1DV0A

Refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN HHR23A
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1dv0A00
1NV8A 1OTRA 2JY7A 2WZJA 3GLGE 1ZMUA 3GLIE 1WJ7A 2DAIA 1VEJA 1IM2A 1ZV1A 3GLFE 1TR8A 1T43A 1WGLA 3FRHA 4F1IA 1OQYA 2L2DA 2CP8A 2R0IA 2RRUA 1VEKA 1JR3E 3IECA 1G3IA 1VDLA 2JY6B 2G3QA 1DO2A 3E46A 1UFZA 1HJPA 3FRIA 1C7YA 2K0BX 4DBGB 2MR9A 3T6PA 2ZTCA 1QZEA 1CUKA 2KHHA 2O25A 1G41A 2DKLA 2BWEA 1XXHE 1ZMVA 1Q02A 1TTEA 2DAMA 2CWBA 2L4EA 1HT1E 2H5XA 2OO9A 4WP2A 1PGYA 1XB2B 3E21A 3F92A 2LVQD 2L4FA 2QSFX 3MMPA 2EKKA 2JP7A 2DAKA 2DAGA 2DNAA 1T6OA 2K9DA 2MROB 1WR1B 1EFUB 2JNHA 3B89A 2DHYA 2LVOC 1WGNA 5JI2E 3LCUA 1V92A 1YLAA 1P3QQ 1WIVA 4UN2B 2MGWA 4Q7JA 4GEWA 2JY8A 2QHOB 1MN3A 1SG9A 3H4JA 1WHCA 3IHPA 1OAIA 1R4GA 1AIPC 2LVPC 1HQYE 1HT2E 1VG5A 1ZMWA 1VQ1A 1BVSA 3LCVB 2EJSA 2KNVA 1Y8GA 1GO5A 1IFYA 1E94E 2B3TA 1KYIA 2ZTDA 1VEGA 1A5TA 2EKFA 1G4AE 2HWJA 2LVAA 2KNZA 1F4IA 1DO0A 1NV9A 1DV0A 2DI0A 3K9OA 3K9PA 3BBZA 2DENA 2KNAA 2OOAA 4HEOA 2JY5A 2OOBA 2LVNC 2DZLA 2HAKA 2LTUA 2LBCA 1IXSA 2MJ5B 4G3OA 3FE3A 2QNJA 2DAEA 2JZ0A 5DFLA 3GLHE 2JUJA 2BWBA 2JZ1A 4R71A 4F2LA 1OKSA
chains in the Genus database with same CATH superfamily
4X65M 4GITA 2Z8YM 4PDGA 1OTRA 4GHLA 4R7GA 1D0KA 1WJ7A 3AJIB 3LQQA 3U5ZA 1IXRC 3K1JA 5F3WA 2DAIA 5FTMA 2ZAMA 1N78A 3GLFE 1ZV1A 4DV4M 1TDHA 1QAQA 3B9PA 2LXEA 2O5RA 2M60A 5H37D 3M0EA 3SATA 1LV7A 3MHVC 3ZC7B 4ITQA 2APLA 1VDLA 3T1YM 4B3SM 3T15A 5ITRA 1ORYB 3I4VA 1XHBA 3KOZE 4NXNM 3L26A 2XEPA 2KW0A 4QHTA 4IIWA 1KFVA 2F5SA 4JI6M 1HJPA 2BJWA 4A3VB 2K0BX 4G4NA 1IN7A 3NBIA 3U6CA 2Q2EB 4DBGB 1PJJA 3U60B 1CUKA 2QBYA 3HX3A 3VDUA 3W0FA 4G4OA 3SFZA 2CEAA 3AFHA 1ZMVA 3FKEA 2HKJA 2DAMA 5DNYA 2L4EA 2FNAA 3B74A 2H5XA 4FWDA 4L15A 2N35A 3GLIA 3HU1A 1XB2B 2AHMA 2CFOA 2KXEA 4DR6M 2KZSA 3TWLA 4WW0A 5E6JA 2J7OA 2L4FA 3MMPA 2EKKA 3PFIA 2UXCM 2ERCA 5FTJA 3SMSA 2KDLA 2CHGA 1C1KA 1T6OA 4FCWA 3FUXA 1IN5A 1QUTA 1WR1B 2FS1A 3EIHA 3NBXX 2DHYA 2BJVA 4QOZC 2L09A 3GLHA 2UU9M 1WGNA 2RKOA 1Z59A 1YLAA 1P3QQ 2OQ4A 2F5QA 4CISA 2MGWA 2QBYB 4GEWA 3U6PA 4IBDA 4MB7A 1I4WA 2QCUA 5EXXA 1MN3A 4D81A 4GC5A 4MM3B 4AQYM 3RGPA 4REZA 2DWNA 2UUAM 4LF8M 1SXJD 2XFTA 1AIPC 1WXQA 4JI0M 1HT2E 3THGA 4JXJA 1VG5A 2DWLA 3RE8A 1E9RA 3HHWA 4FVMA 2K47A 2ZBKB 3J27B 3LCVB 1Y8GA 1PJTA 1GO5A 3W67A 4AZFA 4CGYB 2R6FA 1KYIA 1SXJA 5IWAM 5EP4A 3GPYA 1A5TA 4BB9A 4GKKM 1N77A 2NQ8C 3JAMS 4P16A 2OPFA 2HWJA 3JR5A 3J81S 2LHCA 2EO2A 3U5ZB 2LVAA 4OVZB 4Z8XA 4B3MM 1DGHB 4AG5A 4G6ZA 5BPVA 1GJSA 1ZAEA 1GL7A 8CATA 2WSFF 4BLCA 4I4LA 1G71A 2CHQA 4MGIE 1OIPA 2DI0A 4KHPM 4NRWA 3K9PA 2RGOA 3LQRA 4JV5M 3HGIA 1JR3A 4JN6A 5FSWA 1TH4A 2OOBA 3FUUA 4IBCA 1L1TA 1HR0M 1L2BA 2KA6B 2HAKA 2LTUA 5GKNA 2XSZA 3T1HM 1KSFX 2Z4SA 3FE3A 1IY2A 1L2DA 2JZ0A 2FFJA 2F5PA 4B08A 2A5YB 1G8PA 4FCVA 1HNXM 3R9XB 4OW0A 2LNHC 4QOSA 1JQJC 4WURA 3HHYA 1NV8A 1IY1A 4FW9A 4QNRA 4NSOB 2DWZB 5IZ7D 4DV0M 2W82A 5EXPA 1T3TA 3UGJA 2JWSA 2XH9A 2C96A 3B7QA 3CF2A 4F1IA 1Z5CA 2L2DA 2CP8A 1AUAA 1JR3E 1ZQ9A 4FD2A 4KT0F 3HU3A 4I5SA 3IECA 5FTLA 3GP1A 5KPZA 2JY6B 5EP1A 4B3TM 2G3QA 1D0MA 2V1UA 1MJGM 5BR8M 3C3EA 1UFZA 3FRIA 3GLHB 2X8AA 5FLXS 2YQZA 4DV6M 1D0LA 2XZFA 2DVWB 1QZEA 3FUWA 1J5EM 2J5YA 2F4VM 4W5WA 2JXNA 2DKLA 2VQEM 2CRUA 3HJ8A 5ITXA 1TTEA 1OAOC 1PM5A 1L8QA 1HT1E 1R6BX 2KZUA 3E4RA 3KS8A 4LGYA 1QAMA 1DGGA 1QZMA 1SXJB 2V1CA 3UJNA 4NRVA 3UMMA 4DR7M 4DR4M 3TQSA 3E21A 2C5RA 3TWMA 1QDRA 3SAUA 4LJ4A 3J2PB 4LG2A 3U6QA 2XZUA 4LFCM 4PT5A 1QVRA 3FYDA 3M7GA 1VDDA 2DAKA 1IN6A 3L2AA 4L4UA 4YY3M 3FTEA 4B7HA 2K9DA 3K8ZA 1DGHA 2L7IA 2MROB 3GQ3A 2JNHA 3UZUA 4LF5M 3KVWA 5EXSA 1IQPA 4LGMA 2G5GX 2G8LA 1V34A 2Y0QA 4CJ6A 5JI2E 1V92A 4AKIA 1WIVA 4UN2B 4B3RM 4IBJA 5KO3A 2FH0A 2QHOB 3V76A 3TPZA 1IXZA 1IBMM 3BXWA 3HY5A 3J80S 3ZH9B 4GRIA 4JI3M 1R5LA 3K92A 2XSZD 4DUZM 3L27A 3U60A 4AW4A 2EJSA 1YSYA 1Q3BA 2QQ8A 4OVZA 1NO1A 1Z5AA 2C98A 2L6OA 4LFBM 4AI6A 2ZTDA 4M9SA 1W5SA 1VEGA 5DYGA 1H6UA 3RGSA 4BBAA 1GLNA 1W5TA 3FYCA 3B7ZA 4MGZE 4LJ8A 4DV3M 5DYIA 4PDIA 4AG6A 2KNZA 5LMUM 3GPPA 3AOEC 2CV1A 2Z3XA 5KQDA 3HHZA 1OJLA 5ITYA 4LF9M 3GQ5A 1DGBA 3HZJA 5ITTA 2D7EA 2VF8A 4GH9A 2EUCA 4IBBA 1XC8A 2DENA 2R44A 3SMPA 3FUVA 3FD9A 1MX0A 3Q8XA 3AL0C 2JY5A 1PJQA 3U6EA 3VKHA 2LVNC 2QP9X 4DV7M 2P5TA 3MK6A 3FTCA 4L78A 2Y20A 1IXSA 3TL4X 1EE8A 4G3OA 4X64M 3DOAA 1NNJA 2F5NA 2UUCM 3KW6A 5DFLA 1J7KA 3MJ5A 2BWBA 2JZ1A 4ANRA 1D2NA 4F2LA 3I4YA 4IJFA 3SAWA 4LF7M 4B7GA 4JI7M 4DV1M 4K0KM 3QWLA 4NSRA 5JI3E 1R2ZA 2M5ZA 5IREB 1FNNA 1TR8A 2I7NA 3HJSA 1WGLA 1OFIA 4X66M 1OQYA 2RRUA 2R0IA 5EXTA 2R62A 2C9CA 4NC6A 2C9OA 4Z6YA 3GLGB 2VQFM 1PJSA 4RNAA 4QNMA 3AOGA 5IT9S 1SXJE 1TF0B 1L1ZA 1C7YA 1NNUC 1TH2A 2X4AA 2XGNA 2MR9A 3LMMA 3T6PA 4GKJM 2QZ4A 4LJ5A 2ZTCA 2O25A 2KHHA 1PRBA 1NSFA 3KS4A 2CV2A 2FOIC 1R7RA 4JI8M 1J09A 1GKIA 3KOYE 1N34M 3WHKA 1JR3D 1Q02A 4R71A 3IG8A 4RF0A 4G4QA 1JB0F 3GRVA 2FE8A 4DR5M 2DWMA 1Q39A 2OO9A 3KSJA 1HNWM 3J7BA 4FCTA 4GC9A 4MH0E 2KRUA 1XMOM 1V33A 3FUTA 4NOOB 4YHHM 4DV5M 3DZDA 1N36M 2XF3A 3F92A 1K3WA 2LVQD 2Y21A 1HNZM 4JYAM 1NY6A 2DAGA 1QDTA 2Z7JA 1Z5BA 1DGFA 5C1BA 1YUBA 2R18A 1EFUB 5LMNM 2LWXA 3B89A 4GMQA 4LJ9A 3U6MA 2LVOC 1E32A 3UK6A 3VFDA 4L6V6 1OIZA 2QENA 7CATA 3AKZA 4LZZA 3LVWA 4RKUF 3AV0A 2DZNB 3SYKA 4II7A 1SG9A 3VLFB 3H4JA 5KPRA 2HHHM 1R4GA 3QAUA 2KEBA 4FWHA 2LVPC 1NY5A 3HU2A 1R2YA 2HCBA 1ZMWA 3ILKA 1VQ1A 3CTWB 1BVSA 5ITQA 2GQFA 3VDPA 3SHFA 3PNYA 3EIEA 1IN8A 4GHAA 2YR0A 4KODA 2YFQA 3KDSE 2E5LM 2CE7A 3PXGA 4D80A 1QAOA 2EKFA 3A42A 4LY6A 4DV2M 1G4AE 3GRUA 3LW5F 3HJQA 4PCZA 3SHGB 2V6ZM 4JI1M 3ZCBB 2JA2A 4X62M 3QYEA 3GRYA 2H1RA 1N75A 3U61A 3SASA 2UXBM 3GLFA 4HLQA 1DV0A 2Z4RA 4KLNA 3K9OA 3BBZA 5EJCA 3U6SA 3L28A 3GLFB 3L25A 1IXSB 2OOAA 3I01M 3HHXA 3U6DA 3U6OA 1TH3A 4CHTB 4LRSA 3JR4A 4M9XA 3KP0E 3NWLA 3KFUG 1N33M 1GABA 2CHVA 2CUZA 1K82A 2DXIA 1MU5A 1QUSA 1NJGA 1IN4A 2LBCA 4LRTA 1GVNA 4M0WA 2DHRA 3GLGA 4Y28F 2QNJA 2DAEA 4LF6M 2JUJA 4DR3M 1E9SA 1Q3CA 5KPTA 2ZANA 4M0DA 5ITUA 3H4MA 2JY7A 2J7NA 2WZJA 3GLGE 1SXJC 1ZMUA 5EQTA 3HKPA 3GLIE 2I7PA 3U6LA 3RFWA 2EA0A 3M6AA 1VEJA 4MGKE 1IM2A 1GL6A 4MGHA 1T43A 3SC3A 1LTMA 3FRHA 4D82A 4IBIA 2KRKA 3CF6E 1YE9A 2XLJA 2WSEF 1VEKA 1QANA 2QPAA 4LFAM 4CIZA 3SARA 1G3IA 2D7GA 3LVVA 1N32M 1DO2A 3E46A 5ITXE 5EP3A 4P17A 3A98B 2D7HA 4S12A 3SAVA 1IBLM 3FTFA 1QYRA 2C99A 2R65A 4IJEA 4LJAA 4LJ7A 3T38A 1G41A 3R8FA 3W68A 4L8RC 1PJIA 1S3SA 2BWEA 3SBJA 1XXHE 3AOEA 4XK8F 4AKHA 2CWBA 5KQ8A 5L8RF 3VK8A 3GPXA 3I51A 3IG5A 4WP2A 3W0LB 1PGYA 1EIJA 4IBKA 1G59A 3HWSA 2Y0TA 3CGWA 1RU3A 4B7FA 2MH8A 4I81A 4PD2A 2QSFX 3OTOM 2LH0A 3SYLA 4FWGA 2YNMD 3PNVA 1NHWC 2JP7A 2XFSA 3CF0A 2VDBB 3D8LA 1L2CA 2DNAA 1NVMA 3DFZA 3A46A 4GIPA 3KOWE 2F5OA 1NJFA 4KO8A 3PVSA 3TE6A 2ZM6M 4LF4M 3B7NA 3D8BA 3E9SA 4I8OA 2R4JA 4ZPXA 2GNOA 5FTNA 1GJTA 3LCUA 5EP2A 3VK7A 4XGIA 3GO8A 2LHGA 4Q7JA 2CV0A 4LCBA 2JY8A 2UXDM 4RF1A 3GPUA 3KP1E 3GRRA 3Q8GA 4QHSA 3VKGA 3IHPA 1WHCA 3KOXE 1XXHA 1OAIA 4LJ6A 3WHLA 4AKGA 5A2QS 1OFHA 1HQYE 2R46A 3J7AS 3KXEC 4NXMM 3U61B 3BOSA 4L16A 3L29A 1X37A 2L7HA 4R3DA 1TGUA 2KNVA 4G4RA 1IY0A 1IFYA 1XMQM 1E94E 2B3TA 1FJGM 1I94M 3GLIB 3DA1A 2RGHA 4DUYM 1XNRM 3I04M 2DZOB 4JI4M 1K3XA 1Z6TA 4LZJA 2WSCF 3FTDA 4M9ZA 1IBKM 3A45A 1NHGC 2X49A 4HL4A 1F4IA 1DO0A 1NV9A 4MGYE 4TUWA 4EIWA 3C3DA 1UM8A 3KSXA 4IBFA 4NL4H 5E26A 4OU7A 2O01F 2KNAA 3C58A 4JI2M 4OX9M 2ZAOA 1TDZA 4HEOA 1XWIA 1XXHB 5C18A 2HL7A 2BNKA 2VF7A 2K6BA 3K2LA 3GQ4A 2DZLA 3TWKA 4XBOA 4IBEA 1HQCA 2R45A 3C9PA 4DR1M 2R4EA 3QYBA 1XNQM 4JI5M 4DR2M 2MJ5B 2VIIA 1QQWA 2UUBM 3GLHE 5FTKA 4IBGA 3ZQJA 1OKSA
chains in the Genus database with same CATH topology
1NV8A 1OTRA 2JY7A 2WZJA 3GLGE 1ZMUA 3GLIE 1WJ7A 2DAIA 1VEJA 1IM2A 1ZV1A 3GLFE 1TR8A 1T43A 1WGLA 3FRHA 4F1IA 1OQYA 2L2DA 2CP8A 2R0IA 2RRUA 1VEKA 1JR3E 3IECA 1G3IA 1VDLA 2JY6B 2G3QA 1DO2A 3E46A 1UFZA 1HJPA 3FRIA 1C7YA 2K0BX 4DBGB 2MR9A 3T6PA 2ZTCA 1QZEA 1CUKA 2KHHA 2O25A 1G41A 2DKLA 2BWEA 1XXHE 1ZMVA 1Q02A 1TTEA 2DAMA 2CWBA 2L4EA 1HT1E 2H5XA 2OO9A 4WP2A 1PGYA 1XB2B 3E21A 3F92A 2LVQD 2L4FA 2QSFX 3MMPA 2EKKA 2JP7A 2DAKA 2DAGA 2DNAA 1T6OA 2K9DA 2MROB 1WR1B 1EFUB 2JNHA 3B89A 2DHYA 2LVOC 1WGNA 5JI2E 3LCUA 1V92A 1YLAA 1P3QQ 1WIVA 4UN2B 2MGWA 4Q7JA 4GEWA 2JY8A 2QHOB 1MN3A 1SG9A 3H4JA 1WHCA 3IHPA 1OAIA 1R4GA 1AIPC 2LVPC 1HQYE 1HT2E 1VG5A 1ZMWA 1VQ1A 1BVSA 3LCVB 2EJSA 2KNVA 1Y8GA 1GO5A 1IFYA 1E94E 2B3TA 1KYIA 2ZTDA 1VEGA 1A5TA 2EKFA 1G4AE 2HWJA 2LVAA 2KNZA 1F4IA 1DO0A 1NV9A 1DV0A 2DI0A 3K9OA 3K9PA 3BBZA 2DENA 2KNAA 2OOAA 4HEOA 2JY5A 2OOBA 2LVNC 2DZLA 2HAKA 2LTUA 2LBCA 1IXSA 2MJ5B 4G3OA 3FE3A 2QNJA 2DAEA 2JZ0A 5DFLA 3GLHE 2JUJA 2BWBA 2JZ1A 4R71A 4F2LA 1OKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV8 A;  1OTR A;  2JY7 A;  2WZJ A;  3GLG E;  1ZMU A;  3GLI E;  1WJ7 A;  2DAI A;  1VEJ A;  1IM2 A;  1ZV1 A;  3GLF E;  1TR8 A;  1T43 A;  1WGL A;  3FRH A;  4F1I A;  1OQY A;  2L2D A;  2CP8 A;  2R0I A;  2RRU A;  1VEK A;  1JR3 E;  3IEC A;  1G3I A;  1VDL A;  2JY6 B;  2G3Q A;  1DO2 A;  3E46 A;  1UFZ A;  1HJP A;  3FRI A;  1C7Y A;  2K0B X;  4DBG B;  2MR9 A;  3T6P A;  2ZTC A;  1QZE A;  1CUK A;  2KHH A;  2O25 A;  1G41 A;  2DKL A;  2BWE A;  1XXH E;  1ZMV A;  1Q02 A;  1TTE A;  2DAM A;  2CWB A;  2L4E A;  1HT1 E;  2H5X A;  2OO9 A;  4WP2 A;  1PGY A;  1XB2 B;  3E21 A;  3F92 A;  2LVQ D;  2L4F A;  2QSF X;  3MMP A;  2EKK A;  2JP7 A;  2DAK A;  2DAG A;  2DNA A;  1T6O A;  2K9D A;  2MRO B;  1WR1 B;  1EFU B;  2JNH A;  3B89 A;  2DHY A;  2LVO C;  1WGN A;  5JI2 E;  3LCU A;  1V92 A;  1YLA A;  1P3Q Q;  1WIV A;  4UN2 B;  2MGW A;  4Q7J A;  4GEW A;  2JY8 A;  2QHO B;  1MN3 A;  1SG9 A;  3H4J A;  1WHC A;  3IHP A;  1OAI A;  1R4G A;  1AIP C;  2LVP C;  1HQY E;  1HT2 E;  1VG5 A;  1ZMW A;  1VQ1 A;  1BVS A;  3LCV B;  2EJS A;  2KNV A;  1Y8G A;  1GO5 A;  1IFY A;  1E94 E;  2B3T A;  1KYI A;  2ZTD A;  1VEG A;  1A5T A;  2EKF A;  1G4A E;  2HWJ A;  2LVA A;  2KNZ A;  1F4I A;  1DO0 A;  1NV9 A;  1DV0 A;  2DI0 A;  3K9O A;  3K9P A;  3BBZ A;  2DEN A;  2KNA A;  2OOA A;  4HEO A;  2JY5 A;  2OOB A;  2LVN C;  2DZL A;  2HAK A;  2LTU A;  2LBC A;  1IXS A;  2MJ5 B;  4G3O A;  3FE3 A;  2QNJ A;  2DAE A;  2JZ0 A;  5DFL A;  3GLH E;  2JUJ A;  2BWB A;  2JZ1 A;  4R71 A;  4F2L A;  1OKS A; 
#chains in the Genus database with same CATH topology
 4X65 M;  4GIT A;  2Z8Y M;  4PDG A;  1OTR A;  4GHL A;  4R7G A;  1D0K A;  1WJ7 A;  3AJI B;  3LQQ A;  3U5Z A;  1IXR C;  3K1J A;  5F3W A;  2DAI A;  5FTM A;  2ZAM A;  1N78 A;  3GLF E;  1ZV1 A;  4DV4 M;  1TDH A;  1QAQ A;  3B9P A;  2LXE A;  2O5R A;  2M60 A;  5H37 D;  3M0E A;  3SAT A;  1LV7 A;  3MHV C;  3ZC7 B;  4ITQ A;  2APL A;  1VDL A;  3T1Y M;  4B3S M;  3T15 A;  5ITR A;  1ORY B;  3I4V A;  1XHB A;  3KOZ E;  4NXN M;  3L26 A;  2XEP A;  2KW0 A;  4QHT A;  4IIW A;  1KFV A;  2F5S A;  4JI6 M;  1HJP A;  2BJW A;  4A3V B;  2K0B X;  4G4N A;  1IN7 A;  3NBI A;  3U6C A;  2Q2E B;  4DBG B;  1PJJ A;  3U60 B;  1CUK A;  2QBY A;  3HX3 A;  3VDU A;  3W0F A;  4G4O A;  3SFZ A;  2CEA A;  3AFH A;  1ZMV A;  3FKE A;  2HKJ A;  2DAM A;  5DNY A;  2L4E A;  2FNA A;  3B74 A;  2H5X A;  4FWD A;  4L15 A;  2N35 A;  3GLI A;  3HU1 A;  1XB2 B;  2AHM A;  2CFO A;  2KXE A;  4DR6 M;  2KZS A;  3TWL A;  4WW0 A;  5E6J A;  2J7O A;  2L4F A;  3MMP A;  2EKK A;  3PFI A;  2UXC M;  2ERC A;  5FTJ A;  3SMS A;  2KDL A;  2CHG A;  1C1K A;  1T6O A;  4FCW A;  3FUX A;  1IN5 A;  1QUT A;  1WR1 B;  2FS1 A;  3EIH A;  3NBX X;  2DHY A;  2BJV A;  4QOZ C;  2L09 A;  3GLH A;  2UU9 M;  1WGN A;  2RKO A;  1Z59 A;  1YLA A;  1P3Q Q;  2OQ4 A;  2F5Q A;  4CIS A;  2MGW A;  2QBY B;  4GEW A;  3U6P A;  4IBD A;  4MB7 A;  1I4W A;  2QCU A;  5EXX A;  1MN3 A;  4D81 A;  4GC5 A;  4MM3 B;  4AQY M;  3RGP A;  4REZ A;  2DWN A;  2UUA M;  4LF8 M;  1SXJ D;  2XFT A;  1AIP C;  1WXQ A;  4JI0 M;  1HT2 E;  3THG A;  4JXJ A;  1VG5 A;  2DWL A;  3RE8 A;  1E9R A;  3HHW A;  4FVM A;  2K47 A;  2ZBK B;  3J27 B;  3LCV B;  1Y8G A;  1PJT A;  1GO5 A;  3W67 A;  4AZF A;  4CGY B;  2R6F A;  1KYI A;  1SXJ A;  5IWA M;  5EP4 A;  3GPY A;  1A5T A;  4BB9 A;  4GKK M;  1N77 A;  2NQ8 C;  3JAM S;  4P16 A;  2OPF A;  2HWJ A;  3JR5 A;  3J81 S;  2LHC A;  2EO2 A;  3U5Z B;  2LVA A;  4OVZ B;  4Z8X A;  4B3M M;  1DGH B;  4AG5 A;  4G6Z A;  5BPV A;  1GJS A;  1ZAE A;  1GL7 A;  8CAT A;  2WSF F;  4BLC A;  4I4L A;  1G71 A;  2CHQ A;  4MGI E;  1OIP A;  2DI0 A;  4KHP M;  4NRW A;  3K9P A;  2RGO A;  3LQR A;  4JV5 M;  3HGI A;  1JR3 A;  4JN6 A;  5FSW A;  1TH4 A;  2OOB A;  3FUU A;  4IBC A;  1L1T A;  1HR0 M;  1L2B A;  2KA6 B;  2HAK A;  2LTU A;  5GKN A;  2XSZ A;  3T1H M;  1KSF X;  2Z4S A;  3FE3 A;  1IY2 A;  1L2D A;  2JZ0 A;  2FFJ A;  2F5P A;  4B08 A;  2A5Y B;  1G8P A;  4FCV A;  1HNX M;  3R9X B;  4OW0 A;  2LNH C;  4QOS A;  1JQJ C;  4WUR A;  3HHY A;  1NV8 A;  1IY1 A;  4FW9 A;  4QNR A;  4NSO B;  2DWZ B;  5IZ7 D;  4DV0 M;  2W82 A;  5EXP A;  1T3T A;  3UGJ A;  2JWS A;  2XH9 A;  2C96 A;  3B7Q A;  3CF2 A;  4F1I A;  1Z5C A;  2L2D A;  2CP8 A;  1AUA A;  1JR3 E;  1ZQ9 A;  4FD2 A;  4KT0 F;  3HU3 A;  4I5S A;  3IEC A;  5FTL A;  3GP1 A;  5KPZ A;  2JY6 B;  5EP1 A;  4B3T M;  2G3Q A;  1D0M A;  2V1U A;  1MJG M;  5BR8 M;  3C3E A;  1UFZ A;  3FRI A;  3GLH B;  2X8A A;  5FLX S;  2YQZ A;  4DV6 M;  1D0L A;  2XZF A;  2DVW B;  1QZE A;  3FUW A;  1J5E M;  2J5Y A;  2F4V M;  4W5W A;  2JXN A;  2DKL A;  2VQE M;  2CRU A;  3HJ8 A;  5ITX A;  1TTE A;  1OAO C;  1PM5 A;  1L8Q A;  1HT1 E;  1R6B X;  2KZU A;  3E4R A;  3KS8 A;  4LGY A;  1QAM A;  1DGG A;  1QZM A;  1SXJ B;  2V1C A;  3UJN A;  4NRV A;  3UMM A;  4DR7 M;  4DR4 M;  3TQS A;  3E21 A;  2C5R A;  3TWM A;  1QDR A;  3SAU A;  4LJ4 A;  3J2P B;  4LG2 A;  3U6Q A;  2XZU A;  4LFC M;  4PT5 A;  1QVR A;  3FYD A;  3M7G A;  1VDD A;  2DAK A;  1IN6 A;  3L2A A;  4L4U A;  4YY3 M;  3FTE A;  4B7H A;  2K9D A;  3K8Z A;  1DGH A;  2L7I A;  2MRO B;  3GQ3 A;  2JNH A;  3UZU A;  4LF5 M;  3KVW A;  5EXS A;  1IQP A;  4LGM A;  2G5G X;  2G8L A;  1V34 A;  2Y0Q A;  4CJ6 A;  5JI2 E;  1V92 A;  4AKI A;  1WIV A;  4UN2 B;  4B3R M;  4IBJ A;  5KO3 A;  2FH0 A;  2QHO B;  3V76 A;  3TPZ A;  1IXZ A;  1IBM M;  3BXW A;  3HY5 A;  3J80 S;  3ZH9 B;  4GRI A;  4JI3 M;  1R5L A;  3K92 A;  2XSZ D;  4DUZ M;  3L27 A;  3U60 A;  4AW4 A;  2EJS A;  1YSY A;  1Q3B A;  2QQ8 A;  4OVZ A;  1NO1 A;  1Z5A A;  2C98 A;  2L6O A;  4LFB M;  4AI6 A;  2ZTD A;  4M9S A;  1W5S A;  1VEG A;  5DYG A;  1H6U A;  3RGS A;  4BBA A;  1GLN A;  1W5T A;  3FYC A;  3B7Z A;  4MGZ E;  4LJ8 A;  4DV3 M;  5DYI A;  4PDI A;  4AG6 A;  2KNZ A;  5LMU M;  3GPP A;  3AOE C;  2CV1 A;  2Z3X A;  5KQD A;  3HHZ A;  1OJL A;  5ITY A;  4LF9 M;  3GQ5 A;  1DGB A;  3HZJ A;  5ITT A;  2D7E A;  2VF8 A;  4GH9 A;  2EUC A;  4IBB A;  1XC8 A;  2DEN A;  2R44 A;  3SMP A;  3FUV A;  3FD9 A;  1MX0 A;  3Q8X A;  3AL0 C;  2JY5 A;  1PJQ A;  3U6E A;  3VKH A;  2LVN C;  2QP9 X;  4DV7 M;  2P5T A;  3MK6 A;  3FTC A;  4L78 A;  2Y20 A;  1IXS A;  3TL4 X;  1EE8 A;  4G3O A;  4X64 M;  3DOA A;  1NNJ A;  2F5N A;  2UUC M;  3KW6 A;  5DFL A;  1J7K A;  3MJ5 A;  2BWB A;  2JZ1 A;  4ANR A;  1D2N A;  4F2L A;  3I4Y A;  4IJF A;  3SAW A;  4LF7 M;  4B7G A;  4JI7 M;  4DV1 M;  4K0K M;  3QWL A;  4NSR A;  5JI3 E;  1R2Z A;  2M5Z A;  5IRE B;  1FNN A;  1TR8 A;  2I7N A;  3HJS A;  1WGL A;  1OFI A;  4X66 M;  1OQY A;  2RRU A;  2R0I A;  5EXT A;  2R62 A;  2C9C A;  4NC6 A;  2C9O A;  4Z6Y A;  3GLG B;  2VQF M;  1PJS A;  4RNA A;  4QNM A;  3AOG A;  5IT9 S;  1SXJ E;  1TF0 B;  1L1Z A;  1C7Y A;  1NNU C;  1TH2 A;  2X4A A;  2XGN A;  2MR9 A;  3LMM A;  3T6P A;  4GKJ M;  2QZ4 A;  4LJ5 A;  2ZTC A;  2O25 A;  2KHH A;  1PRB A;  1NSF A;  3KS4 A;  2CV2 A;  2FOI C;  1R7R A;  4JI8 M;  1J09 A;  1GKI A;  3KOY E;  1N34 M;  3WHK A;  1JR3 D;  1Q02 A;  4R71 A;  3IG8 A;  4RF0 A;  4G4Q A;  1JB0 F;  3GRV A;  2FE8 A;  4DR5 M;  2DWM A;  1Q39 A;  2OO9 A;  3KSJ A;  1HNW M;  3J7B A;  4FCT A;  4GC9 A;  4MH0 E;  2KRU A;  1XMO M;  1V33 A;  3FUT A;  4NOO B;  4YHH M;  4DV5 M;  3DZD A;  1N36 M;  2XF3 A;  3F92 A;  1K3W A;  2LVQ D;  2Y21 A;  1HNZ M;  4JYA M;  1NY6 A;  2DAG A;  1QDT A;  2Z7J A;  1Z5B A;  1DGF A;  5C1B A;  1YUB A;  2R18 A;  1EFU B;  5LMN M;  2LWX A;  3B89 A;  4GMQ A;  4LJ9 A;  3U6M A;  2LVO C;  1E32 A;  3UK6 A;  3VFD A;  4L6V 6;  1OIZ A;  2QEN A;  7CAT A;  3AKZ A;  4LZZ A;  3LVW A;  4RKU F;  3AV0 A;  2DZN B;  3SYK A;  4II7 A;  1SG9 A;  3VLF B;  3H4J A;  5KPR A;  2HHH M;  1R4G A;  3QAU A;  2KEB A;  4FWH A;  2LVP C;  1NY5 A;  3HU2 A;  1R2Y A;  2HCB A;  1ZMW A;  3ILK A;  1VQ1 A;  3CTW B;  1BVS A;  5ITQ A;  2GQF A;  3VDP A;  3SHF A;  3PNY A;  3EIE A;  1IN8 A;  4GHA A;  2YR0 A;  4KOD A;  2YFQ A;  3KDS E;  2E5L M;  2CE7 A;  3PXG A;  4D80 A;  1QAO A;  2EKF A;  3A42 A;  4LY6 A;  4DV2 M;  1G4A E;  3GRU A;  3LW5 F;  3HJQ A;  4PCZ A;  3SHG B;  2V6Z M;  4JI1 M;  3ZCB B;  2JA2 A;  4X62 M;  3QYE A;  3GRY A;  2H1R A;  1N75 A;  3U61 A;  3SAS A;  2UXB M;  3GLF A;  4HLQ A;  1DV0 A;  2Z4R A;  4KLN A;  3K9O A;  3BBZ A;  5EJC A;  3U6S A;  3L28 A;  3GLF B;  3L25 A;  1IXS B;  2OOA A;  3I01 M;  3HHX A;  3U6D A;  3U6O A;  1TH3 A;  4CHT B;  4LRS A;  3JR4 A;  4M9X A;  3KP0 E;  3NWL A;  3KFU G;  1N33 M;  1GAB A;  2CHV A;  2CUZ A;  1K82 A;  2DXI A;  1MU5 A;  1QUS A;  1NJG A;  1IN4 A;  2LBC A;  4LRT A;  1GVN A;  4M0W A;  2DHR A;  3GLG A;  4Y28 F;  2QNJ A;  2DAE A;  4LF6 M;  2JUJ A;  4DR3 M;  1E9S A;  1Q3C A;  5KPT A;  2ZAN A;  4M0D A;  5ITU A;  3H4M A;  2JY7 A;  2J7N A;  2WZJ A;  3GLG E;  1SXJ C;  1ZMU A;  5EQT A;  3HKP A;  3GLI E;  2I7P A;  3U6L A;  3RFW A;  2EA0 A;  3M6A A;  1VEJ A;  4MGK E;  1IM2 A;  1GL6 A;  4MGH A;  1T43 A;  3SC3 A;  1LTM A;  3FRH A;  4D82 A;  4IBI A;  2KRK A;  3CF6 E;  1YE9 A;  2XLJ A;  2WSE F;  1VEK A;  1QAN A;  2QPA A;  4LFA M;  4CIZ A;  3SAR A;  1G3I A;  2D7G A;  3LVV A;  1N32 M;  1DO2 A;  3E46 A;  5ITX E;  5EP3 A;  4P17 A;  3A98 B;  2D7H A;  4S12 A;  3SAV A;  1IBL M;  3FTF A;  1QYR A;  2C99 A;  2R65 A;  4IJE A;  4LJA A;  4LJ7 A;  3T38 A;  1G41 A;  3R8F A;  3W68 A;  4L8R C;  1PJI A;  1S3S A;  2BWE A;  3SBJ A;  1XXH E;  3AOE A;  4XK8 F;  4AKH A;  2CWB A;  5KQ8 A;  5L8R F;  3VK8 A;  3GPX A;  3I51 A;  3IG5 A;  4WP2 A;  3W0L B;  1PGY A;  1EIJ A;  4IBK A;  1G59 A;  3HWS A;  2Y0T A;  3CGW A;  1RU3 A;  4B7F A;  2MH8 A;  4I81 A;  4PD2 A;  2QSF X;  3OTO M;  2LH0 A;  3SYL A;  4FWG A;  2YNM D;  3PNV A;  1NHW C;  2JP7 A;  2XFS A;  3CF0 A;  2VDB B;  3D8L A;  1L2C A;  2DNA A;  1NVM A;  3DFZ A;  3A46 A;  4GIP A;  3KOW E;  2F5O A;  1NJF A;  4KO8 A;  3PVS A;  3TE6 A;  2ZM6 M;  4LF4 M;  3B7N A;  3D8B A;  3E9S A;  4I8O A;  2R4J A;  4ZPX A;  2GNO A;  5FTN A;  1GJT A;  3LCU A;  5EP2 A;  3VK7 A;  4XGI A;  3GO8 A;  2LHG A;  4Q7J A;  2CV0 A;  4LCB A;  2JY8 A;  2UXD M;  4RF1 A;  3GPU A;  3KP1 E;  3GRR A;  3Q8G A;  4QHS A;  3VKG A;  3IHP A;  1WHC A;  3KOX E;  1XXH A;  1OAI A;  4LJ6 A;  3WHL A;  4AKG A;  5A2Q S;  1OFH A;  1HQY E;  2R46 A;  3J7A S;  3KXE C;  4NXM M;  3U61 B;  3BOS A;  4L16 A;  3L29 A;  1X37 A;  2L7H A;  4R3D A;  1TGU A;  2KNV A;  4G4R A;  1IY0 A;  1IFY A;  1XMQ M;  1E94 E;  2B3T A;  1FJG M;  1I94 M;  3GLI B;  3DA1 A;  2RGH A;  4DUY M;  1XNR M;  3I04 M;  2DZO B;  4JI4 M;  1K3X A;  1Z6T A;  4LZJ A;  2WSC F;  3FTD A;  4M9Z A;  1IBK M;  3A45 A;  1NHG C;  2X49 A;  4HL4 A;  1F4I A;  1DO0 A;  1NV9 A;  4MGY E;  4TUW A;  4EIW A;  3C3D A;  1UM8 A;  3KSX A;  4IBF A;  4NL4 H;  5E26 A;  4OU7 A;  2O01 F;  2KNA A;  3C58 A;  4JI2 M;  4OX9 M;  2ZAO A;  1TDZ A;  4HEO A;  1XWI A;  1XXH B;  5C18 A;  2HL7 A;  2BNK A;  2VF7 A;  2K6B A;  3K2L A;  3GQ4 A;  2DZL A;  3TWK A;  4XBO A;  4IBE A;  1HQC A;  2R45 A;  3C9P A;  4DR1 M;  2R4E A;  3QYB A;  1XNQ M;  4JI5 M;  4DR2 M;  2MJ5 B;  2VII A;  1QQW A;  2UUB M;  3GLH E;  5FTK A;  4IBG A;  3ZQJ A;  1OKS A; 
#chains in the Genus database with same CATH homology
 1NV8 A;  1OTR A;  2JY7 A;  2WZJ A;  3GLG E;  1ZMU A;  3GLI E;  1WJ7 A;  2DAI A;  1VEJ A;  1IM2 A;  1ZV1 A;  3GLF E;  1TR8 A;  1T43 A;  1WGL A;  3FRH A;  4F1I A;  1OQY A;  2L2D A;  2CP8 A;  2R0I A;  2RRU A;  1VEK A;  1JR3 E;  3IEC A;  1G3I A;  1VDL A;  2JY6 B;  2G3Q A;  1DO2 A;  3E46 A;  1UFZ A;  1HJP A;  3FRI A;  1C7Y A;  2K0B X;  4DBG B;  2MR9 A;  3T6P A;  2ZTC A;  1QZE A;  1CUK A;  2KHH A;  2O25 A;  1G41 A;  2DKL A;  2BWE A;  1XXH E;  1ZMV A;  1Q02 A;  1TTE A;  2DAM A;  2CWB A;  2L4E A;  1HT1 E;  2H5X A;  2OO9 A;  4WP2 A;  1PGY A;  1XB2 B;  3E21 A;  3F92 A;  2LVQ D;  2L4F A;  2QSF X;  3MMP A;  2EKK A;  2JP7 A;  2DAK A;  2DAG A;  2DNA A;  1T6O A;  2K9D A;  2MRO B;  1WR1 B;  1EFU B;  2JNH A;  3B89 A;  2DHY A;  2LVO C;  1WGN A;  5JI2 E;  3LCU A;  1V92 A;  1YLA A;  1P3Q Q;  1WIV A;  4UN2 B;  2MGW A;  4Q7J A;  4GEW A;  2JY8 A;  2QHO B;  1MN3 A;  1SG9 A;  3H4J A;  1WHC A;  3IHP A;  1OAI A;  1R4G A;  1AIP C;  2LVP C;  1HQY E;  1HT2 E;  1VG5 A;  1ZMW A;  1VQ1 A;  1BVS A;  3LCV B;  2EJS A;  2KNV A;  1Y8G A;  1GO5 A;  1IFY A;  1E94 E;  2B3T A;  1KYI A;  2ZTD A;  1VEG A;  1A5T A;  2EKF A;  1G4A E;  2HWJ A;  2LVA A;  2KNZ A;  1F4I A;  1DO0 A;  1NV9 A;  1DV0 A;  2DI0 A;  3K9O A;  3K9P A;  3BBZ A;  2DEN A;  2KNA A;  2OOA A;  4HEO A;  2JY5 A;  2OOB A;  2LVN C;  2DZL A;  2HAK A;  2LTU A;  2LBC A;  1IXS A;  2MJ5 B;  4G3O A;  3FE3 A;  2QNJ A;  2DAE A;  2JZ0 A;  5DFL A;  3GLH E;  2JUJ A;  2BWB A;  2JZ1 A;  4R71 A;  4F2L A;  1OKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...