1DUIA

Subtilisin bpn' from bacillus amyloliquefaciens, crystal growth mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
AKCVSYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSICSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGNSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Protein Interaction Chemistry Through Crystal Growth: Structure, Mutation, and Mechanism in Subtilisin s88
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords PROTEIN (SUBTILISIN BPN')
total genus 97
structure length 266
sequence length 266
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1duiA00
1SBTA 3VV3A 3DE3X 4JP8A 2XTJA 5CW1A 5AMXA 1YJAA 1LW6E 2Z2YA 3QFHA 2W2PA 3LPDA 1TK2A 1JEAA 1BE8A 1CSEE 1AV7A 5FBZA 1NDUA 3F7OA 5B1DA 3DE7X 2SICE 1CNMA 3ZXYA 1XF1A 2WUVA 4AKTA 1GNVA 1ST3A 3AJ9A 1GTJ1 2PQ2A 1NLUA 2SNIE 2W2QA 1Y1KE 1SCAA 1GA4A 1BE6A 1TM1E 1V6CA 3L1KA 3DDZX 3WHIA 5JMOA 1PJ8A 3A3OA 4NE9A 3TI7A 1S01A 2DUJA 2XRMA 3VYVA 4BWGA 1AQNA 1R6VA 2Z2XA 1SUEA 4KB5A 1TECE 3HJRA 1KDYA 1ZVJA 4MZDA 5FFNA 1BH6A 1SPBS 1GA1A 3D43A 1EGQA 2V8BA 1T1EA 4AKSA 1YJCA 4KG7A 2QTWB 2SECE 2WV7A 4RYDA 1SUAA 4CFZA 2G4VA 2GKOA 4OMCA 5AQEA 4ZOQI 2W2MA 1Y3CE 1A2QA 2ZWOA 3P5BA 3OSZA 1SUCA 3DW1X 3GT4A 1VSBA 3PTLA 3CO0S 2WWTA 3BX1A 4LVNA 1P8JA 1SBHA 3VHQA 4C3VA 5AVJA 2B6NA 3GCWA 1GT91 3Q40A 3DE5X 2PMWB 1EA7A 1Y3FE 2ZRQA 1THMA 3GCXA 2ID8A 4H6WA 4KPGA 2Z56A 4CG0A 4DZTA 1SBIA 1NDQA 1SVNA 3DE4X 1T1IA 3CNQS 1TO1E 4OV6B 2TECE 1Y4AE 2PWBA 4GI3A 1SIBE 1HT3A 1DUIA 1V5IA 2Z2ZA 1GNSA 3F7MA 4OMDA 1TO2E 3SICE 2W2OA 5SICE 1WMEA 3DWEX 3EIFA 1BJRE 2PWAA 3QMPA 4I0WB 1YJBA 1C3LA 2HD4A 3VSBA 1AF4A 1TM3E 1Y33E 2PKCA 5ARBA 4NE7A 1KDZA 1WVMA 4YN3A 1S2NA 2E1PA 2ID4A 1AH2A 3TI9A 1KE1A 1P7VA 5JXIA 1Y9ZA 1SUBA 1OYVA 1TM7E 3VV2A 3AJ8A 5K7SA 1IC6A 1SIOA 3WIUA 3DYBA 1YU6A 3LXUX 1AU9A 1GA6A 2DP4E 1GTL1 3F49S 1SIUA 4HX2A 4J94A 1IAVA 2Z57A 3D9QX 3H42B 3LPCA 1WMFA 4K8RB 1S02A 2IXTA 4B5LA 4WOBA 1WMDA 3DE6X 1BFUA 2WUWE 1TMGE 3BGOS 4ZARA 3WIVA 1SBNE 1UBNA 3I37X 3BPSA 2PRKA 4LVOA 1C9JA 1WSDA 5ARDA 5FAXA 3DE1X 1SUPA 1OYOA 1Y3DE 1KDVA 3DVQX 1TM5E 2P4EA 4M1ZA 1SCNE 3I30X 1R64A 3WQBA 3SQOA 4DWWA 1PTKA 1SUDA 1Y34E 1PEKE 1ZVKA 2ZWPA 5JXHA 3AFGA 4Z2AA 3T41A 1SCJA 1SCDA 5ARCA 1GCIA 1DBIA 1SH7A 1SELA 1Y4DE 1AK9A 3DW3X 2PYZA 4NMXB 3DE0X 3GT3A 3UNXA 2Z30A 3QTLA 4H6VA 1GTG1 1AVTA 1Y3BE 3A3NA 3LPAA 3PRKE 5AVKA 4HVLA 2SBTA 2IY9A 1P7WA 1PFGA 1MPTA 1OT5A 1ST2A 1MEEA 1Y48E 3DE2X 3DVSX 4WOCA 1TM4E 1T1GA 1SBCA 2ST1A 4FONA 1C9NA 2DQKA 2X8JB 3EDYA 1C9MA 1Q5PA 5I9SA 1R0RE 4H6XA 3ZXXA 5JXJA 3TECE 3Q5GA 2W2NA 3EE6A 3I34X 4DJ5X 5JXGA 1SN7A 3A3PA 3I2YX 2Z58A 2X8JA 4CFYA 2HPZA 4C3UA 1SCBA 1KE2A 5B1EA 1BFKA 3VTAA 3DVRX
chains in the Genus database with same CATH superfamily
4X94A 1OVGA 5IAEA 3BRQA 1W2WB 4BP8A 4TQAA 5IK2A 3P97A 3KCNA 3LLCA 2HPAA 3PIDA 4CM4A 1C1XB 1FNNA 1JT9A 4KFSA 3U7RA 3R2JA 1UMKA 1NKTA 3M3HA 5E6RB 2VJAA 4MV6A 1DFIA 3ZZ0A 3CGGA 1OX4A 4LWQA 3S2IA 1Z4NA 2RG1A 3SFVA 1J2RA 4AVYA 2FEAA 4IO1A 3VPGA 4CV1A 3IEMA 2AUMA 3GJZA 2A0UA 4DV0B 2O8DB 2IYLD 4KMRA 1C3VA 4IILA 1ZUD1 3BCUA 1DX4A 1XP5A 3OT5A 1DRKA 3PC8A 3P0IA 5HE9A 2QTWB 4ZQCB 4GICA 4GC9A 4DWVA 2RKWA 4BKRA 4D4JA 5KYXA 4JWTA 1X1BA 3GFGA 4YRCA 3O26A 4R1UA 3THOA 1RFGE 3U44B 3DMYA 1ZHOA 5LKRA 3FMFA 3MERA 4NZZA 2BTEA 1NN1A 4JLKA 1P8AA 1PRYA 1HG1A 1S9HA 2JFQA 2Q5CA 3FHJA 3KDAA 4UULA 5ALIA 3JXEA 4IVPA 3HUUA 4UW9A 1GT91 2UYOA 4L4SA 2FG6C 2GEFA 3T9BA 4D9NA 1EUYA 1F2UB 3Q7EA 2R2GA 2NZVG 3BGIA 4KH1A 5H80A 5SZHB 1L2TA 4QTZA 5DTIA 1DT3A 1I8TA 3QKIA 3CZAA 3F5SA 2ZRCA 1HT3A 1Y63A 3QA3E 5BSMA 3WIBA 1T91A 1NNI1 2QUKA 4DV7B 4RLFA 4A91A 2D1YA 3SBDA 3AR7A 3ZY4A 3QMWA 4MWCA 4FGZA 5FBQB 1NLMA 1XRJA 3I53A 4GPEA 1F8XA 1W581 4RZ3A 4BC0A 2XUZA 4FWTA 2QN7A 2E1PA 3UANA 2GM4A 1XMSA 2EQAA 4S05A 2II6A 3K2QA 3KQMA 3N2GB 4N6NA 4DMKA 3IQFA 1SZPA 2KSQA 3E2MA 4FHFA 1B0PA 1VSUA 2KWIA 1Z2NX 1JEOA 4JROA 5FPTA 2UZ4A 2PGNA 1PFUA 2PJZA 5D8DA 4EFKA 5B4VA 4FKMA 3W7VA 1PVOA 3KFVA 1TTTA 1S2MA 2CWWA 5DYIA 5BYAA 1XZKA 5K8JB 1UBFA 4K26A 5E4FA 3U44A 1DELA 1XZ8A 3OHMA 2OV8A 2R0QC 1N9KA 3O1IC 3QMVA 4L15A 1IH8A 1I2CA 4AZWA 3H4VA 1JHUA 4BX9A 4H7HA 5FFFA 3KYBA 3WLMA 4P4SA 5JD5A 3K6SA 1OLUA 2F9FA 4CQLA 1CY1A 3UXYA 3WIEA 4CKYA 3ZDBA 3BOSA 4DB2A 4FFRA 3T1QA 4DLVA 1GIAA 3A3NA 1O9HA 4FLFA 4YRNA 4G0WA 4N47A 4OOEA 2QRVB 3IQIX 4GLBA 4X92A 4CMIB 2HBYA 3CUSA 4UEOA 1GM5A 4PLHA 1QHFA 4JVNA 4UEWA 2PGIA 5HILA 2XHZA 1M8PA 3FNRA 4RKYA 5KINB 3OCCA 4DIOA 1VL1A 1EX7A 3ABZA 1EAYA 1QX4A 2GN9A 2ZIUB 5LQMA 3UUGA 5FTNA 1UWKA 2C0CA 1WQ1R 5CW1A 4IGEA 1XXHE 4XIYA 4KDEA 3L40A 1K5GA 4E5MA 3F71A 4UM9B 1CETA 3CZCA 3TGLA 3CVXA 2X9VA 1KMMA 4FN5A 5BOSA 4Y2TA 3ADCA 4HTAA 5KYWB 1BS9A 2DFKB 4F86A 3KKEA 1U7HA 2WVJA 4YLYA 1IXYA 1Z2DA 4URUR 4D4IA 4HDOB 1FSGA 1RDFA 1SUFA 2JJMA 3QVMA 4IYRA 1R0LA 3QPBA 5ANRB 2XUAA 3LKDA 5L3QA 4G2NA 4UDOA 3DLBA 4LF7B 1JS1X 3F4KA 4FHCA 4CDMA 5E6SB 1UDXA 3RTGA 3QK7A 1U7PA 1DKLA 1FVXA 2V8BA 3QWBA 2RGCA 1CQPA 1I7PA 1MLDA 2B5VA 4TMVA 3WQSB 3T3OA 3QXHA 3C24A 1N9GB 3UBTA 5EXPA 1OW3B 3ZTTA 3HR8A 4BB6A 5KYXB 1Z7EA 1MJHA 1KYTA 5LQAA 5LD2C 1U6IA 1RYDA 3PX2A 3DWFA 5DYTA 5AP9A 2Z08A 1L8OA 2BMDA 1GXSA 1V5FA 3CEJA 3EEBA 3TDNA 2WF7A 4REMA 4CMBA 3MWFA 2J46A 3ZYCA 2D5CA 1JAXA 5T4BA 3ZH2A 3A4YA 1JV2B 4UE3S 1KJNA 1X8JA 4OSPA 4DLLA 1EXDA 2O5CA 3D6TB 2IYFA 1VHWA 2XT9A 4BNUA 4A16A 1GAQA 4X8LA 4P7BA 2OZLB 1AY0A 1E60A 1ARZA 3DV2A 2W22A 5F5NA 4BUCA 1YR8A 2H2GA 2I2XB 3ZVRA 1LU9A 4EEZA 3ORRA 3QQ5A 1P7VA 1C8BA 5DCWA 2BFCB 3NCHA 1GL7A 1OZHA 4BNKA 1IY2A 1B0ZA 5DGXA 1YTUA 1NQTA 1AHNA 1TL7C 2EGUA 4HKTA 1K63A 3JQAD 5FOQA 1UBGA 4Q16A 5CDHA 1EK6A 5JAIA 3HDTA 4FEGA 2B5WA 1SIUA 2AN9A 3A0UA 3HYTA 4KODA 1RI3A 4POOA 3VH3A 4BZXA 3KZMA 2ZM6B 2WUEA 1UJ5A 4K9RA 4BB0A 2J7PA 4OUKX 3K4PA 4N5IX 2EJBA 5B6PA 3T9EA 1D09A 2H48A 2PH1A 4GYYA 3P9SA 1Z33A 4NNJA 4IQ8A 4L5AA 2OHGA 2PXXA 1PT6A 2IYOA 3PLNA 1KO8A 1MAVA 3FF4A 2X0IA 2BI8A 5D51S 2EJCA 3HY3A 1JIQA 2XTMA 1H2XA 3GT3A 3V32A 1N6HA 2CLFB 3N59A 3EXEA 4RD1A 1LDYA 4NICA 5EG5A 1GAWA 1VRCA 5TMDA 4HAUA 1H93A 4WNIA 5DU2A 5AW7A 4NEQA 1BS1A 3LQKA 5C8YB 2OP1A 2I4OA 4OMUA 2IP1A 3H4MA 3H5AA 3HP7A 5AI5A 1F38A 1GRVA 2ERYA 3ENVA 5FPKA 3L8YA 4HPJB 2PMFA 2UZ1B 3LZ6A 1HYQA 4L0DA 1JBQA 1BH2A 4MAMA 4Q7KA 4DWJA 4Z3OA 3K31A 3C85A 1W1IA 5AOBA 4Z1OA 1JPJA 2CJXA 4NLLA 2XMDA 2X9NA 2FN8A 3MUNA 4G81A 4UBLA 4US2R 4K0RA 2QROA 5BSTA 1V37A 1UKEA 2Q6OA 1E5VA 2X5XA 3L46A 4XGKA 5FKJA 4JQZA 5BV1A 3D4IA 1KOFA 3CRVA 1A9YA 1KK3A 3IBGA 4EJ2A 3VTZA 5DNUA 1KC1A 2A5YB 1DIHA 1LSOA 2QMZA 4G6ZA 4B31A 1WUIS 3A4LA 5A5EA 2Q7OE 2ZOSA 1DJOA 1RHKA 3MWDA 2XX3A 4S1TA 2QPOA 4OQPA 1MJGA 2IHJA 3BFJA 4GM4A 3IILA 2PLNA 2BI4A 4M9ZA 4YB8A 2PQ2A 2A9FA 2VEDA 4ZOLA 5FHRA 3VYWA 3D3WB 1M6NA 4J0JA 2IWRA 3TTWA 4BWGA 1DAEA 3PNLA 3EPLA 4S1WA 2H2AA 4DTCA 4BMDA 3EPKA 1GVNB 1DC4A 3I0MA 3NAMA 5JAZA 1GNLA 4TXMA 3IUJA 4Z54A 3R7NA 2PV0A 3AONB 1DAOA 2JS7A 2PNFA 2C3OA 1ZH0A 4M4SA 2VT6A 4RTPA 5EIXA 5HTOA 3LDGA 4M49A 3RJ5A 1Q14A 3ROPA 5C3UA 4WXYB 1JHVA 4O59O 2Y68A 1F06A 2GEJA 3KVRA 2ZRDA 4O1HA 3R6WA 1MKYA 4LIPD 4YC7A 3FSGA 5FWDA 4DV6B 5F98A 1KF0A 3FHTA 4KQMA 1SKAA 4HDKA 2B6NA 3IAM1 3K8QA 4M21A 3V8QA 2Z4SA 4Q0MA 1VE3A 5JD6A 4ARZA 2XF8A 4D3SA 2ZUEA 1XYGA 3CNQS 2VI5A 1UK7A 3V8BA 2CGEA 1M66A 1T5BA 2SKCA 2XMCA 3QYFA 3CLHA 4N65A 1JKIA 4M0KA 3IR6A 5IXYA 4R7TA 3F97A 5AQ1A 5L53A 3H99A 5HIKA 3WP1B 4GI1A 3FNBA 4LGCA 1KP9A 2P0YA 3MFYA 3T3IA 3U3RA 4KFRA 1GUZA 1ODKA 1M6VB 3CWZA 4XD7D 4L3WA 4QTXA 3WJ7A 3ED1A 3FZNA 4IFBA 3HDYA 3O95A 1MA3A 2HK9A 3CJTA 1KARA 3KKOA 1AN9A 3QUBA 5CVEA 4E03A 4NV3A 4JH0A 4V1CB 3QIVA 3ICOA 2XXBA 1EP2B 2NO6A 2RE8A 1JSZA 1XTSA 3NORA 2C5EA 4M2LA 1W94A 1YZYA 3GEIA 4P08A 5GGXA 4NBNA 3B9BA 1WB6A 3QVOA 1Z56C 1NVKA 1IZ8A 2RGDA 1WXGA 4AROA 3FH0A 1L4HA 5FL7A 3WHKA 1KEVA 3OZFA 4ZARA 2DQYA 1Z63A 3GLVA 4WY2A 1V9LA 3D5EA 1XVLA 3R3XA 3K9LA 3EN0A 2JFPA 4OQYA 3KR9A 1VDZA 4RHEA 3K1AB 1JJVA 2EHDA 1DDGA 4MS4B 4NAHA 1W44A 3R3VA 3SAJA 2B1GA 1V6AA 5FEUA 2JAUA 1WD7A 2FMIA 1VJGA 1Z36A 2CNDA 2OQRA 4BKPA 4XM1A 5HCNA 4D9EA 3CLSD 5F2NA 4ZYLA 5EIFA 4OGKA 2OAEA 5EKTA 2FSPA 4P0QB 4RH1A 1XN1A 2DQKA 3DS8A 1S1CA 4K9OA 1NUQA 2QMEA 2EW1A 4H77A 2DRIA 2ZANA 4AJ2A 1RRVA 4PR0A 5E7QA 1E3TA 1LFAA 5ERYA 5ADWA 4NJMA 5K01A 2ODNA 2UZAA 2YXPX 2Z3ZA 2WR8A 3OICA 3K7EA 3BXFA 3M6LA 3KSDO 5E95A 3K9FC 4B74A 5LP1A 2JKYA 3KU1A 2VBGA 1WETA 1ORIA 8ABPA 5FX2A 4NCBA 2VAWA 4GOKA 1ZSNA 1UBTS 2VRBA 4Y2SA 2AOTA 2J41A 2WYWA 2C5GA 2ZI7A 2BCJQ 4IZOA 2PT6A 3R41A 3ZWCA 3GEHA 3G5AA 2HA2A 4TWIA 4C4PA 2JIPA 5IDWA 2ZXEA 3SDBA 3WAJA 1LLCA 1WCIA 2F3SA 4D4HA 2OLEA 3DDZX 3TEFA 4QYSA 4RD2A 4E7OA 1RBZA 1NM5A 2N47A 3AR6A 2Q6TA 2HYDA 5FT9A 221PA 2XQFA 5AKHA 1KETA 3DLIA 1WHSB 5JQGA 2DKNA 3HJCA 1JFVA 2H18A 3HVKA 1AKQA 2HA6A 1UDRA 3ILHA 4RMHA 4X1IA 4B3DA 3L6OO 3KAQA 4A2QA 4FUTA 5FUMA 2E85A 1XCOA 2QRZA 3FNFA 4FZ3A 4BBJA 1CFZA 1GNRA 1OGIA 2DY1A 1M7HA 3K09A 4WXPA 5LZ5A 4CM8A 1XWWA 4DUGD 5DSXA 1BRTA 1Z73A 5HQ3A 4UVHA 1NTRA 3F3YA 1YC2A 1X77A 1EGMB 3C7KA 1A8PA 4YQFA 1W48A 2G5PA 4AUNA 4C2BA 3ZCVA 3LLSA 2OZEA 5ALFA 2OHIA 1JKJB 5JHGB 1M72A 1GITA 4KAXA 3ZWXA 5ALVA 1FB5A 3NDBB 3AQ4A 4B6SA 2LIVA 3FG9A 4KVGA 4O4LB 3IE2A 1COZA 2PQ6A 3F8TA 4Q3AA 3HCWA 5AIBA 3HXKA 1E7MA 1KVSA 1BKYA 4TROA 4RJLA 1Q21A 5TQ2B 4M99A 4CEIB 1N2CB 3WGUA 2X14A 1I0LA 1WSBA 3C6QA 2DUUA 3NM6B 4OJYA 4AJPA 2E4UA 1XNJA 3O74A 2J3EA 2JLAA 4EPVA 1SZCA 3GGDA 1HNWB 3FTFA 4WRRA 2Y66A 4EQ6B 3BHJA 4P58A 5H8WA 2F8MA 4Y30A 3WBKA 1FE8A 4RZ2A 4JI5B 4Y0AA 5TE9A 1JDBB 1MD9A 2YQ5A 5KNCH 1FTYA 1Y6JA 2ACEA 3HY6A 5K8IA 2WU4A 1WE2A 1VCNA 3BCSA 3G2NA 3H3FA 3H42B 4UDNA 4XARA 2YHUA 4MYHA 1BXRA 2QV7A 3FY4A 3PGMA 2B69A 1AKWA 1NSFA 3C1AA 3GDHA 4PIPA 2EGGA 3LY9A 5CNIA 4L57A 4P54A 4IXNA 3FOZA 4DLYA 1YRHA 5AUNB 3ENZA 3H8JA 3IV6A 1E3DA 1GAEO 4G0ZA 1SD5A 2ZTSA 1V8OA 3T95A 1SUDA 3DDCA 4RO0A 4LTMA 3TJZA 1N78A 2FETA 1ZJ4A 3GRFA 3VNBA 3TFOA 1QIDA 3H9JA 4HNVA 3BJZA 4GT1A 4KVFA 3D64A 1P9LA 2FUG1 3IXLA 4HDRA 4HAYA 4OA5A 3RR2A 2H0AA 4KO2S 3VKGA 4U9HS 3D2BA 2IXEA 1YCHA 3P19A 4WD3A 4W9MC 1P7WA 1LVUA 1M8KA 2P8JA 4B6JA 1JEQA 3WKAA 2NTNA 2Q1WA 3A1FA 3JYHA 4OHKA 5LOVF 3Q8KA 3Q5GA 1DDIA 4UM8B 4DA9A 4E2FA 3OZCA 3LT2A 4B34A 1IB0A 2FEWB 1ZJWA 2AOXA 2I6QA 4RKWA 4JLOA 1KAGA 1E1QD 4A2PA 3X2FA 4TVSA 5JJKA 1G7RA 1Z15A 4EF4A 2H4HA 4HQOA 3TS1A 2JZCA 4GKVA 4LG1A 4MVJG 3VC1A 3CZQA 1VGRA 3FDXA 3FFAA 1B7GO 4B0PA 2VCEA 2MU1A 2C88A 4K88A 2G9QA 3T5AA 3BGWA 2GFIA 2VHJA 1NG1A 2YFQA 4OCZA 4Z9XA 3V4PB 3EUFA 4IDOA 2B36A 5IM4A 2HDHA 3LU1A 4MVJI 5J5AA 3G9ZA 1DEOA 3W5CA 1CUGA 1GRRA 2X8LA 2AD5A 1PL6A 4O4JB 5T6BA 2IODA 1NUSA 2IY7A 4KQXA 5FBWB 1CV2A 4YO8A 2ZZNA 2CYBA 1JTVA 2JLSA 1UJ4A 3LCVB 3UKJA 4LY9A 3W5IA 2GPAA 2V4ZA 4HB2A 4G1VA 4NU8X 4W1QA 2WYVA 4CF7A 1T4DA 3UMMA 3PPYA 5C1OA 1I1OA 4YCMA 1LTHR 1Z0JA 3KE9A 2V74B 1U1DA 1WDMA 2X9GA 1PYGA 4N5LA 5BWOA 5HPYB 4I4IA 5BQXA 3CVYA 1QAQA 1OYYA 1P4JA 1SQGA 3BKWA 4G5RA 4MUKA 4OXYA 1GL6A 2YCLA 1SBIA 2I6FA 2QTVA 3BH0A 2EU8A 3NR2A 1TVCA 3IHTA 3TDKA 2Y0DA 2NZ8A 1IJBA 3L7AA 4XVUA 3PC7A 5CDYA 3IP6A 4H1HA 3VI4B 2QSZA 2CD9A 1L5VA 1E62A 1M2HA 4JFAA 2D62A 4M55A 5EINA 5GOTA 4CM3A 2P3LA 1VCIA 1WTCA 1OA1A 1QK5A 2HO5A 4BQFA 3M4NA 1GU0A 1CP2A 4CT4B 1QWOA 1H4TA 3UVEA 4N03A 1PHRA 2BRUA 1MABB 3W6NA 4DF3A 1PWHA 1FUKA 3CW8X 1V3UA 4FYWA 3UO8B 2ICAA 4UTXA 5JSHA 1C0EA 1E6WA 3M3PA 1R0ZA 2G8NA 4LHEA 1D4FA 2FE1A 3GG9A 3CVWA 2R2AA 2D13A 5B4UA 4A0HA 2O3UA 3C48A 4EUNA 4I6GA 1QPBA 1JAZA 1NW3A 3OLWA 1XEWX 5F21A 3ZOZA 4WFJA 2ZCUA 1O6ZA 3P9XA 3EXAA 4NG5A 5A3VA 4O2AF 4QUAA 4BVJA 4YCNA 3TXXA 3IDFA 4RPGA 3FLAA 2AXQA 5JDIA 3C39A 1PGPA 5DFAA 2DERA 1Q50A 5KJ1A 1QX3A 4OHFA 5GONA 3AUFA 2H2FA 5EJ2A 3HNOA 3KYJB 1CUUA 1MV5A 3PT9A 4QBIA 3HB1A 2WJIA 4YRLA 5H70A 1KZ4A 4GGOA 3DTNA 1ENPA 1KR5A 2BFOA 3L0ZA 4GPAA 4HS9A 2LR0A 4Q7MB 3U3OA 2P9YA 2Z6UA 3AB3A 4RZSA 2IUEA 2A8YA 2JHAA 3WLTA 4BASA 4H16A 4O2LA 1MZPA 3QEKA 4QXQA 1RWPA 5TJ9A 2FSSA 3S99A 1XXHB 1MB3A 4OQLA 4AWBA 3ITNA 5I4IA 1FMJA 1IIBA 1N2EA 4QSMA 4UUNA 4ARIA 2XXAB 2IVFA 4EYSA 2HJRA 1XAGA 2NYUA 2ZUSA 3GLHA 3A1NA 4KQ9A 5EWJA 4TWRA 2IXBA 3T7EA 4CQMB 1P61B 3WYBA 4U7TB 5C7IO 2EHJA 2FYTA 1Z5OA 3AIKA 3ESDA 3VU0A 2J3DA 4V1CA 5IZ4A 4NX2A 3NOVA 3QWFA 1R0XA 2ZI4A 4QHYA 1YHNA 1ZIDA 1N1DA 5CGQB 3QU2A 2E4VA 1V6SA 2J67A 5EZYA 3SZMA 3WNVA 4DCGA 4FIDA 3GFRA 3FYCA 3A9VA 3GRRA 1UIRA 5HJ7A 4QYMA 3MTIA 3DM5A 5A5VA 3GNTA 3ZJ5A 1FFHA 1ZK3A 1RQ2A 4JXKA 2CVPA 3SHQA 1XF9A 3UZUA 4EEXA 4EH1A 5DKFA 3HGQA 3IQZA 4WBNF 4L9WA 1NVWQ 1IU9A 1Q3KA 2YFHA 5JH7F 3GUHA 2UAGA 1Y3IA 1X13A 3AVYA 1PBTA 4MWSA 1EFUA 3DMTC 1HQDA 3FNGA 421PA 4UE2A 1J2YA 1VB3A 2Q2VA 1DKOA 1PWYE 3GJ0A 4D9HA 4PS1A 4B9AA 4DQ0A 1A7JA 1YE3A 3S8MA 3C3BA 4KJXA 1RW4A 4GXTA 4QU0A 2GKOA 5CDTA 1J23A 3UPTA 3W5UA 3BFVA 1UOPA 1OVMA 3BAZA 3D0OA 1MX9A 4PE5B 3UN1A 4TKLA 1A9XA 5LNK6 2C61A 4X1KB 4EVRA 1CVLA 2P5YA 3HG7A 1PQPA 3WO0A 1S7CA 2HDWA 5B3LA 4B3GA 1E0SA 1W0JD 3SNHA 5CB0A 3K0CC 1K7SN 4AMGA 2YQ4A 3TQCA 2V98A 1VMEA 4PNZA 1E0JA 4XGRA 4NBWA 5M5BA 5JS7A 1Y9DA 2EFYA 1F2UA 1FCJA 2BZGA 2WIGA 2JFXA 4I6JA 4RIFA 2OA0A 4YUZA 3L8HA 4BL5A 4XYGA 3SBOA 3K6SB 3R7FA 4UBMA 4QOGA 1L7BA 4BKQA 4AY3A 3QOXA 5DCUA 1JLRA 3H8WA 5ECYA 4DARA 4TV8B 4EP1A 2GETA 2ESRA 5CCEA 4KOEC 3OA2A 3UXMA 3WMFA 3ICQB 2C4MA 2YWJA 4CMGA 1G9XA 1O7JA 4LKOA 1AJEA 4CEJA 4P83A 1R8XA 1N3YA 1P0FA 1XEXB 2I33A 3CUTA 3GEMA 3MCTA 3R5FA 1RXVA 2NU6A 2B94A 5EWMB 4YMLA 4OQDA 3WK7A 4AMZA 4W6ZA 3S2ZA 1S6YA 2JHFA 3HVHA 1JLLA 4NS4A 4YCBA 2DECA 4PLFA 2BMWA 5T67A 3OPYB 5CM2Z 1A8IA 1FOEB 1RVDA 2C5BA 1BS2A 2J3KA 2POQX 1DXQA 4HEA6 3IEVA 3GRCA 4QGBA 1VMAA 4Q4HB 3PD0A 4MDYA 5F76A 2O3JA 2ORYA 1SCUA 2GXSA 3JRXA 4RC9A 1OYOA 2ETXA 4JLDA 5CW2A 2NUPB 1M34E 1M0TA 5IVIA 4TLAA 4UCQA 2VNAA 4XVCA 2X23A 3Q87B 3ZZMA 1TRKA 4G23A 3AP2A 4MV9A 5KJCA 4BV3A 2WJPA 5HUQA 1C5KA 2EP5A 2QYSA 3DZCA 3I6ZA 4YYZA 4KQGA 2CDNA 2CF5A 5JECA 1K8XB 3CB2A 1A4RA 1DAMA 2C9CA 5EMLA 2DEUA 4Y98A 2VT3A 1U2GC 4MXDA 3V1TC 1NL3A 3VHXB 3WLSA 5BNTA 3GLFE 4DYHA 1SURA 4QPPA 1P4HA 5BURA 1E3QA 4YV1A 1FMLA 1AE1A 3LF1A 1EEXB 2HTFA 1CB0A 5K4AA 3DEIA 5MHTA 2R79A 3HA2A 1NUTA 3K9NA 3TYXA 1N8TA 4LZPA 3NNDA 1PTJA 5JMWA 2O54A 4TYNA 3A3KA 2IQ5A 2JFZA 4J0KA 1C30A 2IV7A 2RARA 4CIXA 4GI7A 1ECPA 3A4NA 1OH8A 2HIAA 5C4GB 2F1JA 4Q15A 4CBVA 5ERXA 3CR3C 3KHKA 1K75A 4UVDA 2I1WA 3L8EA 2Z2JA 4MVJP 2ZP1A 3TZLA 4UTNA 4I4TF 4YMHA 1COWA 2ZJ4A 3CKLA 1TM1E 2FKNA 5FTJA 4AIRA 4RPJA 1KMHB 1XMPA 5A4DA 1X1SA 1YZLA 2KYRA 3NJRA 3NANA 4IOLA 3RIEA 2X0JA 4QDJA 1R6VA 1WEHA 4JJEA 4PX9A 1YK0A 5BNFA 4G8BA 3V7FA 1FLNA 4WFQA 1E58A 4EITA 3GVIA 3NBZC 1OLXB 3OQ1A 3ZHTA 2FQ1A 3WL7A 1F8UA 3CN9A 3E81A 4KE6A 3ANLA 1Z0AA 2QTHA 4IX1A 4OTZA 4OKNA 2EEZA 2FXVA 3AUUA 3E9RA 3QVWA 3UG6A 1UIMA 2V5UA 3D8HA 2CLCX 3ZGOA 1DEKA 3DBIA 4BV8A 5BN3A 2ZJ0A 2QRPA 4YGYA 3GWZA 4RVFA 4RENA 3CPHA 5JZOA 5JJIA 2XY4A 2D1TA 1USVA 3ST7A 3PTAA 3JQDA 4JI3B 1RXWA 3KWLA 5ENDA 3T15A 1Y1RA 3K6JA 1Q1EA 4MCJA 3QXGA 1DI0A 1HOXA 4NXMB 3EPPA 1G8GA 1VMIA 3QVSA 3WMWA 3THWB 3K8OE 1HDZA 2ZFUA 3QKWA 4E4RA 2OE2A 4MV1A 5CB8A 5IH3A 1ML4A 1T6ZA 2HU7A 3DVLA 3GFFA 3NALA 3M6WA 4F1KA 1XZBA 4LBYA 3V7NA 5IAKA 4CODB 2WHYA 4FHEA 3RIMA 3JWJA 4PX5A 3GDGA 5GM2A 3E7XA 3H5VA 5IJWA 5IKPA 2PJDA 4ZO8A 3OM9A 5BOVA 1EVEA 3IHLA 1RRFA 1ESNA 1E2DA 1JYSA 1WKBA 4OHVA 4BNHA 4YUYA 5DYNA 2C97A 1EE1A 2WOJA 3D5TA 4FNMA 4TSKA 5B7NA 4NMMA 1TF2A 2G9VA 2WTMA 2JLXA 3E9NA 3KQVA 3OM1A 5DMHA 2YIJA 4JKOA 1KRXA 1VSQA 4GOJA 1XZQA 4N5NA 4PS0A 3MJSA 4IW3B 2AYYA 2ROQA 1X7YB 3T1NA 2O8BA 3LHDA 2UXCB 1C1YA 2H2WA 2VPPA 4LISA 5HYVA 3FSEA 2DPXA 2I2DA 4DMFA 2PX8A 3U4HA 3LDHA 3WLJA 5B58C 2F3RA 3JPWA 1QVRA 4RKQA 4TTAA 1C0PA 2Q0SA 2D54A 3DBHA 2BFFB 1GGKA 3WOHA 4FZJA 4ETIA 2PBFA 2JD2A 2G6TA 3JWEA 4GGMX 1ORTA 4QEKA 3JQ8B 1NAHA 1VHTA 3F46A 1JKFA 2HQSA 3QLUC 3UWMA 1UAAA 2HXSA 3OQIA 4LYGA 2GK3A 3JY6A 4M1QA 1XWFA 3I1IA 4ENWA 3LYHA 1YDMA 4BWVA 2RD2A 2Y1LA 1JALA 4LC9A 1OI4A 1L0BA 2AK2A 1CY6A 3ZWWA 1KAHA 1HWYA 5B36A 2WUGA 3JYPA 4BVFA 4U4AA 3UJBA 4CM9D 1AMUA 1DZIA 5C0OE 3RCBA 4D3ZA 1ZVVA 2A88A 2NWQA 4CM9A 2OPBA 4DCOA 1I3OA 3UBMA 3N2GA 3GP3A 2RB4A 4YV2A 3GPDG 4L8YA 5FOTA 2RSLA 1CJVC 4UJ5A 4PNHA 3QFHA 5ESRA 3FJ1A 1O1YA 4ETNA 1DXYA 4M46A 5EMMA 5EGNA 2FZEA 1WS6A 1RNLA 2EG5A 3ZWNA 2ATEA 1L1QA 4CM4B 2FWMX 2GD2A 1E9EA 2Q5FA 3SZGA 3OX4A 4LQDA 1ZAKA 1WTAA 5FWYB 3WHIA 4BMNA 1XRLA 3L1KA 3QUAA 1T8YA 4V03A 1YOBA 4J0DA 3RH0A 4FLMA 1T2EA 5HZHA 1Z6YA 3ETLA 2J9RA 1O95C 4NBSA 4LY3A 4R81A 1SPBS 4EVSA 1II8B 1JVNA 2BDTA 2BM0A 2OKCA 3EYWA 1PDOA 1HR0B 2BGJA 3IQDB 3LF2A 4DCSA 2SCUA 3B6KA 1FX1A 1YE5A 2BH9A 2AH5A 4CF5A 4DMHA 3G2IA 4G67A 4MGEA 3M2TA 3KX2A 3M6IA 2R6GA 5E9QA 3N8NA 3H2JA 1E2UA 3HLYA 4NQRA 4YP0A 2CNBA 4EABA 2BGRA 3KM0A 3TUZC 2A1UB 1SOAA 4U8GA 2AWOA 1S3GA 4FD2A 3DE5X 4Q1AA 2E87A 3DDSA 4WNAA 3TL6A 1N34B 4HDAA 1G8HA 1OB5A 4LZAA 2XBLA 4NJOA 2PWPA 2JGAA 3BIJA 1BEEA 1JKJA 1V9SA 3UXEA 2YY5A 2R00A 2VJNA 4H3SA 1ZVQA 2ZT8A 1E79A 3VOAA 4C4AA 5GZ6A 2P1DA 1C3XA 2FUKA 3B1WA 4Q6BA 3JAKB 3P0FA 4M1KA 3C4JA 3EIHA 2IA5A 4KREA 3D0QA 4B87A 5A7GA 1BN6A 5JSYA 4E33A 4JP1A 2YWBA 3HUEA 3RBAA 2W98A 3AYXB 3C7AA 4HDMA 4BLPA 2QP3A 1TJYA 1GQ2A 1KXJA 1F0KA 4MVXA 5FQOA 2PZFA 3QGMA 1DAGA 3GLUA 4E13A 4UNRA 1Q1QA 4UD6A 2ZAOA 2FGJA 4OHMA 4MP8A 4XM0A 4HGOA 4J1SA 4RTSA 1A96A 2MJLA 3AEZA 4CDGA 2IU6A 1D2EA 1HNXB 1XQXA 2DG2A 4B3JA 3LT0A 3CZRA 2YZ2A 3OUZA 3FX2A 3SQMA 3VNRA 2EQBA 1KRHA 5J1SB 3WKEA 2TMDA 4U63A 4YDQA 4HMPA 3G7SA 3AU9A 1NYRA 3FFWA 2W7TA 3H83A 4J2OA 2WTBA 3SQOA 3T5BA 3VC7A 1MFZA 1FU8A 2G5CA 4DPKA 3K8ZA 3QVKA 3WTBA 1ZW6A 4ZJZA 2J09A 1EXWA 5T4HA 4CTOA 2ZS9A 3KD3A 3Q3JB 5IC5A 1BVRA 1TI7A 5ALTA 1F3OA 2NADA 4LCEA 3TLXA 2GLXA 1YL6A 4M98A 5DBIA 1HYHA 5EKUA 2VSQA 4BGIA 3ESBA 1AUVA 2DSTA 2JL1A 4JJ4A 2WHPB 1Z7BA 3L7NA 1O8BA 1ZDMA 3HEBA 2EKDA 3KE8A 4X7PA 4BJHB 1KERA 1QJ4A 3ZWYA 1OZ0A 3SR4A 4YECA 4MYDA 2GN8A 3PUZA 2CJWB 2QRQA 4IS2A 4NH0A 5ERGB 3RC3A 2JGLA 1R0SA 1EX1A 1QIMA 2GEVA 3T7TA 2HQOA 2JI9A 3ZLVA 1KEPA 1T9GS 4ODIA 1ADGA 4RCVA 4IZ6A 3ZHZA 2IIPA 4FJ1A 4IGAA 5LXTF 1NPDA 1R8YA 1J70A 1P1JA 2H4ZA 2WC1A 2FWRA 4N6OA 3ZDZB 5ISMA 4K6KA 3PCXA 4LW8A 4C5AA 1XCJA 4MAFA 3THYA 3TLZA 4XOUA 3FUXA 5HS4A 2QJWA 2VXOA 1BMQA 4Y1RB 1GNVA 2EBUA 1P2GA 3ANNA 2AG5A 3KSBC 2W48A 5FADA 2H2DA 2ODWA 1B2RA 1YK1A 2ZYTX 1CDOA 3IP3A 3A3OA 1YJ8A 1FMTA 1VI6A 4IJ6A 5E0KB 1RRGA 4CG3A 4OYHA 1E6LA 4B3CA 2AR7A 1ZMRA 4OGFA 2IXAA 3IJ5A 4FGKA 1NBMA 2CYAA 3T7DA 3GC6A 1MNQA 4GFDA 1YJCA 1U02A 3TIVA 1APBA 1M7BA 2JJ1D 4YRMA 3KPUA 5IM4F 1CUEA 4KPEC 4A2CA 3DB1A 4FX5A 1AN0A 3ZHOA 1BWPA 1A95A 1DG1G 3A1DA 5BWLA 5KNLA 3K9HA 1P3JA 4HWGA 1N0VC 4J7UA 4RMGA 1A0OA 4BEWA 4KXMA 4RVSA 4KFCA 1DTWB 3BQ9A 4L08A 3INTA 3W5BA 5A4KA 2XRYA 3R7DA 3MMPA 4EUHA 4AM8A 3E5MA 1CRLA 3HYRA 3NS7A 1E5QA 2G36A 3NEJA 2VPYA 2Q45A 3A26A 3FWHA 4N0DA 1LJ8A 4GHWA 4RLSA 1I0IA 3WICA 5JEDA 4FFBB 3AHGA 5FI5A 1NURA 1MX1A 3O9ZA 4RQAA 4F7DA 3B6IA 4YJ3F 1NY5A 2DR3A 4N49A 3AL2A 5DH9A 1E5TA 2P9HA 4KO1S 4LYDA 4XUCA 5C81A 3IR5A 4YHHB 5I4KA 2FMTA 1FFYA 2Y67A 1QDEA 3UT5A 2DBZA 3DOUA 3D2CA 4J6EA 1D2RA 2CDAA 4QU9A 1E66A 2ZCJA 1PR9A 4CIVA 5G41A 2BR3A 5CH8A 1YAJA 3CVVA 2LDXA 2BFBB 4BBPA 4DV4B 3LQYA 4MIEA 3D8TA 3UT6A 2IYTA 1FUEA 1HDGO 1NW4A 2KI5A 4PLZA 2A1IA 5GAJA 3L0SA 1CUBA 1VOTA 4FIZA 1HKUA 4KXLA 1U3DA 3M4YA 1LGYA 1QH8A 1ZI8A 2O3TA 4M7PA 4QM6A 1IQ0A 5AVSA 1L4MA 3BXPA 3RTEA 1CG6A 4H3KB 4MTLA 2C3PA 2ZI9A 1L8XA 4L95C 2JGFA 5CX4A 4X0EA 5EXXA 4QIHA 4Y7CA 1MEJA 2Q6LA 2QZZA 1I10A 5EJ9A 4JMLA 1S8NA 4ZAVA 1HL7A 4NNOA 3TQFA 2CFCA 2F1HA 1XMJA 1L5HB 1VTKA 2DOKA 2GAIA 3NFYA 3E18A 4WN9A 3NTUA 3TO5A 3O3NB 4RQUA 5SZKB 3PQ8A 3AIMA 2V8OA 1KJQA 2PWZA 2FDCA 3A6HA 3OF2A 3I39X 1DEHA 1T0IA 1GZSA 2I66A 3FFTA 3G59A 1ST2A 1JFTA 1AXGA 1UWVA 1HI9A 2GZMA 2RGGA 3PI6A 5JI3E 4DNXA 2HNBA 2WHPA 2A5JA 5A04A 3L9XA 4HDMB 4IDQA 3UJPA 4IL5A 4OXNA 5KEIA 5JC8A 3OF5A 4AUKA 2BSXA 5LBIA 2I71A 3REQA 5FP0A 4I9HA 3VDQA 1E96A 4DNFA 1EUZA 4EO4A 2W6JA 5BUQA 1ZJZA 1HL3A 5JNRA 1JHPA 4QBTA 5AK6A 1FMCA 3HVJA 1J99A 3DZBA 3GJ5A 3IX7A 3B6JA 1NE2A 4L76A 3GGCA 4KK3A 5TMEA 5TPWA 2YWGA 2VDWA 4EAQA 1MHTA 4PLCA 4BIMA 4HGYA 1CY2A 1D0IA 1K08A 4G4JA 2O20A 4DDMA 2W43A 4HVLA 4DMMA 4IJVA 3RYFB 2ID9A 4R1PA 2QMQA 4NE2A 2KQUA 3TOXA 3O8RA 1E4OA 1X8KA 2DZDA 4RPLA 1L5GB 1YASA 4NDAA 2Q4EA 3OETA 5BMVA 4OGGA 3B36A 3RJ9A 2PVSA 3JQQA 4NL4H 4AMYA 3GFVA 2MYPA 3HLTA 3ONVA 4J3FA 3RSQA 3BK1A 2CN1A 1NNSA 3PFIA 3CMCO 1EGHA 1PKEA 3W9BA 1YZKA 4W5TA 1U8ZA 1Y1SA 2ZWOA 2GBLC 3W5JA 1AHPA 3WGJA 1GV0A 2C5SA 3H2HA 1WMBA 5AW0A 4KACA 2X86A 2HPHA 2SKDA 3AOGA 1D9XA 4FJ0A 3ZGXA 2PUHA 4ZVKA 5JADA 4JD5A 4DDVA 2JLVA 1BX3A 3DTVA 4Z0PA 3UEOA 4I1VA 5J58A 1PFWA 2QENA 5AKYA 4HC4A 1X7XB 1WB5A 4DC9A 3LWNA 3OFJA 4F4FA 3I6YA 2I3AA 2WM8A 4PYMA 1VE9A 4XSGA 4XPIB 2XRZA 4JJZA 2FOIA 1OXVA 4PAMA 4ARZB 4CU5A 2AMLA 3B7GA 1QQAA 4LMBA 2V1UA 1Y0BA 2CMGA 3ZZUA 1V16B 5HA5A 3N5KA 1CZNA 2MSWA 2ZJAA 4PGHA 2K5UA 4NBUA 2VLIA 4PAOA 1V8FA 1GPLA 4BFYA 1JMVA 3BA1A 3OD5A 2E48A 2QPTA 5AW4A 3EVTA 4BYGA 3AINA 1GUFA 1ZX1A 1IXKA 2IXGA 3JALA 3AHHA 1Q3TA 4Q39A 5JAPA 3EGXA 4MKHA 1NHGA 1RQLA 4LTDA 2VKTA 4M1EA 4QUDA 3MWYW 4NATA 4ZVSA 5GMOA 4FB4A 4Q1FA 2ZBDA 5AW1A 2ZRKA 3MPOA 2XWBF 5FB3A 2EWMA 4IHQA 4ZOBA 2P8SA 3ZV7A 2NV6A 2X1HA 3KUXA 2WSSA 3I1FA 4N41A 4EFNA 1AS3A 1GY8A 2BM8A 2K4MA 1KDPA 3BE4A 3K6KA 1ZBQA 4KN6A 4GAEA 1RI2A 4J75A 1E7WA 4KQCA 5IDVA 2RONA 4QXRA 3HS3A 4QSHA 2C9OA 5AM5A 1V43A 2GN2A 1EWTA 3L6RA 1QG0A 5EZ5A 2QVLA 4BFXA 4DMLA 4S2UA 1NFRA 3K15A 3TD9A 1CY8A 2P4EA 3SEFA 3G6WA 4M60A 4YAJA 3QPAA 2Q0QA 5I7RA 3KPWA 1UWCA 4U7DA 1PUXA 2GCIA 2O5EA 5IN5A 4BP1A 2E1RA 4RFSA 1E2NA 1D7AA 4LC1A 1JTEA 4Q66C 2QHXA 3JQGA 4IHJA 4D5GA 2ISQA 4L5CA 3RS3A 2OD2A 2EIXA 3IMCA 3MHPA 2FFBA 2WU3A 1RWNA 3C98A 4K6HA 3RNOA 5HXAA 2ODAA 4G0QA 2PJUA 3E9YA 1VBFA 3B9RA 5D3ZA 4A1FA 4WZ6A 1GPNA 1ZCBA 4RVDA 5F1YA 4MSUA 3CE6A 1TJ3A 2OBNA 1DWQA 4K3UA 1XCPA 1G3RA 2PUGA 1W47A 2AUTA 3B52X 5MN4A 1NNEA 3HCDA 2WUFA 3WDSA 4JS0A 5AK4A 3G23A 1DKNA 3L6DA 4PVCA 3R77A 3SJUA 2NQTA 4QPCA 2IS2A 1FFSA 3BYZA 4P7KA 5BOSB 4CE6A 1G5HA 5HOEA 3WYFA 3NYRA 1VA5A 3EOAI 2PR2A 1NYTA 1U8CB 4TYWA 1H8HA 4YUAA 3SX4A 4CMEA 2RBEA 1B0AA 2BF4A 5FJJA 2ZBGA 4KUHA 3E03A 2WFZA 1YRQA 1IVYA 1CIJA 1ESDA 1KZ1A 3MILA 4MQEB 4PTYA 2BEKA 1I3MA 5LSAA 3ONWA 1YWGO 1JLSA 1JDJA 2O4CA 4I3GA 4KP7A 4IIHA 2KX7A 4KB5A 4XJTA 5DV9A 5KSWB 4MZDA 3AEXA 1P0QA 2BLLA 3CLVA 3PXDA 1J2JA 2AK3A 3QG1A 2QXUA 3ZDQA 2JNWA 1XMVA 3TTTA 4AJNA 5T6MA 2BMEA 1VGQA 3PQ2A 4IIJB 3NVDA 4LRSB 3LUFA 2GRUA 2XMZA 3AFNA 4JJGA 4E09A 5EKXA 2DQSA 3GPIA 2GNOA 2YW9A 1SQFA 1E5XA 3DBHB 1ZXBA 3THSA 1J7JA 2KLBA 3IULA 2ZTUA 1N6RA 3TIXB 5TNXA 1OXMA 3OZWA 3PQ6A 1QFJA 4IGKA 4CG0A 4GNRA 1EH5A 4OPMA 821PA 2IZ1A 3OZTA 3AM1A 1XE3A 4PCLA 2VF7A 4NHOA 4AZ0B 2JLWA 2C96A 4EY4A 1BWQA 4WZBE 3TLYA 3VO8A 3NQ41 4OQNA 4D5EA 4QXOA 4YMSA 5AKLA 3H9BA 4DCPA 1U5BB 2VJPA 3IE1A 3C7CB 3L7YA 5F3RA 4AICA 5DCYA 2B8WA 3FTCA 1R6AA 4MGIR 1G7SA 3ENNA 2X1MA 4N3NA 1KKUA 2CCJA 2QTZA 2V45A 5TV2A 3I4CA 3ZNNA 2LXNA 4B75A 3V7WA 3DH0A 3PITA 5HIMA 2ANBA 3UUFA 4G0NA 1Z8FA 4E5PA 3EBOA 1GA6A 1T2CA 3DVAB 3GJQA 1ZCZA 2R87A 4GS5A 3UOGA 2DQ4A 4PGAA 3AUAA 1AKVA 2XVYA 5FOXA 3RLFA 2CXHA 4Q4HA 2W2VA 3OQNA 1P5RA 2EZTA 2FFJA 1GRCA 1TW2A 1VL6A 2XKBA 3OMXA 3PEFA 4RA9B 5EMHA 4N82A 3ZQ4A 4EZEA 3THXA 1JPVA 1LPAB 3AQIA 1YDWA 1W5BA 3G88A 4N3AA 4OQZA 2V4MA 4DY4A 2QG4A 3VR1A 1PEAA 1N5RA 4K9KA 1TXGA 1F51E 2X22A 1IJEA 2ZSDA 3HJTA 3BCHA 3I8SA 4PQEA 4PV7A 1VSTA 3JQAA 1PLLA 4IWYA 4JJ6A 4JUFA 4TN1A 3RYHA 3F73A 4UHDA 2O2HA 2VPTA 5CVDA 2D2EA 1KDRA 1SVKA 2HQ1A 2X6RA 1I4TD 4IEEA 4CUKA 2JH8A 1YMUA 4F8EA 5B7PA 4G0YA 4Y1EA 1TEHA 1Y3BE 2GAOA 3EDCA 4YV7A 1U8TA 5K51A 2WDPA 4BBAA 2BP7B 1OU4A 4PLGA 4XFJA 3T1TA 3ND8A 2HJGA 4L8LA 2CV0A 3VJRA 3R7AA 1E1KA 7AT1A 4NBVA 2ZROA 5G2OA 3HB4X 2H9IA 2UUOA 2XMGA 1PEDA 3ESYA 3IDOA 4KVAA 1IM5A 4OY3A 3MQ4A 3IP1A 5AJWA 5CBPB 5JJCA 3N7AA 1XDGA 2I4RA 3VR4D 4RS3A 3DB2A 4AK9A 4BO5A 3OU7A 4PG4A 2OWEA 2XV1A 2ZBQA 3UWKA 1XT6A 2YN0A 5B55A 3CNEA 3U4IA 4D2IA 5ITWA 3SI7A 1RPZA 2HBZA 1UBUS 2XUQA 2Q1YA 3KXPA 3P27A 4LRYA 3TXYA 1GDTA 1JA0A 1C30B 5CDUA 1U81A 2JAPA 1KZ9A 1XJQA 5CJJA 1GG9A 5KAPA 4O8CA 3ZVNA 3CO5A 1SNYA 2R6DA 5T57A 1EFPB 3IBTA 4A6XA 2Q8PA 3EUWA 3OUUA 3FLEA 1NAIA 2FJPA 1U04A 2FMUA 3IVAA 3MTJA 4F9GA 1KAEA 1A9OA 1OLXA 1XZFA 3R24A 4QAJA 1OGYA 2J07A 1DIGA 4XGIA 2G1AA 1UUFA 1Y7PA 2MYTA 4TOIA 5IS2A 1GA1A 5ALQA 3LYAA 5HIJA 5DN9A 1H2FA 4UTVA 3HDJA 1D4OA 1K5HA 3LP5A 1P9WA 4FOPA 3VPAA 1I30A 3BE8A 2GAAA 2VDKB 4R2HA 3D7SA 4RXUA 5DMXA 1YCFA 5M7EA 1QNFA 5HP4A 1Z2PX 2QJRA 3ACBA 5KOJA 3KTAA 3UJHA 3ZVMA 1KFCB 4CLOB 2W58A 3C3KA 2DWCA 3SYNA 4D9MA 4K1LA 4QAQA 3NWPA 3U09A 3BIOA 2KBFA 3RJTA 2H1RA 1Q7EA 1VPTA 1PQYA 2H7CA 3QHQA 4EYEA 4TTIA 4K0KB 5L7YA 1ZNQO 2B0JA 3VSEA 4CJXA 3DHVA 2OCIA 3VC3A 5LMNB 1IUOA 1E77A 1IL0A 2BI7A 4BGVA 3LXXA 4LOAA 4F12A 1ONBA 3IBYA 3INRA 3K73O 2IU4A 3O4FA 3KXIA 4KYIB 3PHGA 1VMDA 1PNTA 3WFIA 2ZIAA 5IBCA 1BYUA 1YC5A 3AEQA 2ID4A 2V0CA 4JA0A 4WL0A 4L4RA 1YS2X 3WIDA 3GP5A 3TAXA 2YMPA 2OGUA 3Q98A 5HF9A 3W8RA 4XWAA 3FM9A 5KX5F 2BT4A 4MKGA 2P4SA 3DBRB 4NG4A 1DBWA 5HG0A 5JS6A 3A7EA 3DF9A 3FCOA 2I1QA 3H5LA 4EENA 3QLJA 4QNMA 1CT9A 4E14A 2FX2A 3SZOA 1SCUB 4J0HA 1PN3A 1KYVA 4HDNB 5JWRA 3OCYA 1T43A 4QFDA 1UBNA 3OKPA 1SQ5A 2FW7A 3LC7O 1ML3A 4Y0VA 9ATCA 1RYNA 2R11A 4BNLA 4M8LA 5B6IA 3IV9A 5LLTA 3HYNA 3G17A 3SLGA 3VAZA 1KY4A 3HYSA 2EC5A 3DMDA 1N6OA 1P7ZA 4M3NA 1U2GA 4JU8A 4IDHA 3U4DA 4DIFA 5I8PA 5JSZA 2D0PB 5EIHA 4Y2RA 1J0XO 4R0VA 4XWWA 3DMPA 3DTYA 2I76A 1MOPA 1EFVA 4DRYA 4EG1A 1C2YA 3HBAA 4R2JA 3W79A 4A0RA 1IOWA 2NTVA 2ADFA 3CB4A 4HH3C 2Z3VA 3ECSA 2GESA 2PVPA 3MJTA 3VNAA 5FI1B 3G5LA 5SYMA 4N7RA 3MFQA 1NQWA 3AO0B 4JY7A 5CX1A 3Q3EA 4XVQA 4ZCQA 3EE6A 3FFBA 1CR4A 1QHHB 1B8VA 3ZIUA 3CVJA 4EYKA 1J00A 1PR3A 3U61B 5HFNA 4CKBB 5LM3A 4CEJB 4YH1A 4OB7A 4N5DA 3II6X 3L6BA 2D3WA 4L78A 4XIJA 2G82A 4Z7JA 3HBNA 3DDUA 2C0PA 1LX6A 5FBKA 4GLJA 1QAMA 3IQEA 2IPMA 1JSLA 2NNLD 3VA7A 1T9HA 1WZUA 1Z74A 4JELA 4WWHA 1JJIA 3ETEA 4JLSA 1HLPA 3UAYA 1R9MA 2H4WA 1GTJ1 5GZ3A 1MP0A 1T3TA 3EC7A 2WUDA 1YZGA 2YWCA 3JW8A 3K2IA 4ZODA 1DV1A 1MCZA 4J76A 4B6PA 3TSOA 4CYMA 2GZRA 3C3XA 1QC5B 3LI2A 3OECA 2JK0A 4PG6A 4RJIA 3TSCA 3VKVA 4FB5A 2BH2A 3AF6A 4H0CA 2X8AA 1F0NA 3KWFA 4R98A 3ZTYA 2DU8A 1R37A 4H31A 1T1EA 1ZNWA 2Q3HA 1OIWA 4P0PB 1DOZA 4RTLA 4Y6LA 3O4JA 1M1YE 3JQGB 1JHAA 2XYGA 3PIRA 5J3JA 1LS1A 1VLJA 1K27A 5FTKA 5L40A 1J9GA 4NYJQ 1X1RA 3AWDA 1P4AA 3JR7A 1ULBA 5FR1A 4TTRA 1FZTA 1RS0A 1P5HA 1Z2AA 4HAWA 2FN4A 4DJEC 4B3TB 1P2SA 1RXSA 2QR3A 4L6IA 2GM3A 4R1LA 4RGQA 1FRQA 1UODA 1HEUA 1W29A 3EQ8A 2P6RA 2Q27A 2XZTA 5AOAA 2XVZA 1IEVA 1IUPA 1PSWA 1Y5LA 4GP9A 1TO1E 2VRCA 2IOHA 1ZPDA 2ZSJA 4IIFA 4M0MA 4IUDS 4XM2A 2PMBA 3QEAZ 4KTVE 4MKRA 1C0IA 2HSDA 2JKZA 3KELA 4OHPA 1XTBA 4UAUA 1N2JA 3DWEX 4B3BA 5JNUA 1I3CA 3LHIA 1RJWA 1ONSA 4TMWA 2WK1A 2Z9CA 1FU7A 1B6TA 1NU6A 3L8MA 4EGSA 2UYGA 4QO7A 1JIVA 4ZP1A 2TMYA 4GVPA 4YI5A 1P75A 3BBPA 4C7VA 1KEKA 5BSGA 3W90A 2B35A 2XBMA 1NQAO 2CHQA 2C77A 3FAKA 5JDCC 1RXEA 3DAGA 4F5EA 1TLLA 3W1WA 2OLJA 4KV9A 2HT1A 2QNBA 1KI1A 4DGQA 1C3OB 4YT2A 1IPEA 3B1KA 2PN1A 4YJFB 4XJVA 3UFXB 4D46A 4QOFA 2L42A 4AKIA 3I9NA 1W5SA 1UKAA 4G0PA 4XCQA 4YAIA 1IIRA 2H31A 5C5IA 1YIDA 4Z4IA 2O7NA 4Q3BA 4GF5A 1JAHA 4HH4A 4JOSA 3EGCA 1E20A 3T7RA 2E82A 4EHAA 2XE7A 1FDIA 1OFTA 1QGYA 4Q3DA 4AY4A 4MCHA 2VQ6A 1ZM9A 5D5HA 4DIMA 5IC6A 4XXHA 5EXTA 1OYWA 1DAIA 3GOHA 5B7QA 3G8BA 5D1HA 2BGGA 4L50A 1ZVKA 4NPCA 3V2UA 2IEGA 3FZGA 5AXCA 4LQCA 1PSZA 5KZMB 3JS5A 3LX5A 1WQ4A 3B7PA 5KJ6A 2B8NA 4QVIA 3JQRA 1H2ZA 1JYEA 2I2AA 1KJIA 1W49A 2HRCA 2WI8A 4ZHQF 3U60B 1QIFA 3RRMA 2A5DA 3EVFA 2XF2A 1XMOB 4H1VA 3F5DA 1CY7A 1QQ5A 3I3SR 4Z2YA 1TT7A 1JXMA 4PYIA 3DDOA 3B89A 1GNPA 1F7VA 3D6VA 2PO7A 3PNBA 1RJ9A 1T1GA 4H1WA 4EJFA 1YRBA 1ZNXA 2ECKA 2XB4A 1IOLA 2ACWA 1RM3A 3QVXA 4JC0A 1H6CA 4NCHA 4R1MA 1AG9A 3UAXA 4KLZA 5KX5A 2QSJA 1CUIA 2NPIA 4V0SA 2ZI6A 3C6KA 3H8SA 1USGA 1R0KA 4NENA 3NHFA 1PT9A 2QT1A 1NQOA 1OXTA 1GFSA 3HHPA 5EOVA 3AVVA 5JS1A 4BECA 2J59A 1N2CA 2NVBA 2ZBPA 1OBVA 1VI2A 1W35A 5KHLB 3FOBA 4DXDA 5WRFA 1QNLA 1AXEA 1T0HB 5AHKA 4AKHA 4E2ZA 1L7MA 4JHXA 2OV6A 1K6IA 1DAKA 2C42A 4FOSA 3K5PA 1JFRA 3RADC 4Q18A 3KS9A 3A1SA 1Z62A 4ZRDA 3RHSA 4AJEA 5CLJA 1EFVB 4IIJF 2W6ZA 5EP1A 2FPGA 1YQDA 1XZPA 4UMDA 1J22A 4D9CA 4KIFA 3PCRB 3QIAA 3PVZA 1L5FA 1DE0A 1H3EA 1MBZA 3CINA 1S8AA 3DGFC 1W87A 5TGTA 3AXTA 2ZJ1A 4B8WA 2A0KA 2XCQA 5ED4A 2XA9A 3CZMA 3GT4A 4M36A 4W6QA 2G70A 4R8KA 1A8HA 2J0EA 2FQXA 1UM9A 2O3SA 3A9WA 4E46A 4KNWA 3ADDA 3C6ZA 3EXHA 2IPLA 4E5UA 4D57A 2FI1A 3ANMA 2OPHA 5CA1A 5JZ9A 5L95A 3QXSA 4OAPA 1IM2A 3L7OA 4YT8A 2QI9F 1GKUB 2VZ9A 3NONA 2AN4A 3HNPA 5CGZA 3N2KA 2QD3A 5G0VA 2GQ0A 4U3JA 1Z5WA 3OFNA 1NNUA 3OZXA 5HVNA 2QG6A 1AV6A 2VRCD 1EHYA 2I8LA 4RV9A 4TM7A 2GFQA 2ZUTA 2KE5A 2CLMB 2B4TO 2EKQA 1ZICA 1KE1A 3TQQA 1L7AA 4OM8A 3WL8A 2GJ9A 1JXAA 2HCFA 2O57A 2Y1KA 3B48A 3DHEA 1TUEA 3PKZA 3DYBA 4MJLA 3CCCA 3PG5A 5TSDA 3OJLA 1E18A 2VPIA 3GLHB 4DCCA 1GTL1 3BHIA 4WACA 5KSPA 1RRKA 3EG9B 3B3FA 3ZJ4A 1ZWLA 2Z57A 3G9XA 2VO1A 4C06A 4JUAA 1RZRD 4WJZA 1T3SA 2L0XA 3FUUA 4MNTA 1K7YA 3ROGA 3JQ7B 3NUGA 1T4CB 3UXHA 4EKYA 1SHLA 2CE2X 1SOWA 1GZHB 3HA3A 3H17A 1LK0A 1LLFA 4J0EA 4LECA 4MB0A 4DANA 2AOTB 4GE0A 4S24A 4BEJA 2YIDA 2H1FA 3QEMA 4PGMA 4Q1CA 2MDTA 2BLNA 2X1VA 5J5CA 5AVVA 4UNNA 3RSHA 2YTZA 4EKIA 2ZE7A 2VHTA 4DMUB 4EELA 4EGAA 3U5TA 4MVJE 3JZAA 4WEQA 3B1JA 2IEAA 1OFVA 1Z6GA 1DFHA 2NYVA 2JJ2D 3REOA 1JMKC 3MWGA 4IEFB 1KJWA 4V0ME 2IL1A 3ZUGA 3ROFA 5GJWC 4COOA 2C8JA 3IALA 4WBNA 4FCTA 4OF4A 4UTRA 1J21A 1UP4A 2ACKA 4NH4A 3JWPA 4IJQA 3EQ2A 3CEAA 4KLAA 3WJ2A 2PS0A 1DNPA 1UMDB 4M7OA 3C3PA 3COPA 1WP4A 4C0KA 5CAEA 1HDOA 5JD4A 1M34B 4LZWA 2VP0A 3VZQA 3I04A 4HXFB 2IYYA 4HN9A 5I7OA 1FUUA 1W7AA 2HPZA 2M6SA 4TRNA 2XKJE 3K5WA 4WEOA 1NVTA 5C1IA 1M74A 2COKA 4EYQA 1T3GA 5D3KA 4BMOB 2IY8A 1YB5A 4JVOA 3UGQA 4EHLA 5JW6A 5FUBA 2GRJA 3HVIA 4UU7A 5DM4A 4B3FX 2WSLA 3U16A 4XDYA 4HX5A 1JIXA 1NC1A 5DK6A 2Q4BA 4PHHA 2C1XA 4IWNA 4ZDJA 1T4CA 2QZPA 1XQVA 1ZO8A 3I6BA 5LD2B 3B1FA 3GLFA 3MAAC 2ASVA 1J8QA 3KZOA 5GPBA 4OK3A 3LYLA 2PTGA 1WHSA 2PZJA 2I55A 3AI2A 3I2GA 4ZHQA 5JQGB 1TECE 2AKYA 3G0OA 4MPJA 4OK5A 3NUQA 2CLEB 3N6VA 4CCAA 4DWOA 1WNFA 2O2IA 5AESA 2DWQA 1VC2A 2NSHA 3VR5H 3GGSA 1YS7A 3WK9A 2UVQA 3QG5A 2X5NA 2VBFA 3E22A 3QF7A 2FSHA 1BWRA 1JI0A 3BXEA 3DW1X 3KT8A 5AHXA 1FTQA 4AY6A 4HUQA 4EO9A 1MW9X 4MDFA 2XAUA 4PLTA 3M9LA 4DNPA 3FBGA 5AKIA 1UZMA 5JFTA 4G5OA 2BMJA 2WAYA 2XUPA 4I46A 3UCEA 3FIJA 4B6GA 1WCXA 3WLOA 2VBCA 1Y42X 1F5SA 1GARA 3DUWA 3LO5A 3P9NA 3TTVA 5CA1B 4LJ4A 2DFDA 3GGOA 5CD9A 1XCGB 3KZNA 4BO8A 3BXOA 2QUBA 1US8B 1TO2E 5JNTA 3F6PA 4XPZA 1XOIA 1SKYE 1K4KA 3PB3A 1TF5A 5G0TA 1G3IA 2W00A 4Y2XA 2ZYWX 2VJMA 1EG2A 2IS6A 1HZZC 2FA9A 3ETHA 5H68A 2PKEA 4DM4A 2QUZA 1G2PA 5F2EA 5JY1A 1DXHA 2ECPA 4L3OA 4D9GA 3HKCA 4WHMA 5JO9A 4ZO7A 5IABA 1F4PA 3B53X 1YZ3A 1Z25A 2CNWA 4GOXA 1ACMA 4CIAA 1SWWA 3OZSA 1EJBA 1PV4A 3KLOA 1IULA 2O8CA 1IN8A 1ZMTA 1TADA 1E2IA 1IZ9A 4MDHA 2J5KA 2V6BA 4X71A 3CQ9A 4PIMA 3M9WA 2ZRMA 4CTMA 3ICEA 1F4LA 1G8JA 4UMFA 3QOWA 3K1TA 4LDZA 1O9BA 4GPIB 4CETA 1ILEA 2FEKA 3C1UA 2AV6A 3K0EA 3LAWA 4R8MA 3TRDA 5B3KA 1QFSA 2ZJ7A 4LF9B 1G8PA 1UEIA 1UBMS 2NNWB 3ER6A 1Y1TA 4BZPA 4NWIA 4RPCA 3AL0C 2WINI 3GQBA 1JB1A 4ZCMA 1R7RA 3EB9A 3I83A 4AXBA 3BWCA 1EE9A 3GG2A 1POXA 1CHDA 4JXJA 2IBTA 1QRDA 4MPPA 1DBRA 3JQAB 3MVEA 2V7EA 4G1UC 4U2CA 4S0ZA 4YRSA 2I6GA 4TKZA 3HCPA 3RS8A 2E4AA 3VHXA 3ZIAD 4TV9F 2D2XA 3PL1A 5CVUA 4YRRA 1F48A 1W9HA 3DVSX 2FV8A 4QD3A 1COWD 2BEWB 2OZPA 5I51A 3TINA 3K53A 3Q4GA 3I04M 4KNVA 1KO4A 2COUA 3RJMA 4NS1A 1QH1A 2O52A 4JKIA 3MJFA 4I3FA 5IZCC 3ON5A 2VL7A 5CA0A 1EXVA 3LZCA 3QLTA 3S0JA 4C0XA 3A0RB 2CBXA 5KVAA 1CIVA 2BSAA 3LPLA 4IMIB 1N25A 4R2IA 5IJXA 1DIRA 4UKDA 1QG2A 1IUNA 4CMCA 2FHSA 1CULC 2VWHA 3QVLA 4BAUA 2R1UA 1SOVA 1Y8RB 2JLUA 4F2HA 4B44A 2QAGC 2ZVJA 4PG7A 2RHGB 3CISA 4HI0E 1QYDA 5ALMA 2OQVA 4EPXA 4ZYXA 3HM9A 3FCXA 4JT8A 2Z2XA 1B73A 4XRGA 2AA3A 4ARCA 4XGQA 5CFRA 4FEYA 3PUWA 1WUHS 3L0IB 3S2UA 1AZLA 3Q3GE 2FK8A 3DUFB 3QWAA 4Q48A 5P8WA 5FWNA 4MI9A 3H1PA 3NHWA 2F3TA 3RVDA 1OI2A 2FEOA 2KBEA 3L05A 4I1IA 1M6YA 1E7RA 1HMYA 1N1GA 2ZQ5A 3FKJA 5I5GA 4ERXA 4D81A 4Y9SA 5B2FA 5BNWA 5KWEA 2CC2A 3LPNA 3VYRB 3B78A 4Q9JA 2BBOA 2FWPA 2ZR0A 3V80A 1WAMA 2VHYA 2JFWA 2Y05A 4RVGA 4RBNA 1HDCA 4Z3KA 4EHDA 1Z0IA 1UKVY 3S55A 1H1LB 3M5DA 3DMGA 2ZUDA 4BGUA 3NI2A 1XHLA 1PL0A 1XUOA 2V6GA 4P7JA 4RE5A 5IM5A 1ZCFA 4PTZA 4UEJA 3U4QB 4B3IA 4QOSA 3TW8A 3PDHA 1T0PA 3KJIA 3CX7A 1U7XA 4FP9A 2YDXA 4WCFA 4ESOA 1GUBA 1K3UB 4BBZA 4EB8A 5KREA 1CXZA 1PZNA 1E2PA 1E3LA 1GGNA 1P1CA 2HD4A 2QU8A 4QX6A 3V7UA 4BRZA 2O8EB 1N2ZA 1JEEA 3H6HA 1QPGA 2GS9A 3CSUA 3KZVA 1U28A 1YQWA 1Z4IA 3OG9A 1PX0A 4IF6A 3V1MA 1FFEA 5GVSA 1U3VA 2GNPA 3KSUA 1QH9A 2WOOA 3AYZB 1I2BA 2GJ8A 2Z2KA 3CYFA 5KDDA 5CJ2A 5J2TF 1QF7A 3BSWA 2H7XA 1Y4ZA 3O1LA 2OL4A 1MEOA 1UM8A 1XDDA 3CA8A 3MOIA 3H19A 3R20A 3MC1A 1THTA 4NU0A 5CH3A 3WWDA 4IIGA 1G5FA 3OX1A 4BJ3A 4DDWA 1P9NA 3MD9A 3R8CA 3CSDA 3HCOA 3RTAA 3DM9B 3PC3A 1OXUA 2XE6A 2B21A 2YCBA 1G0NA 3MT8A 2DHRA 4CFSA 3SD7A 4B8ZA 4CL0A 4FFPA 1CIPA 3SVTA 2WBLC 2NAPA 3AESA 1E4VA 4P3OA 4IHJB 4B6RA 3G0BA 1MMFB 3AFGA 3W2FA 1YR2A 5CNJA 2CVQA 1U2EA 3GGJA 4H59A 1BC5A 4KX5A 2IYZA 5ARCA 4GZMA 1LPMA 3LXMA 5AW9A 1MG5A 4EO7A 5HQTA 1NY6A 1C14A 1XTUA 3DE0X 3FA2A 4PZEA 2TMGA 1EVKA 5EQDA 3LKVA 4KN8A 4P4LA 4KZPA 3VM6A 5DX0A 2OESA 4G1FA 3U4QA 1ADBA 2Q5EA 1ODFA 4ZPXA 4JP5A 1TM4E 1UC9A 4RABA 1X80A 4PZPA 2X8JB 5LA6A 1KJZA 2CLHB 3EW7A 5C9ZA 1NN3A 1WLYA 2VT7A 1M9NA 2X8JA 1SIWA 5LA6B 3UH0A 5FXMA 1OHHD 3GVXA 4KXVA 4NAUA 4C4RA 5DCLA 4CV0A 4E7PA 4F4IA 2FRDC 2G28A 3EZ2A 3ZY6A 3S2FA 2M9MA 1D4ZA 2IF2A 5EZYB 3ZHVA 4MGZR 3K70D 3GUVA 3WZMA 4DLXA 3FCUB 4HRXA 1DJMA 2PZGA 3TSWA 2UZ3A 4FDTA 2H5IA 1KI7A 4MIOA 3AUYA 1YQXA 4OOFA 3NHKA 1Z6QA 3MMSA 2UZ0A 1UFRA 2O2YA 3AWIA 4UEKA 5COQA 3RFVA 3RS5A 4EHHA 3MTQA 3AT1A 3TQOA 5ALOA 3VSDA 1DDOA 1ZFNA 2WT4A 2ZRIA 4EI9A 1ZM7A 3F98A 2Y6VA 2FWIA 2XDAA 3B5EA 1E6UA 3LLMA 5FNVF 4C0BA 4YUXA 4FHDA 1EA5A 4O0LA 1CUJA 3AG5A 1CWUA 4XLLA 2OZVA 1ZYUA 4ZEVA 1EJ6A 4OFBA 2P2CA 3RIHA 2I67A 2J5RA 3SKYA 3H11A 1QVAA 3CS3A 4RFSB 3REGA 3LQQA 4A73A 4DIKA 5IDQA 4B7XA 2XYHA 2AF4C 1WBDA 3DAFA 5IXJA 2A94A 3DKRA 1WW3A 4INAA 3O8BA 5C7YA 2AQIA 5A4FS 5G3ZA 3EFOB 3HGMA 1UDBA 1PJRA 3C8UA 3PYLA 4PICA 1DGQA 2ASEA 3CO0S 2JJ8A 4UM7A 1Y7TA 2IYRA 2QMUA 5A4JA 1JA9A 1U0JA 3OCWA 5F73A 521PA 3IKVA 3U7JA 2PANA 3NHUA 2OKGA 2QJFA 3DTVB 3QE3A 4D0NA 3JQFC 2LDBA 1NJFA 2TECE 2Y2VA 4FC6A 4E4YA 4A6EA 2FE4A 1WU7A 3H0KA 3IP7A 4ZDIA 3O38A 2A57A 4DNQA 3OQHA 1R8JA 4H35A 4YP9A 4A0FA 2IEBA 3WGYA 3MCAA 1JU3A 2HMTA 3CLTC 5FLEX 2VHQA 4D6PA 5LUAA 2GMWA 2XZDA 3GVPA 3ID6C 1XEXA 3OT1B 4JUDX 4WXEA 4EL0A 4YN3A 1GEGA 1XBTA 2BZ0A 4FMCF 4WCFC 5KNDA 2O8EA 5C8XA 5LVAA 4DKJA 1SUBA 4TTJA 1XJ5A 1VLVA 3PQ5A 3L7BA 3IMEA 5DRYA 3WWPA 4Q4DA 2VTBA 1Q0ZA 4Z4CA 4LHYA 1OKKD 1QRRA 3I05A 2NVWA 3Q0EA 1PZEA 4DDUA 5E7IA 2VPZA 3P2KA 1W36B 1EEHA 4HWKA 1U9CA 4TTPA 4UAJA 4G8CA 3OEHA 4I55B 2PKRA 4LN1A 1CQWA 1V7QA 4JLPA 1P6XA 3TPCA 3OJFA 1EVJA 3VH1A 1A88A 1A5TA 3U1BA 2W6PA 4X61A 3OCJA 2C9ZA 3MJRA 4IDPA 2YXBA 4I5FA 1YFJA 4PHGA 3DZIA 2R8ZA 4IIXA 2Q2WA 1P5JA 2Z04A 4LJKA 4X65B 4X7RA 4GMFA 1LRKA 2REXB 4FN4A 1N4AA 5A1JA 3T7JA 2AFHA 4RIEA 3FPCA 1U3GA 3NVAA 4N8DA 4XLZA 3TZBA 2WG1A 2E6KA 2HLDA 4X00A 1K86A 3EIEA 3NGLA 4CKCB 1HSOA 3MQ2A 1T9CA 6ABPA 4R54A 4TZ0A 3VMMA 1P5FA 1PWXA 4LZZA 4YLGA 5EIAA 3U80A 3PWSA 4D44A 3R40A 1VJRA 3OHSX 2C54A 3SC6A 1N6PA 1M2GA 2YV3A 4CM7A 3ONNA 3KV3O 1ZITA 1L6IA 2VAXA 3JD0A 3QXJA 4DV5B 3R09A 1YUNA 4YJ2F 1NPYA 4R3WA 2DLNA 5REQA 2XUIA 3U31A 4I6EA 2IHNA 1L7NA 1J9ZA 3NJ8A 2OXFA 2R8OA 3KLBA 5G1PA 3PXGA 4ER3A 5KTSA 3RC9A 3K0CA 3BWDD 5J43A 2AE2A 5FPHA 1XTKA 2HRQA 3UGKA 1IZ7A 1QMPA 4JBGA 4RHFA 1Q0TA 5KYWA 3EZLA 3HB5X 2OO3A 3HU3A 4LYEA 3W2HA 1JHOA 1Z88A 2OZLA 1TAHA 2GYWA 5KNBD 3EEQA 3FVWA 1S2IA 5BN5B 1ZNYA 5U1PA 3UHPA 2CK3A 3G0GA 2ZDHA 4HUJA 4UUPA 2FF5A 1YVEI 1JVBA 5KTNA 1OV4A 1W85A 4FCVA 1WCV1 4EMBA 1A71A 3RB8A 1NLZA 1E9SA 5E2IA 3UFBA 2ZAMA 3CNBA 3E23A 2DTDA 4QO8A 1KK1A 5EA2A 5TEVA 2AOVA 1QQTA 4RVOA 1BH6A 5FPSA 4L85A 2CMFA 5A9SA 1Z28A 2JAXA 4PO8A 2C2YA 3FOEC 3CRZA 3BZWA 4AYXA 4CFZA 1QCZA 2GTPA 1DMSA 3WYDA 1CQZA 3LFTA 1RP7A 2HZ7A 3QITA 4MARA 3K1YA 3WWZA 2FQQA 1YVUA 1FUIA 1L9XA 3COJA 2FPPA 5KOYA 1N36B 3RUDA 1ZZGA 3BZUA 1T2DA 5FL7D 3A70A 1GEEA 3EZXA 1W1UA 2WE7A 5DGDA 5KIAA 2MSEB 1DQPA 2PEZA 2DQZA 4FVTA 3MCZA 1D3AA 2DKOA 3ULKA 3LOUA 1GYPA 4RF5A 4FR2A 3LC0A 3AP3A 3Q10A 3R7LA 4YRPA 4B17A 1PYDA 5JVDB 3YASA 4C7OB 1XLUA 4GDMA 1U63A 4PFQA 5E6RA 4WBNB 8ATCA 2C3YA 2ZBVA 5AJUA 4RNCA 3ASZA 5CXXA 2Y9MB 1BCRB 4PZUA 4L4ZA 4W9RA 2C84A 2YMMA 4ND3A 2P67A 2MR5A 3QPCA 4Q3CA 5LB4A 1I5EA 4PSDA 3VO9A 4M9RA 2WJ3A 2Y1WA 3ISVA 4FEAA 3HM2A 4FE3A 4NYJR 2FDXA 3AUSA 1W9MA 2WFMA 3IQXA 4U2EA 4URFA 2BPOA 4WLNA 721PA 2H06A 1L9KA 3TL2A 3AW8A 1L1EA 6ADHA 2XE4A 4HQLA 2C00A 2DY0A 5JBNA 3DBLA 1C1DA 3D6AA 4P4GA 3G2QA 3TW6A 4D0RA 3EEIA 3ZHBA 1MGOA 1SEPA 3AB8A 3THYB 5JT1A 4BRWA 1FJGB 5SY6A 1A5ZA 4G26A 1JQ5A 4P3PA 3MGCA 3R5XA 5BQPA 3RT7A 2RHOA 3I64A 3RVSA 3T4PA 3G7NA 1XC7A 4I14A 5E2BA 4FMDB 1Q2XA 1DKQA 1M73E 1MH1A 4GI5A 4JLUA 1HMPA 4JDPA 3T3DA 5HM6A 2G83A 4URYR 1Z2OX 4GSLA 2J30A 3IFSA 2G7ZA 4X64B 4I2VA 4DNOA 4RIIA 4O4LF 3QKTA 5EVCA 4YRKA 4F60A 5JVDA 4C7OA 1Z0SA 3MD0A 3OWHA 4QELA 3M4ZA 5DBGA 3I9LA 3OM8A 5J9FA 4F6RA 4GR4A 3OOWA 3LW7A 3PYMA 4PC6A 1PUJA 3UMYA 4X8HA 1T2AA 1E9BA 2QRJA 2DJIA 4UVGA 2V7VA 2XLBA 3EAFA 3FJYA 2GHQA 2OCDA 1SN7A 2UVPB 4UHCA 4YJFA 4C0HA 1C41A 4R5MA 5CAEB 3AUXA 1QO9A 1G5PA 4FFVA 4P22A 5GY7A 5LPNA 5H1YA 5JHHB 1NMQA 4BFVA 3PF9A 2VHUA 3UPDA 1R15A 2BKUA 2P27A 4UZEA 4LJAA 2P30A 3INNA 2VH1A 3NHMA 4V0OA 5JTTA 2KJQA 4YCLA 4RPKA 1IXRC 4DR7B 1KS2A 2FR0A 4JJIA 3ZYZA 5BW4A 3D7KA 3DEHA 4WFIA 1BA2A 4ESHA 2EKLA 1GQYA 1DX6A 4Q3LA 1RWVA 3T9DA 1UCFA 2NYAA 3WLEA 3A9CA 3NBYC 3OA0A 4BRUA 2BKEA 1Q1BA 1JAIA 1UJ2A 1KFKB 3AJRA 5CR9A 1KDYA 1TIBA 2GBPA 1RHRA 1XTPA 5BSHA 1RQPA 2WMNB 3VNQA 5LDDC 3D43A 4A36A 4B2YA 4ZU6X 4X44A 2C4NA 2VJDA 5HZMA 1KORA 2EATA 4YCSA 3Q8MA 3I2KA 4HQNA 3AOEA 4K05A 3Q7SA 4WZBB 3ZKAA 1P91A 3NBKA 2FSGA 3KXDA 4BO4A 4I5DA 2VRNA 5A02A 2AG8A 4D9BA 5DHTA 4YAWA 2ZUWA 3KXKA 4WJLA 4PF1A 1M1UA 1RLMA 4M7WA 3AU8A 4ER0A 4R2WA 4KVZA 2RAPA 4I2NA 5JZVA 5ADVA 4KPGA 1F9AA 1NVGA 1M3SA 2QN6A 1EINA 1H5QA 1NDQA 1OT3A 1UJBA 2CXSA 3O9MA 3PFCA 1DTWA 1K9VF 1E3WA 4IS3A 1TYZA 4QBGB 1WJGA 4U7PB 3L07A 5MFZA 1SIBE 1N2XA 3AETB 3WGTA 3ME5A 2W2OA 3T06B 2EFCB 1BJRE 1T3HA 3WGNA 5KMGA 4ED9A 3KB8A 2VC2B 4N3GA 4OSOA 3VISA 4XE5A 4Z9BA 1ODIA 5G40A 2FCAA 2GZ3A 1KDZA 4D0SA 2X5OA 4OAQA 4YO7A 1PR4A 1NHWA 3K9CA 3I61A 1SA0B 2H16A 4FMBB 3VR0A 4XH9B 3NXSA 2ARKA 2H59A 2RH5A 3A2LA 5DWQA 2FMFA 4QJIA 2Z8XA 3LCMA 3MZ0A 3I52A 4FFSA 1E6MA 5AXAA 1H69A 3HY4A 4ZVLA 4P0TA 1N75A 3VHLB 2ONKA 4FDAA 1DAPA 3JQ7A 3PD7A 2C9DA 2W6IA 5HFJA 3HI6A 4IZHA 1TE2A 2FH5B 3SZRA 1AGXA 2Q5OA 4P93A 4PHCA 3T9CA 3KJEA 3WMEA 2JA1A 1B43A 4RMIA 3FDZB 2JDID 4PC7A 2UUBB 4LQ4A 2Q0XA 3TGPA 4N9QA 1U94A 1NW5A 3ANYB 4H0FA 2KB0A 2VPQA 2QMHA 1OH5A 2DFPA 3EGWA 3RUEA 3DF7A 1MFPA 4OQ4A 1U3FA 5KAMA 5KOHA 1XWIA 2OENG 3BSSA 4GYJA 4Q9AA 4RDCA 1XLWA 3EBPA 4HPXB 5A5FA 2PNJA 4NMXB 2ON6A 2ZWVA 3VZRA 4YT5A 2AI2A 5B12A 3UJ8A 2R84A 4BWFB 4LX8A 3PEWA 4RH3A 5AJXA 1X86B 3P9CA 1XAHA 4RPHA 3W6OA 2X15A 5KU1A 2ZT5A 2PH3A 4EPTA 2WM2A 1LK7A 1P6QA 3G9UA 3SIRA 4YUWA 3QEBZ 1B3BA 3F7NA 3ZJVA 5GV8A 2BJHA 2X0NA 2Y4OA 4QBHA 4C29A 2WSYB 2I1LA 3LJKA 3DFUA 3OOSA 4UD2A 4ZQBA 1KZHA 1KE2A 1G20B 3BMQB 2EOAA 2DFNA 3A6KA 3HBLA 1KBQA 2RCYA 3L2OB 4ND4A 4ALNA 1NLYA 3NM5A 4NENB 3KEGA 2GVNA 4C07A 1X1DA 4U7WA 4MA5A 1HLFA 3CXUA 2GF9A 1MPXA 1JDBC 1IATA 4G07A 2VQEB 4JB0A 1BN7A 2EL9A 1R5JA 5J4LA 3VU9A 2INGX 3EDQA 4WECA 2GERA 2WZDA 4FNOA 2ONYA 1Z0DA 2IPOA 4BAZA 2EW8A 1G59A 2UYQA 3WWYA 1KP2A 3DZJA 2WKPA 4X1OA 1JIJA 4UEQA 4YRZA 1I2AA 1QYXA 4L16A 5A1TA 1GN9A 1ZN7A 4OIFA 4W7HA 4DSNA 5J4KA 3HWX1 2AFHB 1NI3A 1GG8A 2GJAA 1QCCA 2P9JA 5TX7A 1LY1A 1B6GA 4O4IF 3LUGA 4FHGA 4HB3A 1KPGA 3QXXA 5FOSA 2WFAA 5C5CA 1SUCA 3C45A 3SF0A 4TVBA 2H8KA 3OF3A 4JLAA 4IUYA 2F8TA 3TM4A 3MPUA 2NN3C 2HA7A 5IAGA 2X4IA 2J5QA 4RIHA 2RGXA 2H1WA 3EBLA 1EB9A 3U9SA 4DR4B 1QO0D 2EWVA 2FKAA 1JR3A 2GARA 2JASA 2OFWA 2ZR9A 3RIGA 3H1AA 1H1LA 3G9TA 2RGNA 4YDRA 1SPXA 2O8NA 5IW8A 5EXEA 1YV9A 1UFVA 4M0CA 5CTAA 2YVLA 1E0KA 1EUDA 1HEYA 3QSGA 3A6PC 1NN0A 3BDAA 3DMFA 1T1JA 2JK1A 3VYSB 1MVLA 3HZZA 2G71A 3RVOA 1DIOB 1UQRA 3U49A 1M6VA 1IB6A 1WZEA 1ZSYA 3AK4A 4GSYA 4TL8A 3R7SA 3X1WA 4YAFA 5BN1A 3KPJA 4JVSB 1A8UA 3SYTA 3OTWA 3H8VA 3D31A 1J8MF 4PQGA 4HQKA 2P3SA 4QATA 4ZXFA 2D0DA 4X6UA 1X7WB 4ZREA 3RF7A 2GZDA 3MJ4A 4OHCA 5AH0A 1VZ2A 1TU0A 4F96A 4WOBA 9LDBA 5JZMA 2YFYA 2C78A 3WNQA 5K0TA 3EQZA 2E5FA 2QIPA 2E4XA 3NH9A 3FTQA 4U7JA 3ISTA 2I2WA 1N77A 2MINB 5LYJA 1DG9A 3MWEB 1GKYA 3GK3A 3MG9A 5DM2A 2QB5A 2H17A 1T9KA 1Z6AA 1SG0A 1BXKA 1QIEA 1W4LA 3IKMB 3ITEA 4MYRA 1HK7A 2RH9B 3Q7QA 3EZFA 3WNCA 5AI9A 4DKXA 4LK3A 2I4LA 2EF1A 3TW4A 4D8WA 4C5BA 2WY2D 3NOXA 1XD8A 3VC2A 1P2FA 4U1RA 2Z8ZA 4JC8A 4AO6A 2GPTA 1RYZA 1NYQA 1RQNA 2PJRA 5DW0A 4JBWA 1ZUWA 3DXXA 3OOJA 1MX3A 3CPJB 2D3TA 1DL5A 4N12A 4R1SA 1QH0A 4P32A 3MCUA 3UF0A 1H65A 1KIAA 2AR0A 3OLCX 4ZAZA 4I55A 2BKXA 3VTAA 1XNQB 2PQMA