0 A;  3T88 A;  4EMP A;  2ZL2 A;  3MT6 A;  3PZK A;  3DOR A;  3OME A;  2UZF A;  4WZ8 B;  4KD6 A;  2FBM A;  1HZD A;  4IZC A;  1PJH A;  3HIN A;  2J5I A;  4JCR A;  4FJW D;  3T8B A;  2VSU E;  3QXI A;  3QK8 A;  1WDM A;  4JOT A;  5JBW A;  3R9S A;  3N6R B;  2EJ5 A;  4FNB A;  4JJT A;  2A81 A;  2VSU C;  4OMR A;  2IEX A;  4FN8 A;  3LKE A;  1K32 A;  2VSS F;  3U9T B;  2VSS A;  3RRV A;  5G1Q A;  4FND A;  3GF3 A;  1N6D A;  4B3H A;  2NP9 A;  4U18 A;  5INI A;  1WDK A;  3P2L A;  4WCZ A;  3M6M A;  4B3J A;  1SG4 A;  3MFM A;  5E0S A;  1TYF A;  2Q35 A;  4QII A;  2ZQQ A;  4RCN A;  4KPK A;  4ELW A;  2J5G D;  3HE2 A;  3QMJ A;  1ON9 A;  3QKA A;  1EF8 A;  3Q0G A;  2BZR A;  5FUS A;  2VRE A;  1UYT A;  3H0U A;  5CTB A;  2F6I A;  3TV5 A;  1RJN A;  1NZY B;  1O8U A;  4RYF H;  4FN7 A;  1PIX A;  4JYJ A;  4OG1 A;  3KTK A;  5DUF A;  3R0O A;  4WYO B;  1UYR A;  2D3T A;  4HC8 A;  3MOY A;  3WG5 A;  5DL1 A;  3ZW9 A;  1XX4 A;  5DZK H;  4NNQ A;  3QWD A;  1WZ8 A;  3R6H A;  5JBX A;  3H0Q A;  3U9S B;  4NEK A;  3T8A A;  1YG8 A;  4MI2 A;  3ZWC A;  5MGB A;  3OT6 A;  2F9Y B;  4QFE A;  3R9T A;  4GHN A;  4ZDE A;  1UYS A;  4IZB A;  3P5M A;  2DUB A;  4JCT A;  3NJB A;  5DU8 A;  1HNO A;  2GTR A;  4DI1 A;  1OD4 A;  2PPY A;  2ZL4 A;  1XNY A;  2C8T A;  2X58 A;  4K29 A;  4JFC A;  1NZY A;  4JCQ A;  3ZWB A;  4ASI A;  3GLM A;  2DEO A;  5ING A;  1MJ3 A;  2ZL3 A;  3OC7 A;  2HW5 A;  4IZD A;  1J7X A;  4Q1I A;  2QQ3 A;  4OLQ A;  3QYR A;  1XO6 A;  3T3W A;  4B3I A;  1TG6 A;  2PBP A;  3G64 A;  2F9I B;  2Q2X A;  3H81 A;  5INF A;  3ZW8 A;  4MOU A;  3SLL A;  4EML A;  2F9Y A;  3FDU A;  1XNV A;  1JXZ A;  1RJM A;  2Q34 A;  4U0G H;  3TZ3 A;  1W2X A;  3RSI A;  1EF9 A;  4ELS A;  3T89 A;  4U1A A;  3Q7H A;  3L3S A;  3KTH A;  1WDL A;  4EMM A;  5DTW A;  3GMA A;  3TDC A;  4KNP A;  5IKL B;  2X24 A;  1HNU A;  4FB8 A;  5DU6 A;  4RYF A;  4K3W A;  3U9R B;  2CE3 A;  4MXI A;  4LK5 A;  4L8K A;  2FW2 A;  2A7K A;  1DUB A;  3MYB A;  2VX2 A;  5KJP A;  1FC7 A;  3KTJ A;  2VSS E;  1Q52 A;  4I4Z A;  4JVT A;  5DZK A;  5C9G A;  1N6F A;  2F9I A;  3V5I A;  3TT7 A;  4ZDC A;  3JU1 A;  4ZDF A;  3RST A;  2J5I I; 
#chains in the Genus database with same CATH topology
 5DUC A;  2A7S A;  1YG6 A;  4FZW A;  2ZL0 A;  3QRE A;  3TVU A;  4ZDB A;  3LAO A;  3QXZ A;  2WTB A;  4ZU2 A;  1OD2 A;  4JYL A;  4ZDD A;  3TT6 A;  2YJG A;  3H02 A;  3ADB A;  1FC6 A;  3A4L A;  3IBB A;  4Q0G A;  1XNW A;  4F47 A;  3W8H B;  3ST9 A;  3BPT A;  5KDR B;  5DU4 A;  4JSB A;  4QIJ A;  2CBY A;  5E0N X;  3NJD A;  4L6W A;  3R9Q A;  1X0U A;  1FC9 A;  5G1R A;  2F6Q A;  3K50 A;  3ISA A;  3L8I A;  4U19 A;  2W3P A;  3FF6 A;  3GKB A;  4HNK A;  3DJA A;  4GM2 A;  3PE8 A;  3I47 A;  3TVW A;  3HRX A;  3HP0 A;  1Y64 B;  3KTG A;  3P85 A;  3STA A;  1UIY A;  4NAR A;  3BPP A;  3M6N A;  1VRG A;  1Q51 A;  3PEA A;  4GEH B;  3BEZ A;  1FCF A;  4U0G A;  5DKP A;  3TRR A;  1N6E A;  1Y7O A;  4U0H A;  1DCI A;  3ZWA A;  5E0S H;  3GF7 A;  2J5G A;  2VSU F;  3KTI A;  3TLF A;  3K8X A;  2VSU A;  3IB9 A;  4FZW C;  3IAV A;  4YLH A;  5KDR A;  4J2U A;  4Z0M A;  2J5I B;  4I42 A;  3Q1T A;  5DTP A;  3V5E A;  5CTC A;  1UYV A;  4G2R A;  5HUQ A;  4ELX A;  1EY3 A;  1K39 A;  1SZO A;  3H0S A;  4K2N A;  3SWX A;  4JCS A;  2J5S A;  1ON3 A;  2ZQR A;  3VIV A;  2PG8 A;  3H0J A;  3HLN 1;  4KWB A;  3KQF A;  5C90 A;  5FIF A;  2FZS A;  5G1S A;  4JWV A;  3PGQ A;  3Q0J A;  4I52 A;  3BF0 A;  3T88 A;  4EMP A;  2ZL2 A;  3MT6 A;  3PZK A;  3DOR A;  3OME A;  2UZF A;  4WZ8 B;  4KD6 A;  2FBM A;  1HZD A;  4IZC A;  3RQF A;  1PJH A;  3HIN A;  2J5I A;  4JCR A;  4FJW D;  3T8B A;  2VSU E;  3QXI A;  3QK8 A;  1WDM A;  4JOT A;  5JBW A;  3R9S A;  3N6R B;  2EJ5 A;  4FNB A;  4JJT A;  2A81 A;  2VSU C;  4OMR A;  2IEX A;  4FN8 A;  3LKE A;  1K32 A;  2VSS F;  3U9T B;  2VSS A;  3RRV A;  5G1Q A;  4FND A;  3GF3 A;  1N6D A;  4B3H A;  3ADD A;  2NP9 A;  4U18 A;  5INI A;  3O4X E;  1WDK A;  3P2L A;  4WCZ A;  3M6M A;  4B3J A;  3IRB A;  1SG4 A;  3MFM A;  5E0S A;  1TYF A;  2Q35 A;  4QII A;  2ZQQ A;  3AM1 A;  4RCN A;  4KPK A;  4ELW A;  2J5G D;  3HE2 A;  3QMJ A;  1ON9 A;  3QKA A;  1EF8 A;  3Q0G A;  2BZR A;  5FUS A;  2VRE A;  1UYT A;  3H0U A;  5CTB A;  2F6I A;  3TV5 A;  1RJN A;  1NZY B;  1O8U A;  2P63 A;  4RYF H;  4FN7 A;  1PIX A;  4JYJ A;  4OG1 A;  3KTK A;  5DUF A;  3R0O A;  4WYO B;  1UYR A;  2D3T A;  4HC8 A;  3MOY A;  3WG5 A;  5DL1 A;  3ZW9 A;  1XX4 A;  5DZK H;  4NNQ A;  3QWD A;  1WZ8 A;  3R6H A;  5JBX A;  3H0Q A;  3U9S B;  4NEK A;  3T8A A;  1UX4 A;  1YG8 A;  4MI2 A;  3ZWC A;  5MGB A;  3OT6 A;  2F9Y B;  4QFE A;  3R9T A;  4GHN A;  4ZDE A;  3W8I B;  1UYS A;  4HDT A;  4IZB A;  3P5M A;  2DUB A;  4JCT A;  3NJB A;  5DU8 A;  1HNO A;  2GTR A;  4DI1 A;  1OD4 A;  2PPY A;  2ZL4 A;  1XNY A;  2C8T A;  2X58 A;  4K29 A;  4JFC A;  1NZY A;  4JCQ A;  3ZWB A;  1UX5 A;  4ASI A;  3GLM A;  2DEO A;  5ING A;  1MJ3 A;  2ZL3 A;  3OC7 A;  3RQG A;  2HW5 A;  4IZD A;  1J7X A;  4Q1I A;  2QQ3 A;  4OLQ A;  3QYR A;  1XO6 A;  3T3W A;  4B3I A;  1TG6 A;  3A4M A;  2PBP A;  3G64 A;  2F9I B;  2Q2X A;  3H81 A;  5INF A;  3ZW8 A;  4MOU A;  3SLL A;  4EML A;  2F9Y A;  3FDU A;  1XNV A;  1JXZ A;  1RJM A;  2Q34 A;  4U0G H;  3TZ3 A;  1W2X A;  3RSI A;  1EF9 A;  4ELS A;  3T89 A;  4U1A A;  3Q7H A;  3L3S A;  3KTH A;  1WDL A;  4EMM A;  5DTW A;  3GMA A;  3TDC A;  4KNP A;  5IKL B;  2X24 A;  1HNU A;  4FB8 A;  5DU6 A;  4RYF A;  4K3W A;  3U9R B;  2CE3 A;  4MXI A;  4LK5 A;  4L8K A;  2FW2 A;  3AJM A;  2A7K A;  1DUB A;  3MYB A;  2VX2 A;  5KJP A;  1FC7 A;  3KTJ A;  3L8J A;  2VSS E;  1Q52 A;  4I4Z A;  4JVT A;  3ADC A;  5DZK A;  3RQE A;  5C9G A;  1N6F A;  2F9I A;  3V5I A;  3TT7 A;  4ZDC A;  3JU1 A;  3A4N A;  4ZDF A;  3RST A;  2J5I I; 
#chains in the Genus database with same CATH homology
 5DUC A;  2A7S A;  1YG6 A;  4FZW A;  2ZL0 A;  3QRE A;  3TVU A;  4ZDB A;  3LAO A;  3QXZ A;  2WTB A;  4ZU2 A;  1OD2 A;  4JYL A;  4ZDD A;  3TT6 A;  2YJG A;  3H02 A;  1FC6 A;  3IBB A;  4Q0G A;  1XNW A;  4F47 A;  3ST9 A;  3BPT A;  5KDR B;  5DU4 A;  4JSB A;  4QIJ A;  2CBY A;  5E0N X;  3NJD A;  4L6W A;  3R9Q A;  1X0U A;  1FC9 A;  5G1R A;  2F6Q A;  3K50 A;  3ISA A;  4U19 A;  2W3P A;  3FF6 A;  3GKB A;  4HNK A;  3DJA A;  4GM2 A;  3PE8 A;  3I47 A;  3TVW A;  3HRX A;  3HP0 A;  3KTG A;  3P85 A;  3STA A;  1UIY A;  4NAR A;  3BPP A;  3M6N A;  1VRG A;  1Q51 A;  3PEA A;  3BEZ A;  1FCF A;  4U0G A;  5DKP A;  3TRR A;  1N6E A;  1Y7O A;  4U0H A;  1DCI A;  3ZWA A;  5E0S H;  3GF7 A;  2J5G A;  2VSU F;  3KTI A;  3TLF A;  3K8X A;  2VSU A;  3IB9 A;  4FZW C;  3IAV A;  4YLH A;  5KDR A;  4J2U A;  4Z0M A;  2J5I B;  4I42 A;  3Q1T A;  5DTP A;  3V5E A;  5CTC A;  1UYV A;  4G2R A;  5HUQ A;  4ELX A;  1EY3 A;  1K39 A;  1SZO A;  3H0S A;  4K2N A;  3SWX A;  4JCS A;  2J5S A;  1ON3 A;  2ZQR A;  3VIV A;  2PG8 A;  3H0J A;  3HLN 1;  4KWB A;  3KQF A;  5C90 A;  5FIF A;  2FZS A;  5G1S A;  4JWV A;  3PGQ A;  3Q0J A;  4I52 A;  3BF0 A;  3T88 A;  4EMP A;  2ZL2 A;  3MT6 A;  3PZK A;  3DOR A;  3OME A;  2UZF A;  4WZ8 B;  4KD6 A;  2FBM A;  1HZD A;  4IZC A;  1PJH A;  3HIN A;  2J5I A;  4JCR A;  4FJW D;  3T8B A;  2VSU E;  3QXI A;  3QK8 A;  1WDM A;  4JOT A;  5JBW A;  3R9S A;  3N6R B;  2EJ5 A;  4FNB A;  4JJT A;  2A81 A;  2VSU C;  4OMR A;  2IEX A;  4FN8 A;  3LKE A;  1K32 A;  2VSS F;  3U9T B;  2VSS A;  3RRV A;  5G1Q A;  4FND A;  3GF3 A;  1N6D A;  4B3H A;  2NP9 A;  4U18 A;  5INI A;  1WDK A;  3P2L A;  4WCZ A;  3M6M A;  4B3J A;  1SG4 A;  3MFM A;  5E0S A;  1TYF A;  2Q35 A;  4QII A;  2ZQQ A;  4RCN A;  4KPK A;  4ELW A;  2J5G D;  3HE2 A;  3QMJ A;  1ON9 A;  3QKA A;  1EF8 A;  3Q0G A;  2BZR A;  5FUS A;  2VRE A;  1UYT A;  3H0U A;  5CTB A;  2F6I A;  3TV5 A;  1RJN A;  1NZY B;  1O8U A;  4RYF H;  4FN7 A;  1PIX A;  4JYJ A;  4OG1 A;  3KTK A;  5DUF A;  3R0O A;  4WYO B;  1UYR A;  2D3T A;  4HC8 A;  3MOY A;  3WG5 A;  5DL1 A;  3ZW9 A;  1XX4 A;  5DZK H;  4NNQ A;  3QWD A;  1WZ8 A;  3R6H A;  5JBX A;  3H0Q A;  3U9S B;  4NEK A;  3T8A A;  1YG8 A;  4MI2 A;  3ZWC A;  5MGB A;  3OT6 A;  2F9Y B;  4QFE A;  3R9T A;  4GHN A;  4ZDE A;  1UYS A;  4HDT A;  4IZB A;  3P5M A;  2DUB A;  4JCT A;  3NJB A;  5DU8 A;  1HNO A;  2GTR A;  4DI1 A;  1OD4 A;  2PPY A;  2ZL4 A;  1XNY A;  2C8T A;  2X58 A;  4K29 A;  4JFC A;  1NZY A;  4JCQ A;  3ZWB A;  4ASI A;  3GLM A;  2DEO A;  5ING A;  1MJ3 A;  2ZL3 A;  3OC7 A;  2HW5 A;  4IZD A;  1J7X A;  4Q1I A;  2QQ3 A;  4OLQ A;  3QYR A;  1XO6 A;  3T3W A;  4B3I A;  1TG6 A;  2PBP A;  3G64 A;  2F9I B;  2Q2X A;  3H81 A;  5INF A;  3ZW8 A;  4MOU A;  3SLL A;  4EML A;  2F9Y A;  3FDU A;  1XNV A;  1JXZ A;  1RJM A;  2Q34 A;  4U0G H;  3TZ3 A;  1W2X A;  3RSI A;  1EF9 A;  4ELS A;  3T89 A;  4U1A A;  3Q7H A;  3L3S A;  3KTH A;  1WDL A;  4EMM A;  5DTW A;  3GMA A;  3TDC A;  4KNP A;  5IKL B;  2X24 A;  1HNU A;  4FB8 A;  5DU6 A;  4RYF A;  4K3W A;  3U9R B;  2CE3 A;  4MXI A;  4LK5 A;  4L8K A;  2FW2 A;  2A7K A;  1DUB A;  3MYB A;  2VX2 A;  5KJP A;  1FC7 A;  3KTJ A;  2VSS E;  1Q52 A;  4I4Z A;  4JVT A;  5DZK A;  5C9G A;  1N6F A;  2F9I A;  3V5I A;  3TT7 A;  4ZDC A;  3JU1 A;  4ZDF A;  3RST A;  2J5I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...