1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
b'QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN HHR23A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
1YLAA 1OTRA 1MN3A 1HJPA 2DENA 1ZV1A 2JNHA 2LVQD 2QSFX 1T6OA 1VDLA 4F2LA 3FRHA 3GLFE 1XXHE 2QHOB 1G4AE 1TTEA 1AIPC 2OOBA 2CWBA 1G3IA 1VG5A 1P3QQ 2G3QA 2L4FA 3E46A 2DAMA 2JY5A 2LVPC 3LCVB 1CUKA 1OQYA 1XB2B 1Y8GA 1OKSA 2K0BX 2QNJA 4HEOA 1F4IA 1G41A 2DNAA 1HQYE 2R0IA 2DHYA 1HT2E 2EKFA 3GLGE 1DO2A 4DBGB 2EKKA 3BBZA 1R4GA 2MR9A 1JR3E 2KNAA 1ZMUA 4F1IA 4R71A 2L4EA 1QZEA 2B3TA 2BWEA 3E21A 2H5XA 3FE3A 2MROB 1SG9A 2LTUA 2HAKA 4UN2B 1KYIA 5DFLA 1BVSA 1OAIA 3GLHE 2DAKA 2LVAA 3F92A 2JZ1A 2MJ5B 1IM2A 1NV9A 2DAEA 1VEKA 1WR1B 1IXSA 1WHCA 1EFUB 1TR8A 1ZMWA 2BWBA 2OOAA 2RRUA 1UFZA 2DAIA 2DZLA 2K9DA 2JUJA 1WIVA 1V92A 1VEGA 3T6PA 1PGYA 1WGLA 4WP2A 2OO9A 1A5TA 4GEWA 2KNZA 1HT1E 2JY6B 2O25A 1Q02A 3K9OA 2JY8A 3MMPA 3LCUA 1ZMVA 1WGNA 2MGWA 2DI0A 2ZTCA 3IECA 4G3OA 3B89A 2DAGA 2L2DA 2JY7A 3GLIE 1VEJA 1IFYA 4Q7JA 2LBCA 1DV0A 1GO5A 2KNVA 2ZTDA 3IHPA 1NV8A 1VQ1A 2HWJA 5JI2E 1E94E 3H4JA 2LVOC 1T43A 1C7YA 2EJSA 3FRIA 2JP7A 2JZ0A 2DKLA 2LVNC 1WJ7A 2CP8A 3K9PA 2WZJA 1DO0A 2KHHA
chains in the Genus database with same CATH superfamily
3FUXA 1ZAEA 1OJLA 1YLAA 1OTRA 2R45A 4DR6M 2DENA 3QYBA 3SAWA 4HLQA 4PCZA 3K92A 1GL6A 2JNHA 3TWMA 2LVQD 4DUYM 4F2LA 4OVZA 4MB7A 1DGGA 4ZPXA 2DVWB 4P17A 2QHOB 4PD2A 1TTEA 3HWSA 2HCBA 3GLFA 1XXHA 1VG5A 1IBMM 4D82A 2JY5A 4AQYM 2UUAM 1CUKA 1XB2B 1NNUC 2K0BX 4I8OA 1WXQA 4HEOA 4JXJA 3SARA 4GRIA 3FUWA 3U61A 1ORYB 1Q3CA 1HT2E 4W5WA 1N78A 3KVWA 4NXMM 4FCWA 1LV7A 2EKKA 1N33M 4MGYE 1IN7A 4IIWA 3CF2A 2OPFA 2E5LM 1OFHA 4LFBM 4IJFA 4WURA 2UXDM 3L26A 4FCTA 4I4LA 4R71A 4JI7M 1JR3A 2VIIA 1QAMA 2EO2A 2BWEA 3E21A 3KSXA 3LVVA 4B7HA 3UGJA 4I81A 1IBKM 4LF8M 4KHPM 4DV2M 4IBEA 3SYKA 2XF3A 2KZSA 3AOGA 4UN2B 3U6QA 3W0FA 2X8AA 1YE9A 2DWNA 1XNQM 1GJSA 3NWLA 3GQ4A 1NHWC 3I4VA 2KW0A 3FTFA 3E4RA 1C1KA 1HR0M 4IBKA 2XLJA 3AL0C 1TH2A 2LVAA 2DAKA 2DXIA 1XMQM 1QAQA 1Z59A 2JZ1A 2QBYA 1QDTA 1WR1B 1IY1A 1IXSA 3VKHA 3K2LA 1KSFX 3SC3A 1EFUB 3JAMS 5DNYA 2FS1A 2Z3XA 1ZMWA 1SXJD 5KQ8A 1L2CA 2K9DA 3L27A 3RGPA 3T1HM 2JUJA 2HKJA 1TDZA 4GEWA 1A5TA 3FUUA 2RGHA 1JQJC 5EXTA 3B7QA 3TE6A 4ANRA 4B7GA 4JI2M 2JY6B 4K0KM 1E9SA 3DA1A 3UJNA 4OX9M 1R2YA 2CFOA 5KPZA 3NBIA 1HNWM 1T3TA 2V1UA 5FTKA 2J5YA 5DYIA 3SYLA 5IWAM 2UUBM 2MGWA 2L7IA 2DWMA 1XHBA 5KO3A 4DUZM 2R4JA 1R6BX 2XSZA 4IBJA 2F5QA 3T1YM 1JB0F 4IBBA 4Q7JA 3U6LA 4PT5A 5LMUM 2FH0A 1GABA 2VF8A 1SXJE 4B3TM 3QAUA 3HU2A 3CGWA 4M9XA 1DGFA 4JI6M 4LJ8A 5IZ7D 4GC5A 1VQ1A 2Z4RA 2ZAOA 2R62A 3HHYA 1QVRA 2C96A 4KO8A 1E94E 2FNAA 3HU3A 4LCBA 4LGMA 2CEAA 2XFTA 2MH8A 2OQ4A 2DWLA 3HJQA 2R46A 2WSCF 3T38A 1IXRC 1NO1A 2J7OA 5ITXE 2LVNC 4LF7M 1WJ7A 3K9PA 2WSEF 8CATA 2WZJA 3U6EA 3Q8XA 2WSFF 2ZM6M 3HHXA 1HQCA 3GPPA 4LF4M 2X49A 3U5ZA 3DOAA 3FYDA 3AOEC 1VDLA 4L8RC 5EQTA 1YSYA 3GLFE 3MK6A 1XXHE 1GL7A 2VDBB 2KRUA 1AIPC 2KXEA 1Z6TA 5EJCA 1P3QQ 1IN4A 2L4FA 3LCVB 2DAMA 2LVPC 4LG2A 4PDGA 5C1BA 2K47A 1OKSA 1XWIA 2O01F 4DV6M 2F5PA 5KPRA 3U6SA 2QZ4A 1F4IA 3U6DA 1G41A 3PNYA 3U60A 2R0IA 1DO2A 2RGOA 3KW6A 4QOSA 4PDIA 3L28A 3R8FA 1R4GA 1QUSA 3GLGA 3WHLA 4DV1M 2CV1A 1JR3E 1ZMUA 3AV0A 3SHFA 3D8BA 1NY5A 3KOXE 5ITXA 4F1IA 3FTEA 3DZDA 4R7GA 5C18A 1ZQ9A 1RU3A 2H5XA 3GLHB 4NRVA 4FD2A 3FTCA 2C98A 3UK6A 3GO8A 4MGZE 2C9OA 3FKEA 3HJ8A 5ITTA 1HNZM 5DFLA 3C3EA 4FW9A 2Y20A 2HL7A 2LNHC 1SXJB 3SFZA 2XSZD 1Z5BA 1UM8A 2MJ5B 2LH0A 4MM3B 1VEKA 2QP9X 5EP2A 3KOZE 1D0MA 3KOWE 1WHCA 3SAUA 1Z5AA 1V34A 5L8RF 3J81S 1TR8A 2APLA 1K3WA 4AKHA 2G5GX 2BWBA 2RRUA 4Z8XA 1Z5CA 3W0LB 5LMNM 2DAIA 3LMMA 4RKUF 3V76A 4JI0M 2Z4SA 3ZCBB 5FTMA 3TQSA 4L78A 3KS8A 4DR1M 3I51A 4JI5M 1NJGA 2YNMD 4L15A 3KXEC 1HT1E 2V1CA 1DGHB 4NXNM 4ITQA 1PJQA 3BOSA 3K9OA 2JY8A 4JI8M 4X64M 4OW0A 3RGSA 4D80A 4AG5A 3D8LA 3A46A 4BB9A 2ZAMA 1X37A 2DI0A 2QPAA 3VFDA 2QCUA 5FTLA 4OVZB 1MX0A 2DAGA 2L2DA 2JY7A 1PJJA 3GLIE 1VEJA 2J7NA 1DGBA 3IG8A 2D7HA 1IBLM 3GLFB 2F5NA 1XXHB 1N36M 2CRUA 4B3MM 2KNVA 2C99A 1NV8A 2GNOA 2L09A 2KZUA 3EIHA 5EP4A 4IBFA 2KA6B 4GHLA 3U61B 3PFIA 4YHHM 1D0KA 2I7NA 4LJ5A 3HGIA 1I94M 2HWJA 2JA2A 2HHHM 3VLFB 2M60A 2CV0A 2KRKA 4M0WA 4NL4H 2RKOA 4JI4M 2F5SA 1OIPA 2XFSA 2LVOC 4QNMA 4AKGA 2LXEA 2KEBA 1T43A 4RF1A 1C7YA 2EJSA 2EA0A 4LJ6A 4Z6YA 3W67A 2JP7A 3GPXA 4M9ZA 2ZBKB 1W5TA 3K1JA 4NC6A 2AHMA 2DKLA 4QHSA 3LW5F 2CP8A 4LRSA 4HL4A 2XEPA 1AUAA 2ZANA 5FTNA 3J80S 3ZQJA 5JI3E 3SAVA 4B3SM 3A45A 1QQWA 3GLIA 1MN3A 2LWXA 3SATA 4P16A 1L2BA 3MHVC 1HJPA 2QBYB 5ITRA 3GPYA 3VKGA 4LJ9A 2QSFX 1NJFA 3AFHA 4Y28F 2R6FA 2CUZA 1IXSB 3OTOM 1G4AE 1YUBA 4GC9A 4FWDA 4R3DA 2CWBA 1G3IA 1Q39A 1QUTA 4AI6A 5DYGA 2QNJA 4DR5M 3GRVA 4QOZC 2K6BA 4G4OA 4FCVA 5FLXS 4DR2M 4JI1M 2DNAA 1Q3BA 2ERCA 3VDUA 1HQYE 2DHYA 2EKFA 5ITYA 3GLGE 3MJ5A 4NOOB 1R2ZA 4MGHA 4DBGB 1IN6A 4LZJA 3HY5A 2VQEM 1XC8A 2O5RA 3K8ZA 4IBCA 2XH9A 2D7EA 1JR3D 2XZFA 2A5YB 1PJIA 5A2QS 1QZEA 4DV0M 3KDSE 3LQRA 3KP0E 4G4RA 3FE3A 1IY2A 1E32A 3IG5A 4IJEA 2MROB 1SG9A 2LTUA 2YR0A 2HAKA 2I7PA 3DFZA 4GKJM 3C9PA 3PNVA 4WW0A 1KYIA 4G6ZA 5H37D 2DHRA 4LY6A 5EXPA 3T15A 4B3RM 4GKKM 2NQ8C 3B9PA 1BVSA 1OAIA 4GIPA 3J27B 1J09A 1J7KA 3HJSA 3GQ3A 1EIJA 2DAEA 2VQFM 2H1RA 2R18A 4TUWA 2DZOB 1VDDA 2GQFA 1OAOC 2L7HA 5E6JA 1GJTA 5GKNA 1NHGC 2QQ8A 1PJTA 2BJVA 2LHCA 2OOAA 3Q8GA 3THGA 4NRWA 3GRYA 1UFZA 2DZLA 1GKIA 2EUCA 2JXNA 2Y0TA 4IBGA 2C5RA 1KFVA 1G8PA 1MU5A 1V92A 3T6PA 1PGYA 1WGLA 3AOEA 2OO9A 1TDHA 3H4MA 3KSJA 3U6MA 2X4AA 5IT9S 1PM5A 3E9SA 3PXGA 1PRBA 4AKIA 2YQZA 3B74A 4GITA 4JN6A 4LF9M 3MMPA 3LCUA 1ZMVA 1QDRA 3SMPA 3HU1A 5ITUA 3U5ZB 2FOIC 1N75A 3J2PB 3I04M 3KS4A 1L1TA 2UXCM 1GVNA 4REZA 1NSFA 4I5SA 1IFYA 3TL4X 2LBCA 4RNAA 2KDLA 4DV7M 3IHPA 1LTMA 4CHTB 1NY6A 2BNKA 2C9CA 3U60B 4DR4M 4DV4M 5IREB 3SASA 2UXBM 4QNRA 3GLGB 1IN8A 5JI2E 2L6OA 1N32M 4D81A 3B7ZA 3H4JA 3KP1E 3GP1A 4IBDA 3C58A 4LFCM 3RE8A 3FRIA 4FWHA 2CHQA 4MH0E 4LJ7A 3FUTA 3LQQA 1NVMA 4KODA 4EIWA 1QYRA 4LRTA 1TH4A 2BJWA 3VK8A 1E9RA 2DWZB 4FVMA 5EXSA 2XGNA 3VDPA 2Z8YM 3C3DA 4X66M 1ZV1A 4CJ6A 4G4QA 1PJSA 1T6OA 3CTWB 3FRHA 3L2AA 1K3XA 4LF6M 1D2NA 2M5ZA 2P5TA 5KPTA 3VK7A 4GH9A 1OFIA 2OOBA 3GPUA 3E46A 2G3QA 3I4YA 5BPVA 2CV2A 1OQYA 1Y8GA 4BBAA 1W5SA 4AZFA 3M6AA 2V6ZM 4DR7M 1TF0B 5F3WA 2F5OA 3WHKA 1EE8A 3ZH9B 3BBZA 1R7RA 5EP1A 2MR9A 1FJGM 2CHVA 4MGIE 2KNAA 2Z7JA 4KT0F 7CATA 4II7A 2L4EA 2R65A 2B3TA 4M9SA 3AJIB 5EP3A 4OU7A 3LVWA 4LF5M 3M0EA 4QHTA 3UMMA 2G8LA 3NBXX 1QZMA 2Y21A 3TWKA 2F4VM 1FNNA 4RF0A 4B08A 3UZUA 5FTJA 5BR8M 3GQ5A 4DR3M 3ZC7B 3HHWA 3GLHE 3J7BA 3AKZA 4DV5M 4X65M 3F92A 3GRRA 4L4UA 4XK8F 4LJ4A 1IN5A 2W82A 1IM2A 1NV9A 3PVSA 2DZNB 3SMSA 4LZZA 1N34M 1L8QA 4CIZA 1TH3A 3JR4A 4A3VB 4XBOA 5EXXA 3CF0A 4IBIA 4GMQA 3RFWA 1S3SA 3TPZA 1L1ZA 3J7AS 1GLNA 1WIVA 4MGKE 1VEGA 2LHGA 1SXJC 1K82A 4WP2A 3L29A 4GHAA 3SHGB 2KNZA 1D0LA 4XGIA 3BXWA 3L25A 3HZJA 4AG6A 3U6CA 2O25A 4CGYB 2VF7A 4S12A 3TWLA 1Q02A 2CE7A 3A42A 4LJAA 5ITQA 1IY0A 4NSOB 5FSWA 4X62M 3GLIB 2R4EA 1TGUA 2D7GA 4LGYA 3GRUA 3FYCA 3U6OA 4AW4A 1MJGM 1QAOA 1WGNA 3IECA 2ZTCA 4G3OA 1NNJA 2N35A 3B89A 3GLHA 1J5EM 4L6V6 2UU9M 4CISA 1IXZA 3HX3A 4YY3M 4G4NA 1XMOM 1OIZA 4LFAM 3B7NA 1DV0A 2CHGA 1GO5A 4BLCA 2ZTDA 5KQDA 4JV5M 3SBJA 2JWSA 4KLNA 3M7GA 1SXJA 1L2DA 1IQPA 3JR5A 1H6UA 3FD9A 3KOYE 1G71A 3A98B 1I4WA 2FFJA 3I01M 1N77A 1QANA 3U6PA 5E26A 3EIEA 1V33A 3FTDA 4JI3M 4FWGA 2UUCM 4M0DA 2R44A 3HHZA 3CF6E 2QENA 3QYEA 1G59A 3W68A 4NSRA 2FE8A 1R5LA 2Y0QA 2JZ0A 3QWLA 4L16A 4B7FA 4JYAM 3ILKA 2Q2EB 3R9XB 1XNRM 4DV3M 2YFQA 1HNXM 3KFUG 3HKPA 1DGHA 2XZUA 3FUVA 1DO0A 2KHHA
chains in the Genus database with same CATH topology
1YLAA 1OTRA 1MN3A 1HJPA 2DENA 1ZV1A 2JNHA 2LVQD 2QSFX 1T6OA 1VDLA 4F2LA 3FRHA 3GLFE 1XXHE 2QHOB 1G4AE 1TTEA 1AIPC 2OOBA 2CWBA 1G3IA 1VG5A 1P3QQ 2G3QA 2L4FA 3E46A 2DAMA 2JY5A 2LVPC 3LCVB 1CUKA 1OQYA 1XB2B 1Y8GA 1OKSA 2K0BX 2QNJA 4HEOA 1F4IA 1G41A 2DNAA 1HQYE 2R0IA 2DHYA 1HT2E 2EKFA 3GLGE 1DO2A 4DBGB 2EKKA 3BBZA 1R4GA 2MR9A 1JR3E 2KNAA 1ZMUA 4F1IA 4R71A 2L4EA 1QZEA 2B3TA 2BWEA 3E21A 2H5XA 3FE3A 2MROB 1SG9A 2LTUA 2HAKA 4UN2B 1KYIA 5DFLA 1BVSA 1OAIA 3GLHE 2DAKA 2LVAA 3F92A 2JZ1A 2MJ5B 1IM2A 1NV9A 2DAEA 1VEKA 1WR1B 1IXSA 1WHCA 1EFUB 1TR8A 1ZMWA 2BWBA 2OOAA 2RRUA 1UFZA 2DAIA 2DZLA 2K9DA 2JUJA 1WIVA 1V92A 1VEGA 3T6PA 1PGYA 1WGLA 4WP2A 2OO9A 1A5TA 4GEWA 2KNZA 1HT1E 2JY6B 2O25A 1Q02A 3K9OA 2JY8A 3MMPA 3LCUA 1ZMVA 1WGNA 2MGWA 2DI0A 2ZTCA 3IECA 4G3OA 3B89A 2DAGA 2L2DA 2JY7A 3GLIE 1VEJA 1IFYA 4Q7JA 2LBCA 1DV0A 1GO5A 2KNVA 2ZTDA 3IHPA 1NV8A 1VQ1A 2HWJA 5JI2E 1E94E 3H4JA 2LVOC 1T43A 1C7YA 2EJSA 3FRIA 2JP7A 2JZ0A 2DKLA 2LVNC 1WJ7A 2CP8A 3K9PA 2WZJA 1DO0A 2KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLA A;  1OTR A;  1MN3 A;  1HJP A;  2DEN A;  1ZV1 A;  2JNH A;  2LVQ D;  2QSF X;  1T6O A;  1VDL A;  4F2L A;  3FRH A;  3GLF E;  1XXH E;  2QHO B;  1G4A E;  1TTE A;  1AIP C;  2OOB A;  2CWB A;  1G3I A;  1VG5 A;  1P3Q Q;  2G3Q A;  2L4F A;  3E46 A;  2DAM A;  2JY5 A;  2LVP C;  3LCV B;  1CUK A;  1OQY A;  1XB2 B;  1Y8G A;  1OKS A;  2K0B X;  2QNJ A;  4HEO A;  1F4I A;  1G41 A;  2DNA A;  1HQY E;  2R0I A;  2DHY A;  1HT2 E;  2EKF A;  3GLG E;  1DO2 A;  4DBG B;  2EKK A;  3BBZ A;  1R4G A;  2MR9 A;  1JR3 E;  2KNA A;  1ZMU A;  4F1I A;  4R71 A;  2L4E A;  1QZE A;  2B3T A;  2BWE A;  3E21 A;  2H5X A;  3FE3 A;  2MRO B;  1SG9 A;  2LTU A;  2HAK A;  4UN2 B;  1KYI A;  5DFL A;  1BVS A;  1OAI A;  3GLH E;  2DAK A;  2LVA A;  3F92 A;  2JZ1 A;  2MJ5 B;  1IM2 A;  1NV9 A;  2DAE A;  1VEK A;  1WR1 B;  1IXS A;  1WHC A;  1EFU B;  1TR8 A;  1ZMW A;  2BWB A;  2OOA A;  2RRU A;  1UFZ A;  2DAI A;  2DZL A;  2K9D A;  2JUJ A;  1WIV A;  1V92 A;  1VEG A;  3T6P A;  1PGY A;  1WGL A;  4WP2 A;  2OO9 A;  1A5T A;  4GEW A;  2KNZ A;  1HT1 E;  2JY6 B;  2O25 A;  1Q02 A;  3K9O A;  2JY8 A;  3MMP A;  3LCU A;  1ZMV A;  1WGN A;  2MGW A;  2DI0 A;  2ZTC A;  3IEC A;  4G3O A;  3B89 A;  2DAG A;  2L2D A;  2JY7 A;  3GLI E;  1VEJ A;  1IFY A;  4Q7J A;  2LBC A;  1DV0 A;  1GO5 A;  2KNV A;  2ZTD A;  3IHP A;  1NV8 A;  1VQ1 A;  2HWJ A;  5JI2 E;  1E94 E;  3H4J A;  2LVO C;  1T43 A;  1C7Y A;  2EJS A;  3FRI A;  2JP7 A;  2JZ0 A;  2DKL A;  2LVN C;  1WJ7 A;  2CP8 A;  3K9P A;  2WZJ A;  1DO0 A;  2KHH A; 
#chains in the Genus database with same CATH topology
 3FUX A;  1ZAE A;  1OJL A;  1YLA A;  1OTR A;  2R45 A;  4DR6 M;  2DEN A;  3QYB A;  3SAW A;  4HLQ A;  4PCZ A;  3K92 A;  1GL6 A;  2JNH A;  3TWM A;  2LVQ D;  4DUY M;  4F2L A;  4OVZ A;  4MB7 A;  1DGG A;  4ZPX A;  2DVW B;  4P17 A;  2QHO B;  4PD2 A;  1TTE A;  3HWS A;  2HCB A;  3GLF A;  1XXH A;  1VG5 A;  1IBM M;  4D82 A;  2JY5 A;  4AQY M;  2UUA M;  1CUK A;  1XB2 B;  1NNU C;  2K0B X;  4I8O A;  1WXQ A;  4HEO A;  4JXJ A;  3SAR A;  4GRI A;  3FUW A;  3U61 A;  1ORY B;  1Q3C A;  1HT2 E;  4W5W A;  1N78 A;  3KVW A;  4NXM M;  4FCW A;  1LV7 A;  2EKK A;  1N33 M;  4MGY E;  1IN7 A;  4IIW A;  3CF2 A;  2OPF A;  2E5L M;  1OFH A;  4LFB M;  4IJF A;  4WUR A;  2UXD M;  3L26 A;  4FCT A;  4I4L A;  4R71 A;  4JI7 M;  1JR3 A;  2VII A;  1QAM A;  2EO2 A;  2BWE A;  3E21 A;  3KSX A;  3LVV A;  4B7H A;  3UGJ A;  4I81 A;  1IBK M;  4LF8 M;  4KHP M;  4DV2 M;  4IBE A;  3SYK A;  2XF3 A;  2KZS A;  3AOG A;  4UN2 B;  3U6Q A;  3W0F A;  2X8A A;  1YE9 A;  2DWN A;  1XNQ M;  1GJS A;  3NWL A;  3GQ4 A;  1NHW C;  3I4V A;  2KW0 A;  3FTF A;  3E4R A;  1C1K A;  1HR0 M;  4IBK A;  2XLJ A;  3AL0 C;  1TH2 A;  2LVA A;  2DAK A;  2DXI A;  1XMQ M;  1QAQ A;  1Z59 A;  2JZ1 A;  2QBY A;  1QDT A;  1WR1 B;  1IY1 A;  1IXS A;  3VKH A;  3K2L A;  1KSF X;  3SC3 A;  1EFU B;  3JAM S;  5DNY A;  2FS1 A;  2Z3X A;  1ZMW A;  1SXJ D;  5KQ8 A;  1L2C A;  2K9D A;  3L27 A;  3RGP A;  3T1H M;  2JUJ A;  2HKJ A;  1TDZ A;  4GEW A;  1A5T A;  3FUU A;  2RGH A;  1JQJ C;  5EXT A;  3B7Q A;  3TE6 A;  4ANR A;  4B7G A;  4JI2 M;  2JY6 B;  4K0K M;  1E9S A;  3DA1 A;  3UJN A;  4OX9 M;  1R2Y A;  2CFO A;  5KPZ A;  3NBI A;  1HNW M;  1T3T A;  2V1U A;  5FTK A;  2J5Y A;  5DYI A;  3SYL A;  5IWA M;  2UUB M;  2MGW A;  2L7I A;  2DWM A;  1XHB A;  5KO3 A;  4DUZ M;  2R4J A;  1R6B X;  2XSZ A;  4IBJ A;  2F5Q A;  3T1Y M;  1JB0 F;  4IBB A;  4Q7J A;  3U6L A;  4PT5 A;  5LMU M;  2FH0 A;  1GAB A;  2VF8 A;  1SXJ E;  4B3T M;  3QAU A;  3HU2 A;  3CGW A;  4M9X A;  1DGF A;  4JI6 M;  4LJ8 A;  5IZ7 D;  4GC5 A;  1VQ1 A;  2Z4R A;  2ZAO A;  2R62 A;  3HHY A;  1QVR A;  2C96 A;  4KO8 A;  1E94 E;  2FNA A;  3HU3 A;  4LCB A;  4LGM A;  2CEA A;  2XFT A;  2MH8 A;  2OQ4 A;  2DWL A;  3HJQ A;  2R46 A;  2WSC F;  3T38 A;  1IXR C;  1NO1 A;  2J7O A;  5ITX E;  2LVN C;  4LF7 M;  1WJ7 A;  3K9P A;  2WSE F;  8CAT A;  2WZJ A;  3U6E A;  3Q8X A;  2WSF F;  2ZM6 M;  3HHX A;  1HQC A;  3GPP A;  4LF4 M;  2X49 A;  3U5Z A;  3DOA A;  3FYD A;  3AOE C;  1VDL A;  4L8R C;  5EQT A;  1YSY A;  3GLF E;  3MK6 A;  1XXH E;  1GL7 A;  2VDB B;  2KRU A;  1AIP C;  2KXE A;  1Z6T A;  5EJC A;  1P3Q Q;  1IN4 A;  2L4F A;  3LCV B;  2DAM A;  2LVP C;  4LG2 A;  4PDG A;  5C1B A;  2K47 A;  1OKS A;  1XWI A;  2O01 F;  4DV6 M;  2F5P A;  5KPR A;  3U6S A;  2QZ4 A;  1F4I A;  3U6D A;  1G41 A;  3PNY A;  3U60 A;  2R0I A;  1DO2 A;  2RGO A;  3KW6 A;  4QOS A;  4PDI A;  3L28 A;  3R8F A;  1R4G A;  1QUS A;  3GLG A;  3WHL A;  4DV1 M;  2CV1 A;  1JR3 E;  1ZMU A;  3AV0 A;  3SHF A;  3D8B A;  1NY5 A;  3KOX E;  5ITX A;  4F1I A;  3FTE A;  3DZD A;  4R7G A;  5C18 A;  1ZQ9 A;  1RU3 A;  2H5X A;  3GLH B;  4NRV A;  4FD2 A;  3FTC A;  2C98 A;  3UK6 A;  3GO8 A;  4MGZ E;  2C9O A;  3FKE A;  3HJ8 A;  5ITT A;  1HNZ M;  5DFL A;  3C3E A;  4FW9 A;  2Y20 A;  2HL7 A;  2LNH C;  1SXJ B;  3SFZ A;  2XSZ D;  1Z5B A;  1UM8 A;  2MJ5 B;  2LH0 A;  4MM3 B;  1VEK A;  2QP9 X;  5EP2 A;  3KOZ E;  1D0M A;  3KOW E;  1WHC A;  3SAU A;  1Z5A A;  1V34 A;  5L8R F;  3J81 S;  1TR8 A;  2APL A;  1K3W A;  4AKH A;  2G5G X;  2BWB A;  2RRU A;  4Z8X A;  1Z5C A;  3W0L B;  5LMN M;  2DAI A;  3LMM A;  4RKU F;  3V76 A;  4JI0 M;  2Z4S A;  3ZCB B;  5FTM A;  3TQS A;  4L78 A;  3KS8 A;  4DR1 M;  3I51 A;  4JI5 M;  1NJG A;  2YNM D;  4L15 A;  3KXE C;  1HT1 E;  2V1C A;  1DGH B;  4NXN M;  4ITQ A;  1PJQ A;  3BOS A;  3K9O A;  2JY8 A;  4JI8 M;  4X64 M;  4OW0 A;  3RGS A;  4D80 A;  4AG5 A;  3D8L A;  3A46 A;  4BB9 A;  2ZAM A;  1X37 A;  2DI0 A;  2QPA A;  3VFD A;  2QCU A;  5FTL A;  4OVZ B;  1MX0 A;  2DAG A;  2L2D A;  2JY7 A;  1PJJ A;  3GLI E;  1VEJ A;  2J7N A;  1DGB A;  3IG8 A;  2D7H A;  1IBL M;  3GLF B;  2F5N A;  1XXH B;  1N36 M;  2CRU A;  4B3M M;  2KNV A;  2C99 A;  1NV8 A;  2GNO A;  2L09 A;  2KZU A;  3EIH A;  5EP4 A;  4IBF A;  2KA6 B;  4GHL A;  3U61 B;  3PFI A;  4YHH M;  1D0K A;  2I7N A;  4LJ5 A;  3HGI A;  1I94 M;  2HWJ A;  2JA2 A;  2HHH M;  3VLF B;  2M60 A;  2CV0 A;  2KRK A;  4M0W A;  4NL4 H;  2RKO A;  4JI4 M;  2F5S A;  1OIP A;  2XFS A;  2LVO C;  4QNM A;  4AKG A;  2LXE A;  2KEB A;  1T43 A;  4RF1 A;  1C7Y A;  2EJS A;  2EA0 A;  4LJ6 A;  4Z6Y A;  3W67 A;  2JP7 A;  3GPX A;  4M9Z A;  2ZBK B;  1W5T A;  3K1J A;  4NC6 A;  2AHM A;  2DKL A;  4QHS A;  3LW5 F;  2CP8 A;  4LRS A;  4HL4 A;  2XEP A;  1AUA A;  2ZAN A;  5FTN A;  3J80 S;  3ZQJ A;  5JI3 E;  3SAV A;  4B3S M;  3A45 A;  1QQW A;  3GLI A;  1MN3 A;  2LWX A;  3SAT A;  4P16 A;  1L2B A;  3MHV C;  1HJP A;  2QBY B;  5ITR A;  3GPY A;  3VKG A;  4LJ9 A;  2QSF X;  1NJF A;  3AFH A;  4Y28 F;  2R6F A;  2CUZ A;  1IXS B;  3OTO M;  1G4A E;  1YUB A;  4GC9 A;  4FWD A;  4R3D A;  2CWB A;  1G3I A;  1Q39 A;  1QUT A;  4AI6 A;  5DYG A;  2QNJ A;  4DR5 M;  3GRV A;  4QOZ C;  2K6B A;  4G4O A;  4FCV A;  5FLX S;  4DR2 M;  4JI1 M;  2DNA A;  1Q3B A;  2ERC A;  3VDU A;  1HQY E;  2DHY A;  2EKF A;  5ITY A;  3GLG E;  3MJ5 A;  4NOO B;  1R2Z A;  4MGH A;  4DBG B;  1IN6 A;  4LZJ A;  3HY5 A;  2VQE M;  1XC8 A;  2O5R A;  3K8Z A;  4IBC A;  2XH9 A;  2D7E A;  1JR3 D;  2XZF A;  2A5Y B;  1PJI A;  5A2Q S;  1QZE A;  4DV0 M;  3KDS E;  3LQR A;  3KP0 E;  4G4R A;  3FE3 A;  1IY2 A;  1E32 A;  3IG5 A;  4IJE A;  2MRO B;  1SG9 A;  2LTU A;  2YR0 A;  2HAK A;  2I7P A;  3DFZ A;  4GKJ M;  3C9P A;  3PNV A;  4WW0 A;  1KYI A;  4G6Z A;  5H37 D;  2DHR A;  4LY6 A;  5EXP A;  3T15 A;  4B3R M;  4GKK M;  2NQ8 C;  3B9P A;  1BVS A;  1OAI A;  4GIP A;  3J27 B;  1J09 A;  1J7K A;  3HJS A;  3GQ3 A;  1EIJ A;  2DAE A;  2VQF M;  2H1R A;  2R18 A;  4TUW A;  2DZO B;  1VDD A;  2GQF A;  1OAO C;  2L7H A;  5E6J A;  1GJT A;  5GKN A;  1NHG C;  2QQ8 A;  1PJT A;  2BJV A;  2LHC A;  2OOA A;  3Q8G A;  3THG A;  4NRW A;  3GRY A;  1UFZ A;  2DZL A;  1GKI A;  2EUC A;  2JXN A;  2Y0T A;  4IBG A;  2C5R A;  1KFV A;  1G8P A;  1MU5 A;  1V92 A;  3T6P A;  1PGY A;  1WGL A;  3AOE A;  2OO9 A;  1TDH A;  3H4M A;  3KSJ A;  3U6M A;  2X4A A;  5IT9 S;  1PM5 A;  3E9S A;  3PXG A;  1PRB A;  4AKI A;  2YQZ A;  3B74 A;  4GIT A;  4JN6 A;  4LF9 M;  3MMP A;  3LCU A;  1ZMV A;  1QDR A;  3SMP A;  3HU1 A;  5ITU A;  3U5Z B;  2FOI C;  1N75 A;  3J2P B;  3I04 M;  3KS4 A;  1L1T A;  2UXC M;  1GVN A;  4REZ A;  1NSF A;  4I5S A;  1IFY A;  3TL4 X;  2LBC A;  4RNA A;  2KDL A;  4DV7 M;  3IHP A;  1LTM A;  4CHT B;  1NY6 A;  2BNK A;  2C9C A;  3U60 B;  4DR4 M;  4DV4 M;  5IRE B;  3SAS A;  2UXB M;  4QNR A;  3GLG B;  1IN8 A;  5JI2 E;  2L6O A;  1N32 M;  4D81 A;  3B7Z A;  3H4J A;  3KP1 E;  3GP1 A;  4IBD A;  3C58 A;  4LFC M;  3RE8 A;  3FRI A;  4FWH A;  2CHQ A;  4MH0 E;  4LJ7 A;  3FUT A;  3LQQ A;  1NVM A;  4KOD A;  4EIW A;  1QYR A;  4LRT A;  1TH4 A;  2BJW A;  3VK8 A;  1E9R A;  2DWZ B;  4FVM A;  5EXS A;  2XGN A;  3VDP A;  2Z8Y M;  3C3D A;  4X66 M;  1ZV1 A;  4CJ6 A;  4G4Q A;  1PJS A;  1T6O A;  3CTW B;  3FRH A;  3L2A A;  1K3X A;  4LF6 M;  1D2N A;  2M5Z A;  2P5T A;  5KPT A;  3VK7 A;  4GH9 A;  1OFI A;  2OOB A;  3GPU A;  3E46 A;  2G3Q A;  3I4Y A;  5BPV A;  2CV2 A;  1OQY A;  1Y8G A;  4BBA A;  1W5S A;  4AZF A;  3M6A A;  2V6Z M;  4DR7 M;  1TF0 B;  5F3W A;  2F5O A;  3WHK A;  1EE8 A;  3ZH9 B;  3BBZ A;  1R7R A;  5EP1 A;  2MR9 A;  1FJG M;  2CHV A;  4MGI E;  2KNA A;  2Z7J A;  4KT0 F;  7CAT A;  4II7 A;  2L4E A;  2R65 A;  2B3T A;  4M9S A;  3AJI B;  5EP3 A;  4OU7 A;  3LVW A;  4LF5 M;  3M0E A;  4QHT A;  3UMM A;  2G8L A;  3NBX X;  1QZM A;  2Y21 A;  3TWK A;  2F4V M;  1FNN A;  4RF0 A;  4B08 A;  3UZU A;  5FTJ A;  5BR8 M;  3GQ5 A;  4DR3 M;  3ZC7 B;  3HHW A;  3GLH E;  3J7B A;  3AKZ A;  4DV5 M;  4X65 M;  3F92 A;  3GRR A;  4L4U A;  4XK8 F;  4LJ4 A;  1IN5 A;  2W82 A;  1IM2 A;  1NV9 A;  3PVS A;  2DZN B;  3SMS A;  4LZZ A;  1N34 M;  1L8Q A;  4CIZ A;  1TH3 A;  3JR4 A;  4A3V B;  4XBO A;  5EXX A;  3CF0 A;  4IBI A;  4GMQ A;  3RFW A;  1S3S A;  3TPZ A;  1L1Z A;  3J7A S;  1GLN A;  1WIV A;  4MGK E;  1VEG A;  2LHG A;  1SXJ C;  1K82 A;  4WP2 A;  3L29 A;  4GHA A;  3SHG B;  2KNZ A;  1D0L A;  4XGI A;  3BXW A;  3L25 A;  3HZJ A;  4AG6 A;  3U6C A;  2O25 A;  4CGY B;  2VF7 A;  4S12 A;  3TWL A;  1Q02 A;  2CE7 A;  3A42 A;  4LJA A;  5ITQ A;  1IY0 A;  4NSO B;  5FSW A;  4X62 M;  3GLI B;  2R4E A;  1TGU A;  2D7G A;  4LGY A;  3GRU A;  3FYC A;  3U6O A;  4AW4 A;  1MJG M;  1QAO A;  1WGN A;  3IEC A;  2ZTC A;  4G3O A;  1NNJ A;  2N35 A;  3B89 A;  3GLH A;  1J5E M;  4L6V 6;  2UU9 M;  4CIS A;  1IXZ A;  3HX3 A;  4YY3 M;  4G4N A;  1XMO M;  1OIZ A;  4LFA M;  3B7N A;  1DV0 A;  2CHG A;  1GO5 A;  4BLC A;  2ZTD A;  5KQD A;  4JV5 M;  3SBJ A;  2JWS A;  4KLN A;  3M7G A;  1SXJ A;  1L2D A;  1IQP A;  3JR5 A;  1H6U A;  3FD9 A;  3KOY E;  1G71 A;  3A98 B;  1I4W A;  2FFJ A;  3I01 M;  1N77 A;  1QAN A;  3U6P A;  5E26 A;  3EIE A;  1V33 A;  3FTD A;  4JI3 M;  4FWG A;  2UUC M;  4M0D A;  2R44 A;  3HHZ A;  3CF6 E;  2QEN A;  3QYE A;  1G59 A;  3W68 A;  4NSR A;  2FE8 A;  1R5L A;  2Y0Q A;  2JZ0 A;  3QWL A;  4L16 A;  4B7F A;  4JYA M;  3ILK A;  2Q2E B;  3R9X B;  1XNR M;  4DV3 M;  2YFQ A;  1HNX M;  3KFU G;  3HKP A;  1DGH A;  2XZU A;  3FUV A;  1DO0 A;  2KHH A; 
#chains in the Genus database with same CATH homology
 1YLA A;  1OTR A;  1MN3 A;  1HJP A;  2DEN A;  1ZV1 A;  2JNH A;  2LVQ D;  2QSF X;  1T6O A;  1VDL A;  4F2L A;  3FRH A;  3GLF E;  1XXH E;  2QHO B;  1G4A E;  1TTE A;  1AIP C;  2OOB A;  2CWB A;  1G3I A;  1VG5 A;  1P3Q Q;  2G3Q A;  2L4F A;  3E46 A;  2DAM A;  2JY5 A;  2LVP C;  3LCV B;  1CUK A;  1OQY A;  1XB2 B;  1Y8G A;  1OKS A;  2K0B X;  2QNJ A;  4HEO A;  1F4I A;  1G41 A;  2DNA A;  1HQY E;  2R0I A;  2DHY A;  1HT2 E;  2EKF A;  3GLG E;  1DO2 A;  4DBG B;  2EKK A;  3BBZ A;  1R4G A;  2MR9 A;  1JR3 E;  2KNA A;  1ZMU A;  4F1I A;  4R71 A;  2L4E A;  1QZE A;  2B3T A;  2BWE A;  3E21 A;  2H5X A;  3FE3 A;  2MRO B;  1SG9 A;  2LTU A;  2HAK A;  4UN2 B;  1KYI A;  5DFL A;  1BVS A;  1OAI A;  3GLH E;  2DAK A;  2LVA A;  3F92 A;  2JZ1 A;  2MJ5 B;  1IM2 A;  1NV9 A;  2DAE A;  1VEK A;  1WR1 B;  1IXS A;  1WHC A;  1EFU B;  1TR8 A;  1ZMW A;  2BWB A;  2OOA A;  2RRU A;  1UFZ A;  2DAI A;  2DZL A;  2K9D A;  2JUJ A;  1WIV A;  1V92 A;  1VEG A;  3T6P A;  1PGY A;  1WGL A;  4WP2 A;  2OO9 A;  1A5T A;  4GEW A;  2KNZ A;  1HT1 E;  2JY6 B;  2O25 A;  1Q02 A;  3K9O A;  2JY8 A;  3MMP A;  3LCU A;  1ZMV A;  1WGN A;  2MGW A;  2DI0 A;  2ZTC A;  3IEC A;  4G3O A;  3B89 A;  2DAG A;  2L2D A;  2JY7 A;  3GLI E;  1VEJ A;  1IFY A;  4Q7J A;  2LBC A;  1DV0 A;  1GO5 A;  2KNV A;  2ZTD A;  3IHP A;  1NV8 A;  1VQ1 A;  2HWJ A;  5JI2 E;  1E94 E;  3H4J A;  2LVO C;  1T43 A;  1C7Y A;  2EJS A;  3FRI A;  2JP7 A;  2JZ0 A;  2DKL A;  2LVN C;  1WJ7 A;  2CP8 A;  3K9P A;  2WZJ A;  1DO0 A;  2KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...