1DWOA

Crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
b'PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Hydroxynitrile lyase
total genus 97
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwoA00
1TKRA 1MX9A 1VA4A 2DHDA 3H0CA 5IKXA 3TGLA 1XRQA 4LKOA 5BV7A 1KEZA 1X70A 5C8XA 5CXUA 3CXUA 4AO8A 1QO9A 3IUJA 1DX6A 1C4XA 5K3DA 3WL7A 2XMQA 4QZVA 2ACEA 2Z3ZA 3DOHA 2HRRA 1BS9A 4G4JA 2G5TA 4B84A 1QIDA 2B9VA 1H2XA 2PU5A 5JANA 2OQIA 3PFBA 1N5MA 4E14A 1YS2X 3I2HA 4H7DA 1H2YA 3BIXA 3R41A 5ALPA 2QS9A 1E8NA 1BN7A 3BF7A 2QM0A 1PJAA 3IB3A 4XVCA 4UBIA 3IULA 3WIBA 2VT6A 1XFDA 5DYYA 3DCNA 3E3AA 3PICA 1IVYA 4GLBA 5CRIA 3BF8A 2WFLB 1ACJA 2XMRA 1VE7A 1L7RA 3ESAA 1T4MA 3PUIA 2HA6A 1CUUA 1CUZA 5EI5A 1WCYA 4LXIA 4ZGBA 1UKCA 2QJWA 1IMJA 1TCAA 3W06A 1EDDA 4OB7A 3JYHA 4W1QA 2RHTA 2WKWA 4Y7DA 4Y2PA 1R9MA 4BVLA 2ONCA 4UFPA 4RE5A 1YA4A 4DGQA 5AI0A 1N8SA 3BDIA 3DJYA 1PFQA 1W52X 3M81A 3B3QA 4KEAA 5DTJA 1EXWA 5A7FA 3OM8A 4XIIA 2XQFA 4HXGA 5FOQA 5ALGA 4QDXA 2JGIA 2HU5A 3C8DA 3A6ZA 3SC2A 3I1IA 5HK8A 2QRUA 2XUHA 4BE9A 2X5XA 2H1IA 2O2HA 4L72A 1CV2A 5ALUA 1GPKA 4Y2RA 3R0VA 4WY5A 5ALKA 3QITA 2PVSA 4K5QA 3WWCA 3R3XA 2WJ6A 1R3DA 1BE0A 5AM4A 4KACA 3G0CA 3G9UA 2B61A 4L0CA 1LPOA 5K3FA 5FV4A 5JAPA 4Q05A 1CUVA 5A2GA 1E89A 3SK0A 5LP1A 2H7YA 5LLSA 2WG2A 3M3DA 1CIJA 3FCXA 2AJBA 4QNNA 3L1JA 1TAHA 3D0KA 1IZ7A 1TCBA 2XUPA 4Y2JA 5A7GA 3WL6A 1FFBA 2ZYHA 5DNWA 4CI9A 4EY7A 3A2NA 2OPHA 2O2IA 2XMCA 2HA0A 3ANTA 4Q3KA 4TVKA 2XUIA 3WYNA 1IUOA 2ECFA 5D7BA 1R88A 3H1BA 3HABA 2H7CA 3VJLA 1T2NA 4DLNA 5K3CA 3ED1A 4BP9A 5EHZA 2J4FA 5ALSA 1AGYA 4QDZA 5AJHA 3R3UA 1UK7A 4BC0A 2WHQA 5D3KA 1H22A 2ORYA 4C4XA 4J0GA 2QXTA 4Q3LA 3WMRA 1TIBA 2C5FA 1EX9A 2JIDA 3F97A 5AKYA 1LZKA 3FLBA 4BCDA 5JARA 2RONA 6YASA 3UMJA 4PF1A 2WM2A 5FLKA 3FVRA 4U2FA 4KAJA 2JGFA 3DS8A 4KRYA 2VATA 2IX9A 3OTQA 1Y7HA 3UUFA 5AI5A 5JIBA 3HLKA 3QPCA 1XZHA 1K5PA 4W9RA 4CCYA 4MQMA 3QMVA 1EH5A 1C7JA 4X6YA 4BAUA 3STYA 3WA7A 4FBMA 3S2ZA 3C5WP 4Y2QA 2HRQA 3W04A 1G4HA 4J0CA 1XZFA 4H35A 1LLFA 5JZ9A 1K4YA 3L1IA 4OPMA 4NMWA 1R50A 5CT6A 1TQHA 2CZQA 1QFSA 4EZIA 3VKFA 2XQIA 1XZAA 3ANSA 1VXOA 2VJCA 5BWCA 4W1PA 3T52A 3VISA 1HPLA 2WILA 2B20A 1LPAB 5T4FA 4ZWNA 5EIEA 4Q34A 3LS2A 5YASA 4WJLA 1W1IA 2BKLA 3CN7A 5CH5A 4K6GA 2G5PA 1F0NA 4J7AA 1E8MA 4NZZA 3ZLTA 4W1RA 1E3QA 3AINA 1DU4A 3B12A 3R3ZA 5AI4A 4KE8A 1CVLA 3CN9A 3O95A 4FTWA 2XMZA 2D5LA 1JKMA 3GELA 2XE4A 2XB6A 4PW0A 2OQVA 4K6HA 2WU4A 3LLCA 2GYVA 1ODCA 4M0FA 5HF8A 2VJAA 2XUFA 2WTMA 3F67A 4MJ3A 2C5GA 5AP9A 4FFVA 2I3DA 3BIWA 5JATA 3U1TA 2IITA 5LZ5A 1F6WA 1R1DA 3IUMA 4DTCA 3MGAA 3DKRA 1X2EA 5AM5A 1ACLA 4PSDA 3I2FA 2PM8A 1R9NA 4GI1A 2VEOA 2C4HA 3WK5A 1WB5A 2PX6A 4GEGA 2JGMA 4TGLA 1J07A 4GDMA 3FLEA 5HF9A 1XQWA 1GPLA 2EEPA 4JH0A 3W05A 2HDWA 2ZJ6A 5EHNA 2XLBA 3D4LA 4DIUA 3HI4A 4QWWA 1DWOA 2XLCA 5E4JA 2DSNA 3ZLVA 1XRNA 3WK6A 5E4YA 2AJDA 4JEIA 4DNPA 2WU3A 1H2WA 1XKTA 3QBJA 4MWTA 3H2GA 1JMKC 4UBKA 2ZYSA 3U0VA 5AKHA 1QIKA 4EY4A 4DSAA 1QIIA 5JAUA 3DYIA 4Q3OA 4DMCA 4B0OA 4HRXA 1U65A 3QMWA 5AKEA 1H2ZA 1JT2A 5DYTA 1THTA 2V98A 3BXPA 2R11A 2PUHA 4AZ0A 2JF0A 2CKMA 1CUIA 5ALDA 3ESBA 3KSRA 4DSZA 5AKLA 2PSHA 3HSSA 4PSCA 4DMHA 4NVRA 1ZD3A 3NWOA 5LYYA 1BEZA 2YH2A 4F21A 4FNGA 4NS4A 3AFIA 3G7NA 3M82A 2JBWA 5K3AA 1FFCA 4CG2A 1UK9A 5JD5A 1BRTA 4B83A 3H2IA 2Z8ZA 1XZCA 2XUQA 3C8HA 4YPVA 1W76A 5LZ9A 3WK8A 1ODSA 2AJCA 3CCCA 3V1NA 3W2TA 2OCKA 5D6OA 1WPXA 1ORVA 1W6RA 1P0IA 5CT5A 3KOOA 3RK4A 4ZI5A 4LXHA 1USWA 1JFRA 1JU3A 5ALJA 2JEYA 4B6GA 3VXKA 3G0GA 3ZI7A 1DQZA 3V1KA 4OB6A 1ZI6A 3HC7A 3EQ9A 3KDAA 3HRHA 3SX4A 3KWFA 2DQZA 3MUNA 2BAGA 5ALXA 4KYVA 1EDBA 1MAAA 5JYCA 1CQZA 2CB9A 2XI4A 5ALRA 2WTNA 2VT7A 2E3JA 1EDEA 1BROA 2I03A 4J3JA 4S0XA 1AURA 2WHPA 2W22A 1GPNA 1DT3A 1ISPA 1ETHA 3I2KA 1SFRA 1XQYA 2DCMA 2JGKA 1K63A 3FNBA 5EIHA 2VF2A 5I8PA 1NU6A 3HJUA 1CRLA 5LZ8A 4L9AA 5A6VA 4DM7A 2QR5A 3RLIA 1A7UA 4F0JA 2XUGA 4HAIA 4UHBA 4CCYB 5ISMA 3NGMA 2CBGA 4J0HA 4OU4A 2Z3WA 4BDSA 1CUJA 4FMPA 3V1LA 1CUAA 2OLEA 1QO7A 4XX1A 1EK2A 5EIAA 5HF5A 3EBLA 5LZ2A 4OU5A 1EVEA 4BP8A 1ZIYA 4U2GA 2BCEA 1LPBB 2VQ6A 1KU0A 3DL4A 1ZJ5A 1G42A 3H2JA 1YB7A 1LBTA 5AHXA 2OGSA 3GBSA 3WKDA 3DYVA 3K6KA 1MNQA 3D7RA 1XZBA 1J1IA 4I4CA 4G1FA 1XLWA 1BU8A 5FDFA 1CUHA 1M33A 4MEBA 1U2EA 2O2GA 1DWQA 4BBZA 1DQYA 2Q0XA 2PBLA 5K3EA 2RI6A 2AJ8A 4UHCA 2HIHA 4QLOA 1ZD2P 5IVDA 2C58A 3C6XA 3FCYA 4H7JA 2J3QA 3NUZA 2X8BA 1ZIXA 3R3YA 5AOBA 5JASA 1QIHA 3PE6A 2V96A 2UZ0A 3VVLA 5I9IA 3T4UA 5SYNA 1XRRA 4H7HA 3I1YA 1L7AA 1N1MA 3IUQA 4QDOA 1QIEA 2DQYA 1GQSA 3IVMA 4I3FA 2WFMA 5DNUA 4C01A 2XT0A 1EK1A 2HM7A 4CG3A 1ZICA 3QM1A 3O0DA 4LIPD 2OAEA 5A71A 2WIGA 4C4ZA 2XMDA 1VA5A 1BCRA 2PPLA 3WZMA 2RGUA 1X2BA 5LKAA 1NU8A 3D2AA 3H2KA 4C6HA 2XDWA 2BJHA 4ITVA 5DLPA 4AO6A 4QWMA 3IIIA 3GFFA 1AQLA 1YCDA 1XQXA 3DEAA 2C0PA 2PSEA 1Y37A 5T4EA 3DLTA 1QE3A 3WA6A 2WFZA 4BB0A 1XLVA 2HA2A 3VJKA 5AOCA 2WIKA 5HQ3A 1ZI9A 2HL6A 2YYSA 5CURA 3WK7A 3IA2A 2XUJA 5ALIA 3WZLA 4P92A 3Q8WA 1BN6A 3ZLUA 3MVEA 3TEJA 4DMKA 1LGYA 1QIFA 5IH7A 4DNOA 1LBSA 1QFMA 4AN1A 4BVJA 5JZBA 2DFPA 4CIBA 3E1GA 3I6MA 4XWGA 4KR0A 2RIPA 2OCLA 2R8BA 3WKAA 3F96A 1YB6A 5IVIA 4A5SA 1LPMA 3OURA 4G4IA 1HQDA 4DNFA 4FLFA 3R3VA 3FAKA 3IDAA 5A62A 2WG0A 2QJRA 4YASA 4DYHA 5JAOA 5CXXA 5AI8A 1SC9A 4X94A 2WUDA 4ZV7A 3K9BA 4IHAA 2VAXA 2P8SA 4KE7A 2PSFA 5T4BA 4BZWA 2WQZA 1A8UA 4AZ3A 4OCZA 4PV7A 3PUHA 1A8SA 2QXUA 4B82A 1QIMA 4U2CA 1MNAA 5A7HA 4P08A 3AJAA 3AZPA 4RGYA 2ZSHA 4X92A 4X95A 3QZUA 1OCEA 3RM3A 4L3WA 5AK4A 1P0MA 5AM3A 1THGA 4BAGA 2VJBA 2PL5A 5FKJA 1WPRA 5LZ7A 1N5RA 1YAHA 4HVTA 1YASA 1DX4A 4MXDA 5AKZA 4ETWA 4RNCA 5CBKA 3DDUA 2HFJA 4B7ZA 4Y2YA 4UFOA 1IUNA 1IUPA 4WDQA 3D5EA 4G8DA 3ESDA 1CUDA 1H23A 1YAJA 3ZPXA 3FOBA 1B6GA 1A88A 3AZOA 4AXBA 3FYUC 1RYYA 1QTRA 4J0DA 1MTZA 1G66A 2H7XA 1WOMA 2WHPB 5HK9A 1F0PA 1S8OA 3YASA 2QT9A 5JZSA 1J2EA 3F98A 3O9MA 1DT5A 3WKBA 5ALLA 5ALTA 5KREA 2QKYA 2XQGA 3JW8A 1PV1A 1MX5A 2BUCA 4IQ4A 5JALA 1CUCA 1AUOA 2CUTA 5CMLA 5AO9A 4FKBA 1E5TA 1FFDA 4AX4A 3H1AA 1NX9A 3G0BA 2RHWA 1VE6A 4E11A 3H19A 3G9ZA 2XMBA 4EBBA 3QPDA 2YXPX 5J3JA 3FYTA 4CCWA 1XRPA 1ZGBA 4BTVA 2C7BA 4AQDA 1WHTA 1CEXA 4H7EA 4FLMA 3DQZA 3LIIA 1E8DA 1GGVA 3WJ2A 4X6UA 5ALQA 3D2CA 4KRXA 1VKHA 5JD6A 3OOSA 2OAGA 3R40A 3ZWQA 3BWXA 1XKLA 3OC0A 5AI6A 3FYUA 4TPKA 5CW2A 2OGZA 5AICA 3H2HA 1C7IA 3LCRA 4X3CA 1W4LA 5CH8A 3A70A 3X3HA 4FOLA 1XZJA 3FBWA 2QVBA 4J0IA 1SCIA 1XLUA 3C70A 4H18A 1JMYA 1WB6A 3D3NA 1W75A 3I28A 5KWIA 1CUEA 4BE4A 2DR0A 4G9GA 4J0JA 4INZA 5K5EA 4H7IA 3IBTA 2VSQA 1EHYA 4Y2UA 1XRLA 2BUBA 1GQRA 2ACKA 2K2QB 1ZI8A 3D59A 4KE6A 1YSCA 4OYYA 4K6KA 4O08A 4UPDA 5HKAA 2XUDA 4A16A 5ALFA 1SCQA 4N5HX 1GXSA 2QOEA 3ICVA 3C6BA 4Y2TA 4EY6A 1QOZA 3LIPA 5HKBA 2CJPA 3AIKA 3WK9A 4BYMA 2ZYRA 4BDTA 4W63A 4UHHA 3QVMA 1DINA 3O9VA 1K8QA 2YASA 4I19A 3HZOA 1QIGA 2PUJA 3PDCA 3N0TA 4MYDA 4UHFA 1A8QA 4H7KA 1LPNA 1FSSA 4G9EA 5HFAA 2ZYIA 4G8CA 1CFJA 1GZ7A 1FFEA 5K3FB 2FJPA 1LPPA 2VAVA 4HS9A 4F60A 4DMFA 1YR2A 3PI6A 1AZWA 2XUOA 4ZV9A 2I78A 4GHWA 4X71A 1R4ZA 2ZVDA 4U2DA 1LZLA 3G8YA 5HQ3B 2GZSA 5LKRA 5ALZA 4OB8A 3TRDA 5AKGA 3G02A 3WLAA 4AMYA 4IH9A 4RPCA 1XZGA 4EHBA 2OG1A 2Y2VA 2VJDA 1QONA 3EF3A 1WB4A 3PF8A 2OCIA 3ILSA 4PQEA 2XQJA 1KU6A 3FSGD 1CUWA 1XZKA 4ARBA 2WIFA 5AOAA 4GWLA 3GUUA 4FHZA 1YS1X 1O6GA 3L1HA 2WSLA 1G5FA 5D3ZA 4H7FA 1UKBA 4E46A 3V1MA 5AIBA 1AMNA 2ES4A 2Z5GA 1CUXA 4YK7A 2NW6A 4B80A 3WWEA 3QYJA 1OILA 4WFKA 1MJ5A 5H3HA 1ZD4A 4X7BA 5AI9A 2GBFA 4IH4A 1MPXA 4BVKA 1CUFA 4JUIA 2FJ0A 2BFNA 4J03A 2HFKA 4X93A 3N2ZB 4OYLA 1MN6A 4K2AA 4KE9A 4BC1A 2O7RA 2OGTA 5DJ5A 5FP0A 3MUOA 3ZV7A 1CPYA 1HDEA 2D0DA 2PSJA 5ALVA 2WJ4A 1SOMA 5AK3A 2WLSA 2OXEA 3K2IA 1P0PA 3AIMA 5ESRA 1DTEA 3WWOA 1MAHA 4KJXA 1EA5A 4B9AA 4C88A 5BOVA 1EINA 3OPMA 2AXEA 3O4HA 1EI9A 4Y2VA 1QJ4A 4B81A 1HKHA 4F5ZA 1CUSA 2HU8A 3GZJA 5ALOA 4J0KA 4QDUA 3W9BA 5ALNA 3HACA 4PO3X 5ALHA 1MT3A 2BUAA 3DL7A 3STUA 1RWQA 3WWPA 4JNCA 3I2JA 3HXKA 5T4HA 1CQWA 2O7VA 1QGED 3BJMA 4CFSA 1ZOIA 4Q1VA 5LIPA 2JGJA 4JYMA 4BZZA 3VDXA 3EIOA 2GYUA 4EY5A 4Y2SA 5DNVA 1Q83A 2B4KA 3G9XA 5AKXA 4AN0A 4HRYA 1CUBA 1GT6A 3PF9A 4GECA 2X76A 3AUKA 5KWJA 4CG1A 2HA5A 5ALWA 1JJFA 2WG1A 2Y6VA 1HL7A 5DTIA 2V97A 4V2IA 5C8ZA 3DOIA 4UBOA 3HYSA 3UUEA 3H04A 3OG9A 3G9TA 3KD2A 4UBNA 5AKKA 3TJMA 3NOXA 2W6CX 4WDRA 4WY8A 1I6WA 4C87A 3I6YA 2HHAA 4P93A 1U8EA 2VTVA 3FYUB 4FWBA 2XMSA 3QMMA 1XZEA 3O4JA 3FLAA 1QTIA 4N8DA 1XQVA 2HA3A 4C4YA 4B0PA 4XJVA 2JEZA 3KWJA 4BTLA 4H0CA 1UK6A 1TK3A 2XMGA 3DD5A 4EY8A 4BCCA 3W9UA 2QUBA 3F9CA 3QPAA 3WKCA 4LYDA 3WL8A 5EHQA 1VZ3A 5HFNA 4N8SA 1JJIA 2C0QA 2OCGA 2GBIA 4BRSA 1XZDA 4AO7A 1CR6A 2J4CA 4QEKA 1F8UA 3C43A 4G4GA 1QZ3A 4ZRDA 5KBYA 4QDTA 5C8VA 5BWBA 3GA7A 4ZXFA 1UWCA 2GZRA 4KAFA 4Y2XA 4LXGA 1EVQA 3BL8A 3R3WA 1JU4A 1GKLA 3AIOA 4UBLA 5HCUA 1GKKA 2V9ZA 4LYEA 4AMZA 4HZGA 5ALMA 1UOPA 4FNMA 2BGRA 5HZGA 4H77A 3EQ7A 2G4LA 2CEKA 2GBGA 4X97A 5FUMA 1CUYA 5CTAA 4FBLA 3BJRA 5HF6A 5I7UA 4AB1A 3EQ8A 1BCSA 3WKEA 7YASA 1J06A 2J3DA 2XUAA 1Y7IA 3FSGA 5CH3A 2QTBA 3WI7A 4X6XA 5JD4A 1Q0RA 4HXFB 4CIAA 1TRHA 3FVTA 2ZSIA 2BGNA 4GW3A 4BCBA 5EHXA 4OUKX 4W1SA 3STVA 2G63A 3KXPA 3DNMA 3V48A 3P2MA 1EB9A 1UFOA 4B85A 1AC5A 3LP5A 4EA6A 3V9AA 3H18A 4MWSA 1SCKA 1VXRA 5E4TA 5C7YA 1UT6A 2Y1KA 5AM2A 1FFAA 1BEEA 5E2IA 5DWDA 5CT4A 3HEAA 2CMFA 1UK8A 5C81A 5AIAA 1HLGA 5EFZA 4QA9A 1OXMA 3PFCA 2WIDA 4X85A 1XZIA 4IO0A 4JYPA 4EUSA 4UBMA 3WYDA 3AZQA 4Q82A 1CUGA 1EB8A 1MO2A 1WM1A 2LIPA 3IURA 2WUFA 5F4ZA 5ALYA 1FJ2A 3O4IA 4U2EA 4GXNA 1XRMA 4N5IX 4A23A 5AK5A 1YA8A 5AH0A 4G5XA 1VJ5A 5JADA 2WFLA 1Q84A 4DNQA 5FXMA 1UOOA 1LPSA 4HXEB 2WUEA 2ZJFA 1K6EA 5ALEA 3E0XA 2HU7A 1MU0A 1RP1A 5SYMA 2QZPA 5DYWA 4WCVA 2ROQA 3S8YA 3ESCA 2IIVA 1Q0ZA 2XQKA 3C5VA 1ZGCA 3WL5A 4ROTA 4FFWA 4WFIA 4M0EA 3C6ZA 2PKYX 4WFJA 4X00A 2FX5A 3D2BA 1QLWA 1WHSA 4RE6A 4FLEA 4G8BA 4BATA 4HTAA 5AM1A 5IVHA 4GBGA 1CLEA 5CT9A 1VZ2A 1IZ8A 4D9JA 4M0MA 4X91A 2JGEA 2PU7A 3SWWA 3BE8A 3QH4A 1ZJ4A 3BDVA 1ODTC 3C6YA 4UBJA 5FPPA 1U4NA 5LZ4A 5EGNA 2HA4A 3O4GA 2AJLI 2Z8XA 5FPQA 1P0QA 4Z49A 3GROA 2VA9A 2RAUA 3G0IA 4Y9SA 3RKSA 3ICWA 1O6FA 3RARA 3STXA 1JJBA 3WWDA 2JGLA 3B5EA 4EB0A 2WIJA 1TCCA 2ZJ7A 1ZD5A 3VVMA 1VLQA 4KAAA 4OD0A 4OSEA 4C89A 2Y6UA 5K3BA 3VJMA 5JAHA 4U2BA 3I6ZA 3IUNA 3M83A 1QIJA 4QLAA 4E15A 1JI3A 2GYWA 4MEAA 5AK6A 1XZLA 1AKNA 1UOQA 2I3ZA 3G0DA 4BRZA 1L7QA 4UHDA 2QMQA 3WK4A 2WUGA 3I2IA 4P9NA 1Z68A 4LHEA 4N8EA 3AILA 3WJ1A 3WQHA 1XZMA 2WHRA 4UHEA 4UUQA 1B41A 3F8SA 5AM0A 1D07A 3DKKA 4IH1A 4YX9A 3I2GA 5IVKA 3WIOA 3H17A 3C45A 1ORWA 2EDAA 3FWHA 2EDCA 4ARAA 2GBCA 2XUKA 4PNZA 2DHEA 1UKAA 5AKIA 4BAZA 2WJ3A 4QE3A 1XROA 1MX1A 2HA7A 4MQLA 1VOTA 2Y2UA 1UZAA 2DHCA 1E66A 4FDMA 1AX9A 3STWA 4MYSA 1LNSA 1HBJA 5FRDA 4PSUA 2HADA 1DWPA 4UFNA 4B9EA 2PSDA 3C87A 4ZREA 2FUKA 3STTA 2QUAA 1UXOA 4X90A 2H9YA 3JWEA 3A2LA 3CCBA 3E4DA 5CT8A 3Q0TA 5AKJA 3A2MA
chains in the Genus database with same CATH superfamily
3UM9A 1DG9A 2AEJA 4R7ZA 2R8EA 4JSYA 1MX9A 4QEZA 4RV4A 4M1WA 2AF4C 2DHDA 4E7PA 3GQVA 1YRYE 4XI9A 4G3XA 5CFNA 4LKOA 1T0HB 5DK4A 4XQGA 4YRMA 4PR0A 5BV7A 4MROA 3CH6A 4YHHB 4JLKA 1PQ4A 1X70A 3ZWVA 1II0A 1FUIA 2QPLA 4ND3A 4M9XA 4AS1A 2GCNA 4KK4A 1A9RA 1KDZA 1F6DA 3CXUA 4CLHA 1MO5A 3FJYA 2GLXA 4N3NA 1XTUA 5HFJA 4AO8A 5MN4A 2PKEA 4CLRB 3H5LA 4B3BA 5K3DA 3WL7A 4XOIA 3UT5B 1GNVA 3HU5A 2Z3ZA 4QZVA 3FB1A 1FSZA 3DOHA 2HRRA 5EKXA 3RVDA 5LA6B 4WZZA 4QSMA 3Q87B 1L1RA 3WDLA 2G5TA 3ZBUA 4B84A 1DPGA 1WZ2A 3SSOA 4DPMA 1HRKA 1VSVA 4J76A 3V2GA 1RJ9A 4EHAA 2PU5A 2WZCA 3CEAA 4ICIA 3RIEA 4KOEC 4BFSA 5JANA 3KZKA 3LX5A 2R87A 5J4HA 4TMXA 2J5KA 4KSCA 1FF9A 2DLDA 2RHBA 1FMTA 2Q4OA 3FCCA 3HWWA 2F62A 2FPGB 1N0WA 4XDGA 2GCEA 4Z5XA 3I4FA 4FWTA 3E5NA 4N76A 2ADOA 1YS2X 2B83A 4MCAA 3NBUA 5MFZA 4M8SA 2JI7A 2A0UA 3BIXA 3OQ6A 3OVMA 3U56A 2MR5A 5IBQA 2QZ4A 1S2IA 3MTEA 4OP2A 1NOKA 3KS9A 4DXDA 1DCMA 1SG0A 4EO7A 4W99A 4ZANA 4MQUA 5IT5A 4EW2A 1XDBA 4HN4B 1E8NA 1BN7A 1X9GA 2UU9B 4HDMB 1QKIA 2X1LA 2IXFA 1Z3IX 2EIHA 2QTZA 5E6RB 3ER9A 2D1YA 3GJTA 3FCUB 3H0EA 3KTFA 5ICFA 4DRYA 4XVCA 1DAIA 2RKWA 3FDZA 4LA4A 1SXPA 1K7FB 2BFOA 4EAQA 3HXTA 4ZFNA 2JFWA 3PQ6A 1PJCA 4Q15A 2VT6A 3WIBA 4ACAA 6ABPA 3HN6A 3VU9A 2CDAA 4Q9DA 2IUUA 2WWIA 3LZCA 2HAEA 2GLTA 3UW3A 3BAZA 4MB2A 2SBTA 4L02A 5LQMA 2UAGA 5LWHA 4MVJA 3KKPA 1GPUA 3SG0A 2ZI9A 4PHHA 2FZCA 1GN8A 1BGWA 2IF2A 3OQJA 1QCZA 1ORTA 3WVNA 1IB0A 1NE2A 2PH3A 2H59A 1X1EA 5C7LO 5AW6A 3IQIX 4DJEC 3BF8A 4TROA 2AOWA 2PKRA 4JL5A 5GGXA 5K9ZA 2H57A 4Y6RA 5I4IA 3T1YB 4EI7A 3KT3A 1N2IA 2NUPB 1T4MA 5TPZA 3PUIA 2XZPA 5H3LA 2XADA 1RI4A 3IEUA 2JPDA 3QHQA 5G41A 4RA9A 2OXTA 1DMRA 1CUZA 3NTXA 1MQ8B 1SKBA 2D00A 4DLZA 1IFXA 1C30B 4LXIA 4DMRA 4IDOA 1KY5A 4MMXB 2PMFA 1XEXB 4C21A 2X9LA 3GEHA 2PUTA 3L43A 2G1PA 1LUAA 4UEWA 1IMJA 4J49A 2LKCA 1D9XA 2XNDD 4U7JA 3BVPA 3IPRA 3W06A 1N5KA 2JIPA 4MI3A 1ZMRA 4E08A 1YHYA 2CN1A 4INOA 1EDDA 2VDNB 4YJGB 3H9EO 5CJ2A 5CPBA 4NE7A 1CU1A 1K6JA 4P6VF 4Z1MA 1ZOSA 1E1RA 4J1QA 3UGTA 3JYHA 2XGMA 4MGYR 4EUHA 1J90A 3TNJA 2CV0A 2R44A 1W88A 1WULS 4LV6A 4Z86A 2MTBA 4QX6A 2ZYVX 5EJMA 5CFLA 1B76A 1R9MA 4MYTA 4BVLA 4KB5A 1SC3A 4B3IA 2NUBA 1VIDA 3I9JA 3T1NA 2UYOA 2WFAA 1W5FA 4LTNA 4TL9A 3HTXA 4R1QA 2DHQA 5HIAA 3C3CA 1W581 2I66A 2VHQA 1PFQA 1OH6A 2IBSA 3L0OA 1QOQB 2V74B 4CI0B 4Q7MB 2FEOA 4B5KA 4DV5B 2IHUA 1GUZA 1SOAA 1L1QA 4W5RA 1QSGA 4P0QB 3ZWAA 1SU4A 2CXNA 3ES9A 4CKEB 3P27A 1GARA 1QGZA 4Q5IA 4BIMA 5HIKA 4JUDX 4ZZ3A 1ZINA 4IX9A 1F0YA 4DR3B 3V3TA 1L5YA 1YQEA 1JZTA 5ALGA 1LTKA 2JGIA 4ARSA 1OWNA 1R0ZA 1XV5A 3CJRA 2HU5A 2PSSA 3CW9A 5TMBA 3UKJA 3GAFA 1Y8AA 4WD3A 2QV7A 3M4ZA 3A6ZA 1DLJA 3AV0B 3HJRA 1QKJA 4ZAVA 3WHKA 3ZU4A 1Y48E 3UB4A 3TAUA 4K03A 2CMDA 2XX3A 3ZQJA 2QRUA 3ETLA 3RNLA 1Z39A 2VAPA 2F2TA 5JCJA 5JNSA 4FINA 1GTJ1 5BORA 6PFKA 3BSFA 3Q9UA 4UJ3A 3NKFA 2H1IA 3RR2A 1JVBA 4HUJA 2JGRA 2OV8A 2XWQA 3KFVA 3B1WA 4EJMA 4CODB 4J16C 5BSVA 1SCUA 4LOJA 3S2UA 3WNZA 3VSAA 5ALUA 4UZEA 5KYWA 1NRIA 2WP8J 2GF2A 2ID4A 3R0VA 5G0TA 4IHQA 4LC9A 4PVDA 3BK1A 4U02A 4DA6A 2PVSA 1A1VA 1V6CA 4Y30A 4PTZA 1OFIA 3O4VA 2F1JA 1QDLB 5ER6A 3LFTA 4W5WA 1XTKA 2PAAA 4TLLB 3QYAA 3G0CA 3O47A 5AM4A 3UWPA 3GCWA 4WK0B 2BKXA 1PR2A 3AY7A 3CU5A 1OBFO 1LPOA 2I62A 4MP8A 3BILA 1LV8A 5EWJA 1C0KA 5G1PA 3WLHA 4CM5A 4L4XA 1IXYA 5G0WA 3VDMA 3OUUA 1W30A 3I6BA 5ENZA 3WMFA 1RHKA 3ZNPA 4ZOLB 5H81A 2REQB 3W9YA 2Q2VA 4AWAA 1E2DA 5IYZB 5H9VA 4BUJA 2QY9A 1GOTA 3FZGA 4O4LF 2P3QA 4XVUA 5JOQA 3ESYA 3BS4A 1ABFA 3KO8A 2WB4A 1CIJA 2QRGA 3DZJA 2WAOA 5E3JA 4I4LA 3DF9A 1OT3A 4NZMA 3FHLA 2B94A 3Q11A 2D2IA 7GPBA 4OFXA 3EZGA 3DC2A 3FMFA 3K8ZA 1QK3A 2NTYC 3L1JA 1E3LA 4CWAA 2BE7A 3GJ5A 3D0KA 1YRAA 3EE6A 1PV2A 3H9JA 3HJFA 3PGVA 1W44A 4BFZA 1XJ5A 4WUTA 4WVFA 3LG2A 4B17A 4CIVA 1AKQA 2EFCB 2YXLA 3ISTA 4PBSA 5C31A 4YCDA 4OBXA 3HUFA 2OL4A 3PQ5A 1QG4A 1I32A 3KUDA 2WD7A 2EZUA 3NIBA 3R44A 4GYKA 4JLBA 2W4MA 2ZS9A 2VHCA 4MKIA 3NHLA 1ZL0A 2YYAA 3ANTA 16PKA 3MMXA 4WJZA 5DLDA 1B74A 3WYNA 4KIGA 4DOMA 2H1OA 2QGFA 1R88A 3AJ9A 3H1BA 3HU1A 3K3PA 2VNAA 4N5MA 4PO8A 5K3SA 4DADA 1TUBA 2GXAA 1P9OA 2YHBA 3HYTA 5H16A 2X9GA 5IDVA 5K3CA 3EAGA 1BWPA 3KR9A 4YMTA 4OK5A 1JR3A 2WJYA 4IJVA 3ED1A 1J1UA 1XTVA 5DBIA 3WGVA 2GPBA 2OCAA 1WNTA 2WJZB 3BXZA 1AGYA 4HZUA 5EL0A 1KK3A 5L3SB 1EGQA 1GL3A 1E4VA 1ADBA 3PFKA 2BM9A 4LDJA 2G9NA 5CNKA 1BDHA 4B2IA 1OFHA 5C2JB 2WHQA 1DKUA 1IQPA 3NNNA 4O2AB 1H22A 1J1ZA 2WIAA 2G6TA 2IY7A 3H05A 3T9CA 4ECEA 1GCAA 3X1XA 1CKEA 2H63A 4KN9S 3MF4A 4LRYA 2FI1A 3RKUA 4BLQA 3IR5A 3WXMA 3TUJC 3KQHA 1ZCZA 4J0GA 2GK7A 5DP1A 3PUYA 2VYQA 4L8LA 2P9CA 4RZSA 5KINB 1G64A 1YU6A 4L8FA 1F2TA 1Q5PA 2GERA 1Y9EA 3QU7A 4QICA 3RAPR 1IOLA 1Z28A 5D3QA 4MYCA 3ZQ6A 1LS1A 4OK3A 2G4CA 3E05A 3W90A 8LDHA 3R8XA 1Q0PA 1JHRA 2V6GA 2HSGA 2B4QA 2V3WA 1TQ4A 6YASA 2Q4DA 3ZI4A 1W29A 2VDVE 4R0MA 1YGYA 4L4ZA 1GUBA 1XWIA 2YY6A 1RM5A 2QRHA 3K32A 5DTEA 2DEUA 3RYFB 2JGFA 1RC1A 5BV0A 2EJTA 3CJTA 1JTFA 2P4QA 2E5LB 4LHVA 5JCXA 2YOGA 1SU6A 4QQKA 4S2EA 5CR9A 1OBOA 2DBZA 1CETA 2D06A 4I08A 5B3KA 3EIEA 2AC2A 3NBZC 2XVMA 4HQ6A 3M6UA 1EFVA 1ZU5A 2IY9A 4TYPA 1FIUA 1C3VA 2D62A 5KJ6A 1VJ0A 2FK8A 1JDTA 4JOQA 4MPPA 4N7BA 3U44B 3ZE9A 13PKA 3AR5A 4CCYA 2GTHA 2W2NA 5A4FS 1D6MA 2BI8A 5CB4B 2W6ZA 5B6JA 3CVVA 3OPQA 1JH8A 2WAMA 4AIIA 5TLSA 2HQRA 1GPYA 2ZM6B 3LRXA 2F3SA 4JI4B 2WVHA 3WRYC 4OXNA 2QD4A 2VHZA 3STYA 3PRJA 1Z4PX 4FDUA 4CL8A 1AQYA 1YBHA 1FNCA 4FBMA 1HMYA 1YQUA 4A5OA 3HA3A 2PQMA 3I9NA 2YWDA 2RSLA 3WHLA 2O54A 3ZHBA 2GR9A 3W04A 1EIZA 9ABPA 1G4HA 1NLZA 3HVIA 1M0EA 5EXTA 5HSGA 2OZVA 2FNAA 2Q4BA 3AUXA 5IUKC 1J23A 4K0RA 5E2AA 3L1IA 2NAPA 3PCTA 2O4UX 3OCCA 4IDGA 1R50A 2I4TA 1HETA 3NJRA 1IIBA 3U7QB 2ATIA 1QFSA 4R0NA 2JLQA 2XCSB 2X0NA 1S02A 1O97D 2A1TR 2FG5A 2PJUA 2ZYTX 3K0KA 3LVRE 2A30A 1E2IA 1QORA 2QQ0A 4NC9A 3FZYA 4QGAA 3DG9A 4B3MB 1XZAA 2P1ZA 2NZYA 1DVRA 3C0KA 2PGAA 2BEWA 3EHDA 2ZSJA 4EZEA 1JE0A 2GH1A 5BW4A 4O59O 2SCUA 4BKUA 3VKUA 2F4VB 3O1LA 4DC9A 2HZBA 3B1FA 3V8VA 1V45E 1ZNXA 1QQBA 4KPYA 3CS3A 3H2SA 4DA9A 4K6CA 1YQQA 1KDYA 1UJNA 4K3UA 3ABZA 1SK9A 3GFBA 1IEQA 1LPAB 3OLVA 4XIFA 4MW6A 1KFJB 1N6IA 5GOTA 4ZWNA 1XZ8A 2ZI3A 5EIEA 4Q34A 1JDSA 1E69A 5DSTA 4NV3A 1NVBA 2BKLA 2QXYA 2WM8A 3CN7A 3F1LA 4P5DA 5CH5A 4KQHA 4PG4A 3KR2A 4K6GA 1GG8A 2IZOA 4MYRA 1UBJS 2G5PA 3L8ZA 5FL3A 2Q29A 3T41A 3I64A 4NZZA 3R0JA 3U80A 3WGYA 4CEIA 1IEXA 3WMWA 1DG1G 1E3QA 1PKEA 3P96A 4DLUA 4HGZA 4J0EA 1DU4A 4PX3A 1KJJA 4GPD1 3IOEA 1CVLA 2XYQA 4ND8B 1I0IA 2FPXA 3DKVA 4Q1EA 1P6QA 4ILEA 3RRBA 3V1TC 4FTWA 5B5SA 2VQEB 2IS1A 1UXKA 4X54A 2JFUA 4C6SA 1N9GA 2FF5A 3I1FA 3RAGA 3DLHA 1PZNA 2IPNA 3K31A 3OFJA 2FKNA 3C85A 1G2OA 3B36A 4PW0A 2P40A 4MWGA 4JROA 3B2EA 3W5BA 2J0EA 5BR4A 2GYVA 2WD8A 2V5AA 3PDIA 4KX5A 4M0FA 2MMGA 1QH1B 1YOVA 1JP7A 2EFGA 4FT2A 3UMSA 2ATEA 1RYHA 2JHGA 2ZSEA 4YLYA 1I51A 1CLUA 4DLWA 1IXZA 2HOQA 2EU8A 3E8MA 3CGWA 2AN5A 3KPYA 4HQRA 4O4JA 2C5GA 4WXMA 3V3KA 3ZCPA 2J07A 3K6SA 1YZFA 4KQKA 1UQUA 1K86A 5AP9A 3R7SA 1FDWA 2OCBA 3EXG1 2OYCA 1DCFA 4R8SA 2PEZA 1U7ZA 3QOYA 4B7AA 2VRBA 1RLMA 3FUCA 1JDUA 1V4NA 3BIWA 5JATA 5TRTA 3DAHA 5AVOA 2IITA 4IAOA 4LTDA 4TMFA 4YRFA 5LZ5A 1R1DA 4E5KA 4C2UA 4DTCA 2Q50A 1O1YA 2EQBA 4DQLA 1QDEA 3CC8A 1WMAA 4Q7KA 1QB8A 1X2EA 3MJTA 2C3MA 2VUTA 2V8OA 1E3WB 3DULA 2AFHE 3I2FA 5JS8A 1M6YA 3WRWA 5K8UA 1Y7PA 3GDHA 2CMHA 2HJRA 2R7NA 4K8OA 2HUPA 1XP8A 4GRAA 1Z5OA 1PJLA 3A4VA 4HBGA 4P7FA 4AJJA 1T2DA 1FTSA 2VEOA 4AQ7A 4G84A 2GPAA 3ZOKA 1IB6A 2YFYA 1NSTA 1MC8A 1UAYA 2P2CA 2H65A 3DJFA 2WICA 1L8LA 3RS7A 2A78A 2WOJA 4GL2A 3RHZA 2O3RA 3C8MA 4J3FA 1CZUA 3PDJA 4RHUA 1J07A 4RIEA 2IWRA 4N5LA 1GQ2A 3SXJA 1SUDA 3OZVA 5HF9A 1GEGA 4V02A 4X84A 4QUIA 2IDKA 5AWFC 3WLJA 2WJWA 3FF4A 1O6BA 1Z88A 2XCUA 4WOPA 2BEUA 3M9LA 4O8ZA 5GIOE 2DR2A 2WF9A 5IANA 1AKTA 4GC5A 3A1NA 2JIBA 4OH7A 2PXAA 2Z2IA 1DLIA 4PGMA 2YV3A 1E2KA 2Z56A 4RZUA 3W05A 2PUVA 4GM0A 2J9YB 2ZJ6A 4UAGA 3D4LA 3HI4A 4R7GA 1NVUQ 4QWWA 4XB1A 5J5CA 2RGRA 1ZESA 2OY0A 2IDZA 2O8DA 1DELA 4FC6A 5EE9A 4LGVA 2GFQA 2HH9A 5LD2C 1WO8A 5JSQA 3FTNA 2OILA 1XRNA 2QNRA 3OWHA 2B6NA 5BPFA 3ZV6A 1DNPA 4ZVVA 5E4YA 1M8PA 4G1MB 3UGQA 4YV0A 1Z4JA 4LJ4A 2B5WA 1K4MA 2C9DA 1V4BA 2BW0A 1QHFA 2FN9A 4DLSA 3REGA 4EX6A 2XPCA 3A1FA 1N6RA 5EJFA 4DKJA 4UDXX 3HHPA 2EJCA 1JMKC 5U4QA 2ZYSA 5IAOA 2IHVA 2CNWA 4DEYA 2IA5A 3EISA 3N7AA 4OHYA 2JKYA 1QIKA 4UU8A 3VZBA 4EY4A 1NM5C 1YR8A 2XA2A 1JPJA 1RXIA 1XLTC 3SF8B 5E6UB 2DH6A 2GFIA 1EVZA 3TRHA 3O4FA 3EB9A 4QIHA 2B4AA 3M3PA 2R751 2QN9A 4NYJR 4WT7A 5ELXA 1OU0A 3DBVO 1Q92A 5CP8A 3SCZA 2QRKA 1VPVA 5CDYA 3NMUF 1EFTA 4CUZA 2R7AA 2CFIA 4K6MA 1QP0A 1Q91A 2CT8A 3EARA 3HXPA 5HILA 3C3WA 3FH0A 4PAWA 3EWAA 1XCMA 2P7HA 1I2BA 3AWIA 1Q74A 3L07A 2C4TA 3H7IA 3IV7A 4Q9LA 2R11A 3GRUA 3JZIA 4M8IA 4RH3A 1D2CA 2JF0A 2H1WA 1E1NA 1ODIA 3B6JA 3R6TA 4G07A 4P3YA 1VHDA 2D4AA 3AUTA 1N5LA 3L6UA 4YFVA 5ALDA 4RO0A 3K9NA 5DV9A 1PFWA 2ZREA 4ZIRA 4ZVRA 3ZUPA 3KSRA 2YXEA 1QUFA 4NKRA 1NSFA 5AKLA 2QMHA 4RNDB 5P21A 3LCUA 1QWOA 3WDSA 5ILGA 4RC9A 5B3JC 4YWJA 3KVRA 3KDSE 3JY6A 3VC1A 1U28C 5HNKA 2J48A 4PSCA 2AC7A 1CC1S 2C2YA 3FVVA 4BFCA 4O4IA 3ORRA 4KUGA 4Y6LA 4CN8A 2B8EA 1I0LA 3WGMA 5EMNA 3S2YA 3ZX4A 4Z99A 3ZJTA 2PL9A 1BEZA 4KV7A 4M86A 4RXTA 3BH6A 3PA6A 5KNLA 2ORED 3FGNA 5ED4A 5DISB 1HL3A 2ZJ0A 1GGKA 1S3IA 2P6MA 3M82A 2B7BA 4KLAA 3W6OA 1Q0QA 2V7PA 2VTDA 3GA0A 3H3JA 4JXJA 421PA 5K7SA 5L7TA 3TL2A 1IY8A 4DV4B 2Q5OA 2PY6A 4PX9A 1D6SA 2FEKA 3ZHXA 5THKA 1L1FA 2VXYA 3AL2A 4ZAYA 1XZCA 5C1BA 3C8HA 4QOHA 4F3TA 3FNHA 4YPVA 5TGDA 4D45A 3EXAA 4YJ3B 4FSHA 3NVMB 3P94A 5CFRA 1BJKA 4EHIA 1ODSA 2HSWA 2QTNA 3W2TA 2Z6AA 3TB4A 2P5UA 3CEMA 2F7SA 3W2EA 1WPXA 2DM6A 2OVBA 1ORVA 3K9CA 1HOXA 3HN7A 4OOEA 1W6RA 4R4JA 1BHQ1 5LIRA 2C54A 1PT6A 4QXQA 5CIWA 1R6XA 3KQTA 2UUCB 3KOOA 4PGGA 1C8VB 2V58A 4M6WB 4ZI5A 2NYRA 2VG8A 5BMVB 3GLGA 3LW8A 3Q7IA 1DRKA 3ZHVA 1FYDA 2JFPA 5KJFA 1M0SA 5LXTB 1RTKA 1AVTA 4G85A 5CUQA 5BN4A 4OUDA 2EX1A 3NBFA 3H6KA 1UMCA 4M8NE 3R8CA 4FUQA 3G0GA 3ZI7A 1SWVA 3V1KA 1OWMA 2Q6OA 1Q7BA 2DPXA 1GPWB 3I5MA 4HQOA 4L5BA 2OAQ1 4OB6A 4QQ8A 3F6BX 2AFIE 5HGXA 4NCHA 4BNDB 3OCJA 4KC0A 1Y82A 5HX7A 2AR7A 3BHNA 5M04A 3L8EA 3ONNA 3FTQA 1LBQA 2BF7A 1ZI6A 1LQUA 2JLBA 3ZTWA 2X0RA 4P7JA 3AC0A 2QTVB 5FT9A 3FSEA 3HYCA 3RFXA 3L3BA 3KDAA 1MIOB 3SFZA 4EHLA 4OX9Y 4AIRA 3SYMA 1X80B 2GZHA 2R6AA 2EZ9A 3BRCA 3ZWBA 5ICCA 5JC1A 2JG3A 1N5JA 2HRBA 3R7WA 3ZZ1A 2C5BA 4DLTA 5KOYA 1QPBA 5ALXA 5D51S 4OI4A 4V0QA 1KMMA 4N5DA 2C92A 2JLAA 2QRPA 3WGQA 2H92A 5HXAA 2O8EA 1CQZA 2MMCA 3PQCA 4P4GA 1ESZA 2RJOA 4MDHA 3VR5D 5IHPA 4MW9A 1MEOA 1NDUA 4HH4A 4Q12A 4YRGA 2WTNA 3PITA 2PZMA 2E3JA 3I9V1 1ZH0A 2C2HA 1BROA 5GPBA 3TWOA 1OH8A 1E4OA 2FQQA 2X9QA 1ML4A 2YZ2A 3JRWA 2CLSA 3PG5A 2GBPA 2YX1A 4X1YB 1T9HA 3TLCA 3VDRA 4RM3A 2PZAA 2P9BA 3EIXA 3PQEA 1YE8A 4CMCA 2IRWA 2W22A 3T1OA 1UMDA 5BUQA 1GPNA 4FQ7A 2XIQA 1BE1A 3KB1A 3NIGB 2ARKA 4CU5A 5IF9A 5MGBA 1K63A 1J0DA 1CF9A 4GC9A 3FX2A 1L5HB 2GD6A 3PR2B 3TZCA 3HZHA 4O4HF 1A2OA 3TMYA 2HV9A 4BQQA 2QNIA 4OAPA 4WHMA 2Z04A 3LO8A 2F1RA 1MD9A 1SHUX 3I12A 1CRLA 3SM3A 3O8QB 1RZRD 1F8FA 5ARDA 3OQPA 1Z5ZA 2QR5A 3A10A 4M38A 4PPYA 1N0UA 4MJLA 1A7UA 3NEAA 3GC6A 4JVOA 4YT2A 1UDAA 5CEFA 3AKEA 1QS0B 4Z3OA 1NBMA 3W2HA 2XUGA 2Z8YM 3U39A 3UHJA 2JJMA 1I01A 2X6QA 1LVGA 4RF2A 5DK6A 4HADA 5H9WA 5LQJA 4IS3A 3PTAA 1XDSA 1H85A 3JD0A 1AM4D 2QQFA 4UATA 2IEZA 4HUTA 2P0YA 1OZGA 1AGRA 1RI5A 3DGFC 4R98A 3JR7A 4MKGA 1CUJA 2FKAA 3KQYA 4ZU1X 3V1LA 3R1IA 5JT1A 4NOLA 1W46A 1DMSA 4D3FA 2J3JA 2AF3C 1B73A 5KMGA 1UBNA 1I14A 1U1IA 1J20A 3RO7A 4IRUB 5GZ1A 1IRXA 4RWZA 4AQYB 3P2OA 1Z7YA 1Z4MA 2IH5A 3RVSA 1Z0SA 3OQIB 3EBLA 1N2CA 4B6OA 4L4RA 1VKNA 4Q0MA 4GGMX 3HXMA 2DFDA 3WGTA 1YB1A 2JFYA 2ZI4A 3ROFA 3VDQA 5KTYA 1ZIYA 2WABA 2ERCA 1EM8A 4E30A 1BO6A 1E1QD 5A05A 4Z4HA 1CIVA 5C8DA 1T8SA 1TYDE 1W0CA 4FHEA 3UOAB 3GEPA 2VXOA 5LYJA 1ZJ5A 1UODA 1ZHFA 2Z09A 1G42A 3EA5A 2VCHA 3RG2A 3Q41A 1UDCA 4RD2A 2XUZA 1SBIA 1OIVA 5AHXA 4JJFA 2QL6A 1E98A 1E61A 1G5QA 3IQWA 4OBBA 3ADDA 4DB2A 1QGAA 1PV4A 4BASA 2AYYA 6GPBA 3IX7A 3OZEA 1IPHA 3NPMA 1A4IA 4LZWA 1G3UA 1X1TA 2J0SA 3ASYA 4MWEA 1ENYA 3D7RA 2MWMA 1DUVG 1XZBA 3U7EB 3T1HB 4IFIA 2QLTA 3ROXA 4G1FA 4S1PA 4OHWA 1DOAA 3H8VA 1BU8A 1E2NA 2LWIA 2QTFA 2IYOA 2YFQA 2B99A 4M49A 3RU2A 5FDFA 1W4CA 2IHKA 3PXEA 2LXNA 1VYHA 1HG1A 2DU8A 1XNGA 1LJUA 3RNOA 4C30A 2F9LA 2VDMB 1MH9A 3EXIB 3DHNA 3H1EA 2NXCA 3H75A 4MQBA 2ZUVA 2KLBA 2NQ8A 3NCHA 1QP7A 4B3TB 1DWQA 1H2EA 2GKSA 1V26A 1PJSA 2H48A 2HDNB 3KEOA 4E2ZA 7AT1A 1SC4A 4J94A 3JALB 1UFRA 4UCFA 2WJIA 4YRAA 1A3CA 4M53A 2Z30A 3D1JA 2IV7A 4EB3A 5K4GA 1HQCA 3SS8A 2WZBA 1ZR4A 3E5RA 2C58A 5BPHA 3ZE7A 1RXVA 5SY6A 1A27A 4H7JA 1CZRA 1ODLA 4QD3A 1KRXA 1U4OA 4LHSA 2L17A 3DVAB 3R3YA 3BXHA 5JQGB 3N1UA 3P32A 1GTL1 1SUSA 2F67A 3GEMA 2V96A 2UZ0A 3EEQA 1L8AA 3D7MA 3PIRA 4I36A 4LX0A 5KUTA 4EYGA 4DXHA 1PW5A 6CHYA 2HK7A 5SYNA 1AZSC 3URMA 2PMKA 1XRRA 3R75A 1IBKB 3W5SA 4YAJA 2FN4A 3I1YA 4D4IA 1Z6GA 1CX9B 3EZ9A 4DIEA 1GSOA 1IUKA 3BAFA 1UAGA 1Z0FA 3DYBA 1I3NA 1Z4IA 2NUAB 2QM8A 4QM7A 5HTOA 1FQKA 1H3EA 4H1VA 1A9XA 1GNSA 4NBRA 4FYXA 1GQSA 2PLFA 3LQ1A 2XEXA 3IVMA 1VKRA 4Q4HB 4RZIA 2WFMA 1KYIA 1ZGGA 2GVDC 2R85A 2WY2D 5DNUA 3RFFA 1GTSA 2YQ5A 3VOTA 4AECA 1AF4A 4CG3A 1NWHA 3QK7A 1ZP6A 4I50A 1MC4A 1RWKA 4EYKA 1BFKA 1BX1A 4K40A 4KXLA 2R9VA 4RJKA 4FKMA 2Z9BA 3Q85A 2Z1DA 4JMPA 3RTCA 2P4HX 2WE8A 2AWNA 3AY6A 1T25A 3NT2A 4B35A 3FF1A 3RVRA 1V3VA 3WZMA 2RGUA 1YJ5A 3GG2A 4AJHA 3QKIA 2B35A 2EW8A 1IPFA 3VYTB 3VH4A 1XG5A 3IVCA 5A4MS 3D2AA 3H2KA 2HI0A 2V7TA 3PLNA 2R47A 4BBJA 4X8HA 2ZXFA 4X61A 2EP7A 5EKDA 2C1XA 2ZBPA 3A1TA 1OMOA 3DDHA 3IIIA 4QWMA 5KNBD 5E1MA 2BMFA 2R7KA 1CNFA 2P3LA 3AEKB 3RS4A 3ZIUA 4DUGD 1GQYA 4OKSA 4TT3D 3RADC 1YCDA 2IUYA 2VPWA 4RMIA 3PWZA 1XTQA 1WUYA 2C0PA 3TLAA 2C5EA 4A10A 5DGDA 1S3FA 3T38A 4RTJA 2QY6A 4GG1A 1G7CA 1KEKA 3E18A 3FI0A 1VJRA 4BB0A 1EGHA 1ZS9A 1DJNA 2WI8A 3H5WA 2JA2A 2XTAA 1PQUA 1VL5A 2I4OA 3OTIA 3Q5EA 2XNJA 2HA2A 1H4QA 3AHDA 1LNZA 2QEQA 4ZT5A 1M7GA 1W48A 1KAHA 4GM4A 4IUCS 2LKDA 3MCUA 5THXA 5AOCA 1WQ3A 3EUWA 1G60A 2WIKA 3Q15C 5AW2A 5HQ3A 4CF7A 3IERA 3VO2A 3HSYA 3K30A 1ZI9A 3LY9A 3D8TA 1M2FA 3CUEF 2AFHB 4PHGA 4YQZA 4S3MA 2XUJA 5DTMA 1PR4A 5ALIA 3OA0A 2OYRA 3MAJA 4EF6A 1EUQA 1YU9A 3WYFA 5JH7B 4AP9A 4G0OA 2IU4A 3CB2A 3HUUA 1KMQA 4H16A 5LMUB 5ITWA 2HJ9A 3CT6A 4REMA 2JIOA 2I9PA 4R0VA 1YRHA 1QIFA 1CNMA 4UTZA 1UEJA 4MUKA 4MIYA 4XVHA 2WNIA 2VP5A 4AN1A 4HXYA 1PNTA 3SGLA 1YJAA 2IZ5A 4M0LA 4R1LA 4YAOA 4BVJA 2PRYA 3MJRA 2W58A 1QCCA 3MGCA 4UTNA 3TBHA 2K87A 5F7OA 2OB2A 5HWSA 1T8TA 3I6MA 4JL8A 1BOOA 1NGSA 3CUUA 3NETA 4XWGA 4KR0A 3V7FA 2QA5A 5I9LA 1C0EA 2JVIA 3D81A 1NVAA 1ZJ6A 4QQRA 5LPNA 2XRMA 4Z7NB 4CPDA 3Q88A 2B4TO 4AZ0B 1YB6A 5IVIA 1F6BA 4A5SA 1LPMA 4UCWA 2ZIVB 3ME5A 1SIUA 2XSZA 2EWMA 3KZXA 3R3VA 1VBKA 5F7JA 5GM2A 3IDAA 4KL8S 2QJRA 1D5CA 4U6QA 1T1RA 2A92A 3RH0A 4MQ6A 1N5DA 4JKIA 2WPDA 3P9CA 5IARA 2FYTA 1Z29A 5BYAA 4A9AA 1AU9A 2V4ZA 3JAWB 3ABRB 1S8NA 1TOAA 2YV1A 2WUDA 3HA7A 4IFTA 4M9ZA 4ITRC 3NYWA 3IDSA 2QU8A 2FAXA 5F1KA 3PQFA 5E7IA 5EWLA 3A9RA 4ZCQA 1A50B 5LWQA 4C2TA 1F8YA 1EXVA 1MA0A 2PGLA 1VFNA 2PSFA 4JBHA 4XJXA 4HEA1 3WGIA 4MQEA 4GKJB 3RIXA 1EFCA 4B2YA 3KHTA 5EXSA 4BZWA 4P0PB 1U5AA 1NDQA 3PDUA 3PGKA 2UUAB 2WQZA 3NHRA 1A8UA 4QTTB 3SJCA 1RI3A 1YCHA 1KY4A 3HS3A 2W83A 1X1BA 4E3ZA 1A8SA 5E7QA 1ZA2A 4JB0A 1FTGA 3ECSA 4J7UA 1QIMA 3ZGZA 3TL6A 1N32B 4WQMA 3NAQA 5A7HA 4P08A 1V1RB 4RGYA 2BKEA 3C3PA 1QR6A 1CQPA 4HNAB 4YRDA 5G3YA 5F64A 2CVHA 2XRYA 1V6SA 5BSGA 1GZHB 2FEXA 1H3FA 2O0HA 4L3WA 3DONA 2VJBA 5FKJA 1ADGA 5JJBA 3A1SA 1R5OA 3HBJA 1RCTE 3KAQA 1HUQA 1GU7A 1T0UA 4I5FA 4JBIA 3KLBA 4QXOA 5LZ7A 3RU9A 4FDTA 1JKXA 5JNTA 1YAHA 2JD2A 3R3JA 2RAFA 1DX4A 4MXDA 3EVBA 2CXHA 2RCNA 1C4OA 4R81A 4RLQA 5BO5A 5DM70 4DUYB 2XGOA 1KR2A 1VJCA 3G23A 1K6MA 2QUJA 3PTZA 1P2SA 5CBKA 3ER8A 3MLAA 3PHGA 1FU4A 1SMKA 4OBEA 3RLFA 4B7ZA 3I58A 4BFUA 1OWLA 5JQWA 5KYXB 1IEWA 5C1PA 2HO5A 1P1CA 1SH7A 4J75A 2RH5A 4LSZA 4W8OA 3T3OA 2X6TA 1J8YF 2EBHX 2XVZA 3QVJA 2VYFA 5CLFA 2A57A 2PRZA 3D5EA 3I09A 3D6FA 4FGKA 4PAQA 5IJ9A 3RBXA 3VR6H 4BNWA 4WBNB 1CUDA 3FXAA 4CDGA 1H23A 2JLWA 1VG9B 3ZPXA 2IYLD 1RKUA 4M2LA 1HLDA 1QQTA 4ZKEA 2QJTA 1L4GA 5AJVB 3RFCA 5CA0F 1BWQA 2Q1WA 4K28A 3TX6A 3QELA 1L4HA 3ZKWB 1E3EA 5EJ7A 3AZOA 5AXAA 1I1QB 3HCFA 4GM1A 3AI3A 3RUIA 7ABPA 3DMRA 1MV8A 4J0DA 1CDZA 4EA8A 2X3UA 5IDWA 2XBLA 1GUFA 2ZTMA 2P9EA 2Q4RA 2Q46A 4TRNA 3UHPA 4O3MA 3R3HA 4E4RA 1L3CA 4IHKA 4UNIA 5IHXA 4ZOEA 3TPZA 1CS4C 1S8OA 5EKTA 1KK0A 2NO4A 3MGKA 4OHCA 1JEYB 2GN0A 1Z3CA 3P4YA 5JZSA 3H5OA 4E2WA 2ZIZA 4DHEA 3AOEA 3H1PA 3HYNA 4OG2A 1N4DA 3WGNA 5AVYA 5K0BA 1W5SA 1FQOA 1TLLA 2ZRDA 1YJCA 2J45A 4ZEWA 3RKRA 2ZEJA 4FFPA 3TLKA 2HWUA 1DT5A 2QE6A 4ZA2A 1A7AA 3PJRA 3EGDB 3SIPA 5ALTA 4ZHQA 2E18A 1IAQA 4D0RA 3AYXB 4JSTA 3BERA 1MX5A 1DKMA 3T35A 4AJPA 1H94A 2DUJA 3GMIA 2CV2A 4D46A 2PS9A 4TZKA 5JHGB 4IQ4A 3M6XA 1GJRA 1XNJA 5HZMA 1T9AA 4RHTA 4G86A 5AJTA 2CUTA 4B71A 1I80A 1L4NA 1W85B 2AFIB 3D8RA 2DSTA 1M10A 4M7PA 3ZYZA 5B2EA 3T0FA 1JNXX 3EC1A 3H2ZA 3SNHA 1USKA 3GUZA 3LSTA 3BL6A 1E5TA 4EITA 4CU2A 1SQGA 5A1JA 3H1AA 1MOPA 2GHRA 1NP6A 3E9MA 3G0BA 3IT1A 4A2CA 4B32A 4EQZA 1TVMA 3I37X 1P39A 3OEYA 3MELA 3HNOA 4E11A 2DQSA 1L5ZA 4EJSB 1KVTA 3KUUA 2EJWA 4IXWA 2XOKD 4I46A 2NQ2C 2XMBA 3CUSA 5IC6A 1RTTA 3FYTA 3LK7A 4HQKA 2H5IA 4MRMA 4R5HA 3RSFA 4F3YA 2OWDA 4ZZ1A 1EESA 2PBRA 1KJNA 3MS4A 4IJUA 3JATB 4KQXA 4X1IA 4WLUA 2AR9A 2FMUA 4AQDA 3FDZB 4DR5B 1A8IA 3LBFA 2A5JA 5FA5A 1Y7TA 2VPIA 3DQZA 3CX6A 3LIIA 2X2EA 1E8DA 4FLMA 4RL4A 4EP1A 5BOSA 3GP3A 5KDLA 4V1CA 1J8FA 4QOSA 3CE6A 5TQ2B 2XD4A 4ENPA 2ZSAA 3QA3E 4MAFA 3FWKA 4TL8A 1QMPA 3H4TA 1V16A 2GO7A 3IAHA 3IFSA 3SHFA 2J5BA 2C97A 2FRVA 4B76A 1NRWA 1JG1A 5LOVA 2ZT7A 3JPYA 5B7QA 3ZWQA 1PR1A 3P2EA 2BRUC 1A9YA 1BTOA 4FFLA 3OC0A 3TH5A 5IM4F 3ENKA 1L4EA 4MVJM 3GD5A 3OHPA 5CBPB 5F2NA 1KNXA 4TPKA 3W8RA 1P75A 4CM4B 5F5LA 5BT8A 1WW3A 1JAIA 5EG5A 2ZIGA 3O73A 3H16A 2IX3A 4ZKDA 2PUFA 1UMKA 1Q95A 2NOAA 3LHIA 1D1QA 1Y0BA 4RZ3A 5CH8A 5CLHA 5AVZA 4BFTA 5KTMA 1RBMA 1XZJA 2CSXA 2BMWA 1OZ0A 2ZGVA 2QB5A 3OU7A 4MCJA 621PA 1OXVA 4JASB 4CLOB 4KNWA 2RBGA 3L18A 2QVBA 1NPDA 2XTNA 4HAYA 1LXCA 4OQXA 3TCKA 1IWOA 3NWEA 1Z0UA 2IVFA 3IUBA 3DVLA 1L5WA 1UANA 2PT9A 4B8WA 4EIWA 3GEGA 4HFRA 1MAVA 4KV9A 4DVGA 1F60A 1W0KA 1H1TA 2QSJA 3KYCB 4QT0A 5LP6C 4AS3A 3TTSA 2GPTA 2OESA 4KI7A 1SBCA 5K8JB 3KTDA 2FPRA 1YUNA 3ICOA 5EJ9A 4J0JA 1XRSB 2VJMA 1VCNA 3IRUA 3OSZA 1NE7A 2H2WA 1J8VA 1IBCA 2VSQA 1G7RA 3QQ5A 4YXWD 1E5XA 1KEPA 2RAPA 3USCS 1NMZA 3FMGA 5CB0A 3QOWA 1EFLA 3R20A 2CGEA 3NH9A 2EL7A 1DADA 1ZH4A 4LEIA 2K5UA 3HU2A 4CIDA 2OKGA 1RYBA 4PC2A 1BYUA 4LNUA 1JU9A 3DEHA 5SZIA 4PGAA 2G72A 4YRTA 2FPPA 4FGWA 2CUZA 4MUXA 2EYQA 2AOUB 1T6XA 3B9QA 3AEUB 3DWGA 3HUEA 3ZQ4A 1YI0A 1WCXA 1ZDMA 1BWSA 2HGZA 5KPJA 1BNCA 4HNQA 3IIKA 5ALFA 4R9RA 5CFZA 1SCQA 4N5HX 1JW9B 2FXVA 2AL7A 3GZ4A 1OX4B 3MUEA 5C34B 1Z06A 1JJAA 3ICVA 2IPAB 2UZ3A 2ZJOA 3P7MA 4XCVA 3NEJA 2PA0A 1TMYA 4Y2TA 1SOWA 3QE3A 4Q7JB 2NP7A 1Z8FA 3FWZA 3HGTA 1QOZA 5A0TA 1FU7A 2HZ7A 1SXGA 2IYXA 4NYMQ 4F11A 2WYUA 3FUVA 1SU7A 3ZDRA 1DAGA 2MU1A 3NTOA 1BCRB 4GPTA 4UHHA 2XWPA 3DHVA 2ZUDA 2PLNA 4IG4A 3G1WA 4NCNA 1DINA 5KYWB 1OH5A 5AW1A 2F1HA 3O9VA 4D3YA 2YASA 3FWPA 4I19A 3RSGA 5B36A 1QIGA 5C1OA 1G9XA 4DLKA 3PD1A 4RDHA 5CK5A 4UTVA 3KJEA 3PDCA 1NPYA 4MS1A 4OQNA 5CYGA 4CMBA 4MYDA 4CF3A 4UHFA 3TW8A 4H27A 3PNSA 1N2OA 1SUWA 2YWRA 4H9GA 4N18A 1PZXA 1IQUA 4XUDA 1J49A 4LBWA 5HFAA 5LR6A 3K71B 1CFJA 2FJPA 1R12A 1ZK4A 3LC2O 3A1UA 2FHPA 4J6FA 4LHYA 1UXHA 4D0SA 4G9BA 4HAUA 2MINB 3CPSA 4AL4A 1JKJB 1KDTA 3FMIA 3H5VA 1CD5A 3OUZA 1JQLB 3Q0IA 4UQPA 3CSDA 4ETIA 4HB2A 1JPUA 5J2TA 5KQPA 1RVDA 4O0LA 5C9ZA 1DL5A 2CEAA 3KU4A 2FPIB 1CY7A 4IWYA 4YT5A 1EGAA 4P80A 2D1TA 4CW7A 1IC6A 2D7JA 3DF7A 3WL3A 4U6NA 1YE5A 5F1OA 1ZRMA 3EK2A 2YV2A 1JLSA 4L3OA 1SZCA 1A9SA 4WCDA 3WBKA 2IOHA 1KYTA 3IQDB 4Q4JB 1Z9BA 4LE2A 2C9OA 1PNOA 2WSIA 3THWB 4IIJB 3G02A 4G0WA 2OV3A 3C3KA 4KIFA 5HZKA 3OP4A 4AMYA 3C7DB 1X1AA 2VT3A 2F8LA 2XCLA 3SPXA 1XZGA 3V7UA 3GFSA 4HQ0A 3UKOA 4EJSC 1TO2E 1BHSA 2FEMA 2OG1A 2YBDA 1NBWB 3QVWA 3TQSA 4RZXA 4RA6A 2VBCA 4K9MA 4DREA 3NYIA 2PUDA 2WUVA 1ZOLA 3U5TA 1CJCA 4WH0A 1EP2B 3PF8A 3ZDCA 1BXGA 3UAWA 2P6OA 3UCXA 1CB7A 2PLAA 1NW4A 4EG7A 1K6XA 5IUJC 4XUEA 4EWLA 4QATA 1IHXA 4JP8A 5L9AA 2YW2A 1TF2A 1KU6A 3WB1A 5K0TA 1GU0A 1JEEA 1II8B 4HAXA 4JBGA 3CA8A 1AT1A 5FAKA 1ZUD1 3AUJB 3LM8A 3OJ0A 4ARBA 1SK8A 3MCAA 4HPWA 1H8ED 3TRKA 3EG9B 1UKYA 2NPFA 3TZLA 2GJ4A 2JDID 3RS3A 1FDIA 5TVKA 2FMFA 2PEYA 1USVA 1U1FA 1Q50A 2Q9AA 3OY2A 3L1HA 3PNKA 1SG9A 1XU9A 4WASA 2IKQA 4YR7A 2VWQA 4URXR 3LCVB 1F2TB 1G5FA 2CDCA 3ABOB 4INJA 5D3ZA 4NBNA 1UKBA 3QE4A 1O6ZA 3S55A 3V1MA 2FSIA 3BHJA 1N33B 3UHOA 4X7PA 5DM0A 4HOYA 4P34A 5CA1A 3REQA 5AIBA 5CX1A 1B4DA 1QFYA 2OZKA 1Z36A 3K0CA 1QDUA 4AROA 2R8XA 4M1OA 5KTOA 3GJ8A 1SUFA 4FIZA 1QGUA 1U0NA 2F4NA 3S5JA 4B80A 2VPQA 2ID8A 2X58A 1L8QA 1KI4A 2PNJA 2BGTA 4X20A 1T15A 2EGUA 2I5PO 2O6HA 1U63A 4RDXA 5H3HA 1JTVA 5HEKA 2HJHA 3DXFA 5AI9A 4Q03A 3ZXIA 4TL7A 2O8CA 1TPZA 4BVKA 1CUFA 1SVSA 2JCSA 2VDOB 4JUIA 3WSTA 2GK3A 3WNQA 1R6VA 3WDMA 3UPTA 1P2GA 3JQQA 3QBEA 5C80A 1HNWB 4CKBA 5LNK1 2ZBDA 3PEEA 2HFKA 3JQAD 2FB9A 1HTBA 4LJYA 1ICEA 5EE5B 6Q21A 4BY9E 2IS6A 2DMRA 4RANA 3BEOA 4IHJB 4U00A 4X93A 4OYLA 2OHVA 4EFMA 4C5BA 2JHFA 3EY4A 4ZC8A 1R8XA 1R6UA 1VIMA 3B7GA 3RU7A 3HU3A 3DDSA 1Q14A 1NVTA 4N9WA 1XTZA 1QR2A 2AXQA 2CLLB 4K2AA 4BC1A 2OGTA 3JQFC 3VYWA 3B1YA 1U4SA 3MUOA 3ZV7A 2ATVA 2YWGA 3QVUA 4U7TB 4MV8A 3WE7A 3VA7A 3WQQA 1I2AA 4IVRA 3K8YA 2PSJA 4L8VA 1HNXB 3M1AA 1V1MB 3NUGA 3OPYA 1JHDA 1NJFA 3BMOB 1MRNA 1DV1A 3O5AA 2AW3A 3S68A 3BWVA 1LDBA 2JD0A 1P7YA 3GRZA 3ZIAA 3COPA 7REQA 3IILA 2GN8A 1VI2A 2AMYA 3AIMA 5F52A 3LY8A 1REQA 1Z4QA 1YQGA 2GEJA 4Q3EA 1WETA 2JFXA 1PF7E 1XPJA 1P5RA 2F6RA 2NTEA 2RGEA 3BC1A 3UMFA 1OPXA 5IKOA 4RV9A 5K3OA 3KPJA 1KRWA 2C7GA 4N54A 3GHHA 4KMRA 5KTRA 3A3YA 3TFWA 4TUYF 4FU0A 1IIRA 4B9AA 2A9RA 2O1SA 2F17A 4BPBA 1VIYA 2V7QD 4PPGA 3C1OA 3IAS6 3H7AA 5HCIA 3IMCA 1KZGB 5ICGA 1EINA 3R0QA 3GB9A 3EZ2A 4FX2A 1HQKA 4AWBA 3THXB 3EXEB 2QAGA 4LJKA 3O4HA 3SZMA 4OO3A 3E9CA 1MHPA 1VCOA 4W5TA 1R9JA 2CWDA 1DOZA 3MWFA 3KQOA 1QJ4A 5EP4A 3MJFA 3W4KA 3QF4A 2NLOA 1HZJA 1PSZA 3ASVA 3WQRA 4B81A 4QUEA 4EKDA 4YCLA 1CUSA 1L4YA 3HV0A 3EPHA 3UANA 2Y1LA 3GZJA 1G5PA 1RIFA 1EXNA 4QDUA 3HUTA 2ZSUA 4EW3A 4HVAA 1MT3A 1P7PA 4LJ7A 2YHIB 1U1CA 1KOLA 4DN6A 2QT1A 1RWQA 5FTKA 3G1UA 4LY3A 1LWOA 3OTHA 1XWFA 4P38A 4U3JA 2ZXEA 2QD2A 4MVWA 4OLAA 2LCFA 2VDUE 2NNWB 3C3EA 1L7NA 1XEAA 1HXHA 3TTUA 1N77A 1CJMA 1M5UA 2YUIA 4HFJA 4Q66C 4DCSA 4XFDA 1KIAA 1QGED 2CCGA 5J40A 4N3BA 1KE2A 1RRGA 2JAUA 5E0KB 1XZQA 1R7RA 1VE3A 2V9CA 1MDFA 2OV1A 3BFKA 3G8DA 1CHNA 3BJMA 4TV9A 1A5AB 1ZOIA 4CCAA 4LBYA 4KVAA 5L7WA 3E35A 3QXSA 4QECA 4DQKA 5AVWA 1PFGA 1NX6A 1ONOA 5KOIA 4C78A 2B4YA 2LRHA 3PDIB 5L3QA 1DC3A 4Y2SA 3F8WA 5FA6A 2G9QA 3TLGB 3K5WA 1V0JA 1VRCA 4TN5A 2Z6UA 4HO1X 5EWMB 1GP2A 1Z56C 4KHZA 1MCZA 5E9WA 3LDFA 1RT9A 1GNTA 2GARA 4F56A 3QGMA 2CJWA 5FULA 1YRLA 3CLTC 2GPYA 1AKYA 3FMVA 4LKRA 4I1OA 8AT1A 2W5UA 5K8TA 2X76A 3RGWS 1PI3A 1VI5A 1SURA 2ZRCA 4D5GA 3B53X 1EBFA 5HW0A 4P3OA 2HA5A 3USZA 1AK2A 4N0MA 5ALWA 2BZ0A 3AF3A 2CHVA 2WR8A 3SXUB 4AU1A 5JYDA 5DEOA 3O8CA 2VNJA 1HL7A 1Y34E 1LA2A 3ZR4B 4F3CA 1QHGA 5AUQA 2R6ZA 2YRFA 2GEVA 1DDOA 3UUEA 3H04A 3PIIA 1P17A 3LQ2A 1I36A 4YUXA 1SD1A 3OG9A 3H9CA 4JCOA 3BRWA 5GONF 4UTRA 4Z6KA 2Z4TA 3G85A 1WE2A 3QFHA 1NASA 5AKKA 3LGSA 4YROA 3TRFA 1R5JA 1ZIDA 2W6CX 4WY8A 1I6WA 1JSXA 3WDKA 1EJBA 3ZBPA 1JB1A 3B38A 3BMXA 4B8ZA 1DJLA 3N0WA 4P93A 3AR3A 2OXFA 2DVMA 2O8FB 2PO5A 1YNSA 2VTVA 3E7DA 5EE1A 1RDFA 1DXYA 1Y5NA 2G0AA 4IX1A 3SU8A 2HXSA 4DCPA 1A71A 1AKWA 3P0IA 2O23A 1G5TA 3QPVA 5I7FA 1ZGZA 4JENA 3S28A 4C07A 3FLAA 1FP2A 3GFVA 2ET6A 3C3JA 3Q5DA 1NVEA 4C76A 1QTIA 4HRVA 1LLUA 4D74A 1KZ6A 3DFIA 4N8DA 1YZYA 1XQVA 2AVNA 4TWZA 4Y6SA 2EJVA 2BEUB 1NVMB 2HA3A 1BXRB 3R5FA 3T5MA 3MK31 1RQNA 3LXMA 2YIJA 1FRQA 2DT5A 4K3VA 4N01A 3RD5A 4DCTA 3N53A 2OFFA 2ZRNA 1F2UB 1PJ2A 2XMGA 2R86A 3DD5A 1G3MA 2QLMA 3ORHA 3PSHA 1H5QA 2OD2A 2AG1A 4DIBA 1M9NA 4XQ9A 1JLLB 1YL7A 2P27A 3FBGA 2QUBA 4NEGA 1ZXBA 2ON6A 5D84A 2DFNA 2ZXUA 1PUIA 4URUR 3AVQA 2IBTA 3NHUA 2GM5A 5JMWA 2GT1A 1YC5A 4MDFA 3U3OA 1R4MA 5EGSA 1M2GA 3ZZTA 5U9CA 5B53A 2MSCB 6ADHA 3ICPA 1JDJA 1EXMA 3NHKA 1EWVA 3O94A 4MNTA 1TEXA 3VHLB 1A04A 2F1OA 3H87A 4FBGA 4MUGA 4GMHA 4XWTA 2NO9A 5F23A 1NNUA 4WINA 5ABPA 4QEKA 4A8JC 4Y98A 1G20E 2H1RA 5JCPA 1QZ3A 1FUYB 2P9HA 1KTVA 4QODA 2DPLA 2W00A 4NENB 4QOGA 4BU0A 4BX3A 5BWBA 3KTAB 5C8VA 1IY0A 3KRTA 1USUA 1XVIA 1QYVA 3C4VA 4KO1S 5BNIA 1ISSA 2ZWVA 4UVDA 3LP6A 4RK6A 4FJ0A 2HWWA 4P8RA 4ZXFA 2FUCA 4KK3A 1W35A 2BF4A 3U31A 1UWCA 5KI6A 3G5MA 4RIFA 3M4XA 1YQTA 3FPCA 1I7SB 5CDFA 2ZRAA 2J46A 4ZMSA 3IEIA 1CVIA 4YUAA 5HS4A 4KAFA 4LAFA 1Q3HA 2XITA 3N87A 4ON9A 3BL8A 4ZGGA 1JU4A 5JD3A 1IJEA 1B0PA 1ZUWA 3AWDA 2F48A 3CLSC 4NULA 2HRCA 4YC7A 1CYEA 5COQA 4UBLA 1K08A 2DKOA 1C41A 1FXWF 2A35A 3NLLA 2LPMA 5DO9A 1IOZA 1D4OA 2EKLA 2C9CA 2UYGA 1M73E 3PXGA 4LE0A 3VOAA 4AMZA 3CZCA 2B2NA 2WQ6A 1KZYC 4HZGA 4D9EA 3VUEA 3THOA 3L5KA 1ZQ1A 1OZHA 4W8GA 4TV8B 3AFGA 1E7WA 1YBMA 3I8OA 4NOKA 2E9SA 4ZCSA 3A9VA 4I7EA 2KE5A 5I47A 1ODFA 2OD9A 2XVYA 3K73O 3IGFA 4XX0B 4JBYA 1YKGA 5AR1A 1YZNA 3OM1A 1CUYA 1T6BY 4L16A 2FVYA 3W6NA 1N8KA 1PR3A 1MG5A 4RHYA 1CVRA 4WZBE 4AB1A 3EQ8A 5KX5A 5A0VA 1VBMA 1JBQA 1XWWA 2PWBA 1GQOA 2V6BA 3I01M 2G07A 8GPBA 4U0KA 2RD2A 4YDQA 4XE5A 3WKEA 1J06A 3AF5A 1QZXA 1NUQA 3IDQA 3CZ5A 2XUAA 2QAJA 1Y7IA 4XB6B 1OLSB 4X66B 1OTYA 3JU3A 2QTBA 2XNCA 4JFAA 1QF9A 3LCJA 3NFRA 1NA5A 3OZSA 4V24A 3ZWDA 5JD4A 5KNCD 1XJQA 3GRFA 4HXFB 5FBZA 3WNCA 1BDMA 1NZFA 3FNEA 4JT2A 4D42A 3RBAA 3GAZA 3NONA 4UUAA 1ULHA 3R77A 2JFNA 2O3JA 1J99A 1GTVA 4L08A 4C1BA 3K9WA 2OAP1 3ADOA 4BRWA 4HDKB 4CQMA 5GJBA 4OUKX 2YIDA 4HNUA 1U2DA 4ESEA 5KWVA 2G63A 1E79A 1Q57A 5FLEX 5L40A 2QIPA 2B69A 3JRXA 4HNRA 4RKWA 5A5DA 3BTSA 2LDBA 4HDCA 1PJ8A 2Q5EA 1TZKA 3NNDA 4H6VA 2ZBFA 5EQDA 3RUCA 3TVYA 1KQFA 2FSUA 5AVRA 1MABB 3AHCA 4ALMA 3EZFA 1O94C 4YRRA 4M87A 4A8JA 1HSZA 1KO1A 4FMDF 5EZYA 1DAFA 4MUIA 5G1NA 2J1LA 2J0UA 3BH0A 4BEWA 3SKVA 4ZTZB 1PQWA 5I8ZA 1DAOA 2GN2A 3LQRA 3UO8B 1OFGA 4GI3A 1S01A 4MWSA 5H59A 5CB4F 4D25A 1ZNWA 1JHAA 2GMWA 1DJOA 1NF9A 2C2XA 2WA2A 3C5CA 3C7KA 3HI6A 2WA1A 5EVCA 3TBKA 4B2PA 1UT6A 4I8DA 4WW0A 3MFYA 1HLFA 3V4OA 1PVOA 2VJNA 3GN2A 3OCZA 4Z7JA 3RVLA 5C81A 1UK8A 1BD3A 3SQDA 1E5QA 1KMCA 4M88A 1HLGA 1RI2A 1Z4NA 2NSYA 5EFZA 2FSVC 4D8TA 1J21A 4QYSA 2A0YA 3CTPA 3PFNA 5COBA 2RG7A 4FE3A 3KOXA 2CCJA 4YCBA 1T4BA 4AKEA 5JVDA 3AZQA 5FB3A 2HMVA 2LIPA 2X7JA 3O3MB 1SNYA 1WM1A 3WGOA 5BWNA 2DTEA 4HH0A 4Q39A 2C1ZA 3EFOB 1QYIA 3HDQA 5DXFA 4KREA 2Q6TA 1P61B 3GJYA 4LG1A 5A9TA 2C82A 1FVHA 2O2SA 4MS3A 4AJEA 1UZUA 5ALYA 3UJNA 1W73A 1FJ2A 2XQVA 4G1VA 4MQFA 2V59A 3T7DA 1E3IA 3KZ1E 4NH0A 3FZNA 1MJFA 1U0FA 1JQKA 2PZ8A 2QORA 3SI7A 3Q3JB 1ECBA 2FR8C 1YA8A 2UZ1A 5I9BA 1GO2A 3G13A 3FUUA 3TD6A 4PGFA 4RAQA 5FOUA 2ZUSA 2IEDA 2ZE8A 1U9ZA 3CEJA 4R41A 4YN3A 2OBLA 4F91B 4HEHA 3HFGA 1Q84A 3PGJA 4LQCA 1GAWA 1YQWA 5EC8A 4K1LA 1WRBA 2R79A 3DH0A 5K01A 3NI2A 1BW9B 2WU0A 4EO9A 1KHHA 1H65A 1LPSA 2XDQA 1QZTA 3KXKA 4NBLA 4TWIA 5A04A 1RCUA 4RQAA 4NL4H 1SRQA 1WKBA 1ESDA 4FFBB 1JSZA 5I5GA 4WMLA 1NXTA 4KFSA 1RP1A 3HJBA 2G83A 4HF7A 4YJ2F 2PT6A 3DCYA 3N39C 4NDAA 2PHZA 1N7JA 2I3BA 2PS3A 2ZAIA 1E0AA 1KY2A 3DOOA 3C3DA 3IXQA 5DYWA 4MP3A 2ROQA 4MTLA 3ZZ0A 1QPGA 2GTIA 3F4KA 4HMQA 1Q17A 4WLNA 5EFOA 2FZKA 2QD1A 3THRA 4F6RB 2D1SA 1E62A 1CS0A 3K6JA 1RNLA 3KPWA 3CWQA 4MVJD 4ZI7A 5IT9A 3PC6A 3L0YA 4WFIA 1NJSA 2PAFA 4E70A 5LDHA 3OEED 2PKYX 2UKDA 1YTUA 4X00A 3HMKA 4IJQA 1ZK3A 3DWFA 5SY4A 4ENWA 4EABA 4F6CA 4C22A 2FSVA 3FMPB 4P2BA 3RAFC 1ULZA 4OQEA 4HTAA 3HRKA 1ZUNB 3I34X 3QBDA 4I9NA 4LV5B 1VG8A 1GD1O 4MIOA 5I7RA 2C2WA 1BZYA 1QFZA 1PT7A 2JJ1A 3OJWA 4PO9A 3IOBA 4JUBA 4U7FA 1SC6A 4C2AA 1E6MA 1PR0A 1U6IA 2HRDA 3AL3A 3KPUA 1B0ZA 1J97A 1KVQA 4LY6A 1S1MA 5C8YA 3WLTA 3K0SA 2O19A 1PHPA 3UENA 1DQNA 2GD2A 3OESA 4DV0B 2VDKB 1OC4A 4UUMA 1UC9A 4QVGA 3DOCA 4JITA 3S29A 5K45A 1PFYA 2XOEA 1FP7A 4OAOA 5TARA 2ANBA 3B1KA 3LYAA 2PU7A 3DEJA 4K9OA 1AUQA 4IWNA 4RY2A 1W59A 1DEKA 3KSUA 2RGCA 1E1RD 1WDTA 1DEOA 4M55A 3VC7A 1WSDA 1CJBA 4LZZA 4UREA 4UOZA 1JHPA 5IABA 1PGOA 1FY2A 1DAHA 5REQB 4HMPA 3PK0A 1YHZA 3ONDA 1A5SB 5A4DA 2YMQA 3Q3VA 5E1DA 1ODTC 2FQ1A 1IHYA 5ERYA 5FPPA 4HH3C 5LZ4A 4NK4A 4Y9UA 5F3WB 3SR0A 2PBFA 1Q12A 2QPTA 3BRQA 3GRKA 2APJA 3PQ8A 3DVQX 1C1XA 2BKVA 3ROTA 4D81A 4IXDA 2AJLI 4M0KA 5FPQA 1P0QA 2YXNA 4Z49A 2KM1A 2VWPA 1JSLA 3OIVA 4H17A 2G9RA 4IS2A 2JI4A 2E4XA 2O2ZA 2VA9A 1XQ6A 3PNVA 3QFFA 4NZYA 2RAUA 3M1LA 1OYYA 1TF5A 1ZXLA 3NHWA 3QE9Y 1E3TA 1WY7A 1O6FA 5K6RA 4IIVA 1I8TA 1S89A 5A1TA 3VHQA 5DX0A 4BMVA 4Y8VA 5I5EA 1RQRA 4LFAB 3KBOA 4XWYA 2O59A 4EB0A 3ELUA 4KXYA 4HDOB 2LBPA 3GZTB 3LDHA 2H51A 5JCJD 5CK4A 4IJKA 2IT1A 2V4MA 4BVBA 5IS2A 2YBEA 1GGJA 1YDFA 1OYOA 3FDIA 3HVKA 3MT7A 4C7VA 2BFBB 1X42A 1X74A 2HN9A 1LVUA 3KHSA 3LF2A 4JLOA 1LBEA 2GDJA 3KVNA 4NYJQ 3TGWA 3WB9A 2G67A 4MJ7A 1N3BA 1XCBA 4TYMA 2WU1A 2Y6UA 3CEHA 1J39A 1DRWA 3F7OA 3GCZA 5B1HA 4KITB 1WXQA 3NRJA 4IDNA 3JAKA 1UPXA 5CXSA 3ZCUA 3U4QB 1OT5A 4E22A 2IEYA 5ENDA 2COKA 3QUSA 2P9ZA 5EKSA 4UQLA 3JWGA 3SIWA 1YC2A 3EVAA 2V6FA 2DWCA 3HZRA 1JQBA 2VWHA 3KKMA 3VPDA 3NDRA 3IUNA 1QUEA 3OZUA 4RFLA 1FFXA 3F74A 3RVOA 2IPLA 2Q27A 5FWNA 1K6IA 3MMZA 3RVMA 1C1HA 1JI3A 4ZK6A 2GJKA 4FQ5A 3N8NA 1YS7A 2N9UA 3G5TA 4XYLA 4L22A 5AK6A 1XZLA 2G6BA 4J07A 1AN0A 1N36B 2G0NA 1JYSA 2YS6A 4Z51A 2XDAA 1CB0A 1UOQA 2I3ZA 3KQVA 3KTOA 3O2SB 2PBZA 4N3CA 2KW5A 1TC2A 2VNHA 5AJZA 4BRZA 2VAWA 3SX2A 4HT3B 1OLOA 3FCEA 2LV8A 3WNDA 2VH1A 3HB4X 1A1SA 2CFRA 3IVAA 2XWSA 3WK4A 2QMEA 3CYFA 2WUGA 4QPZA 3EW9A 4XD2A 1UBKS 1NC3A 4DWWA 5EUMA 1M6EX 4IBOA 5JPIA 2YL2A 6NULA 3IT2A 1E9VA 1Z68A 2A8YA 2I0FA 2NVWA 3C39A 4LHEA 2XA1A