1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN HHR23A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
3K9OA 1NV8A 2DAKA 3GLFE 2L4EA 2DZLA 2LVQD 1VEKA 1IFYA 1XXHE 3GLHE 4UN2B 2MJ5B 2JUJA 1DO0A 2JZ0A 1CUKA 1YLAA 1HJPA 1WGLA 2LVAA 1BVSA 1F4IA 2QSFX 2LVNC 1IM2A 1VQ1A 2DNAA 2EKFA 2KNAA 2CP8A 2RRUA 2MGWA 1T43A 4GEWA 2JZ1A 1XB2B 2EKKA 2DAMA 1OQYA 2MROB 2OOBA 3B89A 2JP7A 5JI2E 1HT2E 1UFZA 2DAEA 2DI0A 2LVPC 4HEOA 1T6OA 2HWJA 1JR3E 4G3OA 1WR1B 1G41A 2OO9A 1A5TA 2BWEA 1EFUB 3FRIA 2KNVA 1ZV1A 1G4AE 1AIPC 2HAKA 4WP2A 1NV9A 4F1IA 2WZJA 1SG9A 5DFLA 1ZMUA 1ZMWA 4Q7JA 3E46A 1C7YA 1WJ7A 1OKSA 3FRHA 4DBGB 3LCVB 1OTRA 2ZTCA 2CWBA 2EJSA 1TR8A 2H5XA 3IECA 3H4JA 1V92A 2KNZA 2JY5A 2K0BX 2OOAA 1OAIA 2BWBA 1R4GA 2MR9A 3FE3A 1VG5A 1G3IA 1DV0A 2KHHA 1GO5A 1Y8GA 2DAGA 2R0IA 3BBZA 1WHCA 3K9PA 2K9DA 1HT1E 3MMPA 2L2DA 3F92A 1KYIA 2ZTDA 1TTEA 2JNHA 2DKLA 2DAIA 2QHOB 2LBCA 2DENA 2G3QA 2B3TA 2L4FA 1ZMVA 2O25A 1P3QQ 2LVOC 1VDLA 4F2LA 1DO2A 1HQYE 2JY7A 1E94E 2JY6B 1VEJA 1WGNA 1QZEA 3E21A 3IHPA 3GLGE 1IXSA 2DHYA 1VEGA 3LCUA 3T6PA 1WIVA 2QNJA 3GLIE 4R71A 1PGYA 2LTUA 2JY8A 1Q02A 1MN3A
chains in the Genus database with same CATH superfamily
3HHZA 4B08A 3AOEA 3K9OA 3KVWA 3HGIA 4JI8M 2DWNA 3I04M 3K92A 2LVQD 2R62A 3A46A 4MH0E 2MJ5B 4KO8A 4CIZA 2DVWB 2QP9X 2XFSA 3EIHA 3ILKA 1QVRA 1CUKA 3HU1A 2LVAA 3B7NA 3KSJA 4RF1A 4R7GA 3TL4X 5KPTA 2F4VM 1F4IA 3FUVA 2VF7A 1QUSA 1V34A 2R4EA 1IY0A 5IZ7D 4JI3M 2EO2A 4XBOA 3U6EA 3FTEA 3DOAA 3GLHB 4IBBA 2I7NA 3WHKA 2KNAA 3UJNA 2K6BA 2R46A 2J5YA 4DV3M 1JR3A 2CEAA 4AQYM 2UXBM 1OFIA 2XFTA 1K3XA 3M7GA 2QENA 3U6SA 2OOBA 3AFHA 3HHWA 1XHBA 1IXZA 2RGHA 4LF6M 4X62M 1NY6A 4L6V6 4TUWA 3Q8GA 2LH0A 3HX3A 5IT9S 3SBJA 5EXXA 1R2YA 3GRUA 2KRUA 3ZQJA 2I7PA 1G41A 1RU3A 2Y21A 5H37D 1A5TA 1HNZM 2KNVA 1ZV1A 1G4AE 3TWKA 3THGA 4G4NA 3I4VA 3VDPA 3SC3A 1D0LA 3VK8A 2KZUA 4F1IA 1IXSB 2WZJA 2XSZA 1IN4A 1XXHB 1ZMUA 4P16A 2OPFA 2Z8YM 5EP2A 1SXJA 1NO1A 3EIEA 3M0EA 3GPXA 1OKSA 1C7YA 3AL0C 4DBGB 4LG2A 3C58A 2CWBA 4R3DA 4JN6A 3U6MA 3T1HM 3J2PB 2R18A 2CE7A 2H5XA 3LMMA 2E5LM 2F5OA 5EP3A 1HNXM 2N35A 4DV4M 5FSWA 4D80A 5LMUM 2OOAA 4RNAA 4GMQA 1IN7A 3JR5A 1J09A 2ERCA 1K82A 3FTDA 5KQDA 1XNQM 5ITQA 3SASA 1G3IA 5JI3E 2KHHA 4LJ6A 4A3VB 4NL4H 4P17A 2R0IA 4M9ZA 1TDZA 3SYLA 3SARA 1TH2A 3K9PA 2O5RA 4MGYE 1HT1E 1IN6A 3MMPA 4IBFA 5ITRA 1G71A 2FOIC 2VF8A 1PJSA 2X49A 1DGFA 2QPAA 1KSFX 1NNUC 4LF9M 1HNWM 1PJTA 4LJ9A 2YR0A 4NOOB 5L8RF 4NSRA 2K47A 1OIPA 2Q2EB 4FCWA 3RGSA 4FW9A 4IJFA 4X64M 1I94M 2HCBA 1K3WA 4M9SA 3IHPA 1VEJA 2XLJA 2DHYA 1XNRM 4LJ5A 5FTJA 3SAUA 3OTOM 1DGGA 4B7HA 4DR1M 3RE8A 2QNJA 3T6PA 3J81S 3GLIE 3U61A 4QNRA 1PGYA 3R8FA 4OU7A 3I01M 4LJ7A 3HJ8A 2LWXA 2CV0A 4AKGA 1MN3A 2VQFM 4JI7M 3HU2A 1NV8A 2DAKA 4Z8XA 3GLGB 1QDTA 4WW0A 1XXHE 2FE8A 2JUJA 3KP0E 1DO0A 1MX0A 2JZ0A 4DV5M 4DR2M 5EP1A 1L2CA 3LQQA 2FFJA 1ZQ9A 5BPVA 2QSFX 2LVNC 3K8ZA 3GQ4A 4G6ZA 1IM2A 2CV1A 1FJGM 3FUUA 4W5WA 3B74A 4PD2A 3GLFB 2XF3A 4M0DA 1PJJA 4LF7M 2EKFA 3J7AS 4GH9A 1X37A 2CP8A 4XK8F 4NRWA 3KOYE 4FCTA 3CGWA 1WXQA 2R44A 3D8LA 3K2LA 2DAMA 4FWDA 4HLQA 3L27A 2KEBA 3B9PA 1XMOM 2HHHM 5JI2E 2JWSA 1JB0F 3KS8A 1UFZA 2DAEA 2CHGA 2DI0A 4QOSA 5KQ8A 2LVPC 2W82A 1GVNA 2LHCA 3PNYA 4XGIA 5DNYA 1T6OA 1L1TA 1DGHB 2VDBB 4QOZC 1PRBA 2FH0A 4MGHA 5EXPA 3HY5A 1R7RA 2CUZA 2OO9A 2ZM6M 2QCUA 2J7NA 2HAKA 3A45A 1IXRC 1N32M 4L4UA 4DV2M 3GPPA 1Q3CA 1R5LA 2UXCM 3J27B 3J7BA 4B7GA 4WURA 3U6LA 4NXMM 5KPZA 2WSEF 4LJ8A 4MM3B 3U60B 4Q7JA 2Z7JA 4L78A 3HWSA 1JR3D 4EIWA 1QDRA 1WJ7A 3I51A 5BR8M 3FRHA 1Q3BA 2HKJA 3TQSA 3M6AA 2EA0A 1ZAEA 3U6CA 2ZTCA 3AJIB 1TGUA 4DUZM 1YUBA 2EJSA 2M60A 3Q8XA 3U5ZA 1JQJC 7CATA 2JA2A 5FLXS 4QHSA 4B3MM 1NHGC 3H4JA 2APLA 3AV0A 1QZMA 3GLIA 1V92A 1EE8A 3R9XB 4LCBA 2JY5A 3L29A 1J7KA 1DGBA 3AOEC 3KSXA 2Y20A 2F5NA 3HKPA 1FNNA 1QAMA 3GRVA 4IBKA 1G8PA 2UXDM 3MK6A 4KODA 1VDDA 1VG5A 1PM5A 2WSFF 1N75A 1Q39A 5IREB 4MGKE 1GO5A 1T3TA 4GRIA 4DR7M 3FTFA 2BNKA 4LZZA 4KLNA 3VFDA 2DWLA 2QBYA 1NSFA 3U6QA 3MHVC 3NBIA 3F92A 1NJFA 3VDUA 2ZTDA 3TWMA 3FUXA 2JNHA 4LF5M 3A98B 4DV0M 4LRTA 1W5TA 2CHVA 4PCZA 1XWIA 4M9XA 1Z5CA 2G8LA 1TF0B 2D7HA 2QHOB 2XGNA 4FWGA 4I4LA 4JI4M 4GHAA 1OFHA 3GO8A 2Y0TA 2LVOC 2DWMA 4IBCA 4IBJA 1QYRA 4AKIA 3VKHA 1HQYE 4JYAM 4OW0A 2P5TA 4LJ4A 1GL7A 1WGNA 2JY6B 1QZEA 2MH8A 1G59A 4NC6A 3SMPA 1VEGA 3GQ5A 3IG8A 3H4MA 4RKUF 1SXJB 1WIVA 2D7GA 2F5QA 4R71A 4QNMA 2LTUA 3KW6A 2JY8A 4L8RC 1Q02A 1OJLA 3DFZA 3SHFA 4PT5A 2FNAA 4LF8M 3VKGA 5FTKA 4B7FA 2DZLA 4LGYA 1VEKA 1IFYA 1D0KA 3GLHE 4UN2B 2F5SA 3NBXX 8CATA 1UM8A 2Y0QA 2L7IA 4D81A 1YLAA 1HJPA 1WGLA 3SATA 1BVSA 4LRSA 5FTLA 2LHGA 4GC5A 4PDGA 3CF6E 2O01F 2VIIA 4B3SM 1N78A 4CISA 3UMMA 3SMSA 2DNAA 3TWLA 3LVWA 5ITXE 3DA1A 2XZUA 4YHHM 2RRUA 1T43A 4L16A 1NVMA 3PNVA 1NNJA 2JZ1A 3FTCA 5GKNA 2C5RA 2EKKA 2V1CA 2YFQA 4CJ6A 2R4JA 2MROB 3B89A 5DYIA 2JP7A 1HT2E 4DR6M 3ZC7B 4HEOA 1E32A 2UU9M 1YSYA 4GC9A 2HWJA 2EUCA 1NY5A 3TPZA 3W0FA 4B3TM 5FTMA 3SFZA 1JR3E 5IWAM 2M5ZA 4G3OA 3W0LB 3UGJA 4OVZA 1HR0M 4GITA 5F3WA 3GRRA 1N36M 2BWEA 3FRIA 3L25A 3TE6A 1AIPC 1GJTA 1OAOC 2DZNB 5E26A 2R6FA 1GABA 4DV7M 1NV9A 2ZAOA 3V76A 1SG9A 4GIPA 3PVSA 5DFLA 1ZMWA 2LNHC 5A2QS 2UUCM 1L1ZA 4FD2A 2C96A 2Z3XA 3U61B 2UUAM 3KDSE 4JI1M 1EIJA 4FWHA 1R6BX 2RKOA 3CF2A 3VK7A 1OTRA 2HL7A 2J7OA 3GP1A 4DV1M 1GJSA 1TR8A 3K1JA 3SHGB 5LMNM 3IECA 2BJVA 2JXNA 2X4AA 3KOZE 5E6JA 3W68A 2X8AA 2GNOA 3L26A 2BWBA 4G4QA 3QAUA 1XMQM 3GQ3A 3C3EA 4JV5M 2L09A 2XEPA 3FD9A 5FTNA 4LFAM 4AKHA 1DV0A 4ZPXA 3HU3A 4BBAA 3GLHA 5EQTA 1HQCA 2Z4RA 1OIZA 3GRYA 2DAGA 3KXEC 3L28A 3BBZA 3AOGA 2QZ4A 3B7QA 2K9DA 1E9SA 1TDHA 3FUTA 5ITXA 2DXIA 1LTMA 1KYIA 1TTEA 2AHMA 2DKLA 4LGMA 2DAIA 4REZA 4HL4A 4GKKM 3ZH9B 1IQPA 4I8OA 4JI0M 4IBIA 2DENA 2O25A 2B3TA 3KOWE 1ZMVA 3J80S 4LY6A 4IJEA 3RFWA 1QAOA 3LQRA 4NSOB 1VDLA 4G4OA 2R45A 5C18A 4DV6M 1AUAA 1E94E 1LV7A 4MGZE 1Z5AA 5EP4A 3GLGE 1IXSA 2KDLA 4MB7A 2VQEM 2CHQA 2KXEA 3HHXA 1XXHA 2C99A 3SYKA 2XSZD 5EJCA 1E9RA 2D7EA 1L2BA 3UZUA 3FYDA 1SXJD 3HHYA 1IY1A 5KPRA 2Z4SA 2L4EA 3GLFE 3T1YM 3U5ZB 1IN5A 4GHLA 4LFCM 4M0WA 4RF0A 1D0MA 3QYEA 2CV2A 1IBKM 3GLIB 1TH4A 1TH3A 1KFVA 4AG5A 2A5YB 4YY3M 2DZOB 1R2ZA 3FKEA 4II7A 2UUBM 2KA6B 2YNMD 4DR3M 1L2DA 1S3SA 1VQ1A 4B3RM 4IBEA 2XZFA 4OX9M 1IN8A 2KZSA 3HZJA 1GLNA 2FS1A 2MGWA 2WSCF 4D82A 3PFIA 3QWLA 1J5EM 2C98A 4GKJM 4IIWA 5EXSA 4GEWA 2BJWA 1XB2B 2QBYB 3E4RA 2RGOA 4NXNM 3L2AA 1OQYA 4X66M 2V6ZM 3HJQA 3BXWA 1H6UA 2V1UA 3BOSA 3IG5A 1Z59A 1D2NA 4NRVA 4I81A 3T15A 4K0KM 4L15A 1SXJC 1GL6A 3NWLA 1WR1B 3B7ZA 3FUWA 4CGYB 3A42A 4X65M 1EFUB 4AW4A 4WP2A 1ORYB 1YE9A 3VLFB 4AZFA 4IBGA 4LFBM 3T38A 2R65A 3HJSA 3CF0A 1NHWC 1W5SA 3SAWA 1C1KA 1L8QA 1MJGM 4JXJA 3I4YA 5ITYA 3E46A 2ZANA 4Y28F 2QQ8A 3ZCBB 5KO3A 3D8BA 3LCVB 3U6OA 2L7HA 2DWZB 2ZAMA 3GLGA 3KS4A 4DUYM 1GKIA 3E9SA 3RGPA 1I4WA 3KP1E 3C3DA 2LXEA 2DHRA 2GQFA 2KNZA 1IY2A 2K0BX 4PDIA 1XC8A 1OAIA 4JI5M 1R4GA 1N77A 2NQ8C 4IBDA 4AG6A 2MR9A 3GLFA 5ITUA 1N33M 3LW5F 5ITTA 3FE3A 3KOXE 2L6OA 1PJQA 2KRKA 3SAVA 3DZDA 3LVVA 4ITQA 1Y8GA 2CFOA 1V33A 3GPYA 4DR4M 1Z5BA 4JI6M 2F5PA 1WHCA 2XH9A 3WHLA 4BLCA 2KW0A 3C9PA 5EXTA 4JI2M 2C9OA 2L2DA 1QQWA 4KT0F 2C9CA 2YQZA 4S12A 3AKZA 4I5SA 2H1RA 3U6PA 4KHPM 1QAQA 3JR4A 1DGHA 2ZBKB 4QHTA 4Z6YA 3PXGA 3GPUA 2LBCA 4OVZB 4BB9A 2CRUA 1N34M 4G4RA 2G3QA 1SXJE 2L4FA 1NJGA 3MJ5A 3UK6A 3JAMS 4ANRA 1P3QQ 3U6DA 4DR5M 3FYCA 5DYGA 4AI6A 1MU5A 4FVMA 4F2LA 4CHTB 1DO2A 2JY7A 4LZJA 3E21A 3KFUG 4LJAA 4MGIE 3CTWB 3W67A 2G5GX 3LCUA 2OQ4A 3U60A 1PJIA 3QYBA 1IBMM 5C1BA 4FCVA 4LF4M 1QUTA 1IBLM 1Z6TA 1QANA
chains in the Genus database with same CATH topology
3K9OA 1NV8A 2DAKA 3GLFE 2L4EA 2DZLA 2LVQD 1VEKA 1IFYA 1XXHE 3GLHE 4UN2B 2MJ5B 2JUJA 1DO0A 2JZ0A 1CUKA 1YLAA 1HJPA 1WGLA 2LVAA 1BVSA 1F4IA 2QSFX 2LVNC 1IM2A 1VQ1A 2DNAA 2EKFA 2KNAA 2CP8A 2RRUA 2MGWA 1T43A 4GEWA 2JZ1A 1XB2B 2EKKA 2DAMA 1OQYA 2MROB 2OOBA 3B89A 2JP7A 5JI2E 1HT2E 1UFZA 2DAEA 2DI0A 2LVPC 4HEOA 1T6OA 2HWJA 1JR3E 4G3OA 1WR1B 1G41A 2OO9A 1A5TA 2BWEA 1EFUB 3FRIA 2KNVA 1ZV1A 1G4AE 1AIPC 2HAKA 4WP2A 1NV9A 4F1IA 2WZJA 1SG9A 5DFLA 1ZMUA 1ZMWA 4Q7JA 3E46A 1C7YA 1WJ7A 1OKSA 3FRHA 4DBGB 3LCVB 1OTRA 2ZTCA 2CWBA 2EJSA 1TR8A 2H5XA 3IECA 3H4JA 1V92A 2KNZA 2JY5A 2K0BX 2OOAA 1OAIA 2BWBA 1R4GA 2MR9A 3FE3A 1VG5A 1G3IA 1DV0A 2KHHA 1GO5A 1Y8GA 2DAGA 2R0IA 3BBZA 1WHCA 3K9PA 2K9DA 1HT1E 3MMPA 2L2DA 3F92A 1KYIA 2ZTDA 1TTEA 2JNHA 2DKLA 2DAIA 2QHOB 2LBCA 2DENA 2G3QA 2B3TA 2L4FA 1ZMVA 2O25A 1P3QQ 2LVOC 1VDLA 4F2LA 1DO2A 1HQYE 2JY7A 1E94E 2JY6B 1VEJA 1WGNA 1QZEA 3E21A 3IHPA 3GLGE 1IXSA 2DHYA 1VEGA 3LCUA 3T6PA 1WIVA 2QNJA 3GLIE 4R71A 1PGYA 2LTUA 2JY8A 1Q02A 1MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O A;  1NV8 A;  2DAK A;  3GLF E;  2L4E A;  2DZL A;  2LVQ D;  1VEK A;  1IFY A;  1XXH E;  3GLH E;  4UN2 B;  2MJ5 B;  2JUJ A;  1DO0 A;  2JZ0 A;  1CUK A;  1YLA A;  1HJP A;  1WGL A;  2LVA A;  1BVS A;  1F4I A;  2QSF X;  2LVN C;  1IM2 A;  1VQ1 A;  2DNA A;  2EKF A;  2KNA A;  2CP8 A;  2RRU A;  2MGW A;  1T43 A;  4GEW A;  2JZ1 A;  1XB2 B;  2EKK A;  2DAM A;  1OQY A;  2MRO B;  2OOB A;  3B89 A;  2JP7 A;  5JI2 E;  1HT2 E;  1UFZ A;  2DAE A;  2DI0 A;  2LVP C;  4HEO A;  1T6O A;  2HWJ A;  1JR3 E;  4G3O A;  1WR1 B;  1G41 A;  2OO9 A;  1A5T A;  2BWE A;  1EFU B;  3FRI A;  2KNV A;  1ZV1 A;  1G4A E;  1AIP C;  2HAK A;  4WP2 A;  1NV9 A;  4F1I A;  2WZJ A;  1SG9 A;  5DFL A;  1ZMU A;  1ZMW A;  4Q7J A;  3E46 A;  1C7Y A;  1WJ7 A;  1OKS A;  3FRH A;  4DBG B;  3LCV B;  1OTR A;  2ZTC A;  2CWB A;  2EJS A;  1TR8 A;  2H5X A;  3IEC A;  3H4J A;  1V92 A;  2KNZ A;  2JY5 A;  2K0B X;  2OOA A;  1OAI A;  2BWB A;  1R4G A;  2MR9 A;  3FE3 A;  1VG5 A;  1G3I A;  1DV0 A;  2KHH A;  1GO5 A;  1Y8G A;  2DAG A;  2R0I A;  3BBZ A;  1WHC A;  3K9P A;  2K9D A;  1HT1 E;  3MMP A;  2L2D A;  3F92 A;  1KYI A;  2ZTD A;  1TTE A;  2JNH A;  2DKL A;  2DAI A;  2QHO B;  2LBC A;  2DEN A;  2G3Q A;  2B3T A;  2L4F A;  1ZMV A;  2O25 A;  1P3Q Q;  2LVO C;  1VDL A;  4F2L A;  1DO2 A;  1HQY E;  2JY7 A;  1E94 E;  2JY6 B;  1VEJ A;  1WGN A;  1QZE A;  3E21 A;  3IHP A;  3GLG E;  1IXS A;  2DHY A;  1VEG A;  3LCU A;  3T6P A;  1WIV A;  2QNJ A;  3GLI E;  4R71 A;  1PGY A;  2LTU A;  2JY8 A;  1Q02 A;  1MN3 A; 
#chains in the Genus database with same CATH topology
 3HHZ A;  4B08 A;  3AOE A;  3K9O A;  3KVW A;  3HGI A;  4JI8 M;  2DWN A;  3I04 M;  3K92 A;  2LVQ D;  2R62 A;  3A46 A;  4MH0 E;  2MJ5 B;  4KO8 A;  4CIZ A;  2DVW B;  2QP9 X;  2XFS A;  3EIH A;  3ILK A;  1QVR A;  1CUK A;  3HU1 A;  2LVA A;  3B7N A;  3KSJ A;  4RF1 A;  4R7G A;  3TL4 X;  5KPT A;  2F4V M;  1F4I A;  3FUV A;  2VF7 A;  1QUS A;  1V34 A;  2R4E A;  1IY0 A;  5IZ7 D;  4JI3 M;  2EO2 A;  4XBO A;  3U6E A;  3FTE A;  3DOA A;  3GLH B;  4IBB A;  2I7N A;  3WHK A;  2KNA A;  3UJN A;  2K6B A;  2R46 A;  2J5Y A;  4DV3 M;  1JR3 A;  2CEA A;  4AQY M;  2UXB M;  1OFI A;  2XFT A;  1K3X A;  3M7G A;  2QEN A;  3U6S A;  2OOB A;  3AFH A;  3HHW A;  1XHB A;  1IXZ A;  2RGH A;  4LF6 M;  4X62 M;  1NY6 A;  4L6V 6;  4TUW A;  3Q8G A;  2LH0 A;  3HX3 A;  5IT9 S;  3SBJ A;  5EXX A;  1R2Y A;  3GRU A;  2KRU A;  3ZQJ A;  2I7P A;  1G41 A;  1RU3 A;  2Y21 A;  5H37 D;  1A5T A;  1HNZ M;  2KNV A;  1ZV1 A;  1G4A E;  3TWK A;  3THG A;  4G4N A;  3I4V A;  3VDP A;  3SC3 A;  1D0L A;  3VK8 A;  2KZU A;  4F1I A;  1IXS B;  2WZJ A;  2XSZ A;  1IN4 A;  1XXH B;  1ZMU A;  4P16 A;  2OPF A;  2Z8Y M;  5EP2 A;  1SXJ A;  1NO1 A;  3EIE A;  3M0E A;  3GPX A;  1OKS A;  1C7Y A;  3AL0 C;  4DBG B;  4LG2 A;  3C58 A;  2CWB A;  4R3D A;  4JN6 A;  3U6M A;  3T1H M;  3J2P B;  2R18 A;  2CE7 A;  2H5X A;  3LMM A;  2E5L M;  2F5O A;  5EP3 A;  1HNX M;  2N35 A;  4DV4 M;  5FSW A;  4D80 A;  5LMU M;  2OOA A;  4RNA A;  4GMQ A;  1IN7 A;  3JR5 A;  1J09 A;  2ERC A;  1K82 A;  3FTD A;  5KQD A;  1XNQ M;  5ITQ A;  3SAS A;  1G3I A;  5JI3 E;  2KHH A;  4LJ6 A;  4A3V B;  4NL4 H;  4P17 A;  2R0I A;  4M9Z A;  1TDZ A;  3SYL A;  3SAR A;  1TH2 A;  3K9P A;  2O5R A;  4MGY E;  1HT1 E;  1IN6 A;  3MMP A;  4IBF A;  5ITR A;  1G71 A;  2FOI C;  2VF8 A;  1PJS A;  2X49 A;  1DGF A;  2QPA A;  1KSF X;  1NNU C;  4LF9 M;  1HNW M;  1PJT A;  4LJ9 A;  2YR0 A;  4NOO B;  5L8R F;  4NSR A;  2K47 A;  1OIP A;  2Q2E B;  4FCW A;  3RGS A;  4FW9 A;  4IJF A;  4X64 M;  1I94 M;  2HCB A;  1K3W A;  4M9S A;  3IHP A;  1VEJ A;  2XLJ A;  2DHY A;  1XNR M;  4LJ5 A;  5FTJ A;  3SAU A;  3OTO M;  1DGG A;  4B7H A;  4DR1 M;  3RE8 A;  2QNJ A;  3T6P A;  3J81 S;  3GLI E;  3U61 A;  4QNR A;  1PGY A;  3R8F A;  4OU7 A;  3I01 M;  4LJ7 A;  3HJ8 A;  2LWX A;  2CV0 A;  4AKG A;  1MN3 A;  2VQF M;  4JI7 M;  3HU2 A;  1NV8 A;  2DAK A;  4Z8X A;  3GLG B;  1QDT A;  4WW0 A;  1XXH E;  2FE8 A;  2JUJ A;  3KP0 E;  1DO0 A;  1MX0 A;  2JZ0 A;  4DV5 M;  4DR2 M;  5EP1 A;  1L2C A;  3LQQ A;  2FFJ A;  1ZQ9 A;  5BPV A;  2QSF X;  2LVN C;  3K8Z A;  3GQ4 A;  4G6Z A;  1IM2 A;  2CV1 A;  1FJG M;  3FUU A;  4W5W A;  3B74 A;  4PD2 A;  3GLF B;  2XF3 A;  4M0D A;  1PJJ A;  4LF7 M;  2EKF A;  3J7A S;  4GH9 A;  1X37 A;  2CP8 A;  4XK8 F;  4NRW A;  3KOY E;  4FCT A;  3CGW A;  1WXQ A;  2R44 A;  3D8L A;  3K2L A;  2DAM A;  4FWD A;  4HLQ A;  3L27 A;  2KEB A;  3B9P A;  1XMO M;  2HHH M;  5JI2 E;  2JWS A;  1JB0 F;  3KS8 A;  1UFZ A;  2DAE A;  2CHG A;  2DI0 A;  4QOS A;  5KQ8 A;  2LVP C;  2W82 A;  1GVN A;  2LHC A;  3PNY A;  4XGI A;  5DNY A;  1T6O A;  1L1T A;  1DGH B;  2VDB B;  4QOZ C;  1PRB A;  2FH0 A;  4MGH A;  5EXP A;  3HY5 A;  1R7R A;  2CUZ A;  2OO9 A;  2ZM6 M;  2QCU A;  2J7N A;  2HAK A;  3A45 A;  1IXR C;  1N32 M;  4L4U A;  4DV2 M;  3GPP A;  1Q3C A;  1R5L A;  2UXC M;  3J27 B;  3J7B A;  4B7G A;  4WUR A;  3U6L A;  4NXM M;  5KPZ A;  2WSE F;  4LJ8 A;  4MM3 B;  3U60 B;  4Q7J A;  2Z7J A;  4L78 A;  3HWS A;  1JR3 D;  4EIW A;  1QDR A;  1WJ7 A;  3I51 A;  5BR8 M;  3FRH A;  1Q3B A;  2HKJ A;  3TQS A;  3M6A A;  2EA0 A;  1ZAE A;  3U6C A;  2ZTC A;  3AJI B;  1TGU A;  4DUZ M;  1YUB A;  2EJS A;  2M60 A;  3Q8X A;  3U5Z A;  1JQJ C;  7CAT A;  2JA2 A;  5FLX S;  4QHS A;  4B3M M;  1NHG C;  3H4J A;  2APL A;  3AV0 A;  1QZM A;  3GLI A;  1V92 A;  1EE8 A;  3R9X B;  4LCB A;  2JY5 A;  3L29 A;  1J7K A;  1DGB A;  3AOE C;  3KSX A;  2Y20 A;  2F5N A;  3HKP A;  1FNN A;  1QAM A;  3GRV A;  4IBK A;  1G8P A;  2UXD M;  3MK6 A;  4KOD A;  1VDD A;  1VG5 A;  1PM5 A;  2WSF F;  1N75 A;  1Q39 A;  5IRE B;  4MGK E;  1GO5 A;  1T3T A;  4GRI A;  4DR7 M;  3FTF A;  2BNK A;  4LZZ A;  4KLN A;  3VFD A;  2DWL A;  2QBY A;  1NSF A;  3U6Q A;  3MHV C;  3NBI A;  3F92 A;  1NJF A;  3VDU A;  2ZTD A;  3TWM A;  3FUX A;  2JNH A;  4LF5 M;  3A98 B;  4DV0 M;  4LRT A;  1W5T A;  2CHV A;  4PCZ A;  1XWI A;  4M9X A;  1Z5C A;  2G8L A;  1TF0 B;  2D7H A;  2QHO B;  2XGN A;  4FWG A;  4I4L A;  4JI4 M;  4GHA A;  1OFH A;  3GO8 A;  2Y0T A;  2LVO C;  2DWM A;  4IBC A;  4IBJ A;  1QYR A;  4AKI A;  3VKH A;  1HQY E;  4JYA M;  4OW0 A;  2P5T A;  4LJ4 A;  1GL7 A;  1WGN A;  2JY6 B;  1QZE A;  2MH8 A;  1G59 A;  4NC6 A;  3SMP A;  1VEG A;  3GQ5 A;  3IG8 A;  3H4M A;  4RKU F;  1SXJ B;  1WIV A;  2D7G A;  2F5Q A;  4R71 A;  4QNM A;  2LTU A;  3KW6 A;  2JY8 A;  4L8R C;  1Q02 A;  1OJL A;  3DFZ A;  3SHF A;  4PT5 A;  2FNA A;  4LF8 M;  3VKG A;  5FTK A;  4B7F A;  2DZL A;  4LGY A;  1VEK A;  1IFY A;  1D0K A;  3GLH E;  4UN2 B;  2F5S A;  3NBX X;  8CAT A;  1UM8 A;  2Y0Q A;  2L7I A;  4D81 A;  1YLA A;  1HJP A;  1WGL A;  3SAT A;  1BVS A;  4LRS A;  5FTL A;  2LHG A;  4GC5 A;  4PDG A;  3CF6 E;  2O01 F;  2VII A;  4B3S M;  1N78 A;  4CIS A;  3UMM A;  3SMS A;  2DNA A;  3TWL A;  3LVW A;  5ITX E;  3DA1 A;  2XZU A;  4YHH M;  2RRU A;  1T43 A;  4L16 A;  1NVM A;  3PNV A;  1NNJ A;  2JZ1 A;  3FTC A;  5GKN A;  2C5R A;  2EKK A;  2V1C A;  2YFQ A;  4CJ6 A;  2R4J A;  2MRO B;  3B89 A;  5DYI A;  2JP7 A;  1HT2 E;  4DR6 M;  3ZC7 B;  4HEO A;  1E32 A;  2UU9 M;  1YSY A;  4GC9 A;  2HWJ A;  2EUC A;  1NY5 A;  3TPZ A;  3W0F A;  4B3T M;  5FTM A;  3SFZ A;  1JR3 E;  5IWA M;  2M5Z A;  4G3O A;  3W0L B;  3UGJ A;  4OVZ A;  1HR0 M;  4GIT A;  5F3W A;  3GRR A;  1N36 M;  2BWE A;  3FRI A;  3L25 A;  3TE6 A;  1AIP C;  1GJT A;  1OAO C;  2DZN B;  5E26 A;  2R6F A;  1GAB A;  4DV7 M;  1NV9 A;  2ZAO A;  3V76 A;  1SG9 A;  4GIP A;  3PVS A;  5DFL A;  1ZMW A;  2LNH C;  5A2Q S;  2UUC M;  1L1Z A;  4FD2 A;  2C96 A;  2Z3X A;  3U61 B;  2UUA M;  3KDS E;  4JI1 M;  1EIJ A;  4FWH A;  1R6B X;  2RKO A;  3CF2 A;  3VK7 A;  1OTR A;  2HL7 A;  2J7O A;  3GP1 A;  4DV1 M;  1GJS A;  1TR8 A;  3K1J A;  3SHG B;  5LMN M;  3IEC A;  2BJV A;  2JXN A;  2X4A A;  3KOZ E;  5E6J A;  3W68 A;  2X8A A;  2GNO A;  3L26 A;  2BWB A;  4G4Q A;  3QAU A;  1XMQ M;  3GQ3 A;  3C3E A;  4JV5 M;  2L09 A;  2XEP A;  3FD9 A;  5FTN A;  4LFA M;  4AKH A;  1DV0 A;  4ZPX A;  3HU3 A;  4BBA A;  3GLH A;  5EQT A;  1HQC A;  2Z4R A;  1OIZ A;  3GRY A;  2DAG A;  3KXE C;  3L28 A;  3BBZ A;  3AOG A;  2QZ4 A;  3B7Q A;  2K9D A;  1E9S A;  1TDH A;  3FUT A;  5ITX A;  2DXI A;  1LTM A;  1KYI A;  1TTE A;  2AHM A;  2DKL A;  4LGM A;  2DAI A;  4REZ A;  4HL4 A;  4GKK M;  3ZH9 B;  1IQP A;  4I8O A;  4JI0 M;  4IBI A;  2DEN A;  2O25 A;  2B3T A;  3KOW E;  1ZMV A;  3J80 S;  4LY6 A;  4IJE A;  3RFW A;  1QAO A;  3LQR A;  4NSO B;  1VDL A;  4G4O A;  2R45 A;  5C18 A;  4DV6 M;  1AUA A;  1E94 E;  1LV7 A;  4MGZ E;  1Z5A A;  5EP4 A;  3GLG E;  1IXS A;  2KDL A;  4MB7 A;  2VQE M;  2CHQ A;  2KXE A;  3HHX A;  1XXH A;  2C99 A;  3SYK A;  2XSZ D;  5EJC A;  1E9R A;  2D7E A;  1L2B A;  3UZU A;  3FYD A;  1SXJ D;  3HHY A;  1IY1 A;  5KPR A;  2Z4S A;  2L4E A;  3GLF E;  3T1Y M;  3U5Z B;  1IN5 A;  4GHL A;  4LFC M;  4M0W A;  4RF0 A;  1D0M A;  3QYE A;  2CV2 A;  1IBK M;  3GLI B;  1TH4 A;  1TH3 A;  1KFV A;  4AG5 A;  2A5Y B;  4YY3 M;  2DZO B;  1R2Z A;  3FKE A;  4II7 A;  2UUB M;  2KA6 B;  2YNM D;  4DR3 M;  1L2D A;  1S3S A;  1VQ1 A;  4B3R M;  4IBE A;  2XZF A;  4OX9 M;  1IN8 A;  2KZS A;  3HZJ A;  1GLN A;  2FS1 A;  2MGW A;  2WSC F;  4D82 A;  3PFI A;  3QWL A;  1J5E M;  2C98 A;  4GKJ M;  4IIW A;  5EXS A;  4GEW A;  2BJW A;  1XB2 B;  2QBY B;  3E4R A;  2RGO A;  4NXN M;  3L2A A;  1OQY A;  4X66 M;  2V6Z M;  3HJQ A;  3BXW A;  1H6U A;  2V1U A;  3BOS A;  3IG5 A;  1Z59 A;  1D2N A;  4NRV A;  4I81 A;  3T15 A;  4K0K M;  4L15 A;  1SXJ C;  1GL6 A;  3NWL A;  1WR1 B;  3B7Z A;  3FUW A;  4CGY B;  3A42 A;  4X65 M;  1EFU B;  4AW4 A;  4WP2 A;  1ORY B;  1YE9 A;  3VLF B;  4AZF A;  4IBG A;  4LFB M;  3T38 A;  2R65 A;  3HJS A;  3CF0 A;  1NHW C;  1W5S A;  3SAW A;  1C1K A;  1L8Q A;  1MJG M;  4JXJ A;  3I4Y A;  5ITY A;  3E46 A;  2ZAN A;  4Y28 F;  2QQ8 A;  3ZCB B;  5KO3 A;  3D8B A;  3LCV B;  3U6O A;  2L7H A;  2DWZ B;  2ZAM A;  3GLG A;  3KS4 A;  4DUY M;  1GKI A;  3E9S A;  3RGP A;  1I4W A;  3KP1 E;  3C3D A;  2LXE A;  2DHR A;  2GQF A;  2KNZ A;  1IY2 A;  2K0B X;  4PDI A;  1XC8 A;  1OAI A;  4JI5 M;  1R4G A;  1N77 A;  2NQ8 C;  4IBD A;  4AG6 A;  2MR9 A;  3GLF A;  5ITU A;  1N33 M;  3LW5 F;  5ITT A;  3FE3 A;  3KOX E;  2L6O A;  1PJQ A;  2KRK A;  3SAV A;  3DZD A;  3LVV A;  4ITQ A;  1Y8G A;  2CFO A;  1V33 A;  3GPY A;  4DR4 M;  1Z5B A;  4JI6 M;  2F5P A;  1WHC A;  2XH9 A;  3WHL A;  4BLC A;  2KW0 A;  3C9P A;  5EXT A;  4JI2 M;  2C9O A;  2L2D A;  1QQW A;  4KT0 F;  2C9C A;  2YQZ A;  4S12 A;  3AKZ A;  4I5S A;  2H1R A;  3U6P A;  4KHP M;  1QAQ A;  3JR4 A;  1DGH A;  2ZBK B;  4QHT A;  4Z6Y A;  3PXG A;  3GPU A;  2LBC A;  4OVZ B;  4BB9 A;  2CRU A;  1N34 M;  4G4R A;  2G3Q A;  1SXJ E;  2L4F A;  1NJG A;  3MJ5 A;  3UK6 A;  3JAM S;  4ANR A;  1P3Q Q;  3U6D A;  4DR5 M;  3FYC A;  5DYG A;  4AI6 A;  1MU5 A;  4FVM A;  4F2L A;  4CHT B;  1DO2 A;  2JY7 A;  4LZJ A;  3E21 A;  3KFU G;  4LJA A;  4MGI E;  3CTW B;  3W67 A;  2G5G X;  3LCU A;  2OQ4 A;  3U60 A;  1PJI A;  3QYB A;  1IBM M;  5C1B A;  4FCV A;  4LF4 M;  1QUT A;  1IBL M;  1Z6T A;  1QAN A; 
#chains in the Genus database with same CATH homology
 3K9O A;  1NV8 A;  2DAK A;  3GLF E;  2L4E A;  2DZL A;  2LVQ D;  1VEK A;  1IFY A;  1XXH E;  3GLH E;  4UN2 B;  2MJ5 B;  2JUJ A;  1DO0 A;  2JZ0 A;  1CUK A;  1YLA A;  1HJP A;  1WGL A;  2LVA A;  1BVS A;  1F4I A;  2QSF X;  2LVN C;  1IM2 A;  1VQ1 A;  2DNA A;  2EKF A;  2KNA A;  2CP8 A;  2RRU A;  2MGW A;  1T43 A;  4GEW A;  2JZ1 A;  1XB2 B;  2EKK A;  2DAM A;  1OQY A;  2MRO B;  2OOB A;  3B89 A;  2JP7 A;  5JI2 E;  1HT2 E;  1UFZ A;  2DAE A;  2DI0 A;  2LVP C;  4HEO A;  1T6O A;  2HWJ A;  1JR3 E;  4G3O A;  1WR1 B;  1G41 A;  2OO9 A;  1A5T A;  2BWE A;  1EFU B;  3FRI A;  2KNV A;  1ZV1 A;  1G4A E;  1AIP C;  2HAK A;  4WP2 A;  1NV9 A;  4F1I A;  2WZJ A;  1SG9 A;  5DFL A;  1ZMU A;  1ZMW A;  4Q7J A;  3E46 A;  1C7Y A;  1WJ7 A;  1OKS A;  3FRH A;  4DBG B;  3LCV B;  1OTR A;  2ZTC A;  2CWB A;  2EJS A;  1TR8 A;  2H5X A;  3IEC A;  3H4J A;  1V92 A;  2KNZ A;  2JY5 A;  2K0B X;  2OOA A;  1OAI A;  2BWB A;  1R4G A;  2MR9 A;  3FE3 A;  1VG5 A;  1G3I A;  1DV0 A;  2KHH A;  1GO5 A;  1Y8G A;  2DAG A;  2R0I A;  3BBZ A;  1WHC A;  3K9P A;  2K9D A;  1HT1 E;  3MMP A;  2L2D A;  3F92 A;  1KYI A;  2ZTD A;  1TTE A;  2JNH A;  2DKL A;  2DAI A;  2QHO B;  2LBC A;  2DEN A;  2G3Q A;  2B3T A;  2L4F A;  1ZMV A;  2O25 A;  1P3Q Q;  2LVO C;  1VDL A;  4F2L A;  1DO2 A;  1HQY E;  2JY7 A;  1E94 E;  2JY6 B;  1VEJ A;  1WGN A;  1QZE A;  3E21 A;  3IHP A;  3GLG E;  1IXS A;  2DHY A;  1VEG A;  3LCU A;  3T6P A;  1WIV A;  2QNJ A;  3GLI E;  4R71 A;  1PGY A;  2LTU A;  2JY8 A;  1Q02 A;  1MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...