1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN HHR23A
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
3LCUA 2O25A 3FRIA 1HT1E 2EKKA 2JNHA 1IM2A 2DAMA 2QHOB 1DO0A 1HQYE 2KNZA 5JI2E 1EFUB 4Q7JA 2K9DA 2KHHA 4R71A 3FRHA 2DENA 2CWBA 3E46A 4GEWA 1F4IA 4G3OA 1VG5A 1TR8A 2DI0A 2LVQD 1VQ1A 3FE3A 2OOAA 1HJPA 2B3TA 2EKFA 3F92A 2R0IA 1G3IA 2QNJA 1VEKA 2DHYA 2WZJA 1AIPC 1YLAA 4UN2B 1WIVA 5DFLA 2KNAA 1XXHE 1A5TA 2LBCA 2JY8A 1ZV1A 3GLIE 2LVOC 1VDLA 3GLHE 1KYIA 1Q02A 2RRUA 4F1IA 3IHPA 1BVSA 2LVNC 2JY5A 2MR9A 1DV0A 2JZ1A 1Y8GA 1T6OA 4F2LA 1XB2B 2MJ5B 2ZTCA 2DZLA 1WHCA 2HWJA 1MN3A 3MMPA 2DAGA 2LVAA 4HEOA 1TTEA 3IECA 1ZMWA 1R4GA 1OAIA 2EJSA 4WP2A 1IFYA 1UFZA 2JY7A 1OKSA 2BWBA 2L2DA 2BWEA 1C7YA 1V92A 2HAKA 1WGNA 1WGLA 1VEGA 2MROB 2H5XA 2DAKA 1NV8A 2QSFX 1WJ7A 2JUJA 2OOBA 2L4EA 1DO2A 3T6PA 3GLFE 1OTRA 1WR1B 1OQYA 3E21A 3GLGE 1SG9A 3K9PA 2CP8A 2OO9A 1IXSA 1P3QQ 2DAIA 1CUKA 2JY6B 2LVPC 2K0BX 2ZTDA 2KNVA 2DAEA 2G3QA 3K9OA 1G4AE 1ZMVA 4DBGB 2JZ0A 2L4FA 1PGYA 1QZEA 1HT2E 1ZMUA 1E94E 1G41A 2LTUA 1T43A 3BBZA 3H4JA 1VEJA 1NV9A 2DKLA 3LCVB 1JR3E 1GO5A 2MGWA 2JP7A 3B89A 2DNAA
chains in the Genus database with same CATH superfamily
3AJIB 3TE6A 1NSFA 1HT1E 2EKKA 1NJGA 1DGHB 5IREB 3NBIA 2F5NA 4FCWA 2MH8A 1HQYE 2XFSA 2KNZA 4JXJA 2G8LA 1RU3A 4PT5A 1TF0B 4I81A 1IBLM 4S12A 4DV2M 2CEAA 3CGWA 2CWBA 3E46A 4FWHA 1N32M 3KOYE 1F4IA 3DOAA 3LMMA 1TR8A 1GABA 2DI0A 3HY5A 1IXRC 3GLIA 1IBKM 3M0EA 3SFZA 3CF2A 3W0FA 2H1RA 4B3TM 3C58A 3FE3A 3R8FA 3L26A 1IY2A 1HJPA 1N36M 4QHTA 4LF7M 4MB7A 4M9ZA 4ANRA 4IBGA 1V34A 2R0IA 3KOXE 3SMPA 2EUCA 4MM3B 1G3IA 4AG6A 4KHPM 3U6CA 1L1ZA 1LTMA 4JI4M 2C99A 2J7NA 3HJSA 4B3MM 2KW0A 3HX3A 3SAVA 3T15A 4LZZA 2M5ZA 4L4UA 1IBMM 2LBCA 3GRVA 2KZSA 2VIIA 3KP1E 1J7KA 1VDLA 3FTFA 1GJTA 5FTNA 3IHPA 2Q2EB 2O01F 3DA1A 4MGHA 1E9RA 2CHGA 2JY5A 2LVNC 5C18A 2BNKA 3L29A 2DWLA 1R2ZA 1T6OA 2Y20A 5E6JA 3V76A 1YUBA 4RF1A 2XF3A 2DWNA 2KDLA 4L8RC 2HKJA 1IN6A 4AZFA 2ZTCA 3FYCA 3SHGB 3U61B 2DZLA 3CTWB 2CHVA 4GITA 2HWJA 1X37A 4KLNA 2CV1A 1IQPA 4IBIA 1FJGM 4B7GA 2FNAA 3HHXA 1TTEA 1IN8A 1ZMWA 2EJSA 3KW6A 2Z3XA 3PFIA 4DR3M 3GLHA 2YNMD 4WURA 4B7HA 5KPRA 4I8OA 3BOSA 3UK6A 4IIWA 1V33A 1WGNA 3UMMA 4B3RM 1LV7A 1G59A 1VEGA 3J2PB 2FFJA 1N34M 1OJLA 2EA0A 4GH9A 4GMQA 5ITUA 1QAQA 2L4EA 2ZBKB 2CV0A 5EXPA 1OTRA 2RGHA 3K8ZA 4B3SM 3RE8A 1EIJA 4P17A 3THGA 1G71A 1J09A 4FCTA 4QHSA 4DV7M 4G4OA 3QYBA 3TWLA 2FH0A 3GLGB 1QVRA 1Q3CA 4LF4M 3W68A 2DAIA 3FUUA 2ZTDA 2UXDM 2X8AA 2G3QA 4CISA 2ZM6M 3U6SA 4LFCM 1QZMA 1PJIA 1TH2A 1L2BA 4GIPA 3FUWA 1QZEA 3T1HM 5IWAM 1SXJE 1G41A 3BBZA 5EXXA 4JI3M 5BPVA 4D81A 2C5RA 1GO5A 4L16A 3B7QA 1UM8A 2R62A 3HU3A 2JP7A 3FTEA 2UUCM 2DNAA 1IN4A 2VDBB 4AG5A 2O25A 3D8LA 2LWXA 3M6AA 1OIZA 3DFZA 4QOSA 2JA2A 5EP1A 2CE7A 2JWSA 1IM2A 1XXHB 2DAMA 1QAMA 4DR4M 5JI2E 4OW0A 4JI5M 1NHGC 3U60B 2J5YA 3GO8A 3AV0A 1TH4A 2QCUA 3FRHA 3MK6A 4FWGA 3ZH9B 4TUWA 4LGMA 5FTMA 3UZUA 2QBYB 4K0KM 5ITRA 3HJ8A 1L2DA 1R2YA 1MJGM 2DVWB 4LFAM 3T1YM 4Z6YA 4LF6M 3A45A 4RF0A 1TDZA 2XSZA 1R7RA 3GRYA 4QNMA 4DV4M 2B3TA 3J81S 1JR3A 2I7PA 1N33M 1OIPA 3F92A 3SBJA 2WSCF 4Z8XA 2KRKA 4LJ9A 2Y0QA 4ZPXA 3AOGA 3TL4X 2XGNA 4G4NA 3U6EA 1MU5A 3SAUA 1VEKA 4JN6A 4CIZA 2WZJA 5C1BA 2QP9X 4DV3M 3U6MA 4NXMM 3LQQA 1NO1A 2D7GA 5DFLA 1WIVA 4DR2M 1AUAA 1XXHE 1A5TA 1Z5CA 3KDSE 2WSEF 1NY5A 4XBOA 2LVOC 3VLFB 3GLHE 2UUBM 2V1UA 2RRUA 1PJTA 4LJ4A 3HHZA 2RKOA 3I04M 5EQTA 1QQWA 1SXJB 4BLCA 3GLFA 1Y8GA 4LJAA 2L09A 7CATA 1IN7A 3AFHA 3E4RA 2YFQA 3KFUG 3JR4A 2RGOA 4M9SA 2R4EA 3QAUA 1MN3A 1Z5BA 5IT9S 2DAGA 2KEBA 2C9CA 1R4GA 2XZFA 1PM5A 3I51A 4L6V6 3U5ZA 2KXEA 4M9XA 4JI6M 2UXCM 4MGIE 4AI6A 3GQ5A 3GLIB 2JY7A 2R44A 3B7NA 3U6DA 3UGJA 3A46A 1ZAEA 2BWBA 3I01M 5ITXA 4FVMA 5E26A 5LMUM 3AOEA 1HNZM 5EP3A 2DXIA 1JQJC 2H5XA 3C9PA 1NV8A 2QSFX 1WJ7A 4IBCA 5FTJA 5H37D 3FTDA 3IG8A 2OOBA 5FLXS 2P5TA 1DO2A 2F5PA 1OFIA 2L7IA 3L28A 2DZOB 4JYAM 1IY0A 2ZANA 3MJ5A 2D7HA 4XK8F 3D8BA 4JI2M 1D2NA 1NNJA 3B74A 3E9SA 3GPXA 3GQ3A 4FWDA 1FNNA 2R46A 1SXJD 3HHWA 4OVZB 2CP8A 3VFDA 3GLGE 4GHAA 4GRIA 1IXSA 1P3QQ 3GQ4A 4QNRA 2C98A 4AQYM 4YY3M 2KNVA 1NHWC 2DAEA 4NOOB 4DUYM 3M7GA 3VK8A 4GHLA 2LXEA 3FUXA 4REZA 3OTOM 2G5GX 4BBAA 1ZMVA 2NQ8C 2XH9A 3SMSA 4DBGB 2JZ0A 1PJJA 2XSZD 1HT2E 1TH3A 1ZMUA 3TWKA 1XMQM 2LTUA 3H4JA 1VEJA 2UU9M 2MGWA 1K82A 1HR0M 3WHLA 2ZAMA 2CFOA 1MX0A 3K9OA 4HLQA 5KQDA 4LJ7A 5BR8M 3LCUA 1OAOC 1K3WA 4CHTB 2UUAM 4NXNM 2HHHM 4WW0A 1GL7A 1QUTA 3SYKA 4CJ6A 1JB0F 1QANA 2JNHA 5FTLA 2QHOB 1DO0A 2LH0A 3L27A 4NSOB 1EFUB 4JI7M 1PJSA 4Q7JA 2KHHA 4X65M 3K2LA 4R71A 1GKIA 2LNHC 2KZUA 4GEWA 4G3OA 4LJ8A 4W5WA 2EO2A 1QYRA 5DNYA 1VG5A 4AW4A 3PNVA 4X66M 5KQ8A 4ITQA 4G6ZA 1Z5AA 2QBYA 4LJ5A 2VQEM 2F5QA 2OQ4A 2QPAA 1E32A 2OOAA 3U5ZB 3SYLA 3AKZA 2EKFA 3TPZA 2FE8A 4LGYA 4DR1M 3AL0C 3EIHA 1NY6A 4FW9A 3FUTA 4DUZM 1XNQM 3GRRA 2UXBM 3U6PA 2DHYA 1AIPC 1QDTA 1YLAA 2BJVA 4UN2B 2DHRA 1G8PA 5EP2A 3W0LB 4B08A 4LF5M 4LF9M 1QUSA 3FTCA 1ZQ9A 4X62M 3KS8A 2I7NA 2CV2A 4IBKA 4F1IA 1BVSA 1R6BX 2MR9A 2CRUA 4GC9A 2JZ1A 4D80A 1J5EM 1Z6TA 1KFVA 3Q8XA 5DYGA 4I4LA 1VDDA 5EXSA 2MJ5B 3GPPA 3FKEA 4GKJM 4IBFA 1YSYA 3U60A 1XMOM 3MMPA 4AKHA 2LVAA 3NBXX 3KOWE 4IBBA 2LHCA 3KOZE 1OAIA 3SC3A 1C1KA 2CUZA 3HGIA 3R9XB 2A5YB 3Q8GA 4LY6A 3ZCBB 3GLGA 3QYEA 1GVNA 4HL4A 4I5SA 1TGUA 1OKSA 4JV5M 2V1CA 4M0DA 4CGYB 1V92A 2HAKA 1DGHA 2M60A 3AOEC 1KSFX 4PDIA 4DR7M 1W5TA 3LW5F 2MROB 2Z7JA 2AHMA 3LVVA 1OFHA 3ILKA 2HL7A 2BJWA 2DAKA 4LJ6A 4NC6A 2JUJA 1EE8A 3CF0A 3PVSA 4LZJA 4GC5A 3KXEC 5KPZA 4LRSA 4DR5M 4M0WA 4DV0M 4MH0E 2R6FA 1WR1B 1NJFA 2R45A 2WSFF 4KODA 3VDPA 3ZC7B 1OQYA 1PRBA 2J7OA 2DWZB 4D82A 4B7FA 3U6QA 4NRWA 2DWMA 1K3XA 1D0LA 3FD9A 2LVPC 2K0BX 3TWMA 4JI1M 1HNWM 1IXSB 2V6ZM 4BB9A 4X64M 1R5LA 2CHQA 2L7HA 2Y21A 2XZUA 2F5OA 1IY1A 3HJQA 1E94E 1Z59A 2XLJA 4PD2A 1E9SA 1JR3E 1L2CA 5KO3A 4FD2A 3LVWA 3CF6E 2QZ4A 3NWLA 3J27B 3B89A 1DGFA 4KT0F 1DGGA 3HZJA 5ITTA 1QAOA 2L6OA 3FRIA 2FS1A 3B7ZA 3HWSA 5ITYA 3SAWA 4IBDA 3VKGA 4L78A 3WHKA 1Q39A 2Z8YM 3EIEA 3A42A 3U61A 4NRVA 1XHBA 2N35A 1ORYB 2K9DA 4NSRA 4PCZA 4LF8M 4AKIA 4QOZC 1WXQA 1XNRM 4YHHM 2DENA 1PJQA 5DYIA 3FUVA 2QENA 3GPYA 2R4JA 4XGIA 3W67A 2KRUA 2LVQD 3GLHB 5LMNM 1GLNA 4DV6M 3L25A 1VQ1A 2D7EA 3RGSA 1SXJA 5F3WA 3RGPA 3C3EA 4DV1M 3GLFB 3SATA 3C3DA 4LG2A 1N78A 4DR6M 3H4MA 3TQSA 3HHYA 1XC8A 2ZAOA 2X4AA 3T38A 2C96A 2QNJA 2JXNA 4A3VB 2DZNB 4OU7A 4LCBA 4II7A 5ITXE 2KNAA 3KSJA 2JY8A 1ZV1A 3FYDA 3GLIE 4P16A 5EXTA 4PDGA 2XEPA 1KYIA 1I4WA 3J80S 1Q02A 2YR0A 1HNXM 3K92A 1NNUC 2Z4SA 3IG5A 1SXJC 2E5LM 4NL4H 3BXWA 3SASA 3KS4A 1DV0A 1GJSA 2GQFA 2VF8A 3A98B 2APLA 2O5RA 3HU2A 3I4YA 3GPUA 4F2LA 4LFBM 1D0KA 3VKHA 5IZ7D 2R65A 1N77A 1XB2B 3U6OA 5JI3E 2Z4RA 1HQCA 5KPTA 3JR5A 1WHCA 2XFTA 3GP1A 2QQ8A 3KVWA 4EIWA 3UJNA 4HEOA 2VQFM 4DV5M 4IJEA 3IECA 4WP2A 1IFYA 3GRUA 5EJCA 4G4QA 1UFZA 2K47A 4MGZE 4OVZA 3J7AS 4L15A 3MHVC 2KA6B 5L8RF 2C9OA 3VK7A 4IBEA 2VF7A 3VDUA 3B9PA 2L2DA 2BWEA 1C7YA 3DZDA 3SHFA 1XXHA 3ZQJA 3J7BA 1WGLA 4OX9M 4Y28F 1Q3BA 1YE9A 3LQRA 3PXGA 5ITQA 3HKPA 3RFWA 2ERCA 2Y0TA 4FCVA 1XWIA 1QDRA 3JAMS 4MGYE 1NVMA 2FOIC 1GL6A 3T6PA 3GLFE 4IJFA 4IBJA 1L1TA 4GKKM 2F5SA 3QWLA 4KO8A 3PNYA 4R7GA 3E21A 1SG9A 3K9PA 4LRTA 4RKUF 1W5SA 2OO9A 1TDHA 2K6BA 2F4VM 3I4VA 1CUKA 2JY6B 1N75A 4MGKE 2OPFA 4R3DA 3U6LA 2R18A 1IN5A 1IXZA 1G4AE 3K1JA 3SARA 4RNAA 1L8QA 5A2QS 2X49A 3L2AA 3KSXA 1I94M 2L4FA 1PGYA 2HCBA 2GNOA 2LHGA 1DGBA 5GKNA 4G4RA 5EP4A 1T43A 1S3SA 1NV9A 2DKLA 3LCVB 1D0MA 4JI8M 3KP0E 3HU1A 4AKGA 8CATA 1T3TA 5FSWA 1H6UA 2YQZA 4JI0M 2W82A 5FTKA 1JR3D
chains in the Genus database with same CATH topology
3LCUA 2O25A 3FRIA 1HT1E 2EKKA 2JNHA 1IM2A 2DAMA 2QHOB 1DO0A 1HQYE 2KNZA 5JI2E 1EFUB 4Q7JA 2K9DA 2KHHA 4R71A 3FRHA 2DENA 2CWBA 3E46A 4GEWA 1F4IA 4G3OA 1VG5A 1TR8A 2DI0A 2LVQD 1VQ1A 3FE3A 2OOAA 1HJPA 2B3TA 2EKFA 3F92A 2R0IA 1G3IA 2QNJA 1VEKA 2DHYA 2WZJA 1AIPC 1YLAA 4UN2B 1WIVA 5DFLA 2KNAA 1XXHE 1A5TA 2LBCA 2JY8A 1ZV1A 3GLIE 2LVOC 1VDLA 3GLHE 1KYIA 1Q02A 2RRUA 4F1IA 3IHPA 1BVSA 2LVNC 2JY5A 2MR9A 1DV0A 2JZ1A 1Y8GA 1T6OA 4F2LA 1XB2B 2MJ5B 2ZTCA 2DZLA 1WHCA 2HWJA 1MN3A 3MMPA 2DAGA 2LVAA 4HEOA 1TTEA 3IECA 1ZMWA 1R4GA 1OAIA 2EJSA 4WP2A 1IFYA 1UFZA 2JY7A 1OKSA 2BWBA 2L2DA 2BWEA 1C7YA 1V92A 2HAKA 1WGNA 1WGLA 1VEGA 2MROB 2H5XA 2DAKA 1NV8A 2QSFX 1WJ7A 2JUJA 2OOBA 2L4EA 1DO2A 3T6PA 3GLFE 1OTRA 1WR1B 1OQYA 3E21A 3GLGE 1SG9A 3K9PA 2CP8A 2OO9A 1IXSA 1P3QQ 2DAIA 1CUKA 2JY6B 2LVPC 2K0BX 2ZTDA 2KNVA 2DAEA 2G3QA 3K9OA 1G4AE 1ZMVA 4DBGB 2JZ0A 2L4FA 1PGYA 1QZEA 1HT2E 1ZMUA 1E94E 1G41A 2LTUA 1T43A 3BBZA 3H4JA 1VEJA 1NV9A 2DKLA 3LCVB 1JR3E 1GO5A 2MGWA 2JP7A 3B89A 2DNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCU A;  2O25 A;  3FRI A;  1HT1 E;  2EKK A;  2JNH A;  1IM2 A;  2DAM A;  2QHO B;  1DO0 A;  1HQY E;  2KNZ A;  5JI2 E;  1EFU B;  4Q7J A;  2K9D A;  2KHH A;  4R71 A;  3FRH A;  2DEN A;  2CWB A;  3E46 A;  4GEW A;  1F4I A;  4G3O A;  1VG5 A;  1TR8 A;  2DI0 A;  2LVQ D;  1VQ1 A;  3FE3 A;  2OOA A;  1HJP A;  2B3T A;  2EKF A;  3F92 A;  2R0I A;  1G3I A;  2QNJ A;  1VEK A;  2DHY A;  2WZJ A;  1AIP C;  1YLA A;  4UN2 B;  1WIV A;  5DFL A;  2KNA A;  1XXH E;  1A5T A;  2LBC A;  2JY8 A;  1ZV1 A;  3GLI E;  2LVO C;  1VDL A;  3GLH E;  1KYI A;  1Q02 A;  2RRU A;  4F1I A;  3IHP A;  1BVS A;  2LVN C;  2JY5 A;  2MR9 A;  1DV0 A;  2JZ1 A;  1Y8G A;  1T6O A;  4F2L A;  1XB2 B;  2MJ5 B;  2ZTC A;  2DZL A;  1WHC A;  2HWJ A;  1MN3 A;  3MMP A;  2DAG A;  2LVA A;  4HEO A;  1TTE A;  3IEC A;  1ZMW A;  1R4G A;  1OAI A;  2EJS A;  4WP2 A;  1IFY A;  1UFZ A;  2JY7 A;  1OKS A;  2BWB A;  2L2D A;  2BWE A;  1C7Y A;  1V92 A;  2HAK A;  1WGN A;  1WGL A;  1VEG A;  2MRO B;  2H5X A;  2DAK A;  1NV8 A;  2QSF X;  1WJ7 A;  2JUJ A;  2OOB A;  2L4E A;  1DO2 A;  3T6P A;  3GLF E;  1OTR A;  1WR1 B;  1OQY A;  3E21 A;  3GLG E;  1SG9 A;  3K9P A;  2CP8 A;  2OO9 A;  1IXS A;  1P3Q Q;  2DAI A;  1CUK A;  2JY6 B;  2LVP C;  2K0B X;  2ZTD A;  2KNV A;  2DAE A;  2G3Q A;  3K9O A;  1G4A E;  1ZMV A;  4DBG B;  2JZ0 A;  2L4F A;  1PGY A;  1QZE A;  1HT2 E;  1ZMU A;  1E94 E;  1G41 A;  2LTU A;  1T43 A;  3BBZ A;  3H4J A;  1VEJ A;  1NV9 A;  2DKL A;  3LCV B;  1JR3 E;  1GO5 A;  2MGW A;  2JP7 A;  3B89 A;  2DNA A; 
#chains in the Genus database with same CATH topology
 3AJI B;  3TE6 A;  1NSF A;  1HT1 E;  2EKK A;  1NJG A;  1DGH B;  5IRE B;  3NBI A;  2F5N A;  4FCW A;  2MH8 A;  1HQY E;  2XFS A;  2KNZ A;  4JXJ A;  2G8L A;  1RU3 A;  4PT5 A;  1TF0 B;  4I81 A;  1IBL M;  4S12 A;  4DV2 M;  2CEA A;  3CGW A;  2CWB A;  3E46 A;  4FWH A;  1N32 M;  3KOY E;  1F4I A;  3DOA A;  3LMM A;  1TR8 A;  1GAB A;  2DI0 A;  3HY5 A;  1IXR C;  3GLI A;  1IBK M;  3M0E A;  3SFZ A;  3CF2 A;  3W0F A;  2H1R A;  4B3T M;  3C58 A;  3FE3 A;  3R8F A;  3L26 A;  1IY2 A;  1HJP A;  1N36 M;  4QHT A;  4LF7 M;  4MB7 A;  4M9Z A;  4ANR A;  4IBG A;  1V34 A;  2R0I A;  3KOX E;  3SMP A;  2EUC A;  4MM3 B;  1G3I A;  4AG6 A;  4KHP M;  3U6C A;  1L1Z A;  1LTM A;  4JI4 M;  2C99 A;  2J7N A;  3HJS A;  4B3M M;  2KW0 A;  3HX3 A;  3SAV A;  3T15 A;  4LZZ A;  2M5Z A;  4L4U A;  1IBM M;  2LBC A;  3GRV A;  2KZS A;  2VII A;  3KP1 E;  1J7K A;  1VDL A;  3FTF A;  1GJT A;  5FTN A;  3IHP A;  2Q2E B;  2O01 F;  3DA1 A;  4MGH A;  1E9R A;  2CHG A;  2JY5 A;  2LVN C;  5C18 A;  2BNK A;  3L29 A;  2DWL A;  1R2Z A;  1T6O A;  2Y20 A;  5E6J A;  3V76 A;  1YUB A;  4RF1 A;  2XF3 A;  2DWN A;  2KDL A;  4L8R C;  2HKJ A;  1IN6 A;  4AZF A;  2ZTC A;  3FYC A;  3SHG B;  3U61 B;  2DZL A;  3CTW B;  2CHV A;  4GIT A;  2HWJ A;  1X37 A;  4KLN A;  2CV1 A;  1IQP A;  4IBI A;  1FJG M;  4B7G A;  2FNA A;  3HHX A;  1TTE A;  1IN8 A;  1ZMW A;  2EJS A;  3KW6 A;  2Z3X A;  3PFI A;  4DR3 M;  3GLH A;  2YNM D;  4WUR A;  4B7H A;  5KPR A;  4I8O A;  3BOS A;  3UK6 A;  4IIW A;  1V33 A;  1WGN A;  3UMM A;  4B3R M;  1LV7 A;  1G59 A;  1VEG A;  3J2P B;  2FFJ A;  1N34 M;  1OJL A;  2EA0 A;  4GH9 A;  4GMQ A;  5ITU A;  1QAQ A;  2L4E A;  2ZBK B;  2CV0 A;  5EXP A;  1OTR A;  2RGH A;  3K8Z A;  4B3S M;  3RE8 A;  1EIJ A;  4P17 A;  3THG A;  1G71 A;  1J09 A;  4FCT A;  4QHS A;  4DV7 M;  4G4O A;  3QYB A;  3TWL A;  2FH0 A;  3GLG B;  1QVR A;  1Q3C A;  4LF4 M;  3W68 A;  2DAI A;  3FUU A;  2ZTD A;  2UXD M;  2X8A A;  2G3Q A;  4CIS A;  2ZM6 M;  3U6S A;  4LFC M;  1QZM A;  1PJI A;  1TH2 A;  1L2B A;  4GIP A;  3FUW A;  1QZE A;  3T1H M;  5IWA M;  1SXJ E;  1G41 A;  3BBZ A;  5EXX A;  4JI3 M;  5BPV A;  4D81 A;  2C5R A;  1GO5 A;  4L16 A;  3B7Q A;  1UM8 A;  2R62 A;  3HU3 A;  2JP7 A;  3FTE A;  2UUC M;  2DNA A;  1IN4 A;  2VDB B;  4AG5 A;  2O25 A;  3D8L A;  2LWX A;  3M6A A;  1OIZ A;  3DFZ A;  4QOS A;  2JA2 A;  5EP1 A;  2CE7 A;  2JWS A;  1IM2 A;  1XXH B;  2DAM A;  1QAM A;  4DR4 M;  5JI2 E;  4OW0 A;  4JI5 M;  1NHG C;  3U60 B;  2J5Y A;  3GO8 A;  3AV0 A;  1TH4 A;  2QCU A;  3FRH A;  3MK6 A;  4FWG A;  3ZH9 B;  4TUW A;  4LGM A;  5FTM A;  3UZU A;  2QBY B;  4K0K M;  5ITR A;  3HJ8 A;  1L2D A;  1R2Y A;  1MJG M;  2DVW B;  4LFA M;  3T1Y M;  4Z6Y A;  4LF6 M;  3A45 A;  4RF0 A;  1TDZ A;  2XSZ A;  1R7R A;  3GRY A;  4QNM A;  4DV4 M;  2B3T A;  3J81 S;  1JR3 A;  2I7P A;  1N33 M;  1OIP A;  3F92 A;  3SBJ A;  2WSC F;  4Z8X A;  2KRK A;  4LJ9 A;  2Y0Q A;  4ZPX A;  3AOG A;  3TL4 X;  2XGN A;  4G4N A;  3U6E A;  1MU5 A;  3SAU A;  1VEK A;  4JN6 A;  4CIZ A;  2WZJ A;  5C1B A;  2QP9 X;  4DV3 M;  3U6M A;  4NXM M;  3LQQ A;  1NO1 A;  2D7G A;  5DFL A;  1WIV A;  4DR2 M;  1AUA A;  1XXH E;  1A5T A;  1Z5C A;  3KDS E;  2WSE F;  1NY5 A;  4XBO A;  2LVO C;  3VLF B;  3GLH E;  2UUB M;  2V1U A;  2RRU A;  1PJT A;  4LJ4 A;  3HHZ A;  2RKO A;  3I04 M;  5EQT A;  1QQW A;  1SXJ B;  4BLC A;  3GLF A;  1Y8G A;  4LJA A;  2L09 A;  7CAT A;  1IN7 A;  3AFH A;  3E4R A;  2YFQ A;  3KFU G;  3JR4 A;  2RGO A;  4M9S A;  2R4E A;  3QAU A;  1MN3 A;  1Z5B A;  5IT9 S;  2DAG A;  2KEB A;  2C9C A;  1R4G A;  2XZF A;  1PM5 A;  3I51 A;  4L6V 6;  3U5Z A;  2KXE A;  4M9X A;  4JI6 M;  2UXC M;  4MGI E;  4AI6 A;  3GQ5 A;  3GLI B;  2JY7 A;  2R44 A;  3B7N A;  3U6D A;  3UGJ A;  3A46 A;  1ZAE A;  2BWB A;  3I01 M;  5ITX A;  4FVM A;  5E26 A;  5LMU M;  3AOE A;  1HNZ M;  5EP3 A;  2DXI A;  1JQJ C;  2H5X A;  3C9P A;  1NV8 A;  2QSF X;  1WJ7 A;  4IBC A;  5FTJ A;  5H37 D;  3FTD A;  3IG8 A;  2OOB A;  5FLX S;  2P5T A;  1DO2 A;  2F5P A;  1OFI A;  2L7I A;  3L28 A;  2DZO B;  4JYA M;  1IY0 A;  2ZAN A;  3MJ5 A;  2D7H A;  4XK8 F;  3D8B A;  4JI2 M;  1D2N A;  1NNJ A;  3B74 A;  3E9S A;  3GPX A;  3GQ3 A;  4FWD A;  1FNN A;  2R46 A;  1SXJ D;  3HHW A;  4OVZ B;  2CP8 A;  3VFD A;  3GLG E;  4GHA A;  4GRI A;  1IXS A;  1P3Q Q;  3GQ4 A;  4QNR A;  2C98 A;  4AQY M;  4YY3 M;  2KNV A;  1NHW C;  2DAE A;  4NOO B;  4DUY M;  3M7G A;  3VK8 A;  4GHL A;  2LXE A;  3FUX A;  4REZ A;  3OTO M;  2G5G X;  4BBA A;  1ZMV A;  2NQ8 C;  2XH9 A;  3SMS A;  4DBG B;  2JZ0 A;  1PJJ A;  2XSZ D;  1HT2 E;  1TH3 A;  1ZMU A;  3TWK A;  1XMQ M;  2LTU A;  3H4J A;  1VEJ A;  2UU9 M;  2MGW A;  1K82 A;  1HR0 M;  3WHL A;  2ZAM A;  2CFO A;  1MX0 A;  3K9O A;  4HLQ A;  5KQD A;  4LJ7 A;  5BR8 M;  3LCU A;  1OAO C;  1K3W A;  4CHT B;  2UUA M;  4NXN M;  2HHH M;  4WW0 A;  1GL7 A;  1QUT A;  3SYK A;  4CJ6 A;  1JB0 F;  1QAN A;  2JNH A;  5FTL A;  2QHO B;  1DO0 A;  2LH0 A;  3L27 A;  4NSO B;  1EFU B;  4JI7 M;  1PJS A;  4Q7J A;  2KHH A;  4X65 M;  3K2L A;  4R71 A;  1GKI A;  2LNH C;  2KZU A;  4GEW A;  4G3O A;  4LJ8 A;  4W5W A;  2EO2 A;  1QYR A;  5DNY A;  1VG5 A;  4AW4 A;  3PNV A;  4X66 M;  5KQ8 A;  4ITQ A;  4G6Z A;  1Z5A A;  2QBY A;  4LJ5 A;  2VQE M;  2F5Q A;  2OQ4 A;  2QPA A;  1E32 A;  2OOA A;  3U5Z B;  3SYL A;  3AKZ A;  2EKF A;  3TPZ A;  2FE8 A;  4LGY A;  4DR1 M;  3AL0 C;  3EIH A;  1NY6 A;  4FW9 A;  3FUT A;  4DUZ M;  1XNQ M;  3GRR A;  2UXB M;  3U6P A;  2DHY A;  1AIP C;  1QDT A;  1YLA A;  2BJV A;  4UN2 B;  2DHR A;  1G8P A;  5EP2 A;  3W0L B;  4B08 A;  4LF5 M;  4LF9 M;  1QUS A;  3FTC A;  1ZQ9 A;  4X62 M;  3KS8 A;  2I7N A;  2CV2 A;  4IBK A;  4F1I A;  1BVS A;  1R6B X;  2MR9 A;  2CRU A;  4GC9 A;  2JZ1 A;  4D80 A;  1J5E M;  1Z6T A;  1KFV A;  3Q8X A;  5DYG A;  4I4L A;  1VDD A;  5EXS A;  2MJ5 B;  3GPP A;  3FKE A;  4GKJ M;  4IBF A;  1YSY A;  3U60 A;  1XMO M;  3MMP A;  4AKH A;  2LVA A;  3NBX X;  3KOW E;  4IBB A;  2LHC A;  3KOZ E;  1OAI A;  3SC3 A;  1C1K A;  2CUZ A;  3HGI A;  3R9X B;  2A5Y B;  3Q8G A;  4LY6 A;  3ZCB B;  3GLG A;  3QYE A;  1GVN A;  4HL4 A;  4I5S A;  1TGU A;  1OKS A;  4JV5 M;  2V1C A;  4M0D A;  4CGY B;  1V92 A;  2HAK A;  1DGH A;  2M60 A;  3AOE C;  1KSF X;  4PDI A;  4DR7 M;  1W5T A;  3LW5 F;  2MRO B;  2Z7J A;  2AHM A;  3LVV A;  1OFH A;  3ILK A;  2HL7 A;  2BJW A;  2DAK A;  4LJ6 A;  4NC6 A;  2JUJ A;  1EE8 A;  3CF0 A;  3PVS A;  4LZJ A;  4GC5 A;  3KXE C;  5KPZ A;  4LRS A;  4DR5 M;  4M0W A;  4DV0 M;  4MH0 E;  2R6F A;  1WR1 B;  1NJF A;  2R45 A;  2WSF F;  4KOD A;  3VDP A;  3ZC7 B;  1OQY A;  1PRB A;  2J7O A;  2DWZ B;  4D82 A;  4B7F A;  3U6Q A;  4NRW A;  2DWM A;  1K3X A;  1D0L A;  3FD9 A;  2LVP C;  2K0B X;  3TWM A;  4JI1 M;  1HNW M;  1IXS B;  2V6Z M;  4BB9 A;  4X64 M;  1R5L A;  2CHQ A;  2L7H A;  2Y21 A;  2XZU A;  2F5O A;  1IY1 A;  3HJQ A;  1E94 E;  1Z59 A;  2XLJ A;  4PD2 A;  1E9S A;  1JR3 E;  1L2C A;  5KO3 A;  4FD2 A;  3LVW A;  3CF6 E;  2QZ4 A;  3NWL A;  3J27 B;  3B89 A;  1DGF A;  4KT0 F;  1DGG A;  3HZJ A;  5ITT A;  1QAO A;  2L6O A;  3FRI A;  2FS1 A;  3B7Z A;  3HWS A;  5ITY A;  3SAW A;  4IBD A;  3VKG A;  4L78 A;  3WHK A;  1Q39 A;  2Z8Y M;  3EIE A;  3A42 A;  3U61 A;  4NRV A;  1XHB A;  2N35 A;  1ORY B;  2K9D A;  4NSR A;  4PCZ A;  4LF8 M;  4AKI A;  4QOZ C;  1WXQ A;  1XNR M;  4YHH M;  2DEN A;  1PJQ A;  5DYI A;  3FUV A;  2QEN A;  3GPY A;  2R4J A;  4XGI A;  3W67 A;  2KRU A;  2LVQ D;  3GLH B;  5LMN M;  1GLN A;  4DV6 M;  3L25 A;  1VQ1 A;  2D7E A;  3RGS A;  1SXJ A;  5F3W A;  3RGP A;  3C3E A;  4DV1 M;  3GLF B;  3SAT A;  3C3D A;  4LG2 A;  1N78 A;  4DR6 M;  3H4M A;  3TQS A;  3HHY A;  1XC8 A;  2ZAO A;  2X4A A;  3T38 A;  2C96 A;  2QNJ A;  2JXN A;  4A3V B;  2DZN B;  4OU7 A;  4LCB A;  4II7 A;  5ITX E;  2KNA A;  3KSJ A;  2JY8 A;  1ZV1 A;  3FYD A;  3GLI E;  4P16 A;  5EXT A;  4PDG A;  2XEP A;  1KYI A;  1I4W A;  3J80 S;  1Q02 A;  2YR0 A;  1HNX M;  3K92 A;  1NNU C;  2Z4S A;  3IG5 A;  1SXJ C;  2E5L M;  4NL4 H;  3BXW A;  3SAS A;  3KS4 A;  1DV0 A;  1GJS A;  2GQF A;  2VF8 A;  3A98 B;  2APL A;  2O5R A;  3HU2 A;  3I4Y A;  3GPU A;  4F2L A;  4LFB M;  1D0K A;  3VKH A;  5IZ7 D;  2R65 A;  1N77 A;  1XB2 B;  3U6O A;  5JI3 E;  2Z4R A;  1HQC A;  5KPT A;  3JR5 A;  1WHC A;  2XFT A;  3GP1 A;  2QQ8 A;  3KVW A;  4EIW A;  3UJN A;  4HEO A;  2VQF M;  4DV5 M;  4IJE A;  3IEC A;  4WP2 A;  1IFY A;  3GRU A;  5EJC A;  4G4Q A;  1UFZ A;  2K47 A;  4MGZ E;  4OVZ A;  3J7A S;  4L15 A;  3MHV C;  2KA6 B;  5L8R F;  2C9O A;  3VK7 A;  4IBE A;  2VF7 A;  3VDU A;  3B9P A;  2L2D A;  2BWE A;  1C7Y A;  3DZD A;  3SHF A;  1XXH A;  3ZQJ A;  3J7B A;  1WGL A;  4OX9 M;  4Y28 F;  1Q3B A;  1YE9 A;  3LQR A;  3PXG A;  5ITQ A;  3HKP A;  3RFW A;  2ERC A;  2Y0T A;  4FCV A;  1XWI A;  1QDR A;  3JAM S;  4MGY E;  1NVM A;  2FOI C;  1GL6 A;  3T6P A;  3GLF E;  4IJF A;  4IBJ A;  1L1T A;  4GKK M;  2F5S A;  3QWL A;  4KO8 A;  3PNY A;  4R7G A;  3E21 A;  1SG9 A;  3K9P A;  4LRT A;  4RKU F;  1W5S A;  2OO9 A;  1TDH A;  2K6B A;  2F4V M;  3I4V A;  1CUK A;  2JY6 B;  1N75 A;  4MGK E;  2OPF A;  4R3D A;  3U6L A;  2R18 A;  1IN5 A;  1IXZ A;  1G4A E;  3K1J A;  3SAR A;  4RNA A;  1L8Q A;  5A2Q S;  2X49 A;  3L2A A;  3KSX A;  1I94 M;  2L4F A;  1PGY A;  2HCB A;  2GNO A;  2LHG A;  1DGB A;  5GKN A;  4G4R A;  5EP4 A;  1T43 A;  1S3S A;  1NV9 A;  2DKL A;  3LCV B;  1D0M A;  4JI8 M;  3KP0 E;  3HU1 A;  4AKG A;  8CAT A;  1T3T A;  5FSW A;  1H6U A;  2YQZ A;  4JI0 M;  2W82 A;  5FTK A;  1JR3 D; 
#chains in the Genus database with same CATH homology
 3LCU A;  2O25 A;  3FRI A;  1HT1 E;  2EKK A;  2JNH A;  1IM2 A;  2DAM A;  2QHO B;  1DO0 A;  1HQY E;  2KNZ A;  5JI2 E;  1EFU B;  4Q7J A;  2K9D A;  2KHH A;  4R71 A;  3FRH A;  2DEN A;  2CWB A;  3E46 A;  4GEW A;  1F4I A;  4G3O A;  1VG5 A;  1TR8 A;  2DI0 A;  2LVQ D;  1VQ1 A;  3FE3 A;  2OOA A;  1HJP A;  2B3T A;  2EKF A;  3F92 A;  2R0I A;  1G3I A;  2QNJ A;  1VEK A;  2DHY A;  2WZJ A;  1AIP C;  1YLA A;  4UN2 B;  1WIV A;  5DFL A;  2KNA A;  1XXH E;  1A5T A;  2LBC A;  2JY8 A;  1ZV1 A;  3GLI E;  2LVO C;  1VDL A;  3GLH E;  1KYI A;  1Q02 A;  2RRU A;  4F1I A;  3IHP A;  1BVS A;  2LVN C;  2JY5 A;  2MR9 A;  1DV0 A;  2JZ1 A;  1Y8G A;  1T6O A;  4F2L A;  1XB2 B;  2MJ5 B;  2ZTC A;  2DZL A;  1WHC A;  2HWJ A;  1MN3 A;  3MMP A;  2DAG A;  2LVA A;  4HEO A;  1TTE A;  3IEC A;  1ZMW A;  1R4G A;  1OAI A;  2EJS A;  4WP2 A;  1IFY A;  1UFZ A;  2JY7 A;  1OKS A;  2BWB A;  2L2D A;  2BWE A;  1C7Y A;  1V92 A;  2HAK A;  1WGN A;  1WGL A;  1VEG A;  2MRO B;  2H5X A;  2DAK A;  1NV8 A;  2QSF X;  1WJ7 A;  2JUJ A;  2OOB A;  2L4E A;  1DO2 A;  3T6P A;  3GLF E;  1OTR A;  1WR1 B;  1OQY A;  3E21 A;  3GLG E;  1SG9 A;  3K9P A;  2CP8 A;  2OO9 A;  1IXS A;  1P3Q Q;  2DAI A;  1CUK A;  2JY6 B;  2LVP C;  2K0B X;  2ZTD A;  2KNV A;  2DAE A;  2G3Q A;  3K9O A;  1G4A E;  1ZMV A;  4DBG B;  2JZ0 A;  2L4F A;  1PGY A;  1QZE A;  1HT2 E;  1ZMU A;  1E94 E;  1G41 A;  2LTU A;  1T43 A;  3BBZ A;  3H4J A;  1VEJ A;  1NV9 A;  2DKL A;  3LCV B;  1JR3 E;  1GO5 A;  2MGW A;  2JP7 A;  3B89 A;  2DNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...