1DUIA

Subtilisin bpn' from bacillus amyloliquefaciens, crystal growth mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
AKCVSYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSICSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGNSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUBTILISIN BPN')
publication title Probing Protein Interaction Chemistry Through Crystal Growth: Structure, Mutation, and Mechanism in Subtilisin s88
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 97
structure length 266
sequence length 266
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1duiA00
1MEEA 1AF4A 3AJ9A 1WMEA 3H42B 2IXTA 1WSDA 5AVJA 4GI3A 1A2QA 3OSZA 1DUIA 2WUWE 3UNXA 2ZWOA 2PWAA 4CFZA 1NDUA 2SICE 1EGQA 4H6WA 5JXIA 2DUJA 2SNIE 1TM4E 3EDYA 4NMXB 1OYVA 1IC6A 1YJAA 4JP8A 1AH2A 1TECE 1BE8A 3DWEX 5CW1A 3VYVA 5I9SA 3PTLA 3ZXYA 3DW3X 1S01A 3DE2X 1Y9ZA 1NLUA 4OMCA 1OYOA 5JMOA 4OV6B 5B1DA 2GKOA 1AQNA 3D9QX 2ZRQA 1THMA 1HT3A 3I2YX 3I34X 1CNMA 4CFYA 3QTLA 1ST2A 4Z2AA 1XF1A 2XTJA 2PRKA 3DW1X 2HD4A 1SCNE 1YU6A 4C3VA 1VSBA 1WVMA 1GCIA 2Z58A 4WOCA 3TI9A 3DE7X 4DWWA 2XRMA 3A3OA 1GA4A 1T1IA 3CO0S 4I0WB 2WV7A 2Z56A 4C3UA 1AVTA 1WMFA 1BE6A 5ARCA 1ZVKA 1Y3CE 1GTG1 1C9JA 2P4EA 1BFUA 2W2OA 3Q5GA 1TM5E 1NDQA 3LXUX 2Z57A 5K7SA 1SIUA 3DE4X 2G4VA 1SN7A 3VV2A 4RYDA 1TMGE 3I30X 3HJRA 4WOBA 4HX2A 5ARDA 1Q5PA 1SPBS 1Y4DE 3A3PA 1GTJ1 1SCDA 4MZDA 3AJ8A 1PJ8A 3WIUA 3EE6A 3I37X 3D43A 4LVOA 2W2NA 1UBNA 1SUPA 2PKCA 2DQKA 1C9MA 4ZOQI 1P7WA 1R0RE 1Y3BE 5AMXA 2QTWB 1TM7E 1Y3FE 3VSBA 4DZTA 1BH6A 2Z2YA 1SBTA 5FFNA 2PWBA 2ZWPA 1LW6E 2Z30A 3WHIA 1OT5A 4HVLA 4B5LA 1AU9A 1SVNA 1V5IA 1MPTA 1TM3E 2V8BA 1KE2A 1KE1A 4FONA 2WWTA 4H6XA 4H6VA 2ID8A 2ID4A 2W2MA 1SELA 2Z2XA 3GT4A 1GNSA 4KPGA 1T1EA 1SUCA 1TO1E 1CSEE 3F7MA 3DVSX 1SUDA 1TO2E 2PMWB 1GNVA 1SBHA 3TECE 1SUAA 1P8JA 1KDZA 1S2NA 2W2PA 4LVNA 1SUBA 2SBTA 2X8JB 1PFGA 1SCJA 1IAVA 3WQBA 3PRKE 1SBCA 5B1EA 1GTL1 1R64A 3GT3A 3LPCA 3CNQS 5AVKA 1C3LA 3DE1X 2W2QA 1EA7A 4K8RB 3LPAA 3BPSA 2B6NA 2SECE 2PQ2A 1BFKA 1SCBA 2E1PA 4CG0A 1YJBA 1WMDA 3DYBA 1Y1KE 3GCWA 3SQOA 3A3NA 1AV7A 3VV3A 4J94A 3BGOS 1KDYA 1Y48E 1PEKE 1Y34E 3DVRX 2X8JA 1SUEA 3P5BA 1GA1A 1SCAA 1PTKA 3QMPA 1Y4AE 3BX1A 5JXHA 1T1GA 1V6CA 2IY9A 3Q40A 1C9NA 1Y33E 4KG7A 5FAXA 1GA6A 3T41A 3TI7A 4KB5A 4OMDA 1Y3DE 3AFGA 5JXJA 5ARBA 1DBIA 1ST3A 3VTAA 3F49S 3DE5X 2WUVA 1S02A 3DDZX 3DE3X 1TK2A 2Z2ZA 4AKTA 1SH7A 1BJRE 5FBZA 4NE7A 3LPDA 1P7VA 4ZARA 4DJ5X 1SIBE 1SIOA 4YN3A 3ZXXA 1YJCA 3GCXA 3DVQX 3WIVA 1SBIA 3DE6X 1R6VA 2ST1A 3SICE 4BWGA 4NE9A 3L1KA 2TECE 1JEAA 3QFHA 5AQEA 2DP4E 1ZVJA 5JXGA 2PYZA 1AK9A 1GT91 2HPZA 1TM1E 3DE0X 1KDVA 5SICE 4AKSA 3F7OA 1SBNE 3VHQA 4M1ZA 3EIFA
chains in the Genus database with same CATH superfamily
1DJOA 1IFXA 1MEEA 3OQBA 4Q9KA 2D00A 2FHPA 2VXCA 5K3OA 2RGRA 2XGGA 1OFUX 3EMDA 3EWAA 2CJWB 3O38A 3PTZA 1VPWA 1DSSG 3IO5A 1CUFA 1E3WA 3ZIDA 3LUJA 4KR3A 3BK1A 3W78A 4EMUA 4QYIA 4H18A 4UULA 1NKVA 3ILVA 5BQ5A 5LD2B 1F4VA 2JFZA 5AVJA 2FXIA 2VUHB 4GI7A 5BYJA 1JJ7A 3P27A 5LUBA 1NKTA 3ENKA 4AD8A 4YT2A 1T1JA 3KZXA 3OSZA 4KZPA 5SV2A 2PKQP 1P7PA 2OV4A 4KBYA 3QF4A 4Q9AA 3SPXA 2JI4A 1H0HA 5E2IA 1XVVA 4U1RA 4DR5B 4CWAA 3DFIA 4MVJE 3W5IA 3HDYA 5DN6A 3BEDA 1TADA 2OD7A 4HRAA 3L6OO 5F3WB 1OFTA 1T36B 4HXGA 3RVOA 1NX6A 2QMHA 4G0VA 3RU2A 4PC7A 3UEOA 2CVZA 1M2OA 2P9CA 4EVQA 4JBXA 2OYRA 2NU9A 3J81k 1G64A 2XXAA 1IY8A 1QCDA 5I4IA 5C8YB 4ROTA 3NHLA 4L85A 3MJDA 4AUNA 2HPHA 1MC4A 4G0PA 4PLHA 2PAAA 3F2VA 3MTBA 4NPCA 3TTVA 4ARSA 4DCJA 5C8ZA 2SNIE 4G89A 1Z7EA 4H0NA 2WF8A 4JI4B 2Q3CA 3E18A 3GMIA 3PEVA 4RFSA 1ZWLA 4WNYA 5B57C 2JBHA 4HDKA 4PGAA 2WKWA 1GSAA 1JKFA 3OEHA 4MQFA 1Z12A 1UDBA 2GCEA 2JL1A 3ELWA 4LI3X 4Z4QA 2C3UA 4QRDA 1VZ3A 2OHJA 1QX4A 1GG5A 2Q5FA 4N7RA 5MGBA 3RS4A 1AH2A 1VL8A 3C14C 4EKEA 2TMKA 2I4RA 2YXNA 3E15A 3ZWDA 4ZDIA 4A2CA 5MFZA 4HGNA 5GM1A 1N2CE 2H57A 2PBFA 4BFUA 1AG9A 4YP7A 3A1CA 2XQJA 3OAAD 5BSRA 5KYUB 1IONA 5EHGA 3Q3JB 3N7AA 1NFRA 3TSZA 3GP8A 1UBGA 3NV7A 4U2EA 1Q0SA 1WW3A 4DMHA 3DEHA 3HVIA 3SX2A 3T7KA 1UKAA 4NXMB 4MS4A 4DHEA 2FVXA 2R25B 4B8WA 3AVWA 1SKUA 3DS8A 4BWVA 2GRUA 1E4EB 1UK6A 2JHFA 2Z5GA 1QQBA 2ZB8A 1FVHA 1W9HA 4ALNA 3WBBA 1F60A 1G8JA 3ROEA 4EHHA 1POXA 3DE2X 3K9NA 5J63A 4XKJA 1E32A 2I5PO 3NRBA 2H52A 1K63A 1ZGJA 2PMFA 3AJAA 2IZ7A 5H9VA 2HBRA 3A1SA 3K4PA 5JDCA 4I8DA 1OA0A 2V58A 2NU6A 2YS6A 2X4IA 3HKBB 4UTRA 4FMBB 3NKVA 1L2TA 1Z6GA 3EVNA 2O2XA 5FO0A 1IK4A 4C7XA 5HRUA 4MNTA 1UPXA 4JB3A 3RSGA 5JMWA 4GYWA 3FPSA 1U65A 3BXHA 3AUJB 5C3MA 4LJ5A 5FBQB 3I34X 5ERGB 4UEWA 3EVAA 3DAPA 1V4VA 4ND4A 5BRNA 2HCFA 4R1NA 2IEIA 1CNMA 1W6UA 3F0TA 5BXQC 2B4AA 4IX9A 4GX2A 4XUEA 4UUBA 5EWJB 4NFHA 4BZWA 1BOOA 3QVGB 4KFRA 2VQSA 3EZ9A 3QLUC 5AOBA 4M0EA 2QZJA 3X1XA 5CB4F 1KEVA 3RC9A 2PRKA 2QZPA 4Q4JB 4FDLA 1SZDA 1N9GB 2DSTA 3FTCA 4A0HA 2C04A 1K0FA 2NZ2A 5JG7A 2IXGA 5E4FA 1BDBA 3RC2A 1PJAA 2HUNA 1R6AA 1NR1A 2I4IA 5JNUA 5KSWB 5LYYA 2PH7A 1IZ7A 3QE9Y 1PR4A 2PA3A 4OGWA 1MW9X 5TEWA 1V16A 2G9UA 3CR8A 5FWNA 2ZTMA 3INYA 2NO4A 4DTCA 1ONOA 2NX2A 4N6OA 3TGPA 3PGVA 1TFRA 3R8FA 1XKQA 4J2HA 1SCQA 3MWYW 1ZKMA 4ZZ3A 1MNQA 1GTSA 1JB9A 2PCLA 1VCOA 4F2GA 4N39A 3OF5A 3E9NA 2NLOA 2VS1A 3D6HA 3MWDA 2XZTA 3VDMA 1FYWA 3GLGB 2BUBA 3G2IA 3WK4A 2HSJA 3CO0S 3UZUA 4B8YA 4UCQA 3G88A 4MQ6A 5CB6A 1KS9A 1DGQA 4XLLA 4QDKA 2R84A 5BSHA 3ZW9A 3IPCA 3CX4A 1GTG1 3ASZA 3TFQA 2WAYA 1K3TA 1SVMA 5H1YA 4JK3A 3Q5GA 1J24A 4G5YA 3DBHA 5AK0A 5L8VA 1TLFA 2NP6A 2QVLA 5B64A 4PZZA 2ZB7A 4L27A 3PDCA 3AYXB 3FHLA 3CMCO 4BUCA 4NEGA 2ZCJA 1AF7A 4FOLA 2I55A 5EKDA 5AVQA 4AF7A 1J0AA 3S2FA 4WESA 4E5KA 1RYHA 4AO8A 4P1ZA 4WLNA 1RAEA 2QE7D 5AOAA 1SY7A 2ABWA 5AKJA 2VSNA 1IHUA 4I50F 1ZN9A 4WT7A 5A5VA 1JEYB 2G9ZA 2BTQB 1DFIA 4GMFA 4JEUA 4K1XA 4RYLA 1DG1G 3WKEA 4WOBA 4HX2A 3QG1A 4P84A 2A1TS 2WSMA 4LF4B 4NS4A 3Q2IA 1C3XA 3DUFB 5AH0A 3U7HB 4AG5A 4HZUA 3E3MA 2IP2A 1C0KA 1E6MA 2RAUA 3IEKA 2XKAA 2YFQA 5BWLA 4NU6A 3HXPA 4IICA 1LFAA 1QE5A 1WEKA 3CZ5A 4TTSA 2J6CA 5CT9A 1W87A 4JLKA 3HY4A 4UNRA 5D7BA 4MGHA 4BVGA 3PIRA 1OVGA 4I4LA 4UREA 1E1CA 1X7ZB 1XQ6A 2Q6TA 3R0XA 5TDHA 4BGVA 2GZSA 5JAOA 2ODEA 4G63A 3AP1A 3IV6A 4P4SB 5COAA 3IP9A 1CYDA 2X0DA 1L5OA 2C8VA 1GR0A 1Z06A 2HN9A 1LNZA 4IFIA 2DFPA 2ZWMA 3B2QA 4YRPA 3IXLA 1KC3A 3CZAA 2BMJA 3TRFA 3OD1A 4K9LA 5KTPA 3F73A 2AQKA 2Q6VA 1OBFO 2XKBA 3UY4A 3IQXA 3OFVA 1W36C 3MXTA 2R7AA 5AKKA 1YDFA 3AIKA 2DULA 3MRTA 3RJ9A 3RM3A 4HFNA 4M0DA 1H8ED 3JQDA 4HH3C 4D3XA 1TQ6A 3SZ3A 1DMRA 2WJGA 3CH6A 3PFGA 1TM7E 2XNDD 2ZK7A 1MA3A 4L8GA 4Y6QA 3PR3A 5G40A 4NJMA 1TJ4A 1XXLA 2X23A 4QU9A 1V71A 1BROA 4CKXA 3MD9A 4YUAA 4DILA 3CPSA 1VYUA 1WXHA 5TQ2A 4DREA 5KTYA 4O4IA 10MHA 1PI3A 1U6KA 5EJ8A 5FNVA 4EFDA 1RCFA 3LYLA 4RMNA 4M83A 4R8MA 1B41A 1U2SA 4RIGA 1BIFA 1EUDB 5C4MA 4MV0A 3ZDEA 1VRCA 3WP1B 1E7QA 1VL1A 5C5DA 1KEPA 3JX9A 1L4YA 3AP2A 3SJZA 2AMYA 5BVGB 2G36A 2I3GA 4FWIB 3T54A 3ZD7A 4IH9A 2E49A 4TKUA 3W9SA 4EI7A 5ENDA 2YRWA 3DPIA 1RYZA 1NUUA 5EYPA 3WGOA 4C7OA 2IYXA 3RWMB 3DAOA 1T5BA 4IUYA 1WHTA 3DO5A 4EB3A 3GFBA 3BCRA 3M9XA 4D3FA 4KL8S 1X7XA 5IFKA 4DR4B 1N7JA 1UIMA 2ZR8A 3K8OE 2OP1A 1D9XA 2NZYA 5HOQA 1M2FA 2FZ4A 1C8BA 4G9GA 4C01A 3O9ZA 4ZP1A 4GZ5A 1SXPA 1SNYA 2I78A 2LXNA 2EV9A 2Y9PB 4RHFA 1QTQA 3OWHA 2Q28A 4TROA 5GTDA 1BCSA 1OXKB 3ZD9A 3DEIA 3AESB 3K0SA 3B1JA 3B3AA 4N7JA 3DB1A 4OJMX 2FVYA 4TSFA 1K6MA 5HJ5A 1IQUA 4H6VA 1F51E 3ZWNA 3S8MA 4XQCA 1PWXA 4FX5A 3N74A 3PL1A 3L6EA 1P1IA 4CUKA 2QG4A 1NQTA 3H2JA 1YU9A 3ABIA 3KUDA 4G5RA 4QYIB 3GGCA 3RU3A 3SC2A 2Z2XA 4GZ3A 1L4LA 3T9DA 2WBLC 4FZRA 4MCHA 5EVJA 1QJCA 4WRRA 5ALOA 1R9MA 3OKCA 1IPHA 4CG3A 3S2SA 1U8XX 2BP7A 2ODTX 5GV8A 2BY4A 1KKLA 3CH5A 3NBXX 1GAEO 2HSEA 4HNQA 2H16A 2QIOA 4P86A 5BYAA 1HE1C 3U39A 1CSEE 4MJLA 3JQFA 4EIWA 5HRAA 3AJEA 4C4ZA 4DCTA 1R5NA 2WA1A 1Z5OA 2WU1A 3PGA1 5KS2A 4MQ5A 1RJDA 2YWDA 1G5QA 2O23A 2CXRA 2LPMA 3BE8A 2P35A 4ZANA 1K6XA 3WDSA 1OU0A 1U8EA 5A4IS 5JC1A 1P81A 5CEEA 2F55A 2XXAB 4JHXA 3D3EA 2XJ9A 3LXMA 4U3JA 4Z4FA 5T3UA 3CVOA 2FFJA 1SOAA 4L4ZA 5FNZA 5G4LA 2VN8A 2DQSA 1EAMA 4HDCA 5EIOA 2OG2A 2JCBA 1KYZA 1MX5A 2WHEA 3GDHA 4I08A 2R1VA 4Q16A 5F2NA 5AFSA 4RFSB 3D3QA 1HTWA 2GCNA 4QTZA 3BWVA 1PD0A 4MQFB 1SBZA 5FWAA 5TGDA 5HQJA 2NVWA 2B92A 3TQIA 1CE8B 3PLRA 4FFWA 4I46A 5FI3A 1NXOA 1S7GA 3HKCA 5JMTA 4DCNA 1M6HA 1E4VA 5DCUA 3OU2A 2XCQA 4BGIA 1C3LA 4RQBA 3DE1X 1E79A 2FZCA 5D2CA 3AKCA 2AR7A 2QVXX 4MV7A 1K8QA 1US8A 4H7FA 1VMDA 4AJ9A 2ZRKA 1D4FA 1V47A 3KJZA 4RD0A 3VX4A 2MSNA 3TX2A 1O8CA 5KYKA 3IKMB 2PEYA 3K73O 4C06A 2VDNB 1WSBA 1QX3A 3E3AA 5L45A 4QJBA 1R8SA 4MS4B 1ZUIA 2YH2A 2VAPA 3IFSA 1GARA 2CNBA 2W37A 5A04A 1E3TA 1KOFA 1N8NA 3HMQA 3PQ5A 4IV8A 3RFFA 3U7EB 3DYBA 4ZJZA 5EJ6A 1KJ8A 4RHUA 4XIJA 3VYTB 4CKCA 2EDCA 3CVWA 3HYTA 3I92A 1CR1A 2B20A 1QIMA 3SR0A 2GTHA 4XX0B 2A5LA 2VSYA 4DIOA 1KRXA 1PJZA 4MRRA 2GFHA 5ALEA 3H17A 4QXRA 1EJ0A 1HG0A 2CLHB 3HB9A 4D56A 4R83A 1H1DA 2J3EA 2LCFA 1CP2A 1GILA 2PRIA 4REQA 1JG6A 4DLTA 2MWMA 3N8HA 5CBPA 1CJKC 4W5TA 2CW5A 5DNDA 4NICA 1F1JA 2D7JA 3GFSA 1BCRA 5DDIP 4MI1A 1ECBA 1OX6A 1YQUA 2AMLA 4BQOA 5IBQA 2FJ0A 3LWNA 5F4ZA 1DX6A 4RPCA 2VJKA 5AUPB 5KOIA 2PFSA 5A4KA 2MSWA 3QMPA 5BUZA 3P9XA 2F2TA 2DWQA 1FSZA 1RHMA 4LZAA 1NLFA 2OO3A 2REQA 3FFAA 2Y77A 3AIMA 3BWXA 2QTCA 2X19A 4E5DA 4BKQA 3R5HA 1UXIA 1JEEA 1UBLS 2OAGA 4R84A 5FYDA 1BN7A 4JR1A 1V16B 5CDFA 4DKXA 1WU8A 3U16A 1FFDA 3QEKA 1A7UA 3DXZA 4QRIA 5KNDA 4P6VF 4Y9DA 1O6CA 4HLUC 1XLVA 2HR1A 4RLHA 4ZQFA 1CLUA 3M4JA 1JFVA 1DTWB 1GPAA 1VJCA 2HDOA 2NW6A 3BMCA 3ZCXA 5KYGA 2O8FB 1FLVA 3I52A 1TMOA 2PUVA 4KV7A 4F5YA 4Z86A 3KSBC 3AR2A 3WHPA 4RMJA 4QUBA 1O94C 4EHIA 4YRMA 1OBVA 1WZCA 4BGEA 1GV0A 3BZBA 4R71A 2OPBA 3C5HA 4A0FA 2AA3A 2A1TR 5ED0A 2R68A 5I7WA 5M3BA 4FEGA 3V8VA 3K9WA 2O8EA 1TU0A 2IEDA 4PG4A 5KTNA 1N1EA 3HI6A 2X3UA 5L3ZA 1Q3KA 1N2SA 3E03A 2GR9A 1CZKA 1P1FA 2BFOA 2YXEA 4DJ5X 2I91A 4ZD6A 3KBBA 4WESB 3E23A 5ICCA 3O31A 1Z2CA 3TSAA 4NBKA 3I5UA 3JASA 3PJDA 4RKRA 3WSVA 2GEVA 3SF0A 5CYOA 1I0ZA 5THKA 4BKUA 2ZLBA 1JR3A 2ARKA 1FJGB 1FFXA 1X14A 3SICE 4JI5B 4W7IA 5AW9A 2F4NA 4J91A 3DTVB 4X97A 2A86A 1Z4LA 2RCNA 3Q9NA 5AKHA 2QQGA 1N9ZA 1RC0A 4M22A 5ED4A 5F21A 3D4NA 4IDCA 4G41A 3QVWA 5JVDF 2Q9CA 4E5UA 3RBVA 3RHTA 2BHTA 5CM9C 1XALA 2A5GA 4IMRA 1STOA 4M89A 1S3SA 4Q3EA 1DAIA 1G0OA 4NZPA 4X3CA 3U7JA 4C4YA 1JPJA 1XCGB 3PVSA 3ZDAA 4YONB 1U7DA 4N5HX 2C5FA 3IOBA 2W11A 3OIVA 1EEXB 2FLKA 3K1YA 5HNKA 1EVJA 3DE0X 3WK8A 3PPXA 3Q1LA 4ITUA 4RMIA 1JLHA 3VU8A 1V6AA 4CLRB 4QO7A 2V7UA 2V5AA 3VXKA 2BEVB 2XMRA 3D6UA 4AICA 4ZK2A 4CHGA 5LP6B 4AN4A 5EIXA 4PX9A 4F8YA 4O29A 1AF4A 3IP7A 1N33B 4A5OA 3L7AA 3TCXB 3P0RA 5E4JA 1T0IA 3BQ9A 3IV9A 3STXA 5AUOB 1A9XB 2XZOA 3PNSA 3FX2A 3A3YA 3FOFC 2G0NA 2V1UA 4MTLA 3CU5A 2IYVA 2C99A 3F5SA 2ZSFA 4UDYX 4AKHA 2Q8NA 1OFVA 1K7SN 1PTJA 4H4DA 5BN1A 2B2CA 1NW8A 4X8MA 2B2NA 3NB0A 3EIXA 4YDHB 1O5TA 2DPLA 2AXQA 1A76A 1OVMA 5C8YF 4O4IB 1R18A 3I4LA 5F51A 5EIBD 3FWNA 2P6OA 5FNVB 3K9QO 3DMTC 4V02A 4YRKA 1EX7A 4F12A 4IYJA 5ICSA 4XFJA 3FF1A 1GGVA 2FWBA 5EJMA 3UKJA 4BB9A 3N7TA 4Y18A 2XOKD 1U90A 2ZJ6A 5EIHA 3EHEA 1BD3A 5EYPB 4AS3A 2ZBEA 2H29A 1RYYA 4HOYA 5IUKC 2ATVA 3ZOZA 1HFKA 4N0PA 5IM4A 2R8EA 1JWLA 1P61B 3VO8A 2BDUA 1XMQB 5SZJA 4IVNA 3BJRA 1FMTA 1X7XB 4DUPA 4F9TA 4F4HA 4UTNA 1OFGA 4AB1A 621PA 1HDEA 4TVSA 1HV8A 1YK0A 2XWJI 3H8JA 4O8ZA 2B4YA 3S1LA 1RCTE 2J6HA 3DP7A 3MGGA 3OPVA 2E89A 4I1UA 3ADCA 3L8DA 1CXZA 4LZWA 5IDYA 1FRVA 3BQNB 3MQFA 4KH0A 4JUBA 3K7EA 5DLEA 1YZQA 3IMCA 3Q85A 3RVNA 5BMOA 1HORA 1I2DA 1L9XA 2GWHA 3P9PA 1KQPA 1SVOA 4G37A 5ALTA 3WWYA 1U8AA 1ZM3A 1XZMA 3H2SA 3U81A 1XTKA 1ZJ5A 4HGQA 4PTLA 2A57A 2CNLA 2ZVDA 1E5LA 4NNJA 2GN0A 1NIJA 2Z3VA 3ZXSA 5KVQA 3SC2B 5A05A 4JELA 4D02A 2R97A 3JYLA 5BPFA 1NW6A 2I8LA 1BYUA 5IBCA 2VJBA 4WFJA 2PYIA 3TQCA 4DKJA 1LU9A 3BFKA 1CFZA 2A9QA 4O25A 4F2DA 3C6MA 3JQCA 2GAFA 4TZ0A 2CD7A 4TWRA 3IAEA 4OLHA 1CCWA 4OQFA 2XVZA 3IQIX 3K9BA 4HFMA 4IIDA 2BCJQ 1QJ4A 1SC6A 2WSLA 1RC8A 3WKCA 1UOEA 1H1LB 4HB3A 2CFRA 1IULA 3A4IA 3BVPA 2ATIA 2P3LA 3WOVA 5KNLA 1TVKB 3RJZA 2PSDA 2OCIA 3T1YB 1YUMA 4KC0A 4U3JB 4F71A 2GM9A 4KXVA 5FQOA 4DV7B 3DJYA 3STTA 3EEIA 2RH4A 2GBPA 2J7KA 1NWCA 1CIJA 4O2LA 3ABRB 1XQWA 5AHRA 2E4VA 1XVTA 4XGQA 5JQGB 4HB0A 3C3BA 4JEHA 4KGZA 2VT2A 4H0FA 3F6RA 2X8WA 3OQOA 3OZAA 1E1QD 5TB5A 5T4BA 3RRBA 4JLVA 2DY0A 3VNVA 4MR8B 4EYGA 3QU2A 3HKCB 1JPUA 2OO7A 2N0SA 4P7FA 5MN4A 4O4JA 3L43A 1DAPA 5BWMA 1IIRA 3IMKA 3FG9A 1YU6A 3FPJA 3LDHA 2FMHA 3IP8A 3QWIA 4IG4A 2EL9A 2Y3IA 3PX2A 4Z5XA 2QMUA 1Q3TA 3BMOA 3VC1A 4N0QA 3ZVKA 1U9ZA 2OUIA 1XD8A 2HGSA 3GELA 4V0MA 3WBJA 5BNWA 2X41A 1LEHA 1YB1A 5EZYA 1E5VA 3FRIA 3GMSA 3I9OA 4J07A 2DXIA 3IEVA 5CDFE 2O1WA 3VSDA 1QORA 4RKYA 4DCCA 3SDSA 2BHSA 3DC7A 4FXOA 4LS3A 4ZAFA 4TRRA 2C3MA 4JLDA 2C61A 2CYCA 2VBGA 2EBUA 4ZOCA 5H80A 3ZU5A 1FU4A 3GT0A 2H85A 2DJIA 2XYGA 4L5CA 4FKZA 2V3CC 3BBPA 5I9IA 4YV2A 3TNJA 1U2QA 2Y1FA 3DFUA 5HRCA 1SOUA 2YMLA 1FTSA 3KOMA 1Z8FA 2OBXA 2PA0A 5CG1A 5IVDA 2FR8A 2GHTA 4J03A 3LP5A 1N8TA 1PAUA 4ILEA 5HYVA 1F8FA 1EM6A 3LCCA 4FEYA 4KYVA 2CLKB 3PENA 4D6PA 2IC5A 3MTAA 1H2BA 4MEBA 5ARCA 4KDFA 4LUCA 4BEVA 2AK3A 3Q72A 4H59A 2PUBA 2QTFA 3WYGA 1XZBA 3DOEA 2CFCA 1G8FA 4LSZA 4REQB 3UAXA 2PS1A 1I3MA 2BZ1A 5AIBA 1E66A 2FLWA 5EZ5A 1NVWQ 2EKZA 3WRWA 1DJLA 2WPDD 1K8XB 1SEPA 3D8SA 3G7NA 2VJPA 2X0EA 4QQKA 4JC5A 4BAGA 1FP2A 3OPQA 1XP5A 2J5XA 2X0KA 4GH5A 4LMPA 3LUAA 1I4DD 4TQGA 3E22B 1GYQA 3RREA 2IKSA 3MZ0A 3BKWA 1R6XA 1DPFA 1MT3A 1W34A 3CX8A 2DLDA 4GI2A 1YMUA 1EBFA 4NOKA 5C31A 2REQB 5DM0A 3ZXIA 5JAQA 3F5DA 1Q5PA 1JR3E 2Z08A 3BMXA 3FKQA 4GYJA 2C9DA 4N3NA 5IT0A 1IEQA 4AVYA 1KEEA 4RJ2A 1BA3A 4DSAA 1Z3IX 1ZINA 2C4MA 2H1VA 1SCDA 1G8SA 1YR3A 5C53B 1LK7A 3HJBA 4NYIR 5DIFA 3KFVA 3ZYZA 4R8KA 1EM8A 4RF4A 5K8CA 1HE4A 4YRCA 3DGEC 5LJIA 3BSYA 4ZOAA 5ALFA 3TTTA 3EE6A 3TR5A 3D43A 4LQCA 4LVOA 3BMCB 4BFVA 1KY3A 1RPNA 4LCEA 4RVSA 1UBNA 3H0KA 3K72B 4UNIA 2YW9A 1K5DA 2NZWA 2PAFA 1G6KA 2IX9A 5AHKA 2EX1A 1X74A 3OE5A 3C8ZA 3R7LA 4HSEA 3SQDA 3MUEA 2OESA 1KK1A 3TTWA 3H19A 3T0GA 4G5HA 5JRDS 2QVGA 1Y1PA 1NGSA 3ZQUA 3FSJX 4JI8B 2XTAA 4GPZA 1SG6A 5EPOA 2H4FA 1V9CA 1AUVA 2Z95A 3JZMA 1O6ZA 1RM0A 1GKYA 3HEMA 3NHZA 4UVEA 5CIQA 1UC5B 3VDXA 1RRCA 3CLUC 3EXG1 2H4HA 2HNBA 3O4FA 1PL6A 1GSIA 3WQQA 2BGLA 5I7VA 1U1EA 1UKVY 1E2HA 4GM4A 4TWAA 3EG9B 3EH2A 4MDHA 3CRZA 4XAQA 2CDRA 3TKAA 4WY2A 5HFJA 2L69A 4Q34A 4RV9A 3WHLA 2H65A 3DTNA 2GD2A 4IFTA 3ONDA 4HNAB 4QG7A 3B52X 1II0A 1EU1A 3K71B 3D59A 4MUEA 5BT8A 1GZ4A 5A1TA 1I30A 3N8DA 2BI8A 4B87A 3BB1A 1T3LA 3EJWA 4B84A 4K9MA 4OBEA 1T6BY 2PL5A 4TZTA 5AW1A 4ARBA 2YBEA 1O9GA 4BGDA 1BHQ1 2J67A 4F46A 1T26A 1ZSYA 1FXSA 1YV9A 4JUIA 4ENWA 2FTKE 2J3MA 2YV3A 1PFWA 4MRNA 4RGQA 5WRFA 5L4NA 4G0QA 3KLOA 2R4TA 4B45A 1NVBA 2O8CA 5ES3A 2R00A 4KWHA 4X65B 3EAGA 2QX8A 5KTTA 1CJTC 4E31A 2ZJ3A 4YALA 4EYOA 3TLAA 2BGNA 1EDZA 2MYPA 1CJSA 4CM4A 3NBYC 2FZEA 1WSAA 3WK5A 3X1WA 2QGFA 3DCIA 3KE8A 1BEZA 2QD3A 4OYYA 3C8DA 4LJAA 1E3MA 5EQTA 1XEWY 2XB6A 1WCYA 4PXSA 4TLEA 1QGZA 4A8PA 3OEED 1T9CA 4MVYA 1EYZA 3VO1A 1Z82A 4CMKA 1H6BA 4MKZA 3LCJA 3NBKA 4O59O 2GH1A 3TR0A 3VH3A 2UZ1B 2IZOA 4ALJA 2VTVA 3P2OA 3TMAA 1DC5A 1L5NA 4DIFA 5IJ0A 1PP4A 3R6WA 2CDNA 2WOOA 5TPWA 5MF6A 1Y8ZA 2CXUA 3W5UA 3UMYA 2C2MA 1VPVA 4EYQA 2BGIA 3LZ6A 5EUQB 2VAWA 4F2HA 2NSDA 4KWEA 1W4CA 4Q9DA 3NHMA 1D2HA 2OSVA 2YWFA 5K8UA 4C4XA 1PWHA 2EXXA 2IYEA 1JT2A 2ACWA 3HRHA 3BCSA 4PBRA 1YBAA 4YWJA 3K8YA 2QMOA 1GNVA 4H2DA 3ZGOA 3MGBA 1C8KA 3TW4A 4BNGA 5FEUA 4NARA 4AIIA 2BYTA 1OI2A 4CL2A 4IZOA 1QP7A 3T5GA 3PPVA 2PWZA 4JJAA 2VXYA 5IYZA 3TEMA 2JLSA 2CJXA 3SF8A 2G5TA 5F23A 4X5OA 3DMFA 1MJGA 1AHPA 4QDXA 1U8YA 1RLMA 2X2PA 5GGXA 2AOUA 5KHLB 3FCSB 2GK3A 2C4KA 2R4QA 4A5SA 3KFLA 2IE0A 2WJJA 4LHXA 3L7IA 3LOPA 4MO9A 3IVCA 2FJUA 3RW9A 2OLKA 4U6SA 4A91A 4B1FA 3G13A 3ROPA 3ZEAA 4NRDA 1E9AA 2VDPB 2R9VA 3CNQS 3VSEA 5K0JA 3C8HA 4MKXA 4PO8A 4XQGA 3OJCA 3BICA 3N9IA 3OFSA 3UHPA 2W2QA 4ETNA 3RQSA 4FW8A 1ACLA 1QV7A 2ZJ0A 2B7BA 2RAVA 4S0ZA 5FORA 1TMKA 4YS6A 2GCPA 4V0ME 2XVYA 1CRZA 4BBPA 1G8YA 2ZR0A 1SD1A 2CDBA 1C7FA 2IW1A 2OV2A 3C74A 2R0QC 4DXDA 5AKYA 4Z0NA 2QM8A 3FIUA 1YJBA 3B48A 3H1TA 2Y4NA 3K0EA 3N6VA 4LJ6A 2X0IA 4QRHA 4X9XA 5AYVA 4ENVA 1A2OA 1YL5A 1VECA 3H11A 5JQWA 1UZNA 1VFPA 3CZRA 4S1TA 5A0FA 1UJ5A 4EI9A 3CNEA 2WABA 1VSVA 2XB8A 3H2GA 1IRXA 4NBNA 5GAJA 1SO8A 2PZAA 1EFUA 4DA8A 4BNUA 4N40A 4CIDA 3RRXA 3PNKA 4P3XA 5DEIA 4ZVLA 4C5BA 5BY2A 5JW6A 3RIMA 2BFPA 3LCVB 4XLZA 1HZZA 2AXEA 1K86A 4ZU6X 2D5CA 3WZ2A 3OHSX 2ECQA 4IO0A 1YZLA 4OHRA 4XZ3A 1Y34E 2YJ3A 1HTBA 2GKSA 1T8UA 2ISCA 2MR6A 3ZE9A 5KTOA 1U94A 2AG1A 1YD7A 3BGSA 4Y1EA 1J90A 5FI0B 4E12A 1PUXA 2QTZA 2GN2A 2XBLA 4IDNA 4Z2YA 4EZEA 3OQNA 2GHIA 1HDOA 2A92A 3I83A 1J1ZA 1C1YA 1TVMA 4LZJA 5HZGA 5JJ5A 2JH8A 1AQJA 1RVV1 1DO8A 5EKSA 2C88A 4NBTA 4ZMBA 4KMOA 4O4JB 1ZOOA 3N0TA 1PUJA 2FSFA 3OI7A 1T1GA 3L7NA 1ZMXA 2QS9A 3IUMA 3W3AH 1ENOA 1Z88A 3U62A 1EWYA 5IKEA 2ODPA 5EZYB 3OA2A 3ZWOA 4R8RA 3UMRA 4LHSA 2ZRPA 2BISA 4WL0A 1CR0A 2QORA 5I01A 1PYDA 3MT7A 5AJTA 421PA 2BEUB 4LOIA 2HK8A 1EVLA 4FFBA 3LF2A 1WDKA 4UM7A 1R7RA 3RPEA 4MIEA 3U31A 1BDMA 2C8KA 2YRXA 3KIPA 3OE1A 4YMVA 3GJ6A 4U0JA 1WBBA 2HX1A 2FB9A 1MGOA 1XLWA 2KS6A 3HFGA 1SVUA 4GGOA 2FW6A 4KRYA 2VP6A 5EFZA 1T4MA 1U0FA 2WNIA 1A7KA 1U2DA 1VB3A 3LL7A 3OZEA 1NBMD 4Q3CA 1PZGA 2OOSA 2O8DA 2R66A 3FPBA 3HVJA 3NPMA 2Z5LA 5I47A 1K4KA 2ZJBA 3KQLA 1YR7A 4LK3A 4C78A 2DWCA 2YFKA 4CMHA 4ZHQA 3DZFA 3H5AA 2RHMA 1GPBA 1Y8CA 1Z6AA 4BVHA 3H5OA 4JZYA 3RYCA 3BQMB 2I6SA 1U7ZA 2IH2A 4PFKA 2WD9A 2J0EA 5EXPA 5FBZA 3GP5A 4BS9A 4QJ5A 2FAXA 1D0IA 4QA9A 3SIPA 2ZBFA 1QU3A 5J3JA 3I9MA 2RHGB 5CCBA 1T25A 1K92A 3K0FA 2G0AA 3ZHXA 1EVEA 2JEZA 3QNMA 3RTAA 4LMBA 4QNMA 3BIJA 1EXVA 3DLHA 1JL3A 4WKNA 2ZQYA 4AFNA 4B4WA 1FW6A 3QA3E 5JBQA 4HQ0A 3IDAA 1H3EA 4KTVE 2W2LD 3IODA 3DL2A 3E5RA 3FWYA 4J4TA 4GZMA 5EWLB 4MGKR 4ZV7A 5JDCC 3HO8A 3IXMA 2NADA 1KEEB 2VHCA 1EWVA 2EZ4A 1I4LD 4W82A 3UGTA 4DVGA 4DQVA 1PK7A 4WLFA 3N59A 3ZJTA 1PT9A 2C4HA 4EW2A 2JFBA 2WFZA 3JTMA 4J43A 1FQJA 3EXFA 5DIZA 3C85A 3K2BA 4RCYA 4CQJA 1WZNA 5LP6F 5FRDA 3RLFA 3PPIA 2Q7DA 1ECGA 1E6LA 1NVXQ 2TECE 5BSEA 1E9CA 1M83A 3O4VA 4GFDA 1E1MA 4KACA 4KKVA 4U02A 4F4CA 4LYGA 1U7UA 2ECOA 2PJUA 3COPA 4NYIQ 3QX3A 1AK9A 1JBEA 1MF7A 2P79A 1L5YA 1Q1GA 3HFRA 4N49A 4XGNA 3KEOA 4P82A 2HDHA 4ID9A 2GUWA 4NYJR 2AEFA 3HB4X 4CW7A 4JOSA 5K8IA 1QO0D 1NMSA 3MM4A 4QQNA 5DU2A 1GQ2A 1NYRA 2IXEA 4BYMA 5BR8B 3QVLA 2WR8A 1SHLA 1N1MA 4J1TA 1OF1A 4Q6BA 1D7OA 1UPAA 1CHNA 5FNVF 5AVSA 1TEVA 3EZXA 1VA5A 3FVRA 4MW1A 1SC4A 4YTEA 3FZQA 3W5BA 2IXTA 4EF6A 2XTZA 4E3WA 4B32A 5DYYA 1P72A 3MC1A 4TL6A 1VE7A 2AOXA 3WHKA 4FFRA 4B80A 5CITA 5ALQA 5CCEA 2V6IA 3BGVA 4WE3A 1PT5A 3U60B 1TRKA 1XB2A 1EQ2A 2GN1A 2J59A 2NPIA 4FD3A 3W2FA 4KGDA 4B33A 5IVHA 3PHHA 1OCEA 2UUPA 3C1OA 4RCVA 4HNTA 3ZXUB 2VSOA 4QU5A 1CBUA 1VL0A 1I2MA 4D5EA 2ZWOA 2JFNA 4KR9A 3NHRA 3UMJA 1WULS 1KI1A 2CXPA 4K5QA 3UA4A 3DHVA 4JJ6A 1PNOA 3BK2A 1AB6A 2AEEA 4IOLA 1ISMA 1C1DA 4PHGA 4FYPA 3ZQ6A 4PYOA 4ENQA 3KYBA 2JFHA 4NSNA 4JLNA 4IZ6A 4PQFA 1EK1A 3V4OA 1S89A 5CDSA 1JDPA 3U4CA 5LQRA 2D2IA 4CR8A 3K5IA 2NNWB 1YRYE 3HCAA 4WH0A 2VHUA 4JA2A 1ZBDA 4Z9XA 4YRSA 3KETA 1G6HA 4ZYXA 1G41A 3ER9A 4OXQA 4KIUA 4CCWA 2O2SA 1P1KA 2IFTA 1OPXA 3HPQA 1F2VA 2Q3HA 2CL7X 2MYTA 3O8BA 4UVHA 1F8GA 3F78A 1W1WA 2D2XA 2WF7A 2YWHA 1L4KA 1MV8A 1A2BA 2IZ5A 4WHMA 1OZAA 1WCIB 3PPWA 3Q3CA 2AF4C 4NC9A 4V0SA 2F8LA 5IM5A 4LQDA 1A9RA 3HA2A 4B6SA 4K9QA 3GDWA 1AGRA 1E4YA 1NE7A 2X5XA 1B8OA 2PMCA 1RWWA 4QXQA 2H3EA 4ADSG 1GZ7A 5T64A 5IVKA 5LNK1 3KUKA 4WFQA 1YQTA 2HI0A 4EGCB 5TPWB 3M6AA 3QPUA 1X8JA 2BDTA 4RF5A 2NU8A 4DW8A 4KIJA 1UODA 3VDNB 4ZIRB 4QFDA 2VHVA 3CCFA 4M4SA 3Q0IA 1JE1A 5JQGF 3R1IA 4ZVNA 4OMCA 4CGYA 4EO9A 2Y1WA 5EAIA 1VHTA 1YGYA 2HOQA 5B7QA 3KD3A 5TIIA 1IZZA 2WU4A 3T38A 1RBYA 1VL2A 4LVCA 4V0NA 3UXMA 3W1EA 4DLWA 1PVOA 3WNQA 4JSRA 5FI5A 1DIHA 2EF1A 3ROGA 2PX2A 2WILA 2BFCA 5CX1B 2OEPA 1GL7A 5FCDA 4DUGD 1THMA 3G2HA 5IYZB 1R88A 1LC3A 1RXIA 1ZZGA 1ANKA 2MINA 3GYBA 5G4KB 2CVOA 3MBOA 4F5WA 1SG0A 4BB6A 1DE0A 2OOKA 2NPFA 5E7JA 1C7JA 1W5EA 5A6SB 3TQTA 4C9BA 2JBWA 2GZ3A 1ULUA 2G9RA 2IUYA 1P2FA 2OLEA 1D1QA 1XRNA 1N0WA 5T5QA 3A6LA 4IIXA 3G2MA 2XTJA 1T2FA 1VPEA 3RANA 1XAIA 5JECA 3RG8A 3UJ9A 4I3GA 4RZ2A 4WUVA 1S9HA 3ERCA 4WKOA 3U3DA 2Q4RA 4BNJA 4JYZA 3RC7A 3KZNA 3PP8A 2EJTA 2WHPA 3W2TA 1BDIA 1JE0A 2FHSA 3EK2A 3H8SA 3NVDA 1Z2EA 4N5MA 1QQ7A 1UEJA 4EH1A 1N6NA 3CMMA 4P0PB 1Z2AA 1XVAA 3DDNA 1JNXX 4XSGA 3H9UA 5JZVA 5BW8A 3IL2A 5K3EA 4WDQA 1N5KA 1WF6A 1Y0BA 2B69A 1T9GS 1MB3A 1E9FA 1MC5A 3A05A 3G1WA 3IB6A 2W6IA 4WZAA 1V8OA 4OJQA 2IIVA 1J07A 3A3KA 1CUIA 1JR4A 4A2QA 3BXGA 5AK3A 1Q84A 1WB9A 5EUBA 2X8LA 1XFAA 1HKHA 2VDWA 5DM1A 1JS1X 3K3PA 2NVUB 1JIUA 5DYIA 3TSWA 4BQIA 2JGAA 3OJEA 4AK9A 1U7XA 3B1YA 4C3UA 2ZWAA 1Q44A 1J8VA 2B9VA 3EUFA 4H7KA 4MS3A 1F7UA 3KB1A 3N2EA 1E3DA 1ISFA 3FYTA 1U4SA 1PK9A 3EASA 3DDUA 1MNAA 1KO7A 3E84A 4QQFA 3L46A 4WK4B 4DG8A 1JH9A 4RA9B 1V7ZA 3A6GA 3WJ7A 4KXLA 4YRAA 4G1MB 4IILA 1K3FA 2J4FA 2EGGA 4RIHA 4W8OA 2WLSA 1W5AA 1IATA 4LJRA 2C03A 3U3KA 1YI0A 2XB4A 4LI0A 3VMMA 2G4VA 4KLCA 2D6FA 4HGPA 1TMYA 3V4FA 2GSDA 2LCIA 4RAQA 4C0SA 4G5OA 4PG6A 1G3IA 2BFBA 2J46A 3S29A 3LO8A 3JQFC 1OXTA 4ALLA 3VR4D 4LMAA 2X42A 1X7WA 3QY9A 3EUEA 3QEJA 5FTLA 1BRMA 1SRQA 3W90A 1Q7TA 3T4PA 1EXDA 5C18A 3KKZA 2WWHA 3VC7A 3V8PA 4J9UE 1WXIA 1RQLA 4OFBA 4P08A 5KNBD 3CA8A 1T8TA 1WY5A 4A8HA 1KI7A 3ZHRA 1XNRB 2FPIA 4FFBB 1A7AA 3SZUA 1DDOA 2IH4A 3LGAA 3B82A 2BKXA 3HV2A 5LB2A 2M6KA 2C92A 4DLLA 3KKNA 2Q3EA 2Y0EA 3VKFA 1Z63A 2VRWA 4F9FA 1UM9B 1XLUA 2EBWA 3SIWA 3VPXA 3U1VA 1DELA 5PGMA 3RKUA 3QEAZ 2MSKA 5D01A 3TLCA 1KGDA 3DBIA 3DT8A 3H2YA 3LC0A 2ZROA 3FCYA 3L5KA 4LDZA 2IDKA 2O8DB 1WXEA 1QH0A 5BUCA 5DX1A 4ZVOA 3C3JA 3CBGA 4AJ1A 4PCUA 4ZHQB 1E1RA 2O1XA 3S8EA 1NW4A 3P2YA 3C4VA 4E4TA 1CUZA 1T91A 4KO3S 1POWA 1TKBA 1VE5A 4Q3BA 1XN4A 4QOHA 1JFFB 3L8ZA 5T41A 3RS2A 1FFGA 4D4MA 2FEXA 4FLFA 3MMPA 1XDGA 2PS9A 3PIDA 1NR5A 3H3FA 4GZ6A 4CE6A 5BP7A 2QIPA 3FPCA 1ZCBA 4EYKA 1HYBA 3D6VA 3L6UA 3G9XA 4PYQA 1OLXA 1Q3HA 4TS4A 5ERXA 3O8LA 4BLVA 4D0GA 1ZX1A 1RJ9A 4HDRA 4G1UC 2UXBB 3HJCA 3K0FB 1ENPA 5K0ZA 2Q5EA 3V5NA 3H2IA 5FBLB 1FPQA 4MVJM 3UT5A 4AUMA 4LRYA 1XPOA 2W22A 4TV8A 1CEEA 5CJJA 2VXOA 2QAJA 5LQNA 2PT5A 2WHXA 1XV5A 1CZHA 1P2DA 3G8DA 4QJ3A 4Y30A 3RK0A 1RAIA 5ALDA 1JJIA 5EMHA 5A3QA 1U04A 4WGGA 1T2UA 1YGPA 4DGQA 4EHJA 1KK2A 2J6BA 4Y1RB 3FUWA 4XD2A 3TRJA 4IW3B 1JIVA 2XCTB 3WWZA 1VKHA 2RH9B 4LKRA 4Q9LA 3O9VA 5LDHA 2VJMA 1G4AE 1B7GO 1NP7A 4JVSB 1KWGA 3FJOA 1Y3HA 3OURA 5IK2A 5JJBA 3A28A 4Q5IA 4OAPA 3IAS1 4LKOA 2BH2A 5IXJA 1FS6A 1D04A 1V37A 2Q1YA 1DAKA 3OH8A 2A1UA 1H3FA 2V1XA 2LNDA 5EE0A 2D5LA 4V0KA 2QW8A 2B1JA 4I1VA 5CH5A 4MUKA 3FYUA 2JLZA 2VT7A 3PWZA 1JRLA 2CD9A 3OZRA 3EF1A 2OC4A 3AF4A 3GRPA 5DGDA 5ER6A 5KVSA 1QHGA 2KQUA 5J1SB 4R1PA 2QE6A 3G8BA 4Q47A 2PV7A 2PNJA 4OI2A 3V8MA 3WAGA 2WM2A 4C2BA 3LF1A 1I4WA 4ZO7A 4YCJA 3FHTA 1DKOA 2EFYA 3VR6H 5J58A 4MW4A 4YAFA 4IYRA 3LUCA 3IDSA 4LRXA 2G8LA 2YRFA 5IM4F 4DEVA 5FPYA 3WLLA 4FINA 2YASA 1LTHR 3D4PA 1G7CA 3OCZA 3TLGA 4BO9A 1KXJA 1DAFA 3FCAA 3SYKA 3T7DA 2H9IA 3DNFA 5AM2A 4EEZA 1RHKA 4NY1A 4CIWA 4GEKA 2WAAA 4J16A 3H4MA 5JV5A 1J8MF 3TZCA 4F4FA 3PEUA 3ZGZA 2DHRA 4Q1EA 1ZOLA 2NWQA 1GQQA 4RABA 2FUEA 4UEKA 1EP9A 1GTMA 1S6YA 4MITA 2RBKA 3HBAA 1ZGHA 2O7RA 3OO0A 3ZQ4A 2XMSA 4EY8A 3V97A 1N6IA 5B3KA 5F35A 3D8RA 1RXUA 2QENA 3ETHA 1R9GA 3GVCA 3UJHA 1MEJA 1UJ2A 3WWDA 4E70A 1KMIY 2DOKA 1UT8A 3D0QA 4LYYA 4FYYA 4HDMB 4P4UA 1G66A 4KZKA 2BGRA 1TIPA 3MQ4A 1M2JA 1VKRA 5HJ2A 3NJRA 2WYHA 1D2NA 2Q0HA 1L4MA 4BX0A 3LD9A 1E94E 2EJWA 1GGFA 1KPHA 1NMEA 2RONA 1FFSA 5L53A 4X00A 5GJCA 1J5PA 2DJ5A 1YCDA 4NZNA 2VLBA 5HBRA 1YNOA 1Z5PA 3MCWA 1OIWA 2J5BA 2C83A 3EVCA 4WXYB 2OGSA 3CLTC 2UZIR 2VYVA 3GVIA 3KHUA 3R7AA 2IGTA 4EPVA 1IDN1 2V8OA 5C35A 3URKA 4WK0B 1P4AA 1RRVA 1UEIA 2A5JA 4DBLE 2IK8A 1SCIA 3BHJA 4XI9A 1KFBB 1W49A 2HRDA 3FI0A 1FUEA 1TE2A 1Y1KE 4QWMA 4TMZA 4WZAE 3IPXA 4Y8VA 4LDRA 5CGZA 3R7DA 5BWCA 3O84A 4JVNA 5KOYA 3A3NA 3P9SA 3BXZA 3VV3A 3ESBA 3AZOA 2OVFA 2YV2A 2QP4A 1JLSA 1CQPA 1NXWA 2XGOA 3KPJA 4HNSA 2BMFA 2K4MA 1KDYA 2GNPA 2WTAA 1DKMA 1QIHA 3RTDA 3RT1A 5J4YA 1EUQA 3MTGA 5EHNA 1U5AA 3L0YA 1U0JA 3F5QA 4OBXA 3UAZA 1CYEA 1WD5A 2FPXA 5JROA 3ADOA 3B5IA 2R8PA 5E6RB 5HF5A 2MINB 3UJ8A 1DC7A 1PTJC 3C5CA 3HZHA 1CQJB 4LRTB 3R3JA 3E2MA 1Z62A 2WJWA 2W2XA 1Z28A 5EZYF 1GEEA 3MERA 1LPBB 3ZUGA 3H1PA 3LVQE 5ESXA 5B58C 5AJZA 4EUNA 3U56A 1IOVA 1N6PA 5JS2A 1KARA 3LZDA 3ZK8A 2XIQA 4JT8A 4FHEA 3R0IA 4P0TA 3C6XA 4UHEA 3RU7A 2AD5A 1RVDA 4RO0A 4C3ZA 1ZUNA 2WHPB 4DXHA 3I0MA 1KP9A 2O3JA 3SLRA 4B82A 4DMLA 2CHGA 4JBIA 4ABYA 3EDRA 5H9WA 1R6UA 1RSZA 3K30A 4UCFA 2LIPA 1Y33E 3AHDA 3LWBA 1DWPA 3KS9A 4LHEA 3C70A 1KEZA 5CA0A 4ZAZA 3R75A 3B7PA 3ABSB 4YJGB 1UXKA 2BEJA 1GUYA 3ICVA 2D74A 2HBZA 2I7XA 3DXFA 4L74A 5KJEA 4AP5A 1U3TA 1JB1A 1GU0A 4QREA 4TT3A 1VG1A 2PL9A 4KMRA 4ZI5A 2ZYTX 4V0LA 3IULA 3F49S 1ZXXA 3DE5X 2VDWB 2C96A 4RTJA 4BZQA 3SEAA 3F6CA 3REQA 4BMSA 3QE0A 4GM0A 1U0OC 1M8FA 4GYYA 2B3TA 4JENA 4PYIA 5FWXA 2RGXA 4MS3B 4JOQA 4ZJPA 1HR0B 1PT6A 2PDAA 3AETA 1JHQA 5F52A 2ACVA 1TK2A 3DZBA 1GWNA 4JT2A 3B2NA 4TMWA 5F3RA 4CKYA 1E8MA 2QLJA 1NN5A 5LIPA 2X2OA 1WSWA 5JSZA 3X1KA 3AB7A 3KSUA 3FOBA 2F3SA 1SXJB 3IS3A 3PE4A 3GLFB 2GFQA 2JBAA 5F9HA 4LC0A 4MWBA 2ZYAA 4UM5A 2X13A 3VTFA 3CINA 1ML3A 4H35A 1PJ2A 1SBIA 2JARA 5CVCA 2M9MA 3FJYA 4MW7A 2VRBA 2ILVA 1CERA 1Z74A 4BWGA 4JQZA 1JQKA 4TVBA 3E48A 4NU8X 3GEBA 4B44A 1BE1A 1P0IA 4N1AA 2Y1KA 3DBRA 1JHPA 3PNQA 4B31A 4ZHSA 3BH6A 4TLMB 4ETMA 2IH5A 4F21A 2R6FA 1U80A 5KMGA 2OXCA 3B85A 2FPIB 2G25A 2ZFUA 3FMFA 1NW5A 2NT4A 3S55A 3WA6A 1B16A 3AKDA 4C87A 1IXSB 4E11A 4EDFA 3LGSA 4GX1A 1R9JA 1QLWA 3NT5A 4MQBA 4RKFA 4R1UA 2W4QA 1C7ZA 4FS3A 4E5PA 3NYQA 2WFAA 4B2IA 1JQ3A 2MU1A 2VYND 4PU0A 1OX4A 3A9WA 1G8GA 3QXSA 5CLQA 4UOZA 2YNMD 1SBNE 2R6GA 2VJLA 3IUPA 4KR0A 3O8DA 4M1ZA 4H1WA 2PUFA 3P1JA 1ZHHA 1LGYA 4YRZA 2ZYRA 3H5TA 5FLEX 5DEOA 3FOZA 3OZTA 1M2EA 1NVGA 2CYBA 4IF4A 2C7OA 2W6OA 1E6CA 1QSGA 4J0KA 3LX4A 4TKLA 4F3CA 4ZYTA 1NULA 1M5TA 4LZLA 4OQLA 2GNAA 1AUQA 1Q6YA 4WOPA 5AJXA 2DU8A 3IT2A 5L6MB 3JQAB 5LXTA 1HDYA 5KTMA 1NJGA 1RJ9B 2H7VA 4HDRB 4WFIA 4RMGA 1T8YA 4HQOA 2KYRA 3K1JA 4EMTA 3UT5B 1QYCA 1H66A 1XIVA 3GB9A 2EFEB 4Q48A 4B3TB 1E58A 3NIGB 3JQEA 4PV7A 1T4CA 4TS1A 3QPBA 2FR8C 3PC2A 3FYCA 3KUUA 3WL8A 2FSUA 1KYXA 4ZI7A 3C3MA 2BKUA 4YMGA 4RULA 2ZJ2A 2ZS9A 2QMEA 2HQRA 4Z99A 1TX4B 3WZMA 2I2FA 2RHOA 5KQMA 2XE8A 3CUSA 1I9GA 2UUBB 1VPTA 2BZ0A 2KMLA 1DRKA 4ME6A 3BEOA 5JXIA 1GDDA 3A1WA 3CZPA 4CV0A 3IESA 3NI2A 3KOOA 4UTXA 1Y8RA 3MT8A 1JEQB 4M49A 2OFFA 2VJMB 1ZD2P 1L6IA 1UR5A 2CLMB 1WHSB 2BOVA 4ACBA 1OSNA 3H75A 3JVIA 5GPBA 1WDTA 2X4LA 4BCBA 4CQMA 3A9SA 4TV9A 4NL4H 1TUBB 5AVVA 5HR5A 3GYGA 1A88A 4R5HA 4L9RA 4J3JA 1H4TA 3BGWA 4YMSA 2W98A 3ZKWA 4PZLA 4UD2A 4DQDA 3CW2A 4QAQA 3FYUB 3UTDA 2ASVA 2Z04A 2Q5IA 3PTAA 4F96A 1WB6A 4Q1BA 1MQ9A 2P9FA 1BS1A 1SR8A 3C5EA 5T67A 7MHTA 2VP3A 1W581 2JGKA 1X7DA 1ID1A 2ZP1A 1KO8A 3GJ7A 3L4EA 3LUFA 4NAUA 5CW1A 3BXFA 4NH0A 5L4SA 1RFLA 2G28A 2XGSA 3HVKA 3S7ZA 3BXXA 2FPPA 2NGRA 4IQ0A 1MD9A 4II3A 3PUYA 4OQQA 5A5DA 4CMGA 1MRNA 3FUVA 4BNIA 2ZPUA 4BASA 3WADA 3INRA 4KQ2A 4QUKA 3I3SR 2D0OB 4JXXA 1PN3A 2QVCA 1QQ5A 5IYZF 4ZV4A 4EJSA 2WSSA 2VTBB 4KVGA 3O8OA 2IL1A 4PVCA 5J59A 1CUSA 1V3UA 1X1QA 3R0JA 8GPBA 1LPNA 1EQAA 2XAUA 2G6TA 1TCBA 3BJZA 3VMFA 1GD1O 3H7AA 4M98A 2QK4A 3G3EA 2Q5LA 2B4RO 2QYOA 4N6NA 1LZLA 2RIPA 1KPGA 4P7GA 4HEA6 2JFVA 1I1QB 3ZV7A 4B6EA 4XYLA 3A4LA 4JU9A 1I24A 2FG5A 1JA0A 1BXRA 5KYWA 3AW9A 3UT0A 1A27A 3VPBA 3L82B 2WQ6A 1XWIA 2I71A 1P1RA 3SKYA 3U48A 2VZ9A 4IDBA 1QBGA 3KT6A 4AECA 4CTKA 3TYXA 3QTLA 1ST2A 1C9EA 1L5RA 2OYSA 3UFBA 4JN6B 3RGGA 3ZV5A 2QX6A 5FBHA 4EEKA 2ZAMA 4GRIA 4BNHA 4Z2AA 1LBSA 3L77A 4F3NA 3CVJA 5TQ0B 2HD4A 2XGJA 5CAEA 4A1OA 1SOVA 4E5NA 1WZIA 1Y7PA 1YQGA 3BREA 3GG9A 3RS0A 1CR2A 2AHRA 1PGOA 4KEAA 1RI5A 1O77A 1U4OA 4BV2A 3RFTA 4BRUA 1XYYA 1Q20A 2VJYA 1VOTA 1EFPA 1XNGA 4IHQA 3G2QA 4GSLA 4O1HA 4TUYA 2NUPA 2CSUA 1NN1A 1PFUA 4E14A 1U9YA 3DE7X 3DR5A 3QBJA 1XDBA 3DZIA 4KR7A 2P2SA 3PFHA 3BL5A 4HLNA 3IYLW 3FCOA 2AN3A 1Y3AA 2QX4A 2GLUA 2R00C 3A32A 1TUIA 2WDZA 1ZM2A 3C43A 4WFKA 3GUHA 1KFJB 3GLTA 5A9RA 3HJAA 4BFLA 3K5WA 5GJVC 1R37A 3R3XA 4NYMQ 3UB3A 2V7XA 3NGLA 3AW8A 3HL4A 4OH1A 5G0SA 1HGXA 2P9EA 5FB3A 1YKFA 2QD5A 2RGAA 3PC7A 1ZMBA 3IVMA 3RROA 4K3UA 2C97A 2ZUUA 2O3TA 2XQGA 5EI5A 1C9JA 3HB1A 4D4LA 3ZQJA 2GPSA 3I3OA 3AGPA 3ZU6A 2R7NA 1W5FA 2IXBA 5LMCA 3F4LA 2Z57A 5D1HA 1DI0A 5HKKA 4GXQA 4JWTA 1X8KA 1JFTA 1Y8AA 2V7BA 2ZRNA 3LIPA 5CEFA 2Y1GA 1FSFA 2O7QA 2ZJ7A 2YHBA 5FWYB 5G53C 3FM9A 4BIIA 1MH9A 2BFFA 2X40A 1W4LA 3M5DA 4IF6A 2Z8XA 1K8ZB 1XD2A 2QW0X 3D0KA 3JSAA 4JJKA 5ICFA 3TAHA 3E5MA 3OAAA 4GOOD 1MQSA 2OCPA 1EPUA 1YS4A 1U3DA 2JGFA 5IASA 3SLKA 3SHFA 3GRZA 1YKGA 4ZVVA 3BILA 3ELDA 3IQWA 1COWD 2JFPA 5I8WA 4ARVA 5JYCA 5JJLA 4XJVA 4EG1A 1VHDA 3GFTA 3IQGX 3QBTA 4WN9A 4CG1A 1XVLA 3W1VA 4D4GA 4R2WA 1B15A 1L7DA 3GXOA 2NUAA 3PJRA 4IP0A 4ZHQF 1SUFA 1AMOA 4QGFA 2X1MA 4GGMX 2VUSA 2Z0MA 4I66A 4JC8A 4O2BA 3EPLA 4WW0A 5JLAA 3VNSA 4FFSA 4BX2A 3D3JA 4FMDB 5JSHA 4UHKA 3BJIC 3ABZA 3TJRA 1KKMA 4Z0HO 3O8CA 4GL4A 4OXNA 4E5YA 1WUIS 1TJPB 3REQB 2GXUA 1T29A 3C3AA 3F74A 2I4MA 1E8DA 4EO4A 1X15A 1XKTA 4ZV9A 2AMJA 2YJTD 2R4UA 2JGDB 3OWXA 1HQDA 4LG1A 4BO6A 9LDBA 4ZZ1A 4ZPXA 4PSVA 3DEKA 1NY5A 4HS4A 3V4ZA 1GQYA 3TM4A 1GPMA 3UAOA 3I05A 1Z29A 6ADHA 1TI7A 4D26A 5JSZB 3FAZA 2C2YA 3BA6A 3FPKA 4DT1B 4ML3A 5F1KA 2L18A 2G80A 5IJAA 1ZM7A 4LPKA 3KKLA 4MWDA 1F4PA 2JBAB 3DZ8A 3C3XA 1DMSA 4UUMA 1B6RA 2Y93A 4MV1A 5FBKA 5HS6A 5P21A 1E3JA 1KYQA 1O5OA 1G5HA 1VCMA 1TT5B 4EMBA 3IAS6 2XXBA 1RD4A 1Z7GA 2AVDA 3FMPB 4GU5A 4C0WA 1QYDA 2P9QA 1R10A 4HK4A 4FEAA 2OILA 3ZDZB 3EGWA 2AMVA 3ITKA 4MJXA 2YJZA 4BVAA 4DMUB 5DMHA 3R9XA 2XA2A 4RJIA 3HCWA 4M1SA 3OTIA 3WHIA 3KQHA 3BMNA 3RFUA 1QZUA 4B48A 3MRSA 1HZZC 2GWRA 3JWGA 5CXSA 1BXGA 1PX0A 3S68A 3UPDA 1WO8A 2ZVPX 3OZCA 1UK7A 1ZHFA 2OGTA 5TPZD 2B1IA 2RHWA 5I9LA 1IBMB 1ATZA 2YJ5A 5HDBB 1QIDA 2EIXA 1MOQA 4LRSB 1AUOA 1YRLA 4QPDA 4X3PA 1E9VA 3H9BA 5KPJA 1KMNA 1TTHA 3UOGA 5D7NA 1BMQA 2O2GA 3O47A 1W88A 3W34A 1VQ1A 3T12A 2ZJOA 2ONJA 4DJEC 3WZLA 1P44A 3RTGA 4OAQA 2IYSA 3CWZA 3TKYA 4PZ9A 4AWAA 3ACDA 4RCZA 1H6AA 1QP0A 1J97A 1OX4B 1XZCA 3JWJA 4FOPA 3B53X 1IVYA 3PFWO 2QQFA 2QSUA 4IJWA 1RXEA 2CE7A 5AOVA 1AJEA 2B7CA 4ZT5A 5TS2A 3V6MA 4FC7A 1YXMA 1KDPA 1SIWA 2O52A 3SIRA 5FA5A 1UJCA 4GR5A 4BO1A 1A2KC 5AVXA 4ARCA 2SKEA 5DWDA 3ZVLA 1O2DA 1UPBA 4RK5A 4EX7A 1HLGA 3X1MA 1Z08A 1A98A 3U4DA 1QNFA 4MUXA 1M6EX 2L19A 2PSHA 4YJ2A 1UJNA 2ZS7A 3OCYA 3THOA 5A5FA 2IPLA 4DQXA 4EQ6A 1M2HA 4NATA 1OI3A 3PXUA 3VAAA 1KORA 4TLCA 5ITSA 1FYXA 1O96A 3JVDA 1U2DC 3KAJA 4OL0A 3UAVA 5H3CA 4BTLA 4ZCSA 3T9EA 4ZI7B 2I34A 2Q9BA 1MDBA 2FQ1A 4I4TB 5E1OA 1FA9A 2FX5A 5TGTA 3WSWA 2ZRGA 3DB2A 4YA6A 5KYYB 2P1RA 3CUKA 3FVWA 5GQSA 2BHLA 7REQB 3PFBA 1SBHA 4C07A 1F0KA 1DKNA 1M72A 1SUAA 5I6DA 5SYMA 4DV5B 4QEDA 3NBMA 3VC3A 1QF9A 2RB4A 3KJFA 3SJCA 1UL1X 2I8AA 4C7BA 1E89A 1JKXA 2V54A 1FDWA 2YOGA 4UBKA 2SBTA 2X8JB 2JKVA 3N8IA 1T43A 2C2BA 3AEYA 3CURA 4GX5A 1CLEA 1MB4A 1NASA 4YCSA 4QYTA 1IAVA 1IM2A 4UQOA 1N25A 2KBEA 3PRKE 3R41A 2VNIA 1SBCA 1PNVA 4E4RA 3BTUA 1R64A 3L1JA 3GT3A 1JZTA 4R1QA 3ZKWB 4PLYA 5BN3B 2P27A 2WW8A 3F8TA 4P7JA 1OIVA 3L7YA 2J45A 4EZBA 1H8EA 2X9VA 4DC9A 1K08A 5F5XA 2BR4A 4KQ6A 4YCLA 4FMCB 3AHIA 4M21A 4LCJA 4W8HA 3SQXA 3ZWVA 1FLNA 3HHPA 3TX6A 1NJ1A 1I36A 1MBZA 3QUQA 3IIMA 4MEJA 1RMTA 3WIOA 1B1CA 2ZUWA 3ESQA 3FLAA 3L0DA 4G6ZA 4Q3OA 5E0KB 1EZ4A 3UKDA 1LSOA 3IE1A 1OXXK 4EPWA 4X6XA 2E9SA 3VQTA 2ZB2A 1U2TA 1JHOA 2OK8A 4TM7A 1NI4A 4ZQEA 1BEEA 1FUYB 2QRPA 2VATA 3QE3A 4GBED 4JLBA 1WLYA 4M53A 4OP1A 3KOXA 5E2BA 3UB4A 4CF3A 1JFLA 2VPPA 2UAGA 4RQAA 3DA8A 3L0IB 4S2UA 1BMTA 2FUCA 1XJ5A 1CKEA 2BJHA 3LKBA 6LDHA 5E8JA 4E13A 4J1TC 4KXYA 4KU4A 4WWHA 3THXA 2Q45A 4QUEA 4G86A 4JVMA 4RY2A 3JPYA 1AXEA 4H7EA 2C7RA 1OXSC 1F0NA 2W6JA 3PG5A 4IKPA 5ENVA 4EB6A 3T0FA 4HAIA 2NP7A 3CKMA 4QD3A 3JSXA 1A82A 3CO5A 3PQEA 3BRWA 4RD6A 2FWMX 4EFLA 1PEKE 1JI0A 3IEIA 3L7MA 4Q37A 4OP2A 2PZKA 4CETA 4G07A 4ZCTA 3S7TA 4S1NA 4A1FA 2AV6A 4TLLB 2H8GA 2IYAA 2OQ2A 4Y2PA 1VHLA 2X9GA 5BUSA 4MV4A 1G21B 1SQGA 2AX4A 2Y92A 3PS9A 2I4NA 3TH5A 4CCSA 4E33A 3JD4A 4KVFA 2JGMA 3OE7A 5FPPA 5CAEB 2HTFA 3TIXB 4EY3A 1AKQA 3G59A 5DFAA 2OXTA 1ZAKA 3A1EA 4HP8A 1U6JA 4JDPA 5JXHA 2ZI6A 1HOTA 5DM4A 1I7NA 3ZDCA 1QHXA 3MJCA 1BGVA 1AK1A 3ER6A 1EP3B 3IBYA 3QBEA 4WNCA 3RUDA 4DRZA 2MIIA 1XTUA 5FO1A 2F3PA 4TUYB 3E7PA 2V6FA 3TBFA 4B4UA 1JH8A 3HBLA 2OE2A 5AW4A 3AWDA 3Q7RA 3TL3A 2XOXA 1OBOA 2BLNA 1NVTA 3GJZA 5A3SA 5BYBA 1K27A 4FYMA 2LUOA 1Z0KA 2B30A 5JTUA 4HN9A 3CVVA 3IKJA 2Y1LA 4R7ZA 4YJ3A 3ESRA 2IYTA 3N3BC 5CNJA 1RQ2A 4NNOA 3CXUA 4BQSA 3DEZA 4CM6A 2ZULA 4ZEOA 3QOXA 2INGX 1VIVA 1Z8HA 4JGBA 4P54A 4WADA 1X1RA 3VPSA 2HMYB 4Z4CA 5FTWA 4XVRA 4B2LA 3I4CA 3CLSC 3LVFO 3MJFA 2ZETA 2J9GA 3F3MA 3NQ41 4TOIA 1N0IA 4EVRA 1GAXA 4CT5A 4A8JA 4UQLA 1CG6A 3QITA 2JFQA 3OCUA 1P7VA 3I6YA 5AJWA 3GQBA 1DBQA 4FMPA 3AY3A 2HC9A 3FZNA 1RYNA 4KX5A 3OBBA 3ZEIA 2FN3A 2DPGA 2Q4OA 3CT4A 4MA4A 4OFWA 5HMMA 3MOIA 1GU7A 1DNPA 1XD2B 2CVFA 3KHTA 5CUQA 2L42A 1O6BA 3FGOA 3C3YA 2R8XA 4PPFA 5HXAA 5IZCA 2P9GA 4BUZA 5A2QA 1Z13A 3CEJA 4ER0A 1JWBB 2PGDA 1MDFA 1U0EA 1UJMA 1Z5ZA 3DCJA 4NE9A 4EUEA 2H4JA 3I5AA 3O90A 3UAGA 1WUYA 2AKYA 1V11B 2H7XA 3QTBA 1V96A 1DEKA 2RHRA 3UMSA 5DP1A 2JC3A 2PK3A 3RBXA 4KRFA 4CODB 1D4AA 2I3BA 4URVR 4BZXA 1RAAA 1ES9A 3LNTA 3QKRA 1ETHA 4O2BB 5CVEA 4AQYB 1DX9A 2ZBVA 2PZEA 4S1OA 2QSJA 2OZVA 4M9XA 5FR2A 4L9AA 1KY2A 4QBTA 2M6SA 4O0MA 1OV4A 5C5CA 1T8RA 1NUSA 1R9NA 1VMKA 2XOEA 2ZI4A 2ZSDA 3MILA 4J29A 1OB5A 4YI5A 3KSAC 1DAMA 1KETA 4YR7A 4BC1A 2PLFA 4N48A 5CURA 3ZBPA 5GVRA 1YQWA 2CHQA 2GF9A 3HSYA 4FZVA 1ZY2A 2A5YB 4GOKA 1UWLA 3OX3A 1ZLXA 1PSWA 5LMNB 2EGHA 1OGIA 5JFOA 3EQ9A 1N5OX 5AK6A 5BVHA 1MB0A 1TPYA 3K1AA 1U6IA 1TA9A 2KLHA 2ZJ5A 3D2CA 1TYDE 3N0VA 4YLYA 4FP9A 3I2HA 1WSDA 3PA6A 4CKZA 6GPBA 4DBLC 3ZH9B 2JLWA 3BIXA 4RTMA 1Z6ZA 2KHZA 2UXDB 3RVRA 5K0CA 4KXQA 4RTQA 4HAYA 4PLPA 2JF0A 2X5KO 1DHRA 4Y6RA 1NNLA 2IS2A 3HO1A 2W83A 1PDVA 5ENZA 3L7LA 2JJYA 3RAEC 4FC6A 4IIHA 5IEJA 2JLQA 3PBKA 1NU8A 1A8HA 5FOXA 2P5SA 5E4TA 1GPLA 1J2RA 1QANA 4JBGA 4LOAA 5DLDA 2QD4A 2H51A 2RBGA 2SICE 5J23A 4RTPA 4PM4A 3RF7A 1VMAA 2X8BA 3QU5A 5JANA 1J8DA 2QTNA 3WLAA 4MP8A 1JEJA 5JNSA 2OZLA 1G8AA 1BXGB 1M66A 1G7SA 5BOSA 1A8QA 1AS2A 2QUZA 2VPXA 5H59A 1MG0A 1YJ5A 1Q74A 2WZDA 1MX3A 3ONFA 3U7RA 1RTTA 2OV1A 5AXBA 1W88B 2DKOA 2YQZA 3SCZA 4D9EA 3EDQA 3EXHC 5AQ1A 4JHLA 5CDGA 2Q6KA 1YJAA 1U3UA 4DSTA 1CUCA 1L8OA 2R5NA 2ESRA 2PD4A 4M8KA 4C4AA 1LH0A 1LK0A 4L75A 1OFIA 3K32A 1L5ZA 4A10A 2OHVA 3UJPA 4DANA 3ESCA 2XIJA 1P2UA 3R74A 2GGSA 5J5CA 3PPYA 2W0SA 1PJQA 3QGMA 4R1MA 2UXCB 4CF6A 5K20A 2CK3A 1D2MA 5F7XA 1J2UA 5H3LA 1E2GA 2P0AA 3I1JA 3Q10A 1PL7A 1ORIA 5K2MA 3UWOA 3L6CA 3ZZNA 4BQNA 4CMIA 4DCSA 5KNDH 1JZQA 1PG2A 2WKRA 1JG4A 3P9RA 1S3FA 1Y63A 1QB7A 2KSQA 3QVUA 4ZCQA 4KOEC 5JD5A 3IDOA 1LA2A 2PY6A 1R0ZA 3OJ0A 1E18A 2AG8A 1QAMA 3EC7A 1RC1A 5E9JA 5KKAA 1FC0A 4EQ6B 3HVRA 3ZV4A 2WIAA 5DHRA 2WA2A 2WUFA 4XARA 2FEPA 3PZBA 3ECAA 3GK3A 2DF8A 1NLUA 1S2DA 3TXYA 3LLMA 2CKDA 3A26A 3ND9A 4JWKA 4ZVKA 2XW6A 4IMIB 4WJKB 3OZXA 3SC3A 2I29A 1B2RA 3I01M 1NG1A 4KIGA 2EW8A 2GKOA 3S40A 4HRYA 4X7BA 3U7IA 1U0LA 4JU8A 3KAQA 2YC2C 3F3KA 3O95A 4CI0B 4HY3A 3V4PB 4K1LA 1ZD8A 1XT6A 3L3BA 4BTVA 4IIYA 3CONA 2OGZA 5FOSA 4KW7A 2AQ8A 1UBCA 1W8DA 2DTXA 1OGJA 2V6BA 2ZSBA 4IJKA 3I2YX 1ZN2A 1RZUA 1ZOIA 3CF2A 4KHZA 4V0OA 6YASA 1J25A 3KJIA 3OICA 4R1SA 5KHOC 1LB1B 4J0JA 1EX9A 2FSIA 3ET5A 1ZGCA 1EVQA 4NAVA 3DZJA 3QVXA 1U0HC 4AKGA 3GJRA 3A4NA 1RACA 1O1YA 1Z2DA 2WU8A 3U2QA 3H4VA 1TYEB 1XAGA 3SHWA 4R1OA 1NXTA 1WP4A 4JGGA 5B53A 1E3LA 5DX8A 4OXIA 3JQ8B 4MCJA 5AJVB 1SCNE 1OTHA 3BF8A 2RE8A 3EG5A 2IYOA 2PV0A 2O59A 1ZRHA 2PJZA 3GRAA 4FGUA 5DI3B 4EOGA 3U4AA 1A1VA 1KHHA 5TF0A 1JTFA 2Z5VA 5J47A 5CHYA 1RR6A 1Y7TA 4EJ2A 2KJQA 3SHQA 2K7FA 4RZQA 4PVDA 1Z5VA 1W19A 5H0IA 1Q1BA 1FP6A 1YOVA 1QVWA 2RARA 4YRRA 3FNBA 2B5WA 2VK1A 2Y27A 3DHWC 3MN1A 3JR3A 4V2UA 3TBKA 2ECKA 1TTQB 3AUAA 1GPYA 2RI1A 2XQFA 3ETJA 2XOKA 1A4RA 4QXMA 5AM3A 5CDTA 5LZ8A 1CQXA 3MGKA 4B3JA 2FMTA 1Q92A 2XDQA 3IQFA 3K16A 2A9JA 3L0SA 1KO4A 4M9SA 4HS9A 3N2KA 3FYUC 3PT5A 2YQ4A 1KI6B 1JNYA 2WDPA 2GKGA 2I4LA 4EB6B 5B3LA 1V26A 1Y3CE 3GJSA 1LI7A 2PH5A 3JQ7A 3MGCA 5CA1B 2I3AA 1QHSA 5GIPE 4JC0A 3CLVA 3V55A 2WHQA 4B35A 4BNYA 1ZXBA 5COBA 4CEIA 2VKTA 4FCVA 4YAKA 1PL0A 1QMPA 3GJXC 1XTRA 4RKEA 4XCQA 1QYRA 3GRCA 2VF5X 1INLA 1PKXA 2WAMA 2IYNA 4RXUA 5JLJA 1U3VA 3VV2A 1O95A 3I5MA 1DUSA 1GNQA 1TMGE 4QG3A 1BA2A 2CUKA 2EX4A 1S5PA 3DMPA 4QASA 4X6YA 3RYFB 1H22A 2C2GA 3DTYA 4EVSA 2CCGA 4NZMA 4NHEA 3D1JA 1ECFA 1X9GA 4EITA 2WUDA 3E4DA 1A71A 4J16C 1GAWA 2P6PA 2XY4A 4WXPA 4ZAWA 1YQQA 4N3CA 2R3SA 3A3PA 3GFGA 4FMDF 4NWIA 4D7AA 1FYFA 2CFSA 3QK7A 1I1NA 1YRAA 4MS1A 4OBBA 3ROQA 2GF2A 4ZN6A 3FPFA 4GDMA 4LHYA 4AY2A 1E1LA 4D3ZA 5TMPA 2EFCB 2QQ5A 2ZBPA 3G7UA 1FMJA 4BZZA 5C7OO 1YF3A 2B2XA 3W6PA 1GFZA 3BFPA 1X7HA 3HDVA 4OUKX 1MG5A 1FBNA 2FZVA 2VP9A 2OCLA 4H3HB 4B17A 5HGXA 1JLKA 4LFAB 2OCKA 3BTSA 4IDEA 1Q1QA 3OCXA 1OWOA 3EQ8A 1VJ5A 3FMGA 4RVCA 4H77A 4YXFA 1J1IA 2PLNA 3AVXA 4AI6A 3ZVRA 2QI9F 4AZ3A 1HYHA 4WEQA 1BU8A 4UW9A 3JVVA 3UCFA 1XA4A 2HHJA 4MHTA 2Z3ZA 3C7DB 1NJ8A 2ZPTX 2PO5A 1EBUA 3CWCA 3DLIA 3FNHA 3OHPA 3P0IA 3JD0A 5LBIA 5AMXA 4A8JB 1F6WA 2PX5A 1J5XA 1E1QA 4KDEA 2H6EA 1DJQA 3Q3GE 2WVAA 2NUTA 2ZG6A 3RU9A 2QZ9A 3GQBB 3S2GA 3TDKA 3USES 4D6YA 4FGKA 4L1KA 1C4XA 3EVBA 3P19A 3SFVA 3T3HA 3TLYA 1R1DA 1G55A 3LCMA 3B8HA 3LPNA 2AN5A 1TOAA 1UDXA 4LHVA 3D7RA 3HBNA 1QS0A 4AJ2A 3KOUA 3E9MA 2HKIA 1NLZA 1F8XA 1TYCA 2IPAB 3N5KA 1ZGAA 5IN5A 4B74A 1E2KA 1CUXA 1GRQA 2DHEA 2OBBA 3DM9B 4LXUA 2I65A 1RHUA 4WUTA 1LW6E 1XELA 2JI6A 1VIAA 2PRZA 2XTNA 2ZAOA 2AS0A 3I58A 3MG9A 4CDGA 2NXCA 3ORRA 3MWKA 4XCXA 3H1GA 1SAYA 3F8WA 1YI1A 2W0MA 3QKRB 3LZCA 3OIUA 3GRUA 2O2EA 1MJGM 5B3JC 5LLSA 4GQBA 4RVOA 1O8BA 3BRQA 1P73A 4B81A 1OYWA 4BJ3A 3REFA 2VAMA 1RMYA 3CISA 1S1CA 3ZC3A 5F33A 6CHYA 2YN2A 3IT3A 4CIVA 5INTA 3PIIA 5KDOA 1AV6A 1AKNA 3UGQA 1FCJA 2FSVC 1TM3E 4HUTA 2VQDA 1T9DA 2BF7A 3A2NA 2HF2A 3OCVA 1KE2A 3UUWA 4ABTA 1T34A 3ROKA 3CR3C 4H6XA 5JYDA 3VZPA 4FQ8A 4BKPA 2QTLA 3EZGA 2BBTA 2CLIB 2V98A 1W4AA 1HYQA 1RTKA 4UAUA 2ZM6B 5BVHB 3SD7A 4A6PA 2HIHA 2O3SA 4ZI7F 2OWDA 4MWTA 4BUJA 1U0BB 4I4TF 4DF3A 3SYMA 3UQZA 2A9RA 1SM4A 2E5FA 4ZQBA 3W3AD 4QSMA 2FNAA 2OV6A 5CX4A 4CM7A 2F8TA 3MJ4A 4R9RA 4C6SA 3EYWA 1KA9H 4LDJA 3AL0C 3NVKI 1RQ7A 3N7UA 4X1KB 4JXZA 3SXJA 4AMYA 2H2IA 1JDJA 4Y9TA 3ZBUA 4JP3A 2R6HA 2GN4A 3PKZA 1WVGA 2QV0A 4GKJB 3HYRA 5FR1A 2IJGX 3HN7A 5IHPA 1DBRA 2XA9A 5CIWA 1XZNA 3USZA 1IYZA 3FVQA 3BWEA 4TL7A 5BMVA 2PL1A 1W7AA 4RPJA 3X0DA 2QTBA 2OZLB 1VG0B 4ISCA 1KDZA 4OXXA 4JX9A 5BOSB 3W5CA 4LVNA 4AY6A 2HZBA 1HEIA 3DR3A 2HIAA 4H3VA 1KQOA 1M2VA 5GY7A 2XF8A 5D3QA 1XDZA 2ZRMA 3T95A 1J09A 3UJ3X 3BMQA 2P9YA 5LQSA 2QI9C 3TNFA 4R31A 2CL6X 2PGAA 4Y6GB 4XE5A 4JBNA 3WQBA 4BNVA 2PUGA 4KUEA 4DAEA 3DEAA 1P5RA 1S4QA 2O50A 5DCLA 3SSNA 5EIFA 3LUGA 5K8LA 3AM5A 2BCGY 3UWPA 4BFXA 2P8JA 1H2AS 3IE2A 5SYNA 1I13A 3TRHA 3SJUA 1VKOA 4DFDA 4RQUA 5HZKA 1KL7A 3VPHA 3NDPA 2FUG1 1BWSA 1Y1SA 1PEYA 3KZ1E 3NP9A 3PXDA 2C9BA 4Z49A 2HQ1A 2QY9A 3RRNA 1WXFA 8ATCA 5JZBA 5J2UA 3U44B 1ZD5A 4MVJP 4ZA2A 4QSHA 1ORTA 4MICA 1ZCAA 1FX0A 4EGQA 2HPVA 4LNUA 1N7IA 4QARA 3KVOA 4BRSA 2FKNA 1T4BA 1NBHA 3TG8A 1LX6A 2WWWA 3GEMA 4Z7JA 5JOQA 4OFZA 4YHHB 1REQB 2OP0A 4HQNA 2PZGA 2YWGA 1V1MB 4ZXPA 4D0LB 1RFGE 2X9QA 3TVDA 4EO7A 1NSFA 1UZMA 4ND2A 1F0PA 4NCIA 4TX1A 4YCNA 2ZSHA 3GIWA 1TUGA 1OLOA 2XQIA 3WLQA 4DG9A 4LZZA 4JSYA 4B79A 2I6QA 2D2EA 2IEBA 3X2FA 1Z4NA 5GOZA 1T1RA 5DBIA 4C6RA 1YA6A 2Q5JA 4E5SA 4AXXA 2R11A 1W36D 5I51A 1GZVA 3A27A 4W4TA 4U2DA 3PYLA 2H9YA 3DFFA 3HB0A 3ZU2A 2VHWA 3EH1A 2V0NA 2QXTA 2YWXA 2JIBA 3FHJA 3IAFA 1VXOA 3BS4A 4ZOLA 1GCAA 1BN6A 2H17A 2IHYA 5AIAA 4D3DA 2A9PA 3OEEA 3T1HB 3FUCA 2X9NA 1DOAA 2GA8A 3O21A 2OGWA 5AVWA 3TQFA 2EKLA 1HE3A 2CXSA 5BURA 2QEQA 1CJCA 2WT9A 2ZYUX 4MHSA 1QZZA 1L8XA 3M2PA 5D00A 2VDLB 4UBMA 3KSDO 1JBQA 3T3IA 4TMFA 1RZRD 3L40A 3CUWA 1Z9BA 3OMLA 1BMFD 1XJWA 1Y80A 1Q1EA 2ZSIA 3A36A 4IQ8A 4UDOA 1GA6A 1PKEA 5FAXA 4YB8A 1YOVB 3RSOA 2I8CA 1NJ5A 1J0CA 3AFGA 5AVYA 5M5BA 2JHAA 1T3HA 1KSFX 1NVKA 2P3OA 3E7WA 5B6PA 3H2ZA 4AZVA 1JIQA 1WAMA 5FUWA 1Y6GA 4B4DA 2X5JO 4PXYA 3QE4A 1IOWA 5HE8A 1Q7RA 1W44A 2FMIA 3V7NA 2HSGA 4I8IA 2XDQB 3O1HB 1XWWA 1JKJB 1ZW1A 3DL0A 3ZHQA 5JNLA 3DDZX 4D42A 3N2KB 3NTVA 2ROQA 4TYWA 1IOLA 1QFJA 4RPKA 3ROZA 5I7OA 3EFOB 1P1JA 5L6LB 2QWXA 3MWJA 1QHHA 4B3GA 3GNSA 3JQ7B 3NT4A 4RHXA 5JTTA 3JYQA 2Z2ZA 3HP4A 1G9TA 3T9AA 1RLOA 2HA2A 4IR7A 3IAHA 5FOWA 2NVBA 1BZYA 1LRLA 4EZIA 4A73A 1QH1B 1G7TA 1MXFA 2V6JA 5FF9A 3RSCA 1M6YA 4N5NA 5KWJA 1QK5A 4O5OA 2J5QA 2NM0A 4CU5A 4J0EA 1N77A 3C39A 4A26A 4FLMA 3I4FA 1MZPA 5KI6A 4G1CA 5ABPA 1KMHA 1TJYA 5G1PA 1XRRA 3SOZA 3DVQX 4EJSC 1T10A 1T9AA 4L6IA 1UANA 5DNEA 1XZKA 4O2BF 3ZGNA 1ELOA 2WJ4A 2I54A 3FR7A 3SXUA 1FDVA 3TW8A 4GPEA 3KRTA 3O0TA 2YZ7A 4HC4A 3H97A 4X45A 3M4XA 2IUFA 4I55B 1QG6A 4WY8A 2PMKA 5AI6A 3EWIA 4YRTA 2QP9X 4I9FA 2DCUA 2C3YA 3R5KA 1JFRA 4HGZA 5ADVA 3KQUA 3KNZA 1CY6A