1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN HHR23A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
1R4GA 3GLHE 3FE3A 1IXSA 1NV9A 4GEWA 1DO0A 2OO9A 2DAEA 1DV0A 1XXHE 1G3IA 2L2DA 3H4JA 3B89A 2CP8A 1E94E 3E46A 1T43A 2DAMA 2JY5A 1HT1E 3T6PA 1C7YA 2G3QA 1UFZA 1VEKA 1V92A 1WGLA 3GLGE 2DAIA 2DI0A 1VDLA 2O25A 1Q02A 3E21A 1GO5A 1WIVA 1BVSA 2OOBA 4G3OA 1OQYA 2KNZA 1TR8A 2JY6B 2EKKA 1WGNA 2ZTDA 3IECA 2RRUA 1G41A 2LVNC 1HQYE 3FRIA 4UN2B 1WJ7A 1F4IA 3LCVB 2DHYA 2JUJA 1QZEA 2L4EA 2DKLA 2R0IA 2HAKA 2K0BX 2QNJA 1WR1B 2ZTCA 2JP7A 1P3QQ 2LVAA 1NV8A 2KNVA 1AIPC 2KNAA 1YLAA 1VQ1A 2LVPC 4WP2A 2KHHA 1EFUB 5JI2E 1ZMWA 1HJPA 1IM2A 2LBCA 5DFLA 1T6OA 2MR9A 1ZMUA 1PGYA 2JY7A 2HWJA 1OAIA 2DZLA 3MMPA 4HEOA 2DENA 3FRHA 1VEJA 1OTRA 3IHPA 2CWBA 1KYIA 1Y8GA 2MROB 2DAKA 3BBZA 1ZV1A 2L4FA 1WHCA 2QHOB 4DBGB 1HT2E 3K9OA 1XB2B 1G4AE 2QSFX 1OKSA 1DO2A 3LCUA 2K9DA 1ZMVA 1VG5A 2H5XA 3F92A 2MJ5B 3GLFE 2MGWA 2OOAA 1A5TA 4F2LA 1JR3E 2DNAA 2JZ1A 2BWEA 2JNHA 2JY8A 1SG9A 2WZJA 3GLIE 2JZ0A 4R71A 1CUKA 1IFYA 2LTUA 4F1IA 2LVOC 2EJSA 2LVQD 1VEGA 4Q7JA 2DAGA 2B3TA 1MN3A 2BWBA 2EKFA 3K9PA 1TTEA
chains in the Genus database with same CATH superfamily
1NJGA 3SYKA 3FE3A 1PJTA 3D8BA 3U6OA 1NHWC 5IREB 2OO9A 4JI8M 4LGMA 1L2CA 4M9SA 1NVMA 1ZAEA 3GRRA 3QYEA 4REZA 3FD9A 4TUWA 1Q39A 2CP8A 1E94E 3NBXX 3E46A 1DGBA 4AI6A 5LMNM 3KSJA 3W0LB 3FKEA 3LQQA 4Y28F 3SARA 2G3QA 3AV0A 2DWZB 2FH0A 1SXJA 1E32A 3L27A 3M7GA 1WGLA 5ITXA 4JV5M 2DVWB 3KOWE 2Z3XA 4X62M 4IBKA 3K2LA 3HU3A 1VDLA 4G4NA 2LWXA 3KDSE 2Z7JA 1XWIA 4JI5M 3TQSA 1WIVA 3HJ8A 1PM5A 2GQFA 1Q3CA 3TWLA 2DWMA 1DGHA 1Z5AA 5JI3E 2XSZD 2Y0TA 5F3WA 2F5PA 1OQYA 1W5TA 2JY6B 1N33M 3W0FA 2JA2A 4DR5M 2RRUA 4D81A 3JAMS 1G41A 3KOZE 2XGNA 3SMPA 1HQYE 1NO1A 4P17A 3K92A 4L4UA 4UN2B 5DYGA 1WJ7A 1OJLA 2DXIA 1IN4A 2C96A 4ZPXA 4FCTA 1OAOC 2KRKA 3FUWA 4LZJA 4QHTA 2HCBA 3U5ZA 5FSWA 3J2PB 1R5LA 2NQ8C 4LRSA 4NXNM 3GPUA 4GKJM 4KO8A 1WR1B 2ZTCA 1JR3A 4L8RC 2ZAMA 3THGA 2M60A 2JP7A 1HNXM 4YHHM 2FS1A 2CRUA 2KRUA 2FOIC 1ORYB 4B3MM 1YLAA 1VQ1A 1W5SA 3KP0E 4MGYE 2LNHC 2C99A 1DGGA 2CV0A 4JI7M 2LVPC 4WP2A 3C58A 3L25A 1SXJE 2C9CA 1EFUB 4NSOB 4DR6M 5JI2E 4LFAM 4BLCA 5ITXE 3OTOM 2X49A 1JB0F 2I7NA 4QOSA 5ITQA 2LBCA 3BXWA 3CGWA 4FWGA 2Z8YM 4OU7A 1GL6A 3LW5F 4I8OA 1PGYA 2ERCA 3FTEA 3B74A 3B7ZA 1MU5A 3C3DA 4NSRA 2KA6B 5LMUM 3GLFA 3ZC7B 3LVVA 2RGOA 3HHZA 1QZMA 3B7NA 4HEOA 1D0KA 5E26A 2C9OA 2MROB 2FE8A 1C1KA 2R4EA 3UK6A 1IXRC 3BBZA 2C5RA 1N78A 2I7PA 3ZCBB 3UZUA 4B7GA 3VLFB 2WSFF 3GLIA 3R8FA 1ZQ9A 3LVWA 5A2QS 1PJJA 2K9DA 1ZMVA 2K47A 3Q8GA 2CHGA 3F92A 2UXCM 3A46A 3FUXA 4IJFA 3SAWA 1HQCA 2MGWA 2L7HA 2VDBB 1A5TA 4LJ8A 3EIHA 4DR1M 3I4YA 2XF3A 4IBIA 1JR3E 4FW9A 1IN8A 4FVMA 3RFWA 3SMSA 4JI1M 2DNAA 5BR8M 4Z6YA 4RF1A 1XXHB 2LH0A 1E9SA 2J7NA 4R71A 3AKZA 2Z4RA 4LFCM 4OVZB 3TL4X 2DAGA 3EIEA 4I4LA 4MGKE 3VKGA 3CTWB 1KFVA 4K0KM 4B3TM 1Z5CA 3HHXA 1TTEA 1R4GA 2O5RA 1FJGM 1SXJD 3CF2A 2XZFA 3GLGB 4G4OA 4GEWA 3KOXE 1DO0A 2QCUA 4AQYM 2DAEA 4DR4M 3U6DA 3H4MA 3KSXA 1D0LA 1G3IA 1GJSA 2LHCA 3H4JA 2G8LA 3B89A 1IN6A 2D7GA 1NJFA 4X66M 4PDIA 3QAUA 5EP2A 2Y21A 2DAMA 1QVRA 2R44A 2VF7A 1C7YA 3U61B 1VEKA 4FD2A 4LJ4A 4QHSA 1TH2A 2FNAA 1EIJA 2ZAOA 1TDHA 3VDPA 1GL7A 5E6JA 5ITUA 3J27B 3ILKA 1XC8A 1QUSA 4IBJA 4NRVA 2OOBA 4IIWA 2RKOA 4MGZE 2KNZA 3T38A 2R18A 3UJNA 4LZZA 1J09A 1JR3D 4HL4A 1I94M 3FRIA 4DV1M 2F5QA 1F4IA 2L4EA 3RGSA 2L6OA 3A45A 2L09A 1L1TA 3DZDA 2CFOA 2DZNB 4L78A 3A98B 1L8QA 5ITRA 4PCZA 1IBLM 4GHAA 1QAQA 2K0BX 2MH8A 2QNJA 4AW4A 2V1UA 1IY0A 3FTDA 1DGFA 3E4RA 4LGYA 1IBMM 4MGIE 4QNRA 1GJTA 1TGUA 1Q3BA 4BBAA 3FTFA 1NNJA 2CHVA 2Y0QA 3GQ5A 3J81S 4AG6A 3L28A 4B3RM 4NXMM 2XFSA 3HY5A 4MH0E 2UXDM 4IBFA 1NY6A 1E9RA 3SATA 3HWSA 3GLHA 1L1ZA 1OIZA 1D2NA 1VDDA 2KW0A 3L26A 1IXZA 1UM8A 1T6OA 4LG2A 3VFDA 1TH4A 1XXHA 1ZMUA 2JY7A 3PNYA 1I4WA 2HWJA 1OAIA 3PXGA 3GP1A 2XZUA 4OVZA 4A3VB 1K3XA 3HJQA 1N32M 2DENA 3PFIA 1VEJA 1JQJC 3IHPA 1NY5A 4CIZA 1QANA 4JI6M 2YR0A 3TPZA 3GPYA 2OPFA 1N34M 4LJ5A 1WHCA 3BOSA 2J7OA 8CATA 3K9OA 1XB2B 2OQ4A 1IY2A 4DUZM 2QSFX 1OKSA 3VK7A 1J5EM 4II7A 2VQFM 3LCUA 3SFZA 4G4RA 4KODA 2UUBM 1VG5A 1MX0A 2O01F 4EIWA 2MJ5B 2GNOA 3MK6A 4M0WA 3HGIA 4LY6A 3U6CA 4R7GA 4NL4H 3U61A 4IBBA 4AKHA 4KHPM 4IJEA 4OW0A 1SG9A 2E5LM 2WZJA 2R65A 1NNUC 4I81A 1CUKA 4R3DA 2LTUA 1T3TA 5EXTA 3VDUA 4B7FA 4F1IA 2EJSA 2LVQD 1VEGA 1LV7A 5DNYA 3U6LA 2P5TA 3U60B 2EKFA 4LJ9A 1K3WA 3JR4A 1QAOA 4M9XA 2VF8A 3AOEC 5KQDA 2RGHA 2F5OA 1XNQM 2XEPA 3GLHE 4G4QA 5C18A 3U6QA 1PJQA 1QYRA 3SHGB 1NV9A 3KOYE 2R62A 3HZJA 1DV0A 1XXHE 3SC3A 2L2DA 1TF0B 1G8PA 3KFUG 5ITYA 4D80A 4AG5A 1D0MA 2CE7A 3A42A 1MJGM 3HU1A 3HU2A 3T6PA 2XLJA 2XH9A 2ZANA 4WW0A 3B7QA 3UGJA 1UFZA 1SXJB 3GPPA 3W68A 1V92A 4DV0M 3FUTA 3VKHA 4KLNA 3GLGE 1RU3A 2LXEA 2V6ZM 4DV5M 2UXBM 5FTJA 1YSYA 2O25A 2Y20A 4LJAA 3T1YM 3PNVA 2WSEF 4CGYB 3WHKA 2QPAA 1BVSA 1DGHB 1V34A 5DYIA 3D8LA 1HNZM 5IT9S 1IXSB 2EKKA 4G6ZA 4DV7M 4AKIA 3IECA 2ZTDA 5KPZA 3FYCA 5KPRA 2CV1A 4RKUF 2KEBA 3GQ4A 2KDLA 2R45A 3LCVB 2EO2A 1QZEA 1SXJC 3I01M 2DKLA 1IQPA 2R0IA 1YUBA 4IBGA 4PT5A 5FTLA 3U5ZB 1QQWA 4MB7A 3GQ3A 2R46A 3FUUA 1OFIA 3HHWA 1G59A 2KXEA 5IWAM 4PD2A 3GPXA 3T15A 2LVAA 1P3QQ 1IN7A 3HX3A 5EP4A 1NV8A 2A5YB 2KNVA 3U6EA 1AIPC 2KNAA 4LJ6A 4IBEA 3GRYA 3I04M 1XMOM 1HNWM 2KHHA 4L15A 4LJ7A 2X4AA 2H1RA 4NRWA 2QBYB 3TWMA 1ZMWA 2CHQA 2UUCM 4ANRA 3I4VA 1HJPA 4IBDA 2VQEM 1IM2A 1IN5A 4FWDA 4CHTB 1AUAA 4GRIA 4X65M 3GLFB 2LHGA 4WURA 4JI4M 3RE8A 4PDGA 1IBKM 1XMQM 3U60A 2CWBA 2KZSA 1NSFA 3GO8A 1PRBA 4LF7M 4LF9M 1S3SA 1N36M 1GABA 3T1HM 2FFJA 2QQ8A 1WXQA 2J5YA 4D82A 4S12A 3ZH9B 4IBCA 3K1JA 3GLIB 4DR3M 3ZQJA 1DO2A 2YNMD 5FTKA 5EP3A 1R2ZA 1XHBA 1Z59A 2C98A 2H5XA 5C1BA 1PJIA 5EP1A 5ITTA 1QDTA 2OOAA 5EQTA 3IG8A 4F2LA 2UUAM 5BPVA 5FTNA 4DV2M 2JZ1A 2BWEA 3CF0A 3IG5A 4KT0F 4NOOB 1Z6TA 3TE6A 4DV3M 1GKIA 1IFYA 1R7RA 2BJVA 2CUZA 3LQRA 4JXJA 4Q7JA 2BNKA 3AJIB 2B3TA 1MN3A 1NHGC 1Z5BA 2BWBA 4YY3M 4GIPA 4ITQA 2HHHM 4LCBA 4GKKM 4L16A 4QNMA 3NWLA 4LF4M 1IXSA 2K6BA 3FUVA 4GH9A 3GLGA 3AFHA 2Z4SA 2L7IA 1PJSA 3FYDA 4MGHA 3E9SA 3DA1A 3KS8A 1TH3A 5KPTA 1R2YA 3W67A 4AZFA 2CV2A 1XNRM 2R6FA 2DHRA 4FCWA 1T43A 4GITA 5EJCA 4GHLA 2JY5A 1KSFX 4JN6A 1X37A 1HT1E 3KXEC 3V76A 2R4JA 4BB9A 5L8RF 1G71A 2G5GX 3M6AA 4GC9A 3UMMA 2HKJA 1EE8A 2W82A 2YQZA 2DAIA 2DI0A 4DV4M 1R6BX 4NC6A 1Q02A 3E21A 2Q2EB 1GO5A 3QWLA 2X8AA 7CATA 5IZ7D 4AKGA 3HKPA 2QP9X 3M0EA 4QOZC 2D7HA 3KS4A 4G3OA 2JWSA 3C3EA 1TR8A 2ZM6M 3Q8XA 3SAUA 4RF0A 5EXPA 2F5SA 4M9ZA 3AL0C 1WGNA 3L29A 3RGPA 4DR7M 2QBYA 2EUCA 2LVNC 1HR0M 4I5SA 4DV6M 3KVWA 4LRTA 2DHYA 2JUJA 4P16A 2N35A 3NBIA 3VK8A 2KZUA 2XSZA 2D7EA 2DWNA 2F4VM 3HJSA 2HAKA 1QDRA 4LF6M 3U6MA 4X64M 1V33A 2ZBKB 3MHVC 3TWKA 2HL7A 4FWHA 3GRUA 4B08A 3CF6E 4JYAM 3J7BA 1FNNA 4L6V6 5EXXA 4FCVA 1N75A 3GRVA 4OX9M 3SAVA 1YE9A 5H37D 4DR2M 4XGIA 3GLHB 3QYBA 1IY1A 3AOGA 4LF8M 2BJWA 5DFLA 4JI0M 1N77A 4CJ6A 3L2AA 3LMMA 3WHLA 2AHMA 2MR9A 1QAMA 3U6PA 3SASA 3B9PA 3K8ZA 1LTMA 2EA0A 1H6UA 2DZLA 4RNAA 3MMPA 2YFQA 3KW6A 4MM3B 1L2DA 3FRHA 2XFTA 3U6SA 1TDZA 1OTRA 5KQ8A 2UU9M 1KYIA 1Y8GA 3I51A 2JXNA 4JI2M 2DAKA 3DFZA 3J7AS 1GVNA 1ZV1A 2L4FA 3KP1E 3PVSA 4CISA 3JR5A 2QHOB 3MJ5A 1HT2E 5GKNA 3AOEA 4DBGB 3SHFA 1G4AE 5FTMA 5KO3A 4LF5M 4B3SM 2VIIA 1QUTA 4M0DA 3GLFE 2M5ZA 5EXSA 1J7KA 2V1CA 2F5NA 4DUYM 4B7HA 3SBJA 3FTCA 4GC5A 4XBOA 4JI3M 2APLA 1OFHA 2QZ4A 4W5WA 2JNHA 2JY8A 2CEAA 4HLQA 4Z8XA 3GLIE 2JZ0A 4GMQA 2DZOB 2QENA 3SYLA 2LVOC 3C9PA 5FLXS 3DOAA 4LFBM 3HHYA 4XK8F 1K82A 2WSCF 2DWLA 1GLNA 3K9PA 1OIPA 3R9XB 1L2BA 3J80S
chains in the Genus database with same CATH topology
1R4GA 3GLHE 3FE3A 1IXSA 1NV9A 4GEWA 1DO0A 2OO9A 2DAEA 1DV0A 1XXHE 1G3IA 2L2DA 3H4JA 3B89A 2CP8A 1E94E 3E46A 1T43A 2DAMA 2JY5A 1HT1E 3T6PA 1C7YA 2G3QA 1UFZA 1VEKA 1V92A 1WGLA 3GLGE 2DAIA 2DI0A 1VDLA 2O25A 1Q02A 3E21A 1GO5A 1WIVA 1BVSA 2OOBA 4G3OA 1OQYA 2KNZA 1TR8A 2JY6B 2EKKA 1WGNA 2ZTDA 3IECA 2RRUA 1G41A 2LVNC 1HQYE 3FRIA 4UN2B 1WJ7A 1F4IA 3LCVB 2DHYA 2JUJA 1QZEA 2L4EA 2DKLA 2R0IA 2HAKA 2K0BX 2QNJA 1WR1B 2ZTCA 2JP7A 1P3QQ 2LVAA 1NV8A 2KNVA 1AIPC 2KNAA 1YLAA 1VQ1A 2LVPC 4WP2A 2KHHA 1EFUB 5JI2E 1ZMWA 1HJPA 1IM2A 2LBCA 5DFLA 1T6OA 2MR9A 1ZMUA 1PGYA 2JY7A 2HWJA 1OAIA 2DZLA 3MMPA 4HEOA 2DENA 3FRHA 1VEJA 1OTRA 3IHPA 2CWBA 1KYIA 1Y8GA 2MROB 2DAKA 3BBZA 1ZV1A 2L4FA 1WHCA 2QHOB 4DBGB 1HT2E 3K9OA 1XB2B 1G4AE 2QSFX 1OKSA 1DO2A 3LCUA 2K9DA 1ZMVA 1VG5A 2H5XA 3F92A 2MJ5B 3GLFE 2MGWA 2OOAA 1A5TA 4F2LA 1JR3E 2DNAA 2JZ1A 2BWEA 2JNHA 2JY8A 1SG9A 2WZJA 3GLIE 2JZ0A 4R71A 1CUKA 1IFYA 2LTUA 4F1IA 2LVOC 2EJSA 2LVQD 1VEGA 4Q7JA 2DAGA 2B3TA 1MN3A 2BWBA 2EKFA 3K9PA 1TTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4G A;  3GLH E;  3FE3 A;  1IXS A;  1NV9 A;  4GEW A;  1DO0 A;  2OO9 A;  2DAE A;  1DV0 A;  1XXH E;  1G3I A;  2L2D A;  3H4J A;  3B89 A;  2CP8 A;  1E94 E;  3E46 A;  1T43 A;  2DAM A;  2JY5 A;  1HT1 E;  3T6P A;  1C7Y A;  2G3Q A;  1UFZ A;  1VEK A;  1V92 A;  1WGL A;  3GLG E;  2DAI A;  2DI0 A;  1VDL A;  2O25 A;  1Q02 A;  3E21 A;  1GO5 A;  1WIV A;  1BVS A;  2OOB A;  4G3O A;  1OQY A;  2KNZ A;  1TR8 A;  2JY6 B;  2EKK A;  1WGN A;  2ZTD A;  3IEC A;  2RRU A;  1G41 A;  2LVN C;  1HQY E;  3FRI A;  4UN2 B;  1WJ7 A;  1F4I A;  3LCV B;  2DHY A;  2JUJ A;  1QZE A;  2L4E A;  2DKL A;  2R0I A;  2HAK A;  2K0B X;  2QNJ A;  1WR1 B;  2ZTC A;  2JP7 A;  1P3Q Q;  2LVA A;  1NV8 A;  2KNV A;  1AIP C;  2KNA A;  1YLA A;  1VQ1 A;  2LVP C;  4WP2 A;  2KHH A;  1EFU B;  5JI2 E;  1ZMW A;  1HJP A;  1IM2 A;  2LBC A;  5DFL A;  1T6O A;  2MR9 A;  1ZMU A;  1PGY A;  2JY7 A;  2HWJ A;  1OAI A;  2DZL A;  3MMP A;  4HEO A;  2DEN A;  3FRH A;  1VEJ A;  1OTR A;  3IHP A;  2CWB A;  1KYI A;  1Y8G A;  2MRO B;  2DAK A;  3BBZ A;  1ZV1 A;  2L4F A;  1WHC A;  2QHO B;  4DBG B;  1HT2 E;  3K9O A;  1XB2 B;  1G4A E;  2QSF X;  1OKS A;  1DO2 A;  3LCU A;  2K9D A;  1ZMV A;  1VG5 A;  2H5X A;  3F92 A;  2MJ5 B;  3GLF E;  2MGW A;  2OOA A;  1A5T A;  4F2L A;  1JR3 E;  2DNA A;  2JZ1 A;  2BWE A;  2JNH A;  2JY8 A;  1SG9 A;  2WZJ A;  3GLI E;  2JZ0 A;  4R71 A;  1CUK A;  1IFY A;  2LTU A;  4F1I A;  2LVO C;  2EJS A;  2LVQ D;  1VEG A;  4Q7J A;  2DAG A;  2B3T A;  1MN3 A;  2BWB A;  2EKF A;  3K9P A;  1TTE A; 
#chains in the Genus database with same CATH topology
 1NJG A;  3SYK A;  3FE3 A;  1PJT A;  3D8B A;  3U6O A;  1NHW C;  5IRE B;  2OO9 A;  4JI8 M;  4LGM A;  1L2C A;  4M9S A;  1NVM A;  1ZAE A;  3GRR A;  3QYE A;  4REZ A;  3FD9 A;  4TUW A;  1Q39 A;  2CP8 A;  1E94 E;  3NBX X;  3E46 A;  1DGB A;  4AI6 A;  5LMN M;  3KSJ A;  3W0L B;  3FKE A;  3LQQ A;  4Y28 F;  3SAR A;  2G3Q A;  3AV0 A;  2DWZ B;  2FH0 A;  1SXJ A;  1E32 A;  3L27 A;  3M7G A;  1WGL A;  5ITX A;  4JV5 M;  2DVW B;  3KOW E;  2Z3X A;  4X62 M;  4IBK A;  3K2L A;  3HU3 A;  1VDL A;  4G4N A;  2LWX A;  3KDS E;  2Z7J A;  1XWI A;  4JI5 M;  3TQS A;  1WIV A;  3HJ8 A;  1PM5 A;  2GQF A;  1Q3C A;  3TWL A;  2DWM A;  1DGH A;  1Z5A A;  5JI3 E;  2XSZ D;  2Y0T A;  5F3W A;  2F5P A;  1OQY A;  1W5T A;  2JY6 B;  1N33 M;  3W0F A;  2JA2 A;  4DR5 M;  2RRU A;  4D81 A;  3JAM S;  1G41 A;  3KOZ E;  2XGN A;  3SMP A;  1HQY E;  1NO1 A;  4P17 A;  3K92 A;  4L4U A;  4UN2 B;  5DYG A;  1WJ7 A;  1OJL A;  2DXI A;  1IN4 A;  2C96 A;  4ZPX A;  4FCT A;  1OAO C;  2KRK A;  3FUW A;  4LZJ A;  4QHT A;  2HCB A;  3U5Z A;  5FSW A;  3J2P B;  1R5L A;  2NQ8 C;  4LRS A;  4NXN M;  3GPU A;  4GKJ M;  4KO8 A;  1WR1 B;  2ZTC A;  1JR3 A;  4L8R C;  2ZAM A;  3THG A;  2M60 A;  2JP7 A;  1HNX M;  4YHH M;  2FS1 A;  2CRU A;  2KRU A;  2FOI C;  1ORY B;  4B3M M;  1YLA A;  1VQ1 A;  1W5S A;  3KP0 E;  4MGY E;  2LNH C;  2C99 A;  1DGG A;  2CV0 A;  4JI7 M;  2LVP C;  4WP2 A;  3C58 A;  3L25 A;  1SXJ E;  2C9C A;  1EFU B;  4NSO B;  4DR6 M;  5JI2 E;  4LFA M;  4BLC A;  5ITX E;  3OTO M;  2X49 A;  1JB0 F;  2I7N A;  4QOS A;  5ITQ A;  2LBC A;  3BXW A;  3CGW A;  4FWG A;  2Z8Y M;  4OU7 A;  1GL6 A;  3LW5 F;  4I8O A;  1PGY A;  2ERC A;  3FTE A;  3B74 A;  3B7Z A;  1MU5 A;  3C3D A;  4NSR A;  2KA6 B;  5LMU M;  3GLF A;  3ZC7 B;  3LVV A;  2RGO A;  3HHZ A;  1QZM A;  3B7N A;  4HEO A;  1D0K A;  5E26 A;  2C9O A;  2MRO B;  2FE8 A;  1C1K A;  2R4E A;  3UK6 A;  1IXR C;  3BBZ A;  2C5R A;  1N78 A;  2I7P A;  3ZCB B;  3UZU A;  4B7G A;  3VLF B;  2WSF F;  3GLI A;  3R8F A;  1ZQ9 A;  3LVW A;  5A2Q S;  1PJJ A;  2K9D A;  1ZMV A;  2K47 A;  3Q8G A;  2CHG A;  3F92 A;  2UXC M;  3A46 A;  3FUX A;  4IJF A;  3SAW A;  1HQC A;  2MGW A;  2L7H A;  2VDB B;  1A5T A;  4LJ8 A;  3EIH A;  4DR1 M;  3I4Y A;  2XF3 A;  4IBI A;  1JR3 E;  4FW9 A;  1IN8 A;  4FVM A;  3RFW A;  3SMS A;  4JI1 M;  2DNA A;  5BR8 M;  4Z6Y A;  4RF1 A;  1XXH B;  2LH0 A;  1E9S A;  2J7N A;  4R71 A;  3AKZ A;  2Z4R A;  4LFC M;  4OVZ B;  3TL4 X;  2DAG A;  3EIE A;  4I4L A;  4MGK E;  3VKG A;  3CTW B;  1KFV A;  4K0K M;  4B3T M;  1Z5C A;  3HHX A;  1TTE A;  1R4G A;  2O5R A;  1FJG M;  1SXJ D;  3CF2 A;  2XZF A;  3GLG B;  4G4O A;  4GEW A;  3KOX E;  1DO0 A;  2QCU A;  4AQY M;  2DAE A;  4DR4 M;  3U6D A;  3H4M A;  3KSX A;  1D0L A;  1G3I A;  1GJS A;  2LHC A;  3H4J A;  2G8L A;  3B89 A;  1IN6 A;  2D7G A;  1NJF A;  4X66 M;  4PDI A;  3QAU A;  5EP2 A;  2Y21 A;  2DAM A;  1QVR A;  2R44 A;  2VF7 A;  1C7Y A;  3U61 B;  1VEK A;  4FD2 A;  4LJ4 A;  4QHS A;  1TH2 A;  2FNA A;  1EIJ A;  2ZAO A;  1TDH A;  3VDP A;  1GL7 A;  5E6J A;  5ITU A;  3J27 B;  3ILK A;  1XC8 A;  1QUS A;  4IBJ A;  4NRV A;  2OOB A;  4IIW A;  2RKO A;  4MGZ E;  2KNZ A;  3T38 A;  2R18 A;  3UJN A;  4LZZ A;  1J09 A;  1JR3 D;  4HL4 A;  1I94 M;  3FRI A;  4DV1 M;  2F5Q A;  1F4I A;  2L4E A;  3RGS A;  2L6O A;  3A45 A;  2L09 A;  1L1T A;  3DZD A;  2CFO A;  2DZN B;  4L78 A;  3A98 B;  1L8Q A;  5ITR A;  4PCZ A;  1IBL M;  4GHA A;  1QAQ A;  2K0B X;  2MH8 A;  2QNJ A;  4AW4 A;  2V1U A;  1IY0 A;  3FTD A;  1DGF A;  3E4R A;  4LGY A;  1IBM M;  4MGI E;  4QNR A;  1GJT A;  1TGU A;  1Q3B A;  4BBA A;  3FTF A;  1NNJ A;  2CHV A;  2Y0Q A;  3GQ5 A;  3J81 S;  4AG6 A;  3L28 A;  4B3R M;  4NXM M;  2XFS A;  3HY5 A;  4MH0 E;  2UXD M;  4IBF A;  1NY6 A;  1E9R A;  3SAT A;  3HWS A;  3GLH A;  1L1Z A;  1OIZ A;  1D2N A;  1VDD A;  2KW0 A;  3L26 A;  1IXZ A;  1UM8 A;  1T6O A;  4LG2 A;  3VFD A;  1TH4 A;  1XXH A;  1ZMU A;  2JY7 A;  3PNY A;  1I4W A;  2HWJ A;  1OAI A;  3PXG A;  3GP1 A;  2XZU A;  4OVZ A;  4A3V B;  1K3X A;  3HJQ A;  1N32 M;  2DEN A;  3PFI A;  1VEJ A;  1JQJ C;  3IHP A;  1NY5 A;  4CIZ A;  1QAN A;  4JI6 M;  2YR0 A;  3TPZ A;  3GPY A;  2OPF A;  1N34 M;  4LJ5 A;  1WHC A;  3BOS A;  2J7O A;  8CAT A;  3K9O A;  1XB2 B;  2OQ4 A;  1IY2 A;  4DUZ M;  2QSF X;  1OKS A;  3VK7 A;  1J5E M;  4II7 A;  2VQF M;  3LCU A;  3SFZ A;  4G4R A;  4KOD A;  2UUB M;  1VG5 A;  1MX0 A;  2O01 F;  4EIW A;  2MJ5 B;  2GNO A;  3MK6 A;  4M0W A;  3HGI A;  4LY6 A;  3U6C A;  4R7G A;  4NL4 H;  3U61 A;  4IBB A;  4AKH A;  4KHP M;  4IJE A;  4OW0 A;  1SG9 A;  2E5L M;  2WZJ A;  2R65 A;  1NNU C;  4I81 A;  1CUK A;  4R3D A;  2LTU A;  1T3T A;  5EXT A;  3VDU A;  4B7F A;  4F1I A;  2EJS A;  2LVQ D;  1VEG A;  1LV7 A;  5DNY A;  3U6L A;  2P5T A;  3U60 B;  2EKF A;  4LJ9 A;  1K3W A;  3JR4 A;  1QAO A;  4M9X A;  2VF8 A;  3AOE C;  5KQD A;  2RGH A;  2F5O A;  1XNQ M;  2XEP A;  3GLH E;  4G4Q A;  5C18 A;  3U6Q A;  1PJQ A;  1QYR A;  3SHG B;  1NV9 A;  3KOY E;  2R62 A;  3HZJ A;  1DV0 A;  1XXH E;  3SC3 A;  2L2D A;  1TF0 B;  1G8P A;  3KFU G;  5ITY A;  4D80 A;  4AG5 A;  1D0M A;  2CE7 A;  3A42 A;  1MJG M;  3HU1 A;  3HU2 A;  3T6P A;  2XLJ A;  2XH9 A;  2ZAN A;  4WW0 A;  3B7Q A;  3UGJ A;  1UFZ A;  1SXJ B;  3GPP A;  3W68 A;  1V92 A;  4DV0 M;  3FUT A;  3VKH A;  4KLN A;  3GLG E;  1RU3 A;  2LXE A;  2V6Z M;  4DV5 M;  2UXB M;  5FTJ A;  1YSY A;  2O25 A;  2Y20 A;  4LJA A;  3T1Y M;  3PNV A;  2WSE F;  4CGY B;  3WHK A;  2QPA A;  1BVS A;  1DGH B;  1V34 A;  5DYI A;  3D8L A;  1HNZ M;  5IT9 S;  1IXS B;  2EKK A;  4G6Z A;  4DV7 M;  4AKI A;  3IEC A;  2ZTD A;  5KPZ A;  3FYC A;  5KPR A;  2CV1 A;  4RKU F;  2KEB A;  3GQ4 A;  2KDL A;  2R45 A;  3LCV B;  2EO2 A;  1QZE A;  1SXJ C;  3I01 M;  2DKL A;  1IQP A;  2R0I A;  1YUB A;  4IBG A;  4PT5 A;  5FTL A;  3U5Z B;  1QQW A;  4MB7 A;  3GQ3 A;  2R46 A;  3FUU A;  1OFI A;  3HHW A;  1G59 A;  2KXE A;  5IWA M;  4PD2 A;  3GPX A;  3T15 A;  2LVA A;  1P3Q Q;  1IN7 A;  3HX3 A;  5EP4 A;  1NV8 A;  2A5Y B;  2KNV A;  3U6E A;  1AIP C;  2KNA A;  4LJ6 A;  4IBE A;  3GRY A;  3I04 M;  1XMO M;  1HNW M;  2KHH A;  4L15 A;  4LJ7 A;  2X4A A;  2H1R A;  4NRW A;  2QBY B;  3TWM A;  1ZMW A;  2CHQ A;  2UUC M;  4ANR A;  3I4V A;  1HJP A;  4IBD A;  2VQE M;  1IM2 A;  1IN5 A;  4FWD A;  4CHT B;  1AUA A;  4GRI A;  4X65 M;  3GLF B;  2LHG A;  4WUR A;  4JI4 M;  3RE8 A;  4PDG A;  1IBK M;  1XMQ M;  3U60 A;  2CWB A;  2KZS A;  1NSF A;  3GO8 A;  1PRB A;  4LF7 M;  4LF9 M;  1S3S A;  1N36 M;  1GAB A;  3T1H M;  2FFJ A;  2QQ8 A;  1WXQ A;  2J5Y A;  4D82 A;  4S12 A;  3ZH9 B;  4IBC A;  3K1J A;  3GLI B;  4DR3 M;  3ZQJ A;  1DO2 A;  2YNM D;  5FTK A;  5EP3 A;  1R2Z A;  1XHB A;  1Z59 A;  2C98 A;  2H5X A;  5C1B A;  1PJI A;  5EP1 A;  5ITT A;  1QDT A;  2OOA A;  5EQT A;  3IG8 A;  4F2L A;  2UUA M;  5BPV A;  5FTN A;  4DV2 M;  2JZ1 A;  2BWE A;  3CF0 A;  3IG5 A;  4KT0 F;  4NOO B;  1Z6T A;  3TE6 A;  4DV3 M;  1GKI A;  1IFY A;  1R7R A;  2BJV A;  2CUZ A;  3LQR A;  4JXJ A;  4Q7J A;  2BNK A;  3AJI B;  2B3T A;  1MN3 A;  1NHG C;  1Z5B A;  2BWB A;  4YY3 M;  4GIP A;  4ITQ A;  2HHH M;  4LCB A;  4GKK M;  4L16 A;  4QNM A;  3NWL A;  4LF4 M;  1IXS A;  2K6B A;  3FUV A;  4GH9 A;  3GLG A;  3AFH A;  2Z4S A;  2L7I A;  1PJS A;  3FYD A;  4MGH A;  3E9S A;  3DA1 A;  3KS8 A;  1TH3 A;  5KPT A;  1R2Y A;  3W67 A;  4AZF A;  2CV2 A;  1XNR M;  2R6F A;  2DHR A;  4FCW A;  1T43 A;  4GIT A;  5EJC A;  4GHL A;  2JY5 A;  1KSF X;  4JN6 A;  1X37 A;  1HT1 E;  3KXE C;  3V76 A;  2R4J A;  4BB9 A;  5L8R F;  1G71 A;  2G5G X;  3M6A A;  4GC9 A;  3UMM A;  2HKJ A;  1EE8 A;  2W82 A;  2YQZ A;  2DAI A;  2DI0 A;  4DV4 M;  1R6B X;  4NC6 A;  1Q02 A;  3E21 A;  2Q2E B;  1GO5 A;  3QWL A;  2X8A A;  7CAT A;  5IZ7 D;  4AKG A;  3HKP A;  2QP9 X;  3M0E A;  4QOZ C;  2D7H A;  3KS4 A;  4G3O A;  2JWS A;  3C3E A;  1TR8 A;  2ZM6 M;  3Q8X A;  3SAU A;  4RF0 A;  5EXP A;  2F5S A;  4M9Z A;  3AL0 C;  1WGN A;  3L29 A;  3RGP A;  4DR7 M;  2QBY A;  2EUC A;  2LVN C;  1HR0 M;  4I5S A;  4DV6 M;  3KVW A;  4LRT A;  2DHY A;  2JUJ A;  4P16 A;  2N35 A;  3NBI A;  3VK8 A;  2KZU A;  2XSZ A;  2D7E A;  2DWN A;  2F4V M;  3HJS A;  2HAK A;  1QDR A;  4LF6 M;  3U6M A;  4X64 M;  1V33 A;  2ZBK B;  3MHV C;  3TWK A;  2HL7 A;  4FWH A;  3GRU A;  4B08 A;  3CF6 E;  4JYA M;  3J7B A;  1FNN A;  4L6V 6;  5EXX A;  4FCV A;  1N75 A;  3GRV A;  4OX9 M;  3SAV A;  1YE9 A;  5H37 D;  4DR2 M;  4XGI A;  3GLH B;  3QYB A;  1IY1 A;  3AOG A;  4LF8 M;  2BJW A;  5DFL A;  4JI0 M;  1N77 A;  4CJ6 A;  3L2A A;  3LMM A;  3WHL A;  2AHM A;  2MR9 A;  1QAM A;  3U6P A;  3SAS A;  3B9P A;  3K8Z A;  1LTM A;  2EA0 A;  1H6U A;  2DZL A;  4RNA A;  3MMP A;  2YFQ A;  3KW6 A;  4MM3 B;  1L2D A;  3FRH A;  2XFT A;  3U6S A;  1TDZ A;  1OTR A;  5KQ8 A;  2UU9 M;  1KYI A;  1Y8G A;  3I51 A;  2JXN A;  4JI2 M;  2DAK A;  3DFZ A;  3J7A S;  1GVN A;  1ZV1 A;  2L4F A;  3KP1 E;  3PVS A;  4CIS A;  3JR5 A;  2QHO B;  3MJ5 A;  1HT2 E;  5GKN A;  3AOE A;  4DBG B;  3SHF A;  1G4A E;  5FTM A;  5KO3 A;  4LF5 M;  4B3S M;  2VII A;  1QUT A;  4M0D A;  3GLF E;  2M5Z A;  5EXS A;  1J7K A;  2V1C A;  2F5N A;  4DUY M;  4B7H A;  3SBJ A;  3FTC A;  4GC5 A;  4XBO A;  4JI3 M;  2APL A;  1OFH A;  2QZ4 A;  4W5W A;  2JNH A;  2JY8 A;  2CEA A;  4HLQ A;  4Z8X A;  3GLI E;  2JZ0 A;  4GMQ A;  2DZO B;  2QEN A;  3SYL A;  2LVO C;  3C9P A;  5FLX S;  3DOA A;  4LFB M;  3HHY A;  4XK8 F;  1K82 A;  2WSC F;  2DWL A;  1GLN A;  3K9P A;  1OIP A;  3R9X B;  1L2B A;  3J80 S; 
#chains in the Genus database with same CATH homology
 1R4G A;  3GLH E;  3FE3 A;  1IXS A;  1NV9 A;  4GEW A;  1DO0 A;  2OO9 A;  2DAE A;  1DV0 A;  1XXH E;  1G3I A;  2L2D A;  3H4J A;  3B89 A;  2CP8 A;  1E94 E;  3E46 A;  1T43 A;  2DAM A;  2JY5 A;  1HT1 E;  3T6P A;  1C7Y A;  2G3Q A;  1UFZ A;  1VEK A;  1V92 A;  1WGL A;  3GLG E;  2DAI A;  2DI0 A;  1VDL A;  2O25 A;  1Q02 A;  3E21 A;  1GO5 A;  1WIV A;  1BVS A;  2OOB A;  4G3O A;  1OQY A;  2KNZ A;  1TR8 A;  2JY6 B;  2EKK A;  1WGN A;  2ZTD A;  3IEC A;  2RRU A;  1G41 A;  2LVN C;  1HQY E;  3FRI A;  4UN2 B;  1WJ7 A;  1F4I A;  3LCV B;  2DHY A;  2JUJ A;  1QZE A;  2L4E A;  2DKL A;  2R0I A;  2HAK A;  2K0B X;  2QNJ A;  1WR1 B;  2ZTC A;  2JP7 A;  1P3Q Q;  2LVA A;  1NV8 A;  2KNV A;  1AIP C;  2KNA A;  1YLA A;  1VQ1 A;  2LVP C;  4WP2 A;  2KHH A;  1EFU B;  5JI2 E;  1ZMW A;  1HJP A;  1IM2 A;  2LBC A;  5DFL A;  1T6O A;  2MR9 A;  1ZMU A;  1PGY A;  2JY7 A;  2HWJ A;  1OAI A;  2DZL A;  3MMP A;  4HEO A;  2DEN A;  3FRH A;  1VEJ A;  1OTR A;  3IHP A;  2CWB A;  1KYI A;  1Y8G A;  2MRO B;  2DAK A;  3BBZ A;  1ZV1 A;  2L4F A;  1WHC A;  2QHO B;  4DBG B;  1HT2 E;  3K9O A;  1XB2 B;  1G4A E;  2QSF X;  1OKS A;  1DO2 A;  3LCU A;  2K9D A;  1ZMV A;  1VG5 A;  2H5X A;  3F92 A;  2MJ5 B;  3GLF E;  2MGW A;  2OOA A;  1A5T A;  4F2L A;  1JR3 E;  2DNA A;  2JZ1 A;  2BWE A;  2JNH A;  2JY8 A;  1SG9 A;  2WZJ A;  3GLI E;  2JZ0 A;  4R71 A;  1CUK A;  1IFY A;  2LTU A;  4F1I A;  2LVO C;  2EJS A;  2LVQ D;  1VEG A;  4Q7J A;  2DAG A;  2B3T A;  1MN3 A;  2BWB A;  2EKF A;  3K9P A;  1TTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...