1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN HHR23A
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
2DNAA 2QHOB 2LTUA 2HWJA 1WIVA 2L2DA 3GLIE 2OO9A 2L4FA 3LCVB 3IHPA 2KHHA 1R4GA 1DO2A 3F92A 1HJPA 3MMPA 4HEOA 4WP2A 1WR1B 3E21A 1SG9A 3FRIA 1IXSA 2JZ1A 1JR3E 3GLGE 1C7YA 2DAKA 1MN3A 2KNVA 2LVAA 1AIPC 2CWBA 1XB2B 2EKKA 1HT1E 3K9OA 1VG5A 2O25A 2OOAA 3E46A 2HAKA 2QNJA 2ZTDA 1OQYA 3GLHE 1V92A 4DBGB 3GLFE 1DO0A 1UFZA 3BBZA 2KNZA 1DV0A 2EJSA 1WJ7A 1E94E 2JUJA 3FE3A 1QZEA 2JZ0A 2JP7A 1ZMWA 1WHCA 1ZMVA 1P3QQ 3T6PA 2CP8A 1G41A 2JY7A 3K9PA 2MJ5B 2LVQD 1TR8A 1XXHE 1G3IA 1BVSA 3LCUA 3H4JA 2K0BX 2WZJA 2LVOC 1OAIA 1VQ1A 2DZLA 1Q02A 2LBCA 1T43A 1CUKA 3IECA 2OOBA 2G3QA 1GO5A 4Q7JA 1KYIA 1A5TA 1ZMUA 1T6OA 4R71A 2BWBA 2H5XA 4G3OA 1IFYA 1NV9A 2B3TA 1F4IA 3B89A 2LVPC 1Y8GA 2K9DA 1ZV1A 2R0IA 2MR9A 2DKLA 1WGNA 2DAEA 1EFUB 2JY5A 2RRUA 1NV8A 1OKSA 2JY8A 1PGYA 2LVNC 1HQYE 1G4AE 1VDLA 2KNAA 1VEKA 1IM2A 1WGLA 2DAMA 2JY6B 2MGWA 2MROB 4F1IA 3FRHA 2DAIA 2BWEA 2DI0A 4UN2B 2DENA 4GEWA 1HT2E 1YLAA 1OTRA 5JI2E 2DHYA 2L4EA 1VEJA 5DFLA 2QSFX 1VEGA 2DAGA 4F2LA 2ZTCA 2EKFA 1TTEA 2JNHA
chains in the Genus database with same CATH superfamily
4G4NA 3L26A 3SAUA 3FTEA 4AG6A 2R6FA 2WSCF 1IXSB 1HNWM 4IBFA 2APLA 3FD9A 3FUUA 5F3WA 2R18A 2EO2A 2L4FA 3LCVB 4B7FA 1L1ZA 1RU3A 1E32A 2R4EA 3HY5A 1EE8A 3HHXA 1R4GA 3GRRA 3F92A 1HJPA 3MMPA 4KT0F 1MJGM 1N78A 3W0LB 2R44A 3TWKA 3VKGA 3KSJA 2JXNA 2HHHM 2XF3A 3OTOM 3U6PA 1TGUA 1ZQ9A 1QAOA 1Z5BA 2FH0A 3THGA 1Z59A 3GLHB 1XB2B 4FWHA 4W5WA 4DR7M 4FCTA 3BOSA 2OOAA 3QWLA 3E46A 4MGHA 4Z6YA 3GLGB 4IBBA 4M0DA 2CEAA 2EUCA 4L78A 5E6JA 3GPXA 1Q3BA 1GL6A 3HU3A 4AG5A 1G59A 2Z4SA 5ITTA 1OQYA 3MHVC 3GLFE 4GITA 3ZC7B 3K92A 3GRUA 4IIWA 4LRTA 4G4RA 4I4LA 1KFVA 3LMMA 3DA1A 2EJSA 4MB7A 4EIWA 4KHPM 4XGIA 3FE3A 1QZEA 4JI7M 1QAMA 1TDHA 2XSZA 3UZUA 4WURA 4BB9A 3KOXE 3PXGA 2HL7A 2CP8A 3DZDA 3C58A 1PJIA 2LWXA 4LCBA 1L1TA 2VF8A 3L27A 3L29A 3HJSA 4DR3M 2X8AA 2BJVA 3LCUA 2KDLA 2K0BX 1YSYA 2QP9X 5KQ8A 3U6EA 2ZBKB 3AOGA 2LH0A 4NRVA 4JV5M 3FKEA 1K82A 3KP0E 4L15A 5EQTA 4L16A 4QNRA 4FW9A 3HHYA 1T43A 2XSZD 3IECA 2OOBA 4MGKE 3KXEC 3HJ8A 3SASA 4Q7JA 4JI0M 4FWDA 3J80S 5KPZA 5DYGA 3GLGA 2CE7A 3NBXX 4R71A 4II7A 4R3DA 2H5XA 4LGMA 1IFYA 1NV9A 4IBJA 4DV2M 2L09A 1QANA 2D7HA 2DVWB 3B7ZA 4AKHA 2QZ4A 4X66M 1GVNA 3AFHA 4M9ZA 1OKSA 1N33M 2JY8A 3W68A 1IXRC 5ITRA 4JI6M 1JR3D 4P16A 2HKJA 2FOIC 1QDRA 4L6V6 4NOOB 3V76A 4B7GA 4PDIA 1OFHA 4LF5M 4X62M 2M60A 5IZ7D 3A42A 3GLFB 3AOEC 1IN4A 3NWLA 1VDLA 1HNZM 4CJ6A 4LJAA 4NSOB 2C9CA 4GIPA 2MROB 2MGWA 1VEKA 4MGIE 2F4VM 5LMUM 1K3WA 2DAIA 1SXJA 2DI0A 4DUYM 2F5OA 1HT2E 3HJQA 2F5NA 2FE8A 1GABA 4X64M 5KPRA 4RF1A 1H6UA 5JI2E 4DV3M 4B3RM 2ZAOA 3CF6E 4GRIA 4JI5M 2XZUA 3SHFA 4L8RC 1XHBA 2DZNB 1J7KA 5FTJA 2ZAMA 3GO8A 3U6SA 1IY0A 2JNHA 1E94E 2YQZA 2DNAA 3AKZA 1D0MA 2CV0A 5A2QS 2QHOB 4NC6A 3Q8GA 1NJFA 1IBLM 1JQJC 1WIVA 5EP3A 4DV4M 2W82A 1SXJD 3SYKA 4PDGA 2C9OA 4PD2A 3GPYA 1QQWA 1Q39A 3WHLA 3AOEA 5BR8M 1NY5A 1DO2A 1DGBA 3KP1E 1QYRA 4DR6M 2V6ZM 4WP2A 3FUXA 1WR1B 2CFOA 1HQCA 1JR3A 2JZ1A 2QENA 4GC5A 3MK6A 1W5TA 4D81A 4IBKA 3K1JA 1TH2A 3DFZA 2DAKA 4B3SM 1FJGM 4KO8A 1MN3A 4M0WA 4BLCA 3CTWB 3JR4A 1AIPC 2GQFA 3KFUG 1I94M 2O5RA 3HZJA 8CATA 1NO1A 4TUWA 2HAKA 4REZA 1WXQA 2XZFA 3RE8A 1W5SA 1IN8A 2LHCA 1N32M 2BJWA 2QBYA 5E26A 3HHZA 1DO0A 1UFZA 2XGNA 5EXPA 4MM3B 1LTMA 5FTMA 1TH3A 4DV0M 4PT5A 1WJ7A 4XBOA 3T38A 3W67A 3UGJA 4LF6M 3W0FA 2JUJA 5ITUA 5FTKA 5EXSA 2UUCM 2JP7A 1ZMWA 3KW6A 3T6PA 3L25A 1G41A 3VDUA 1N75A 4DV6M 2UU9M 3UJNA 4IBGA 3SAWA 3R9XB 2V1UA 2L7IA 4I8OA 2Y20A 4B7HA 1G3IA 2CHGA 2YFQA 3GLIA 2WZJA 2Q2EB 5ITXE 3KVWA 1XC8A 1VQ1A 2DZLA 4IBCA 4RF0A 1CUKA 2G3QA 4RKUF 1GO5A 2P5TA 1IY2A 1KYIA 2GNOA 1OAOC 2KEBA 1L2BA 1PJSA 1R6BX 2NQ8C 3M7GA 2RGHA 2QQ8A 2LHGA 2XFTA 3HX3A 4FD2A 2OQ4A 2BWBA 4G3OA 3GPPA 2B3TA 3T15A 1F4IA 1Y8GA 4NXMM 1TH4A 1EFUB 2RRUA 3I4YA 3U6OA 2UXCM 1NVMA 3TWMA 2FNAA 2LVNC 3Q8XA 4AW4A 1Z5CA 4I81A 3J27B 4CGYB 4AQYM 2RKOA 3SMSA 4G4OA 4LJ5A 2UUBM 1OIPA 2JY6B 4IBEA 1GJSA 1NNUC 2J5YA 4GC9A 4QHSA 2M5ZA 2BWEA 3PNYA 4F1IA 3GQ3A 1IXZA 3PNVA 4AZFA 4IJFA 4K0KM 3TWLA 3GLIB 1VDDA 1QZMA 4OVZB 3IG8A 1YLAA 3IG5A 1J5EM 1OFIA 3SBJA 1DGFA 1OTRA 4FWGA 5KPTA 3FTCA 3HU2A 4MGYE 1QVRA 1DGGA 1VEJA 4KLNA 2YR0A 3I4VA 4CIZA 4DR5M 4AKGA 2DAGA 4A3VB 1R7RA 5L8RF 4LFAM 4OX9M 3I04M 1TTEA 3QYBA 4LJ4A 3U6CA 1XMQM 1V33A 3U5ZB 4LFBM 2C98A 3SHGB 2LTUA 1NSFA 2HWJA 5IWAM 4LY6A 2L2DA 1T3TA 2R65A 3FTDA 1TDZA 2OO9A 4IBDA 1R2YA 3IHPA 4G4QA 2CHQA 4G6ZA 3E21A 4PCZA 1SG9A 3FRIA 4OU7A 3U61A 3A45A 4GKJM 3U61B 4B3TM 1JR3E 2XH9A 3FUWA 1QDTA 3M6AA 4LJ6A 4LJ7A 4JI4M 4GH9A 2KNVA 3ZCBB 4OVZA 2ZANA 2F5PA 1IN6A 3GLHA 1EIJA 1VG5A 1HNXM 3AL0C 2I7NA 3R8FA 1V34A 2L7HA 2AHMA 4I5SA 4QOSA 5BPVA 2QNJA 4NXNM 5DYIA 5FLXS 2CV1A 2DXIA 1XXHA 2XLJA 1QUTA 4JI3M 2E5LM 4AKIA 3GLHE 3GP1A 4DBGB 1N34M 2OPFA 3LVWA 2VIIA 4LJ8A 2KNZA 2DWLA 4AI6A 4P17A 3I01M 3LQQA 3QAUA 1PJJA 1DV0A 3RGPA 1XNQM 2QPAA 2R4JA 4FVMA 3SC3A 1IN5A 3SYLA 3SARA 4S12A 4XK8F 5DNYA 1TF0B 2JZ0A 3GLFA 1WHCA 2Z8YM 1ZMVA 2JY7A 3HU1A 2LVQD 2R46A 3FYDA 1XXHE 1QUSA 3CF2A 5FTLA 2WSEF 2N35A 5FTNA 2Y21A 5JI3E 2LVOC 4LZJA 1MX0A 3VLFB 3ZH9B 4LF7M 1OJLA 2DHRA 3E9SA 2C5RA 3D8LA 2O01F 2R45A 3J2PB 1PJTA 2VDBB 4IBIA 2D7EA 3KSXA 3FUVA 4RNAA 4CISA 2QCUA 3PVSA 4Z8XA 2XEPA 5ITQA 4MH0E 4DV1M 2DZOB 1R5LA 1E9SA 2F5SA 1ZMUA 3B74A 1UM8A 1NNJA 3EIHA 3B89A 2K47A 4GHLA 2KW0A 2K9DA 1S3SA 2R0IA 1D2NA 1ZV1A 3H4MA 5EXXA 4DV5M 1WGNA 3E4RA 1IBKM 4NRWA 2FS1A 2JY5A 2WSFF 1N36M 1ORYB 4QNMA 2F5QA 4DV7M 3VK8A 2UXBM 4LG2A 1LV7A 3TPZA 1PGYA 2RGOA 4Y28F 2BNKA 4M9SA 4DR2M 1HQYE 1E9RA 3FTFA 1N77A 5GKNA 3J81S 3GQ4A 2ERCA 1NHWC 5EXTA 1IM2A 1NHGC 5EJCA 5KQDA 3DOAA 4LRSA 4UN2B 3U60A 5C18A 7CATA 2JWSA 4D82A 3HHWA 3U6DA 1GL7A 5FSWA 4YY3M 2DHYA 2L4EA 4JN6A 2Y0TA 4LGYA 5DFLA 2UUAM 4LF9M 2ZM6M 2CHVA 3HWSA 5IREB 3CGWA 2J7OA 5KO3A 3B7NA 3U6QA 3SATA 4GMQA 2C99A 2QBYB 1SXJE 4D80A 2FFJA 1Z6TA 1PM5A 4R7GA 3TL4X 2KRKA 2I7PA 2YNMD 3PFIA 1XXHB 1J09A 2KA6B 3M0EA 4GKKM 1KSFX 5ITXA 3KOYE 4X65M 3TE6A 3GLIE 3SFZA 5ITYA 1L8QA 1QAQA 3JAMS 3RGSA 3JR5A 2KHHA 3LQRA 4KODA 1DGHA 3KOWE 3ZQJA 3T1YM 4LFCM 2V1CA 4HEOA 3VK7A 5LMNM 3SMPA 1IXSA 2CV2A 2Z4RA 1PJQA 3B7QA 1L2DA 3VFDA 3GLGE 2Z3XA 3KDSE 1C7YA 4B3MM 4LF8M 3FUTA 2A5YB 2LVAA 3QYEA 2CWBA 2KZSA 2MH8A 2EKKA 1HT1E 3K9OA 2O25A 2Z7JA 4JI1M 2G5GX 4L4UA 1G71A 2LNHC 3BXWA 4WW0A 1HR0M 4ITQA 3U5ZA 2UXDM 3HGIA 2ZTDA 1Z5AA 2VQEM 4JYAM 1FNNA 1K3XA 4DR1M 1V92A 2DWNA 3BBZA 3UMMA 4DR4M 3LVVA 1XNRM 2KZUA 1XWIA 1L2CA 4M9XA 3T1HM 4QHTA 1C1KA 4NL4H 4MGZE 3GRVA 4LF4M 1JB0F 1NY6A 4LJ9A 1NJGA 3RFWA 4IJEA 1GJTA 1P3QQ 3GRYA 3K9PA 2CUZA 1Q3CA 1YE9A 2MJ5B 1TR8A 2Y0QA 3FYCA 3L2AA 1DGHB 4CHTB 4YHHM 4GHAA 2HCBA 3HKPA 1BVSA 3LW5F 1MU5A 1OIZA 3H4JA 2DWMA 2CRUA 4ANRA 1OAIA 3L28A 4HL4A 4NSRA 2G8LA 4B08A 2EA0A 1SXJC 3VDPA 5C1BA 1Q02A 2LBCA 1SXJB 3C3EA 3J7BA 1GLNA 4FCWA 3D8BA 4ZPXA 3AJIB 2KRUA 3A98B 5IT9S 1G8PA 1A5TA 2X49A 3U6LA 4HLQA 4JI2M 3KS8A 1T6OA 1IN7A 2JA2A 2R62A 5EP4A 2LVPC 1R2ZA 2C96A 3C9PA 4LZZA 2MR9A 2DKLA 3K8ZA 1IQPA 2DAEA 3KS4A 2J7NA 4FCVA 3KOZE 1NV8A 2XFSA 1X37A 3WHKA 3A46A 2VF7A 3B9PA 3VKHA 4OW0A 4DUZM 1IBMM 1ZAEA 3SAVA 1IY1A 1G4AE 3J7AS 3MJ5A 4JXJA 4JI8M 2KNAA 2DAMA 1WGLA 3K2LA 3GQ5A 3FRHA 4BBAA 2KXEA 3I51A 1D0LA 5H37D 3ILKA 3TQSA 2DENA 4GEWA 3CF0A 2X4AA 3EIEA 2K6BA 5EP1A 3U6MA 5EP2A 3GPUA 4QOZC 3AV0A 2D7GA 2L6OA 3NBIA 1XMOM 2LXEA 2VQFM 2QSFX 1YUBA 1I4WA 1VEGA 1GKIA 3C3DA 2H1RA 2DWZB 3U60B 1AUAA 1D0KA 3UK6A 4F2LA 2ZTCA 1PRBA 2EKFA
chains in the Genus database with same CATH topology
2DNAA 2QHOB 2LTUA 2HWJA 1WIVA 2L2DA 3GLIE 2OO9A 2L4FA 3LCVB 3IHPA 2KHHA 1R4GA 1DO2A 3F92A 1HJPA 3MMPA 4HEOA 4WP2A 1WR1B 3E21A 1SG9A 3FRIA 1IXSA 2JZ1A 1JR3E 3GLGE 1C7YA 2DAKA 1MN3A 2KNVA 2LVAA 1AIPC 2CWBA 1XB2B 2EKKA 1HT1E 3K9OA 1VG5A 2O25A 2OOAA 3E46A 2HAKA 2QNJA 2ZTDA 1OQYA 3GLHE 1V92A 4DBGB 3GLFE 1DO0A 1UFZA 3BBZA 2KNZA 1DV0A 2EJSA 1WJ7A 1E94E 2JUJA 3FE3A 1QZEA 2JZ0A 2JP7A 1ZMWA 1WHCA 1ZMVA 1P3QQ 3T6PA 2CP8A 1G41A 2JY7A 3K9PA 2MJ5B 2LVQD 1TR8A 1XXHE 1G3IA 1BVSA 3LCUA 3H4JA 2K0BX 2WZJA 2LVOC 1OAIA 1VQ1A 2DZLA 1Q02A 2LBCA 1T43A 1CUKA 3IECA 2OOBA 2G3QA 1GO5A 4Q7JA 1KYIA 1A5TA 1ZMUA 1T6OA 4R71A 2BWBA 2H5XA 4G3OA 1IFYA 1NV9A 2B3TA 1F4IA 3B89A 2LVPC 1Y8GA 2K9DA 1ZV1A 2R0IA 2MR9A 2DKLA 1WGNA 2DAEA 1EFUB 2JY5A 2RRUA 1NV8A 1OKSA 2JY8A 1PGYA 2LVNC 1HQYE 1G4AE 1VDLA 2KNAA 1VEKA 1IM2A 1WGLA 2DAMA 2JY6B 2MGWA 2MROB 4F1IA 3FRHA 2DAIA 2BWEA 2DI0A 4UN2B 2DENA 4GEWA 1HT2E 1YLAA 1OTRA 5JI2E 2DHYA 2L4EA 1VEJA 5DFLA 2QSFX 1VEGA 2DAGA 4F2LA 2ZTCA 2EKFA 1TTEA 2JNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNA A;  2QHO B;  2LTU A;  2HWJ A;  1WIV A;  2L2D A;  3GLI E;  2OO9 A;  2L4F A;  3LCV B;  3IHP A;  2KHH A;  1R4G A;  1DO2 A;  3F92 A;  1HJP A;  3MMP A;  4HEO A;  4WP2 A;  1WR1 B;  3E21 A;  1SG9 A;  3FRI A;  1IXS A;  2JZ1 A;  1JR3 E;  3GLG E;  1C7Y A;  2DAK A;  1MN3 A;  2KNV A;  2LVA A;  1AIP C;  2CWB A;  1XB2 B;  2EKK A;  1HT1 E;  3K9O A;  1VG5 A;  2O25 A;  2OOA A;  3E46 A;  2HAK A;  2QNJ A;  2ZTD A;  1OQY A;  3GLH E;  1V92 A;  4DBG B;  3GLF E;  1DO0 A;  1UFZ A;  3BBZ A;  2KNZ A;  1DV0 A;  2EJS A;  1WJ7 A;  1E94 E;  2JUJ A;  3FE3 A;  1QZE A;  2JZ0 A;  2JP7 A;  1ZMW A;  1WHC A;  1ZMV A;  1P3Q Q;  3T6P A;  2CP8 A;  1G41 A;  2JY7 A;  3K9P A;  2MJ5 B;  2LVQ D;  1TR8 A;  1XXH E;  1G3I A;  1BVS A;  3LCU A;  3H4J A;  2K0B X;  2WZJ A;  2LVO C;  1OAI A;  1VQ1 A;  2DZL A;  1Q02 A;  2LBC A;  1T43 A;  1CUK A;  3IEC A;  2OOB A;  2G3Q A;  1GO5 A;  4Q7J A;  1KYI A;  1A5T A;  1ZMU A;  1T6O A;  4R71 A;  2BWB A;  2H5X A;  4G3O A;  1IFY A;  1NV9 A;  2B3T A;  1F4I A;  3B89 A;  2LVP C;  1Y8G A;  2K9D A;  1ZV1 A;  2R0I A;  2MR9 A;  2DKL A;  1WGN A;  2DAE A;  1EFU B;  2JY5 A;  2RRU A;  1NV8 A;  1OKS A;  2JY8 A;  1PGY A;  2LVN C;  1HQY E;  1G4A E;  1VDL A;  2KNA A;  1VEK A;  1IM2 A;  1WGL A;  2DAM A;  2JY6 B;  2MGW A;  2MRO B;  4F1I A;  3FRH A;  2DAI A;  2BWE A;  2DI0 A;  4UN2 B;  2DEN A;  4GEW A;  1HT2 E;  1YLA A;  1OTR A;  5JI2 E;  2DHY A;  2L4E A;  1VEJ A;  5DFL A;  2QSF X;  1VEG A;  2DAG A;  4F2L A;  2ZTC A;  2EKF A;  1TTE A;  2JNH A; 
#chains in the Genus database with same CATH topology
 4G4N A;  3L26 A;  3SAU A;  3FTE A;  4AG6 A;  2R6F A;  2WSC F;  1IXS B;  1HNW M;  4IBF A;  2APL A;  3FD9 A;  3FUU A;  5F3W A;  2R18 A;  2EO2 A;  2L4F A;  3LCV B;  4B7F A;  1L1Z A;  1RU3 A;  1E32 A;  2R4E A;  3HY5 A;  1EE8 A;  3HHX A;  1R4G A;  3GRR A;  3F92 A;  1HJP A;  3MMP A;  4KT0 F;  1MJG M;  1N78 A;  3W0L B;  2R44 A;  3TWK A;  3VKG A;  3KSJ A;  2JXN A;  2HHH M;  2XF3 A;  3OTO M;  3U6P A;  1TGU A;  1ZQ9 A;  1QAO A;  1Z5B A;  2FH0 A;  3THG A;  1Z59 A;  3GLH B;  1XB2 B;  4FWH A;  4W5W A;  4DR7 M;  4FCT A;  3BOS A;  2OOA A;  3QWL A;  3E46 A;  4MGH A;  4Z6Y A;  3GLG B;  4IBB A;  4M0D A;  2CEA A;  2EUC A;  4L78 A;  5E6J A;  3GPX A;  1Q3B A;  1GL6 A;  3HU3 A;  4AG5 A;  1G59 A;  2Z4S A;  5ITT A;  1OQY A;  3MHV C;  3GLF E;  4GIT A;  3ZC7 B;  3K92 A;  3GRU A;  4IIW A;  4LRT A;  4G4R A;  4I4L A;  1KFV A;  3LMM A;  3DA1 A;  2EJS A;  4MB7 A;  4EIW A;  4KHP M;  4XGI A;  3FE3 A;  1QZE A;  4JI7 M;  1QAM A;  1TDH A;  2XSZ A;  3UZU A;  4WUR A;  4BB9 A;  3KOX E;  3PXG A;  2HL7 A;  2CP8 A;  3DZD A;  3C58 A;  1PJI A;  2LWX A;  4LCB A;  1L1T A;  2VF8 A;  3L27 A;  3L29 A;  3HJS A;  4DR3 M;  2X8A A;  2BJV A;  3LCU A;  2KDL A;  2K0B X;  1YSY A;  2QP9 X;  5KQ8 A;  3U6E A;  2ZBK B;  3AOG A;  2LH0 A;  4NRV A;  4JV5 M;  3FKE A;  1K82 A;  3KP0 E;  4L15 A;  5EQT A;  4L16 A;  4QNR A;  4FW9 A;  3HHY A;  1T43 A;  2XSZ D;  3IEC A;  2OOB A;  4MGK E;  3KXE C;  3HJ8 A;  3SAS A;  4Q7J A;  4JI0 M;  4FWD A;  3J80 S;  5KPZ A;  5DYG A;  3GLG A;  2CE7 A;  3NBX X;  4R71 A;  4II7 A;  4R3D A;  2H5X A;  4LGM A;  1IFY A;  1NV9 A;  4IBJ A;  4DV2 M;  2L09 A;  1QAN A;  2D7H A;  2DVW B;  3B7Z A;  4AKH A;  2QZ4 A;  4X66 M;  1GVN A;  3AFH A;  4M9Z A;  1OKS A;  1N33 M;  2JY8 A;  3W68 A;  1IXR C;  5ITR A;  4JI6 M;  1JR3 D;  4P16 A;  2HKJ A;  2FOI C;  1QDR A;  4L6V 6;  4NOO B;  3V76 A;  4B7G A;  4PDI A;  1OFH A;  4LF5 M;  4X62 M;  2M60 A;  5IZ7 D;  3A42 A;  3GLF B;  3AOE C;  1IN4 A;  3NWL A;  1VDL A;  1HNZ M;  4CJ6 A;  4LJA A;  4NSO B;  2C9C A;  4GIP A;  2MRO B;  2MGW A;  1VEK A;  4MGI E;  2F4V M;  5LMU M;  1K3W A;  2DAI A;  1SXJ A;  2DI0 A;  4DUY M;  2F5O A;  1HT2 E;  3HJQ A;  2F5N A;  2FE8 A;  1GAB A;  4X64 M;  5KPR A;  4RF1 A;  1H6U A;  5JI2 E;  4DV3 M;  4B3R M;  2ZAO A;  3CF6 E;  4GRI A;  4JI5 M;  2XZU A;  3SHF A;  4L8R C;  1XHB A;  2DZN B;  1J7K A;  5FTJ A;  2ZAM A;  3GO8 A;  3U6S A;  1IY0 A;  2JNH A;  1E94 E;  2YQZ A;  2DNA A;  3AKZ A;  1D0M A;  2CV0 A;  5A2Q S;  2QHO B;  4NC6 A;  3Q8G A;  1NJF A;  1IBL M;  1JQJ C;  1WIV A;  5EP3 A;  4DV4 M;  2W82 A;  1SXJ D;  3SYK A;  4PDG A;  2C9O A;  4PD2 A;  3GPY A;  1QQW A;  1Q39 A;  3WHL A;  3AOE A;  5BR8 M;  1NY5 A;  1DO2 A;  1DGB A;  3KP1 E;  1QYR A;  4DR6 M;  2V6Z M;  4WP2 A;  3FUX A;  1WR1 B;  2CFO A;  1HQC A;  1JR3 A;  2JZ1 A;  2QEN A;  4GC5 A;  3MK6 A;  1W5T A;  4D81 A;  4IBK A;  3K1J A;  1TH2 A;  3DFZ A;  2DAK A;  4B3S M;  1FJG M;  4KO8 A;  1MN3 A;  4M0W A;  4BLC A;  3CTW B;  3JR4 A;  1AIP C;  2GQF A;  3KFU G;  1I94 M;  2O5R A;  3HZJ A;  8CAT A;  1NO1 A;  4TUW A;  2HAK A;  4REZ A;  1WXQ A;  2XZF A;  3RE8 A;  1W5S A;  1IN8 A;  2LHC A;  1N32 M;  2BJW A;  2QBY A;  5E26 A;  3HHZ A;  1DO0 A;  1UFZ A;  2XGN A;  5EXP A;  4MM3 B;  1LTM A;  5FTM A;  1TH3 A;  4DV0 M;  4PT5 A;  1WJ7 A;  4XBO A;  3T38 A;  3W67 A;  3UGJ A;  4LF6 M;  3W0F A;  2JUJ A;  5ITU A;  5FTK A;  5EXS A;  2UUC M;  2JP7 A;  1ZMW A;  3KW6 A;  3T6P A;  3L25 A;  1G41 A;  3VDU A;  1N75 A;  4DV6 M;  2UU9 M;  3UJN A;  4IBG A;  3SAW A;  3R9X B;  2V1U A;  2L7I A;  4I8O A;  2Y20 A;  4B7H A;  1G3I A;  2CHG A;  2YFQ A;  3GLI A;  2WZJ A;  2Q2E B;  5ITX E;  3KVW A;  1XC8 A;  1VQ1 A;  2DZL A;  4IBC A;  4RF0 A;  1CUK A;  2G3Q A;  4RKU F;  1GO5 A;  2P5T A;  1IY2 A;  1KYI A;  2GNO A;  1OAO C;  2KEB A;  1L2B A;  1PJS A;  1R6B X;  2NQ8 C;  3M7G A;  2RGH A;  2QQ8 A;  2LHG A;  2XFT A;  3HX3 A;  4FD2 A;  2OQ4 A;  2BWB A;  4G3O A;  3GPP A;  2B3T A;  3T15 A;  1F4I A;  1Y8G A;  4NXM M;  1TH4 A;  1EFU B;  2RRU A;  3I4Y A;  3U6O A;  2UXC M;  1NVM A;  3TWM A;  2FNA A;  2LVN C;  3Q8X A;  4AW4 A;  1Z5C A;  4I81 A;  3J27 B;  4CGY B;  4AQY M;  2RKO A;  3SMS A;  4G4O A;  4LJ5 A;  2UUB M;  1OIP A;  2JY6 B;  4IBE A;  1GJS A;  1NNU C;  2J5Y A;  4GC9 A;  4QHS A;  2M5Z A;  2BWE A;  3PNY A;  4F1I A;  3GQ3 A;  1IXZ A;  3PNV A;  4AZF A;  4IJF A;  4K0K M;  3TWL A;  3GLI B;  1VDD A;  1QZM A;  4OVZ B;  3IG8 A;  1YLA A;  3IG5 A;  1J5E M;  1OFI A;  3SBJ A;  1DGF A;  1OTR A;  4FWG A;  5KPT A;  3FTC A;  3HU2 A;  4MGY E;  1QVR A;  1DGG A;  1VEJ A;  4KLN A;  2YR0 A;  3I4V A;  4CIZ A;  4DR5 M;  4AKG A;  2DAG A;  4A3V B;  1R7R A;  5L8R F;  4LFA M;  4OX9 M;  3I04 M;  1TTE A;  3QYB A;  4LJ4 A;  3U6C A;  1XMQ M;  1V33 A;  3U5Z B;  4LFB M;  2C98 A;  3SHG B;  2LTU A;  1NSF A;  2HWJ A;  5IWA M;  4LY6 A;  2L2D A;  1T3T A;  2R65 A;  3FTD A;  1TDZ A;  2OO9 A;  4IBD A;  1R2Y A;  3IHP A;  4G4Q A;  2CHQ A;  4G6Z A;  3E21 A;  4PCZ A;  1SG9 A;  3FRI A;  4OU7 A;  3U61 A;  3A45 A;  4GKJ M;  3U61 B;  4B3T M;  1JR3 E;  2XH9 A;  3FUW A;  1QDT A;  3M6A A;  4LJ6 A;  4LJ7 A;  4JI4 M;  4GH9 A;  2KNV A;  3ZCB B;  4OVZ A;  2ZAN A;  2F5P A;  1IN6 A;  3GLH A;  1EIJ A;  1VG5 A;  1HNX M;  3AL0 C;  2I7N A;  3R8F A;  1V34 A;  2L7H A;  2AHM A;  4I5S A;  4QOS A;  5BPV A;  2QNJ A;  4NXN M;  5DYI A;  5FLX S;  2CV1 A;  2DXI A;  1XXH A;  2XLJ A;  1QUT A;  4JI3 M;  2E5L M;  4AKI A;  3GLH E;  3GP1 A;  4DBG B;  1N34 M;  2OPF A;  3LVW A;  2VII A;  4LJ8 A;  2KNZ A;  2DWL A;  4AI6 A;  4P17 A;  3I01 M;  3LQQ A;  3QAU A;  1PJJ A;  1DV0 A;  3RGP A;  1XNQ M;  2QPA A;  2R4J A;  4FVM A;  3SC3 A;  1IN5 A;  3SYL A;  3SAR A;  4S12 A;  4XK8 F;  5DNY A;  1TF0 B;  2JZ0 A;  3GLF A;  1WHC A;  2Z8Y M;  1ZMV A;  2JY7 A;  3HU1 A;  2LVQ D;  2R46 A;  3FYD A;  1XXH E;  1QUS A;  3CF2 A;  5FTL A;  2WSE F;  2N35 A;  5FTN A;  2Y21 A;  5JI3 E;  2LVO C;  4LZJ A;  1MX0 A;  3VLF B;  3ZH9 B;  4LF7 M;  1OJL A;  2DHR A;  3E9S A;  2C5R A;  3D8L A;  2O01 F;  2R45 A;  3J2P B;  1PJT A;  2VDB B;  4IBI A;  2D7E A;  3KSX A;  3FUV A;  4RNA A;  4CIS A;  2QCU A;  3PVS A;  4Z8X A;  2XEP A;  5ITQ A;  4MH0 E;  4DV1 M;  2DZO B;  1R5L A;  1E9S A;  2F5S A;  1ZMU A;  3B74 A;  1UM8 A;  1NNJ A;  3EIH A;  3B89 A;  2K47 A;  4GHL A;  2KW0 A;  2K9D A;  1S3S A;  2R0I A;  1D2N A;  1ZV1 A;  3H4M A;  5EXX A;  4DV5 M;  1WGN A;  3E4R A;  1IBK M;  4NRW A;  2FS1 A;  2JY5 A;  2WSF F;  1N36 M;  1ORY B;  4QNM A;  2F5Q A;  4DV7 M;  3VK8 A;  2UXB M;  4LG2 A;  1LV7 A;  3TPZ A;  1PGY A;  2RGO A;  4Y28 F;  2BNK A;  4M9S A;  4DR2 M;  1HQY E;  1E9R A;  3FTF A;  1N77 A;  5GKN A;  3J81 S;  3GQ4 A;  2ERC A;  1NHW C;  5EXT A;  1IM2 A;  1NHG C;  5EJC A;  5KQD A;  3DOA A;  4LRS A;  4UN2 B;  3U60 A;  5C18 A;  7CAT A;  2JWS A;  4D82 A;  3HHW A;  3U6D A;  1GL7 A;  5FSW A;  4YY3 M;  2DHY A;  2L4E A;  4JN6 A;  2Y0T A;  4LGY A;  5DFL A;  2UUA M;  4LF9 M;  2ZM6 M;  2CHV A;  3HWS A;  5IRE B;  3CGW A;  2J7O A;  5KO3 A;  3B7N A;  3U6Q A;  3SAT A;  4GMQ A;  2C99 A;  2QBY B;  1SXJ E;  4D80 A;  2FFJ A;  1Z6T A;  1PM5 A;  4R7G A;  3TL4 X;  2KRK A;  2I7P A;  2YNM D;  3PFI A;  1XXH B;  1J09 A;  2KA6 B;  3M0E A;  4GKK M;  1KSF X;  5ITX A;  3KOY E;  4X65 M;  3TE6 A;  3GLI E;  3SFZ A;  5ITY A;  1L8Q A;  1QAQ A;  3JAM S;  3RGS A;  3JR5 A;  2KHH A;  3LQR A;  4KOD A;  1DGH A;  3KOW E;  3ZQJ A;  3T1Y M;  4LFC M;  2V1C A;  4HEO A;  3VK7 A;  5LMN M;  3SMP A;  1IXS A;  2CV2 A;  2Z4R A;  1PJQ A;  3B7Q A;  1L2D A;  3VFD A;  3GLG E;  2Z3X A;  3KDS E;  1C7Y A;  4B3M M;  4LF8 M;  3FUT A;  2A5Y B;  2LVA A;  3QYE A;  2CWB A;  2KZS A;  2MH8 A;  2EKK A;  1HT1 E;  3K9O A;  2O25 A;  2Z7J A;  4JI1 M;  2G5G X;  4L4U A;  1G71 A;  2LNH C;  3BXW A;  4WW0 A;  1HR0 M;  4ITQ A;  3U5Z A;  2UXD M;  3HGI A;  2ZTD A;  1Z5A A;  2VQE M;  4JYA M;  1FNN A;  1K3X A;  4DR1 M;  1V92 A;  2DWN A;  3BBZ A;  3UMM A;  4DR4 M;  3LVV A;  1XNR M;  2KZU A;  1XWI A;  1L2C A;  4M9X A;  3T1H M;  4QHT A;  1C1K A;  4NL4 H;  4MGZ E;  3GRV A;  4LF4 M;  1JB0 F;  1NY6 A;  4LJ9 A;  1NJG A;  3RFW A;  4IJE A;  1GJT A;  1P3Q Q;  3GRY A;  3K9P A;  2CUZ A;  1Q3C A;  1YE9 A;  2MJ5 B;  1TR8 A;  2Y0Q A;  3FYC A;  3L2A A;  1DGH B;  4CHT B;  4YHH M;  4GHA A;  2HCB A;  3HKP A;  1BVS A;  3LW5 F;  1MU5 A;  1OIZ A;  3H4J A;  2DWM A;  2CRU A;  4ANR A;  1OAI A;  3L28 A;  4HL4 A;  4NSR A;  2G8L A;  4B08 A;  2EA0 A;  1SXJ C;  3VDP A;  5C1B A;  1Q02 A;  2LBC A;  1SXJ B;  3C3E A;  3J7B A;  1GLN A;  4FCW A;  3D8B A;  4ZPX A;  3AJI B;  2KRU A;  3A98 B;  5IT9 S;  1G8P A;  1A5T A;  2X49 A;  3U6L A;  4HLQ A;  4JI2 M;  3KS8 A;  1T6O A;  1IN7 A;  2JA2 A;  2R62 A;  5EP4 A;  2LVP C;  1R2Z A;  2C96 A;  3C9P A;  4LZZ A;  2MR9 A;  2DKL A;  3K8Z A;  1IQP A;  2DAE A;  3KS4 A;  2J7N A;  4FCV A;  3KOZ E;  1NV8 A;  2XFS A;  1X37 A;  3WHK A;  3A46 A;  2VF7 A;  3B9P A;  3VKH A;  4OW0 A;  4DUZ M;  1IBM M;  1ZAE A;  3SAV A;  1IY1 A;  1G4A E;  3J7A S;  3MJ5 A;  4JXJ A;  4JI8 M;  2KNA A;  2DAM A;  1WGL A;  3K2L A;  3GQ5 A;  3FRH A;  4BBA A;  2KXE A;  3I51 A;  1D0L A;  5H37 D;  3ILK A;  3TQS A;  2DEN A;  4GEW A;  3CF0 A;  2X4A A;  3EIE A;  2K6B A;  5EP1 A;  3U6M A;  5EP2 A;  3GPU A;  4QOZ C;  3AV0 A;  2D7G A;  2L6O A;  3NBI A;  1XMO M;  2LXE A;  2VQF M;  2QSF X;  1YUB A;  1I4W A;  1VEG A;  1GKI A;  3C3D A;  2H1R A;  2DWZ B;  3U60 B;  1AUA A;  1D0K A;  3UK6 A;  4F2L A;  2ZTC A;  1PRB A;  2EKF A; 
#chains in the Genus database with same CATH homology
 2DNA A;  2QHO B;  2LTU A;  2HWJ A;  1WIV A;  2L2D A;  3GLI E;  2OO9 A;  2L4F A;  3LCV B;  3IHP A;  2KHH A;  1R4G A;  1DO2 A;  3F92 A;  1HJP A;  3MMP A;  4HEO A;  4WP2 A;  1WR1 B;  3E21 A;  1SG9 A;  3FRI A;  1IXS A;  2JZ1 A;  1JR3 E;  3GLG E;  1C7Y A;  2DAK A;  1MN3 A;  2KNV A;  2LVA A;  1AIP C;  2CWB A;  1XB2 B;  2EKK A;  1HT1 E;  3K9O A;  1VG5 A;  2O25 A;  2OOA A;  3E46 A;  2HAK A;  2QNJ A;  2ZTD A;  1OQY A;  3GLH E;  1V92 A;  4DBG B;  3GLF E;  1DO0 A;  1UFZ A;  3BBZ A;  2KNZ A;  1DV0 A;  2EJS A;  1WJ7 A;  1E94 E;  2JUJ A;  3FE3 A;  1QZE A;  2JZ0 A;  2JP7 A;  1ZMW A;  1WHC A;  1ZMV A;  1P3Q Q;  3T6P A;  2CP8 A;  1G41 A;  2JY7 A;  3K9P A;  2MJ5 B;  2LVQ D;  1TR8 A;  1XXH E;  1G3I A;  1BVS A;  3LCU A;  3H4J A;  2K0B X;  2WZJ A;  2LVO C;  1OAI A;  1VQ1 A;  2DZL A;  1Q02 A;  2LBC A;  1T43 A;  1CUK A;  3IEC A;  2OOB A;  2G3Q A;  1GO5 A;  4Q7J A;  1KYI A;  1A5T A;  1ZMU A;  1T6O A;  4R71 A;  2BWB A;  2H5X A;  4G3O A;  1IFY A;  1NV9 A;  2B3T A;  1F4I A;  3B89 A;  2LVP C;  1Y8G A;  2K9D A;  1ZV1 A;  2R0I A;  2MR9 A;  2DKL A;  1WGN A;  2DAE A;  1EFU B;  2JY5 A;  2RRU A;  1NV8 A;  1OKS A;  2JY8 A;  1PGY A;  2LVN C;  1HQY E;  1G4A E;  1VDL A;  2KNA A;  1VEK A;  1IM2 A;  1WGL A;  2DAM A;  2JY6 B;  2MGW A;  2MRO B;  4F1I A;  3FRH A;  2DAI A;  2BWE A;  2DI0 A;  4UN2 B;  2DEN A;  4GEW A;  1HT2 E;  1YLA A;  1OTR A;  5JI2 E;  2DHY A;  2L4E A;  1VEJ A;  5DFL A;  2QSF X;  1VEG A;  2DAG A;  4F2L A;  2ZTC A;  2EKF A;  1TTE A;  2JNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...