1DWOA

Crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Hydroxynitrile lyase
total genus 97
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwoA00
5JALA 3ESCA 4ZGBA 2V98A 4CI9A 3G0CA 1CUSA 2JGMA 3STXA 1F8UA 2PSEA 2VJDA 1TCBA 5AKJA 2FX5A 3BDIA 5AK5A 1YCDA 4DTCA 5D6OA 5AM5A 1C4XA 1WB4A 5C7YA 2FUKA 5CW2A 1MX9A 3I6MA 3OPMA 4MWSA 1N8SA 1MNQA 4MEAA 1F0NA 1T2NA 5A71A 4U2FA 3I1IA 1GQRA 2O2IA 3C8HA 3WJ2A 4QLOA 2HL6A 5JATA 1A8UA 1ORVA 3WQHA 3M81A 3HRHA 2XLBA 4X3CA 1XQYA 2H7XA 5E4JA 3WL6A 1XZGA 5JZBA 4UPDA 4WFKA 3LP5A 1K8QA 5DYWA 5CH5A 1H22A 3FOBA 2Y6UA 4J0DA 3W05A 1LPSA 4KYVA 4OB6A 1ISPA 4Q3OA 1UK9A 1XZDA 5E4TA 3R3WA 1BROA 3GBSA 2HA6A 4RGYA 3FVRA 3QMVA 5EHQA 1CUBA 1MU0A 3NUZA 1CUUA 2JGIA 3V1MA 4NZZA 4F5ZA 4IHAA 2HDWA 2XUJA 1ORWA 3D4LA 3R41A 4WFIA 1J06A 4BP9A 4CFSA 5FUMA 4H0CA 2I3DA 2HA2A 2XI4A 4BDTA 4PV7A 5A7HA 1XZIA 4YASA 5JAPA 1BS9A 4FMPA 2VF2A 5ALHA 1CUGA 1UK8A 2XE4A 3S8YA 2PBLA 3C6BA 2VATA 5ALPA 5LIPA 4NS4A 3BE8A 5AJHA 2PSDA 4W1RA 3F67A 4PSCA 4BTLA 1ZOIA 5CH3A 2VSQA 1K63A 2WFLA 3G02A 5AM2A 1JU3A 1KEZA 2BFNA 5AKGA 4EA6A 1YSCA 3TRDA 3DQZA 3KOOA 2XUKA 4X6UA 4H18A 3R3YA 4AMYA 3WKCA 4IH9A 4UHCA 2Z8ZA 3VJKA 3VVLA 2H7CA 3LCRA 1CUDA 5LP1A 5ALTA 3K2IA 4UHEA 4J7AA 5AOAA 3IBTA 5FPPA 5HK8A 4C4ZA 3D7RA 5AKKA 1DX6A 1EI9A 4ZREA 1UKBA 4BP8A 1H23A 1CUCA 3PI6A 3D3NA 2PKYX 1U4NA 4AB1A 5ALYA 2WFZA 2WUDA 4PSUA 3WZLA 4X90A 1OXMA 4DMHA 3FYUA 2XB6A 5AKZA 2BKLA 1AKNA 1W4LA 2QOEA 3L1HA 2AJLI 5ALEA 2WUEA 5KREA 3C6YA 3VJMA 3HI4A 5JZSA 1Q84A 4FLEA 1A8QA 1DINA 4J3JA 5ALFA 3O0DA 5BV7A 5JARA 1EK1A 3C8DA 1EA5A 4KEAA 3C43A 1EB9A 1C7JA 1XLWA 3DLTA 3AUKA 4AQDA 5JADA 3ZLUA 2V97A 1TCAA 1CEXA 1VA5A 3WWOA 4INZA 4U2DA 1MN6A 1BEZA 2HRQA 3C5WP 5DJ5A 2O7VA 2OLEA 3WYNA 4E46A 2XMDA 4DNQA 4H7FA 4PF1A 1A8SA 1BE0A 3I6ZA 5HF5A 2DSNA 4QNNA 2H7YA 2BJHA 4H7IA 4BAUA 1TRHA 3M3DA 2R11A 2XUGA 4DM7A 3EBLA 5DYTA 1DX4A 1UKCA 2HU7A 1Y7IA 4HRYA 2OCLA 5HK9A 1JFRA 4B0PA 3W9BA 4EZIA 4OB8A 4E14A 2CJPA 5AKYA 3I2FA 3BDVA 1EXWA 4B6GA 2RAUA 1R1DA 4ZV7A 3CCCA 5IVHA 3G7NA 1SCIA 2DHDA 5EI5A 2O7RA 1NU8A 3PUHA 4DMFA 2WJ3A 3WL8A 5ALJA 5SYNA 1VE7A 5LZ4A 2BUAA 4KAJA 4X71A 2X76A 3BIWA 1W76A 4QA9A 1UT6A 3WYDA 2YYSA 1B6GA 1IZ8A 4QEKA 5J3JA 3YASA 5HFAA 1QIEA 3Q8WA 1MNAA 5ALZA 3QMWA 2CMFA 1WB6A 5EIAA 2BUCA 4Y2RA 3D5EA 2FJ0A 5AM1A 5AOCA 4QDOA 3D0KA 5K3BA 3R0VA 3DNMA 4KE6A 5ISMA 1LGYA 2XUQA 3DL7A 3ICVA 2WILA 5DTIA 3WWPA 4U2EA 1EVEA 1QIKA 4B83A 3W06A 3FVTA 2GYUA 3WLAA 2V9ZA 4MWTA 2ACEA 4OU5A 1XQWA 4GDMA 1YAJA 3W04A 1PFQA 1GQSA 5HKBA 1UK6A 4OB7A 5YASA 2ECFA 1W6RA 3LLCA 1UZAA 2WUFA 4B80A 3H0CA 3WL5A 3CN7A 2XMCA 3PDCA 1BRTA 2WHQA 1S8OA 4JYPA 5ALIA 4L3WA 5AI8A 3QYJA 3G0GA 4QDXA 3MUNA 4WDRA 5FRDA 1T4MA 3BF7A 1VJ5A 4X93A 3I28A 3IB3A 3GZJA 5DNUA 5IVIA 4GHWA 1GPNA 2C7BA 1THGA 4J03A 4CCYA 2NW6A 4X7BA 1LBSA 3L1IA 3WWCA 3G9ZA 3DKKA 1XRPA 3G0BA 3CCBA 1G66A 5ALDA 1FFDA 1LLFA 2AJDA 2HU5A 5LZ5A 3QPCA 4F0JA 2XUIA 3CXUA 1A7UA 3D2AA 3IUJA 3VKFA 5AO9A 3AFIA 3VJLA 2QS9A 4U2CA 2BGNA 1H2ZA 1DWOA 1L7RA 2XUOA 2QTBA 1ODSA 1SCKA 2XUPA 1DTEA 1WCYA 2WLSA 2HFJA 1RYYA 4BRZA 4LXIA 2DHEA 3ZLTA 2AJBA 1E8MA 5ALWA 5E2IA 4EHBA 7YASA 4UFOA 1O6GA 3MGAA 2ZJ7A 2JGLA 4AZ0A 2XQIA 2WSLA 3BWXA 4P92A 1JI3A 4ROTA 3WK7A 3GROA 1F6WA 5LZ9A 1FJ2A 4H7JA 1QIGA 4C89A 5AI0A 2VJAA 2WQZA 2OQVA 1CIJA 3FLBA 3H1AA 3V1KA 4H35A 3H17A 3LIIA 5T4HA 4J0KA 2WFLB 4IH1A 1AMNA 2JGKA 4GLBA 2HIHA 5ALLA 3S2ZA 2GBGA 3PF9A 4H7DA 1IMJA 3QZUA 3BJMA 2IITA 4FLFA 1JJBA 5DYYA 3NGMA 4G8DA 4XVCA 1R3DA 1H2YA 5EHZA 3QITA 4B85A 2VTVA 1XZHA 1WM1A 5EHNA 1CVLA 2QZPA 1ZI6A 1ODCA 5HF9A 3WKAA 5AKXA 1E66A 3DL4A 1WPXA 4ARAA 1H2XA 5ALMA 3CN9A 1FFEA 2BCEA 2DQZA 5FLKA 3RM3A 4I19A 3I2IA 2Z3WA 3O4IA 1A88A 2JBWA 4PQEA 3FYUB 1IVYA 1LZKA 4RPCA 4Y2QA 2PX6A 1LPAB 1GKLA 5LZ7A 4IQ4A 4YX9A 3OG9A 2FJPA 3EIOA 4ZI5A 4UHBA 4J0JA 1XZEA 2XLCA 2J3DA 2YH2A 1ZICA 2WIGA 4X85A 4FBLA 5C8VA 1DWQA 1CR6A 1ETHA 2X5XA 4YPVA 3QMMA 3R3VA 2K2QB 5D3ZA 4QWMA 4QE3A 5K3DA 1CFJA 1QOZA 3T52A 3Q0TA 2WHPB 2XDWA 1K4YA 3M83A 2PUJA 4K6HA 2G4LA 5ALNA 3IUMA 1VKHA 5LKRA 3H2KA 4IH4A 4N5IX 4JEIA 2OGSA 2BUBA 3BF8A 4AX4A 4P9NA 2QJRA 2QMQA 1JMYA 1P0PA 4B0OA 1YR2A 2QUAA 2QRUA 2V96A 2DQYA 4RNCA 3WKBA 2CKMA 2ZJFA 1LZLA 4EY4A 1JU4A 4K6KA 1K5PA 4G1FA 1DT5A 4UFNA 2WIKA 1TAHA 3A6ZA 4FTWA 1XZBA 4AO7A 5JANA 1XROA 2VT7A 4X6XA 4Y2JA 1M33A 4XWGA 4P08A 5AM4A 2B9VA 2ROQA 3P2MA 2B4KA 2DR0A 5C81A 2GYVA 1ACJA 3ESBA 1JMKC 4G8CA 1GPKA 3EF3A 1OILA 3SX4A 1XRLA 4N8EA 5HCUA 1GGVA 3VXKA 2QVBA 4GI1A 1SOMA 3WKDA 2GBCA 2VA9A 5AICA 4HTAA 2WKWA 3BJRA 3TJMA 3I1YA 5ALUA 5EFZA 4M0MA 5AI5A 1HPLA 1TK3A 2WIFA 1CUYA 1GZ7A 3I2KA 3STVA 3C6ZA 2WIDA 2HA3A 4B7ZA 4HVTA 1LPMA 3I6YA 3ZLVA 3ZWQA 1EK2A 1LBTA 4KJXA 3ANTA 1QJ4A 2XMSA 2OGZA 1GPLA 3IURA 1CUVA 5F4ZA 2CUTA 2JEYA 3T4UA 4Q3KA 4ARBA 5AK6A 1CV2A 1FFAA 1MPXA 3ED1A 5EGNA 1ZD2P 2JGEA 4WY5A 1YA4A 3QBJA 3AZOA 2OQIA 3SK0A 2Y2VA 3F96A 1MJ5A 2OPHA 2PSHA 4FFWA 3F9CA 2BAGA 4UHHA 3STYA 3FWHA 1HQDA 1I6WA 4OUKX 3SWWA 1VA4A 1XLUA 2PSFA 2Y2UA 5FP0A 4B81A 2J4CA 5FKJA 2ES4A 3NWOA 3FLAA 2Z3ZA 3PF8A 2HU8A 1E3QA 3G0IA 2WHPA 5IKXA 2WTMA 2XQFA 4FOLA 1BN7A 1KU6A 5ESRA 3I2GA 5JAOA 2OXEA 1GXSA 4X91A 2YASA 3GFFA 4HRXA 1AGYA 4CCYB 2QM0A 1Q83A 1RP1A 4X6YA 2XUHA 5K3FA 1AC5A 4FNGA 4C87A 2VQ6A 4DGQA 5DTJA 4WFJA 3LIPA 3VVMA 4C01A 5AM3A 4FFVA 3O9VA 1O6FA 3STUA 2P8SA 5JD4A 4DNOA 2GYWA 2R8BA 1H2WA 3WIOA 3V9AA 4HXEB 3E3AA 3WL7A 1EX9A 1DU4A 1E8DA 3BIXA 1EVQA 1LPBB 5LZ2A 3HABA 4UFPA 1UOOA 4MYSA 4H7HA 1FFBA 4PW0A 3ESDA 2PVSA 1QIHA 2HA7A 1GT6A 4JUIA 5ALQA 4FKBA 4ZRDA 1UK7A 4PSDA 5ALSA 4OU4A 1IUNA 2HFKA 5AH0A 5FOQA 5CXXA 4FWBA 3G9UA 6YASA 5CRIA 3EQ9A 2B61A 3STWA 1VXOA 1ZIXA 2GBIA 3N0TA 1ZJ5A 5CT9A 1TIBA 1CUIA 2AXEA 4UHFA 2E3JA 2YXPX 1R4ZA 4PO3X 1Z68A 5EIEA 3IULA 3PFCA 1D07A 4FDMA 3AZPA 2JGJA 1E89A 1UFOA 3TGLA 5FXMA 4N8DA 1TCCA 2GBFA 1CUFA 4AXBA 5AKHA 3VISA 3O95A 5K5EA 1ACLA 3R40A 3D59A 4CG1A 5CXUA 4X95A 4CIAA 4AN1A 4H77A 4K5QA 3E1GA 4CG3A 3H19A 4QWWA 1G5FA 3UUEA 5T4FA 1AX9A 3DYVA 4XIIA 2O2HA 1VLQA 2OCGA 3C5VA 3WWEA 4OPMA 1CUHA 3F98A 4N8SA 3WZMA 1ZGBA 2W22A 1XZAA 1VOTA 5I7UA 2QJWA 1P0IA 2ORYA 4KE7A 4BCBA 4MQLA 4CCWA 2H9YA 4KRYA 4YK7A 2ZYRA 3JW8A 4QDUA 3WK8A 2XQGA 3R3UA 2WJ4A 1J2EA 4JH0A 5K3AA 1JT2A 3GA7A 2XQJA 3MUOA 2PPLA 4Y2PA 4DMCA 3A2MA 3ZI7A 5CT8A 4UBLA 1NX9A 4UBKA 3HACA 4M0EA 3WMRA 5AK4A 4LIPD 4B84A 5A7FA 5H3HA 1F0PA 3AINA 1YS1X 4TPKA 3DYIA 5CT4A 1K6EA 1W75A 1XZCA 3OOSA 5LKAA 2ZSHA 3HZOA 3IUNA 2C0PA 1XZKA 3A2NA 5AI4A 4BAZA 2C58A 1EINA 5JZ9A 2JGFA 5IVDA 3KSRA 5HFNA 2ZVDA 5AKLA 4JYMA 4WCVA 4H7EA 3AIOA 1R9MA 2ONCA 4OSEA 5K3CA 1AZWA 5BWBA 2I78A 4RE5A 2RHWA 4GEGA 5AOBA 1CQWA 3OM8A 2DCMA 4OCZA 2PM8A 1ZD5A 1GKKA 2ZYIA 1BN6A 3ZPXA 1ZIYA 4HXFB 5FPQA 1YA8A 3PE6A 4BC0A 1CUJA 1QLWA 2DHCA 4DLNA 1QONA 3V1LA 3U0VA 4D9JA 3BXPA 4BVLA 1UXOA 4S0XA 2WIJA 1WB5A 5ALGA 2OGTA 4Q05A 4BC1A 3GELA 1XRNA 2DFPA 5CURA 1ZGCA 2OCIA 3H2JA 5HQ3B 3AIKA 2RIPA 4ZWNA 1ZD3A 2XUDA 4BDSA 4Y9SA 4NMWA 1CUXA 1XRMA 3HJUA 5AKEA 4OYLA 1X2BA 4AMZA 3HLKA 1NU6A 2ZJ6A 5A2GA 3EQ8A 4DSZA 5CT6A 2PU5A 4MEBA 4G8BA 2PSJA 1ODTC 4BB0A 3HSSA 5HF8A 2C4HA 3WK9A 4A23A 1CUAA 1E5TA 4I4CA 4GXNA 5ALXA 4I3FA 2OAEA 2HA0A 1CUWA 3TEJA 4HZGA 2AJ8A 3RKSA 1JKMA 4A16A 2HADA 4J0CA 2XMBA 3HXKA 2WU3A 1X2EA 3DD5A 1VZ3A 4QZVA 4HXGA 3K6KA 4RE6A 1HLGA 2QUBA 5LYYA 5JYCA 5BWCA 4UHDA 4L0CA 3ANSA 1HKHA 2WTNA 1MTZA 4NVRA 3OTQA 2D5LA 4FNMA 4OYYA 3O9MA 4GW3A 1Q0RA 4DNPA 4CIBA 1Y7HA 1G42A 2GZSA 5JAUA 1MX5A 3FCXA 1QIDA 1BEEA 1DT3A 4DIUA 3DOHA 3OURA 5C8XA 4TGLA 3O4HA 5LLSA 2OG1A 3HEAA 5JIBA 1VE6A 4BCDA 2ZYHA 1PJAA 4FBMA 4Q82A 3WJ1A 3IDAA 5KBYA 4Z49A 1MAAA 1ZJ4A 3FAKA 5CBKA 1W52X 4EY6A 5AI9A 5ALVA 3R3XA 2RHTA 1QFSA 4Y2XA 5AKIA 1U65A 4JNCA 4F21A 4EY8A 1QTRA 4W1PA 5AM0A 5AK3A 3DDUA 3I2JA 5K3FB 4DSAA 4DYHA 2Q0XA 4MQMA 4ZV9A 5D7BA 4BYMA 2UZ0A 4M0FA 2EDAA 2CEKA 1ZI9A 3IUQA 5E4YA 3U1TA 1X70A 3FBWA 5K3EA 1B41A 4Q34A 5HQ3A 1R88A 1BU8A 1N5MA 3G9XA 1YASA 2CB9A 4HS9A 1MT3A 1WHSA 2JEZA 2VAVA 4KE8A 4TVKA 2C0QA 1FFCA 1EHYA 1EB8A 4EBBA 4BE4A 2XMGA 3AILA 1EH5A 2Y1KA 5EHXA 4MYDA 5ALOA 2O2GA 4BVKA 1BCRA 5LZ8A 5JD5A 1YB7A 2WFMA 3H2HA 5KWJA 1CLEA 3QM1A 4HAIA 3KWFA 4BATA 2ACKA 1QFMA 4UBMA 1AUOA 4FLMA 1P0MA 5A62A 4Y2SA 2VJBA 1KU0A 1G4HA 3D2BA 3W2TA 4P93A 3VDXA 1EDEA 3AIMA 1XFDA 2QR5A 1WHTA 3FYUC 2PL5A 1QTIA 2QT9A 4C4YA 2XUAA 3DKRA 1OCEA 2RGUA 1SCQA 3FSGA 1HL7A 3UMJA 5CT5A 4X97A 3ZV7A 2HA5A 2WU4A 3IVMA 4G9EA 3RARA 1XZLA 2RONA 1XZJA 4L9AA 3WK4A 4W9RA 1LPPA 1SC9A 4BE9A 4Q3LA 4DNFA 3OC0A 3WA7A 5D3KA 5KWIA 4QDZA 1ZD4A 2WM2A 1R9NA 3H2GA 5HKAA 3KDAA 4UBOA 1UOPA 1Y37A 4Y2UA 4KAAA 5AP9A 1WPRA 4J0GA 4GECA 3E0XA 5DNWA 3V48A 2C5FA 4E11A 4XX1A 3G8YA 3L1JA 5DWDA 3QH4A 3O4GA 4MJ3A 4A5SA 2IX9A 2C5GA 5FDFA 4C6HA 4ETWA 2WUGA 5SYMA 4WY8A 2J3QA 2QXUA 2BGRA 3PUIA 3IA2A 1CUZA 3H1BA 3ICWA 3W9UA 2B20A 1DQYA 4QLAA 3FCYA 1YAHA 3WK5A 4BZZA 5A6VA 3H18A 1L7QA 2HRRA 3B12A 4H7KA 2HM7A 1C7IA 1TQHA 3LS2A 3QPDA 1RWQA 4N5HX 4UBJA 4Y2TA 2RI6A 1QIMA 3C45A 1L7AA 4WJLA 4KE9A 3WKEA 2PUHA 3BL8A 2LIPA 1E8NA 2JF0A 2ZSIA 3PICA 1QO9A 3H2IA 4K6GA 2D0DA 3C70A 2QKYA 2AJCA 1UWCA 3D2CA 4AO6A 2GZRA 3SC2A 3F8SA 2VT6A 2WG0A 5I8PA 4LYEA 2VJCA 4G9GA 4LXHA 3DCNA 3M82A 1YB6A 4Y2VA 1LNSA 4KRXA 1CPYA 3N2ZB 4G4IA 4B9EA 1DWPA 4XJVA 1J07A 4ITVA 3V1NA 1QIIA 4J0HA 5IVKA 3WA6A 3B3QA 5JASA 1MX1A 1SFRA 2G63A 3C87A 3F97A 1AQLA 1HBJA 3AZQA 4Q1VA 4BZWA 3A2LA 4AN0A 5FV4A 4CG2A 5A7GA 2I03A 3WIBA 5DLPA 1P0QA 1XQVA 4AZ3A 3FYTA 3A70A 1YS2X 3E4DA 3WWDA 1AURA 1Q0ZA 5BOVA 1VZ2A 3PFBA 3QPAA 4E15A 4PNZA 3JWEA 4BAGA 5JD6A 3QVMA 1EDDA 4BVJA 1MO2A 3RLIA 2X8BA 5CTAA 3FNBA 4K2AA 5EIHA 4O08A 1TKRA 3I2HA 4WDQA 4IO0A 4W63A 5C8ZA 3ILSA 1XKTA 1U8EA 1THTA 5IH7A 3HC7A 3G0DA 5T4BA 2Z5GA 2EEPA 4BBZA 2J4FA 1QGED 2OAGA 3ESAA 4B82A 3MVEA 2XMZA 3R3ZA 5ALKA 1UKAA 1QIJA 2WJ6A 5I9IA 3X3HA 4DMKA 4QDTA 4MXDA 1U2EA 5CH8A 4Y2YA 4UBIA 5AIBA 5CMLA 1XZFA 4U2BA 2XMQA 3WK6A 1MAHA 4KAFA 1IUPA 1USWA 1DQZA 4X92A 3FLEA 3DJYA 4KACA 1QIFA 5JAHA 3KWJA 3IIIA 3STTA 3EQ7A 2W6CX 4FHZA 1N1MA 2HA4A 3JYHA 1QZ3A 2Y6VA 4X00A 1CRLA 3WI7A 4F60A 2PU7A 3GUUA 4LXGA 4C4XA 2XUFA 4UUQA 3DS8A 3RK4A 2XMRA 1PV1A 3HYSA 4G5XA 1LPNA 2CZQA 1QO7A 2G5TA 1XRRA 3K9BA 2VAXA 4LYDA 4Y7DA 1VXRA 3B5EA 4W1QA 5HF6A 3UUFA 2VEOA 3NOXA 4KR0A 4J0IA 4ZXFA 4AO8A 2IIVA 2WHRA 4GWLA 1CUEA 2I3ZA 4EY7A 1QE3A 1EDBA 1HDEA 2CBGA 2EDCA 4EUSA 2ZYSA 4B9AA 4BTVA 1JJFA 2XT0A 1WOMA 1UOQA 1IZ7A 2QXTA 2HHAA 5ALRA 2XQKA 4BRSA 3O4JA 3KD2A 3DEAA 4LKOA 4UBNA 5AHXA 5DNVA 4W1SA 4X94A 5AIAA 3DOIA 2WG1A 5T4EA 1IUOA 1XQXA 4EB0A 4G4GA 1XLVA 2H1IA 4OD0A 1W1IA 4BCCA 1ZI8A 2JIDA 4EY5A 1XRQA 1J1IA 2OCKA 1N5RA 1CQZA 5HZGA 1R50A 3FSGD 1LPOA 3C6XA 4LHEA 4GBGA 3KXPA 2G5PA 3G9TA 1FSSA 1JJIA 3AJAA 2WG2A 4L72A 4C88A 1BCSA 2Z8XA 5AI6A 3H04A 4G4JA 4U2GA 4V2IA 1XZMA 1XKLA
chains in the Genus database with same CATH superfamily
5FA6A 1SH7A 3ZX4A 1T9CA 1DWUA 1MLDA 2V7PA 3AF5A 3G0CA 3O8OB 4KQEA 1WZCA 4O2BA 3QI7A 4QYIB 4AMUA 4I8XA 3S8MA 4DV0B 4LGCA 4JQOA 3WJ7A 1NVKA 3X2SA 4U9UA 2R66A 4GWKA 4AULA 5AKJA 1XLTC 1V45E 2FX5A 3ADDA 1M7BA 2X6TA 1ONOA 1YCDA 4DTCA 4JLMA 5D6OA 1C4XA 4AD8A 5EJEA 4X66B 1XMOB 1G3RA 1XMVA 4WGFA 3DCIA 4GBED 5CW2A 4EJ6A 5A4AA 2C59A 3KOYA 3P52A 3OPMA 4C3OB 3CUUA 1MNQA 4I4TA 5C8YB 2X22A 3JQGB 1S01A 3RYFA 4U39A 1BNCA 1Y5RA 1TXGA 3NRCA 1OXSC 3HV0A 2O7QA 4TSRA 4QNRA 4U2FA 3I1IA 1F4VA 4XVRA 3NTLA 4CYMA 3WJ2A 1W5SA 1UC4B 1X7WB 2C9BA 3COSA 3HLYA 3N87A 2UYQA 5EQFA 4IXNA 1T9DA 3KQLA 4JI4B 2W2QA 4QXQA 4A15A 4OQQA 1JZTA 2P2SA 2A3RA 3M81A 4BO5A 4C6TB 3JYPA 1ABEA 1P2BA 1JSXA 2FZLA 2IHYA 3DXXA 5DBFA 3WBFA 1P72A 1X6VA 5BYBA 4KR7A 2AXPA 4PZDA 3L6EA 5EXEA 3UMMA 1EUYA 2IUEA 3UG7A 5JPIA 4MP8A 1Z8NA 2ZI3A 2UXDB 3PVSA 4QUAA 3NHYA 4NZ9A 1E96A 4I1IA 3GDOA 5SY6A 4WVFA 5D85A 4ALLA 4E5KA 2COKA 3D7SA 4KIGA 1KH1A 4UPDA 1JEEA 3UHAA 4WFKA 3MINB 5AOVA 1K8QA 2FFRA 3H2SA 3PXXA 3VYVA 5DYWA 4QG3A 1BFUA 2FFAA 2V8BA 3IOBA 2R00A 2P4UA 2XNSA 3H6HA 4J0FA 2FWAA 2YYZA 1H22A 4LQLA 3FX2A 1PW7A 4TZ0A 3VJRA 2XYHA 1T4BA 3W05A 4YNBA 1JTFA 3RUPA 3PPIA 1U0OC 4ILKA 1UXJA 5CLJA 2NYRA 2WT8A 4OB6A 2X2PA 1O1YA 1QWSA 1ISPA 3NALA 2QSYA 2J45A 4Q9LA 2REQA 1Z6AA 4TLAA 2A3NA 2C8VA 2PX5A 4QEDA 4D57A 2D0IA 3JVEA 3R3WA 2OORA 3K72B 1BROA 4PLYA 4KXWA 4RY2A 4CV0A 2O2ZA 1I9CA 1T8SA 2ZRKA 5TRTA 3AVXA 3FCEA 3MWDB 4XFKA 3WGIA 1N77A 2F59A 3FWYA 3QMVA 4E4YA 4PLGA 3K1TA 1TW2A 1GTRA 1F8YA 4M1OA 4XGQA 4LHXA 1Y98A 1P2SA 2JGIA 1I4EB 2QIPA 1TO6A 4A3SA 1X0XA 2ZYTX 5AW0A 2M32A 3EZ7A 5BVGB 2XUJA 3AEQA 3TLZA 4CCAA 3AY0A 2JLCA 4TTQA 3ZGNA 3G2HA 2XNJA 3D4LA 3R41A 1KJ9A 1X87A 5F78A 4MB2A 2DPHA 1TB4A 4E5SA 3L1VA 3QI2A 4NJEB 4U63A 4Q4CA 2W6NA 4BP9A 2DULA 5FUMA 1N5IA 2I3DA 3MJVA 3QUCA 5DLYA 3N1UA 2PJUA 3A0UA 4BDTA 1SQSA 1L7XA 1U2TA 2JI9A 5A7HA 3WGVA 4D45A 4ZMSA 1TD9A 3TEFA 3OOEA 1BU5A 3JQ7B 4Q1CA 3AKZA 4JBYA 3T9BA 1TZCA 2OZKA 2I8LA 5LU9A 1KZ4A 1T4DA 4YCJA 4MROA 2ZCUA 5JS6A 5ALPA 5LIPA 3ONVA 4EENA 3OE1A 3Q12A 4I5EA 3JQBC 1KDPA 3SKVA 5JPCA 1V8BA 2ECKA 1DXQA 4IRXA 4QVKA 4E21A 2PSDA 3D43A 4N3BA 5IPFA 1RXWA 3F67A 5EQJB 1RCTE 3GVIA 4XD7D 1U5CA 2BE7A 3A8TA 1WXXA 1UMCB 1MX3A 3G6WA 3KOMA 3ND5A 4BTLA 1ZOIA 4NFHA 3T41A 2B8TA 4LHZA 4MRRA 1OTHA 2R8YA 3V1TC 1TMGE 2ZSEA 1KO4A 2BZSA 4X1KA 4BLQA 2VSQA 4FC6A 3GAFA 4I46A 3B2QA 1XD8A 2BKAA 4TMYA 2IQ5A 2QD1A 4H1WA 1KOLA 3FB1A 3OPXA 2QENA 3QY9A 4MITA 4AZTA 3R8FA 1NRIA 4CEHA 1N7GA 4KGDA 1JEDA 3EASA 5IUJC 3QG1A 3L7YA 2GD0A 1UBEA 4P3OA 2XUKA 1ADJA 1XKQA 4WK0B 4BLSA 5LDDC 1CR2A 4O4HF 3B13B 1X3LA 2NX2A 4IH9A 5FX2A 1D2RA 3OQOA 2X6RA 1E1DA 4P4SB 3BZBA 1IB0A 2G0TA 3DLHA 2H7VA 2GM9A 4RU1A 4FW9A 5LP1A 1R4MB 5FTNA 5ALTA 4QPPA 5EHGA 2FTKE 5L8VA 4PR0A 4LJAA 2CUNA 5F2OA 3PHGA 3MWEA 5L51A 5AUPB 1T0BA 3WIEA 3LA8A 2L2QA 1RVDA 3DUFA 1LJLA 3L4BA 2BZ0A 1RIIA 5AJTA 3OE5A 3IBTA 4Q9KA 2A0UA 3I9KA 5IAEA 4AJ1A 3FKSD 1EFUA 1OLOA 4OREX 2O5VA 3K9CA 4E6PA 2G88A 2IHBA 3VOBA 2VAMA 4ZDWA 4KO8A 1JG7A 1RZUA 1TRKA 1JLLA 1P0CA 2ZI6A 4G0XA 3OCJA 3O94A 4MR9B 4RCYA 2QTVA 1P7CA 3KQMA 4FSXA 1SBIA 1SMKA 2EWWA 5CDFA 3AEXA 3PI6A 1UM8A 4QUJA 1UMBA 3TZ6A 1U9IA 3BD6A 4L15A 5BR4A 3EA4A 1KJQA 2P91A 5HW0A 2AJTA 1CETA 2ODBA 3BICA 4QEZA 3TRKA 3UV7A 1MJFA 4CW7A 4RQUA 5AVSA 2YWGA 3OZDA 2WRZA 3SHFA 1L1QA 3L46A 3SYKA 4ANFA 5B1HA 4X90A 3M7IA 1V3QE 3I23A 3NHFA 4TVOA 3WZLA 4DMHA 3W5DA 4EKNB 3IR6A 1T5LA 2DCUA 2ISQA 4FFBB 3ZGOA 3RS7A 2BGKA 4M76B 1Q0QA 2OPBA 3OMXA 3IV9A 2QOEA 3A11A 3I30X 1HH4A 3D4IA 1YKSA 4AWBA 4EUKA 5A4MS 4W5QA 1YRLA 3JPWA 2JGDA 4Q9HA 1Q84A 1I51A 2HMTA 3MQ4A 2ZIXA 1P6QA 3TKAA 4I9NA 1B1AA 2PH3A 4FWIB 2HUPA 3FPJA 1I4LD 3TSOA 3LQQA 3VR2A 1UPXA 2FH5B 3W2FA 4EAAA 1VHDA 3VU3A 5JARA 1EK1A 4IDDA 2C4UA 3NIWA 1EA5A 3TVTA 4KEAA 4BMSA 2ZB4A 1EP3B 2EP7A 4RK6A 3BIOA 3DOFA 4Q1EA 3WBBA 4AUKA 3T1OA 1QDUA 5BSHA 3DLTA 3MBOA 4NCNA 1PEAA 4YJKA 3NWBA 1OFVA 5INTA 2XKKA 4PRYA 3BAFA 1GUDA 4JL8A 1EFRD 1SWVA 2OK8A 2V97A 1TCAA 1K6MA 2YINC 3NTQA 4G0WA 4TV8F 4XOIA 4ZK2A 1HA3A 1VA5A 5C0OE 3JPYA 2H08A 5IM4A 1KH2A 3N2GB 1WW8A 2QXYA 3IE1A 2WA2A 4Y6RA 1TJNA 1U8AA 2D1YA 1G3UA 4QJ3A 3S2SA 4UVHA 3O73A 1A2KC 3CSSA 3PE3A 4JI2B 4R84A 4CL0A 3JV7A 3PGVA 4ZO8A 4MUHA 4BFWA 2NO7A 2YWJA 4J2OA 1SC3A 1M0SA 2O2YA 2ZWVA 3ZDZB 4TMXA 2VRCD 3E3LA 4H7FA 1BAPA 4TLDA 3RFXA 1O94C 4F4CA 3HHPA 1B0AA 1A8SA 5DFAA 1WXDA 2B25A 2CYBA 2BHRA 3AOEC 4KQIA 5B6PA 1DCFA 2PSSA 3RYIB 1WWKA 5DXJA 3MLAA 3O4RA 3M4ZA 1RWWA 2CK3A 5J2TB 2H7YA 2REXB 5IDQA 2Z57A 1KMQA 2R6DA 4QU8A 1Y9ZA 3RU3A 3JATA 1VL0A 2FUG1 4BNWA 1GNPA 2QRZA 1OGIA 2NO4A 2WZDA 3A3NA 4LZLA 4KU4A 1MA3A 1OZGA 4DM7A 2Z5LA 1VJTA 3PEVA 3UGKA 4L95C 3RC9A 3F0TA 1L5ZA 3HN6A 2KI5A 2RHJA 1YIOA 2R86A 5G3YA 1JFTA 2QYSA 3SYRA 1EQAA 1UKCA 1N78A 3U80A 1BS1A 5KYWB 3C0KA 1MW8X 4C5AA 4BLWA 1VJCA 3P0JA 4EPWA 1P61B 2RD2A 3QEKA 4HRYA 3DHEA 1DO8A 1KI1A 4OBEA 4TTPA 3ROMA 3ZQUA 3KIPA 3S70A 5HK9A 5HZMA 5L6MB 4B3MB 3WY9A 4OA8A 3LOUA 4CG0A 1E99A 4F9GA 4AMVA 1BVRA 4L0QA 1E20A 1C4WA 1NX6A 2HO4A 3I2FA 5AKYA 3WQRA 4HVCA 1JDJA 5KJEA 1DC3A 2VG8A 4UDXX 1T5HX 1JAIA 5DDIP 3EDQA 3CCCA 3KX2A 4RMHA 2AKAB 3USCS 2ZU6A 3LDHA 4PS1A 1US8B 3ZWNA 3K94A 3W5VA 4X20B 5U9CA 3KNZA 2Z0MA 1MB3A 2O7RA 1ZFNA 3OEEA 5HA5A 1X7ZA 2O2EA 1OWMA 3VZCA 2ZRCA 2FK7A 3R4VA 3D4PA 5AUQA 4FGSA 4ENVA 5C1DA 2PNJA 3RADC 4W8GA 2OBBA 1F2UB 2C99A 2H11A 2Y1WA 4IQFA 3GT3A 4FQ8A 3BQ9A 3FJ1A 4JQSA 3HU2A 2BUAA 4X71A 4XGRA 3ZS8A 1P9LA 3BIWA 2ID9A 1GZ5A 1YQGA 2VDKB 2FW8A 4QUEA 2JCSA 5FNVF 3TPFA 3IDFA 3IEIA 1KAHA 1NE2A 3ABQB 3BWVA 1UT6A 3PQDA 1SU8A 1XHEA 5KYGA 2V0GA 1N3YA 2Q6VA 4MYUA 1B6GA 1L8QA 1LUAA 4FYHA 3GDGA 3ZY4A 3TECE 1S8FA 1UFRA 1NVUQ 2RHDA 3EVZA 4QEKA 4DR5B 1L5MA 2OUKA 2Q9UA 3MBIA 3H1TA 4EW6A 4HZUA 5BORA 5D1NA 1SD5A 1ZN8A 2OO5A 4JQCA 4L27A 5DPMA 1WB6A 4BASA 2WM9B 2LCFA 1EGMB 1XL0A 4D3ZA 4JB8A 3T1VA 4KR6A 3ROGA 5F3RA 4Y2RA 1P8JA 3P27A 1NXQA 1Q5PA 1X15A 3OETA 4XPZA 5AOCA 3UTDA 3DNMA 5H5JA 2GTHA 3NKFA 4MS3A 1QORA 4KE6A 4H1UA 3QNWA 5LMCA 4FGUA 3DDSA 1QHXA 3M2TA 2FWMX 4OAPA 1E7YA 3PQ5A 1NKSA 4YS6A 1D9XA 1G21E 3QBTA 4RDXA 1WMDA 1DI0A 4K03A 4CIXA 2PKWA 4B83A 1H3FA 2I7XA 2XUZA 2FLWA 3T3EA 5A2GA 2GYUA 1YE5A 5KJ6A 2HXYA 3PWTA 2ACEA 2C8JA 4TRMA 1XQWA 1Z83A 2QE6A 3RUFA 3W04A 4H6WA 3IAS1 3QHAA 4X3PA 3O8BA 1NR7A 2GN4A 4X65B 2O52A 2GARA 2X1MA 4MGKR 1A9SA 1N2SA 4QODA 4OB7A 5DNEA 1WDTA 3ZLBA 1DC8A 2G36A 5E95A 4YAWA 5IK2A 2X5NA 3H84A 4M38A 3N2KB 3R9WA 4NBKA 5CB4A 4R6XA 3SXUA 3UHOA 1VSVA 2GOYA 4U6SA 3ND7A 4GL2A 2JBAB 3LLCA 1J8VA 1NW8A 1UZAA 2WUFA 5I8ZA 4X8OA 4QXOA 3F5QA 4DIMA 3U4IA 2XDQB 2DETA 3RKRA 1TA4A 3UN1A 3JAWB 3H0CA 1KZGB 2CLEB 2PZBA 4NBWA 3OI7A 1E0KA 2FSVC 1H1LA 2X9LA 4GSYA 4I2VA 4KLZA 2XMCA 5BSEA 2OCYC 1F1JA 4KNWA 2AX3A 1NOKA 5A2QA 1FU4A 1RTKA 1XZ8A 1BRTA 2ODEA 1UKZA 1R8YA 4GIBA 5JOQA 3IOEA 1ZEJA 4A0SA 4JENA 2WHQA 5GPBA 3QJYA 3GIDA 1Y80A 4UXJA 4JYPA 1PZHA 5TQVA 1E5DA 1U3FA 1VP9A 2ZI5A 1U1EA 4RCZA 4JLSA 2H16A 5IUKC 5AI8A 1H66A 1Z5OA 4Z7OB 2ORWA 5HS4A 3DBVO 4ID3A 5AHOA 2JVIA 5FA8A 2PMBA 3QYJA 4CMGA 3IMKA 4TLCA 4EO7A 1DJMA 4EI7A 1X1BA 4YROA 4DLSA 3M6AA 4BVFA 4DR1B 1KOFA 3LG2A 4WEOA 1L4HA 1VJ5A 4F2DA 2R6AA 4QDKA 5D84A 1QRSA 3FRJA 3KT3A 4X93A 3I28A 1U28A 5C3UA 3IB3A 4Q4HB 1HE5A 2FRDA 4Z8XA 2AEFA 1OOEA 3DE2X 3JQFA 3CW2A 1TUGA 3MM4A 4NE2A 4TS1A 3RRMA 3UMYA 1SXGA 3NANA 4MUAA 3FPAA 3PEEA 4HFMA 4L4ZA 5C51B 2CE2X 5JVDF 1RWNA 2IYLD 4K9DA 1DAEA 2O3RA 3TAUA 1R5OA 2JHGA 3DTTA 1C4OA 3V46A 1N2CB 1THGA 4X1YB 4AUMA 3ICQB 1HYEA 4W9NA 1JHPA 4DC0A 4N65A 4E5NA 4BVEA 2C7VA 4MYRA 3N8KA 1KWKA 5JJ5A 4CEIA 1KFBB 3AONB 2NV6A 1QE0A 3RLFA 1AKTA 1A97A 1PT6A 3OBIA 2D3WA 1UDBA 1OZ0A 2NZVG 3RR2A 3SJCA 2XCOA 3ZZTA 3A26A 1WDKA 3B3JA 1KBQA 1XRPA 3G0BA 4FE7A 4LWZA 1FVFA 3QU9A 1E6KA 1JDVA 1OHHD 2I33A 4JEHA 1HF3A 1P73A 5CM2Z 5FJJA 4F0JA 1C1HA 3UZUA 4P4UA 4TLLB 4DA9A 4DIFA 9ABPA 1IZ9A 3GJ8A 5E6UA 2DLDA 3VGJA 3AFIA 3W1VA 2DBZA 5F21A 1PJ8A 1YDHA 4QXRA 3T1TA 4NYIQ 2WWWA 3PDUA 1Q1EA 5BN3A 2QQEA 3HYNA 3IODA 3FCUB 1V8FA 1Z2DA 2JFYA 3M4XA 4P4LA 4HDCA 3SHOA 4F46A 1M34E 1ESNA 2I1VB 4XQCA 2IEZA 3BMOB 2BEKA 4KQKA 2AFIA 4O4IB 1TADA 4KWTA 2NWQA 1P3JA 3V80A 4KBFA 4EPRA 4IV0A 4MGIR 2WOJA 4FPXA 1VMKA 1WUTA 3CZAA 1SXJA 3HO8A 2VNJA 2XUOA 3FMOB 3LF2A 3QYFA 4JC5A 4OXQA 3AB7A 1SEPA 1E7RA 3H7AA 4K86A 2C3PA 3TVYA 2XUPA 3CKMA 2I6TA 2JAHA 3AVPA 2CNWD 1WCYA 2WK1A 2E5FA 5FOXA 4L4RA 4CZ2A 2JLVA 4X0EA 3WIDA 4E0BA 2FNAA 5F7XA 2KB0A 4ODIA 4BLUA 3LUKA 2DHEA 3MOGA 5EUCA 2HCTA 4FS8A 2RBGA 2ETVA 4M1MA 3T94A 2P9JA 2QJFA 5DIFA 1ORRA 4NHOA 1XNQB 2BFCB 1C14A 4CMAA 1ISGA 1CEQA 2LR0A 3CMCO 3V2UA 1YI8A 4AZ0A 3HDHA 1N5JA 2LKDA 2R4UA 4IZOA 4Q5IA 2VPQA 3MERA 3K0SA 1CX9B 2PRSA 2VWHA 3IP7A 3E0QA 3ENVA 2WSLA 1L4KA 2EERA 3BXHA 3LY8A 3MLEA 4YRFA 4BL5A 4HNAB 3B51X 2GFHA 1C29B 1JI3A 5EXDA 3R5FA 4KQFA 3I9V1 1WNTA 5THQA 1GCUA 5EKUA 1P4HA 3FZNA 3KHTA 3VNSA 5C1OA 2AN5A 1JMVA 2Q8QA 3Q5DA 5IFKA 1F14A 4KOAA 2P2ZA 4MARA 5GOZA 1UPCA 2W2XA 4OHRA 4PZPA 5REQA 5LZ9A 3A1CA 3ENZA 1YH3A 1FJ2A 5AXDA 4H7JA 5EZYA 4RY0A 2B4QA 3CR7A 4A8HA 2QTCA 2ZWPA 1QIGA 5HE8A 4YXWD 1W2WB 2OE2A 2XE8A 2Y4OA 4TN5A 3CG4A 3B38A 4OI4A 1PO7A 2AA3A 2XRYA 4Z4QA 1CIPA 1KQPA 2Q29A 3DM5A 2WQZA 1FJHA 4GM1A 1H8HA 2PUDA 2BHNA 3RHFA 2Z4TA 2H51A 2P11A 4JBHA 5CDHA 1LDNA 2PUAA 2CFOA 1XEWX 2VRNA 3E2IA 4G84A 3V1KA 3VPXA 2GCEA 3CVJA 3RSSA 5T4HA 3BQMB 2Q0QA 1AMNA 1WBBA 4GLBA 1D5WA 1SVNA 2G08A 1L4NA 2XNDA 3M4NA 3RABA 5EZ5A 4CF6A 4KMRA 2WSSD 1EE1A 1Z12A 2C5LA 2NU7B 1GSHA 5ALLA 5JCZA 2NXCA 1FRFS 1MXHA 1JHZA 3PF9A 4BX8A 1T8UA 2X1LA 4H7DA 5BSMA 4D5GA 1AN9A 1OIXA 3QZUA 1SVLA 4BQSA 3IDSA 1U0TA 2ODWA 1RWMA 3JD0A 2B6NA 1MC5A 3K1AB 4IIJB 4FLFA 2YJ6A 1FB5A 3AR9A 1ZNQO 4NR0A 4EG6A 4X5OA 3WXBA 2JJ1A 5IAGA 5K0CA 4QM6A 3LA6A 2FZEA 3K20A 2WQ6A 3NHAA 1QFYA 5KQSA 2YJTD 5G0VA 3UWKA 5B4UA 4C2TA 5KUTA 1E9SA 4UUOA 3NAQA 2X86A 2WYVA 4G0ZA 3PSHA 3KTAA 2J6HA 2Q46A 4DEYA 3I34X 5EHZA 4EUEA 1JZSA 1T91A 1O96A 1JG4A 1OBCA 4II2A 3ILYA 2GVDC 4JT4A 4OBWA 1QH8A 1T3TA 2NSJA 4GICA 4M21A 1XZHA 4ND3A 5LA6B 3SJ7A 3IS3A 3GH3A 2E37A 2MINA 4FHFA 3NONA 1ODCA 3QPUA 4P31A 5F7ZA 5HF9A 4J3FA 3ZEAA 3GN1A 3WKAA 4RHUA 1E66A 2H9AA 2O2DA 3OFJA 2VJLA 2J7PD 3OE7D 1TZBA 3H8SA 2X0NA 1WPXA 5AW4A 2FZKA 4PRKA 1SVMA 3E6AA 5ALMA 4G5QA 3BRSA 3CN9A 1U8XX 1FFEA 1BXRB 1GEEA 2BCEA 2DQZA 1VIMA 3ZXXA 5LUBA 2XQVA 3EVNA 1H6DA 1R6BX 3BMQB 4I19A 1PZXA 2VQEB 1J1UA 4HBZA 1IHPA 3O4IA 2VZ0A 3KBBA 4JGBA 1A88A 2QAJA 2CMKA 6REQA 5JT1A 2EW8A 2D2VA 4PQEA 3S55A 3NFYA 3PUXA 1NF2A 1DEXA 4ZMRA 1VMAA 1LZKA 1Z2PX 3SHTA 1FTNA 5EWJA 2VJPA 3IQWA 1C5KA 3NLLA 1FS5A 4Y2QA 4MGEA 5EWLA 3WGOA 3ZXSA 2A5LA 3OBBA 2GBLC 4NBNA 5LZ7A 3BFXA 2IYVA 4Q3BA 4CV3A 3I4CA 4LE0A 2FJPA 3LX8A 4ZI5A 1Z7WA 1L3CA 3TLBA 3HJHA 1TM1E 2GR9A 3P71T 8AT1A 1KMMA 1L5OA 3H11A 2ZUCA 1XWIA 4ZREA 2FR0A 2NUTA 4MRMA 1VPEA 3P9RA 1DWQA 2CN1A 3WGLA 1ETHA 3BS4A 4O4LF 2J3EA 4RV5A 5IC6A 4YPVA 4V0QA 3R3VA 1D6MA 1E7MA 1ZD9A 5EQDA 2QM7A 2PWAA 2OHXA 4V0KA 1LVHA 4UU7A 5D3ZA 4QKQA 4HLDA 4JLOA 1V7CA 3B1FA 3W7VA 5C7LO 5SZIA 2PXXA 4KTVE 2QBYB 3ZD6A 1CVIA 3MWKA 4ZAVA 4DREA 3ZV4A 1GG5A 1QK3A 2BPOA 5K3DA 1HNZB 2G06A 5EPEA 1J00A 4BJHB 2JB9A 1GA1A 2X4DA 4KVFA 2WHPB 4C0SA 5AUOB 3E48A 1NUPA 2BGIA 1QC5B 2I4OA 2EG9A 2P5TB 2Q2NA 2QX6A 1ISJA 1ND6A 2E2WA 4MI1A 4X62B 2C78A 1SKMA 2A58A 3WAKA 4B2YA 3ZBUA 4LYFA 1SCUA 1WBJB 1XDSA 2VSOA 3FJYA 2QQ5A 2CW5A 3A31A 4MUEA 4N5IX 5JBIA 3FDZB 2JZCA 2HAEA 1W581 1NQXA 1HO3A 1QYVA 1ZM4A 2LGJA 2ZT7A 3NHWA 4XX0B 3K6JA 5J59A 5JAIA 1BTOA 4LNHA 1RJ9B 2G67A 1SOWA 2ADOA 4BNGA 2W8ZA 3WX0A 5EIWA 2QJRA 2CFCA 3PT9A 3G8CA 4D5EA 3KUKA 1JMYA 1GGEA 1NRWA 1P0PA 1SU4A 3KP1A 4US0R 1MB4A 1X14A 2QUAA 4YMVA 5IU6A 2QRUA 2VL7A 1U0BB 2NGRA 5EXXA 4NESA 4G0PA 5IMBA 5C32A 2WYHA 5FBLB 3BHIA 1VL2A 1UBHS 1WS6A 4B32A 3GVCA 1PTJA 4M49A 1JLKA 2VC2B 4EY4A 3O3CA 4ZODA 1JU4A 4ZZ1A 2Q0SA 4O1IA 1K5PA 4ZCMA 5MHTA 1FSZA 1TAHA 1NFRA 2O3JA 3BCHA 5AK0A 3ZBTA 4A8TA 4NXNB 1DCKA 1U4OA 4HT3B 1U3VA 521PA 1D8AA 2IPXA 4AO7A 1O94D 2ZSFA 3QOFA 3Q98A 4M86A 3HCCA 4DXDA 4NP6A 4RM2A 4X6XA 3LGSA 2ZRBA 3VR5D 2V9CA 1KA9H 2OUIA 4WBNB 4ZI2A 3IELA 1PJSA 3AMVA 3FWNA 2IIPA 2PX0A 2Y05A 3N0VA 1JEQB 4Q4AB 4DLLA 5BR7A 4JEUA 3W8NA 1DKOA 3MUFA 3AESB 3P2MA 4NIMA 2N1MA 1T9BA 2VI5A 4JLVA 4GUAA 3VOTA 4YJ3F 2DR0A 1NAHA 2IK8A 2FF7A 2BMVA 5K0BA 3TE6A 1V8ZA 1HQKA 2ZIZA 2N0SA 3K9GA 1KJYA 5F7JA 5FHRA 2VDWB 4DDKA 4W9MC 5ENDA 1F2VA 1XRLA 4N8EA 1OWNA 2AE2A 4NENA 1D4AA 1FDTA 4C76A 3ORQA 2D2XA 2XZTA 4R2MA 1XWWA 1QH0A 2FRVA 1RPNA 2QX7A 4ND1A 4XGNA 5CPFA 4MUKA 5L9AA 2PYZA 3RYIA 3KQUA 1GZUA 2VA9A 4YJ2F 3WNDA 3WOVA 3HGQA 4HTAA 3U81A 4BS9A 2JD1A 1Z7EA 2QL7A 3FMPB 2QU8A 1NL3A 3GZTB 4AG3A 1ZK4A 1SURA 3L7MA 2R8EA 3A9UA 4ROSA 3TJMA 4UCWA 3GLGE 1E3TA 2VUSA 2J31A 3PJGA 4ZU6X 5A9RA 4E22A 2EFEB 3U7QA 4HNUA 5ADUS 2X2OA 2IKSA 4R2IA 3WLSA 2HBRA 3QVJA 1H42A 2WIFA 1UBRS 1RQPA 2QTHA 2DHRA 2CF6A 1GLNA 1S7GA 1GZ7A 1U9CA 1ZK0A 2LZ0A 5JH7F 4KNVA 3KDPA 4EUHA 2AHOA 2B7LA 4XLZA 2ZSAA 2RG1A 5GZ3A 3TYXA 1JQJC 5DZSA 4P5EA 4I55F 2FKNA 5HIIA 1LDMA 1QP8A 1IVNA 4ZT7A 4EIWA 2CNOA 2VNIA 3N39C 2F8TA 2RHHA 3GMSA 4Z3DA 4MRSA 3CCFA 3IIEA 1HT3A 3HUUA 3QW2A 1Q2UA 2VRBA 3GT7A 1XQ1A 4QUHA 2GN1A 4GYJA 2R1ZA 2O8EA 3BMXA 2WYOA 1HG0A 2VAPA 1W88A 3QLTA 4D9GA 2PMCA 3LLMA 3AKCA 3UM9A 5IJ0B 3M6IA 4FOTA 4ZT5A 2I4RA 2WBLC 3IURA 1LVUA 1IOLA 1CUVA 3VTFA 1TGYA 3WADA 4X54A 4E03A 3Q9UA 2CUTA 3S5UA 4LGMA 5BXYA 2BZ1A 1KY4A 4ZVPA 1AKQA 2BFBA 5JSHA 4OYHA 3FB4A 3DBIA 1XSEA 1EVKA 1IHXA 2M6SA 4KQ9A 2VK2A 1U3DA 5FL7D 1XPOA 2OFWA 2JW5A 4KH0A 4AP6A 4D8VA 3BKXA 4Y1RB 4FXPA 3V3TA 3JQRA 5A03A 4WY5A 1YA4A 4EITA 1YDFA 4F93B 2RGBA 3AZOA 4I2NA 3FXAA 3H97A 4BQIA 1MC4A 1NMXA 4F7WA 3DE6X 4JL6A 2WJYA 3WGHA 1MJ5A 2A6PA 4N47A 1BC5A 1QKKA 3KJNA 4FFWA 1I2BA 2PUVA 2AB0A 4XDZA 2PLAA 3AEKA 3IAFA 4UHHA 4ZU3A 3STYA 5KNCA 1ZRHA 3FI9A 4MCAA 4YBZA 5L4LA 2XGOA 1RZRD 4NZNA 1T1IA 1KJNA 4X24A 2C4KA 1I6WA 4F5YA 1QMPA 3LWDA 4R8VA 2C61A 3SWWA 1L4EA 5FTJA 2OC4A 3V1UA 1M2WA 4C05A 2G04A 3SJZA 2PSFA 2Y2UA 5FP0A 4B81A 3AVWA 3RS3A 4LISA 3UB4A 2Q6LA 4IKPA 2ES4A 3OQHA 3K9LA 4IWYA 4IZHA 3UIEA 3QXCA 2HTEA 3TTYA 1U8CB 3WGZA 1W87A 1WQ1R 1XEAA 3MRTA 1P9OA 5F73A 1EBBA 4FX5A 4PG8A 2WTMA 5IKXA 2XQFA 3G2PA 2RKWA 1KP2A 2ST1A 1VGVA 4NI5A 4FOLA 2XHZA 1M1YA 4XQ9A 1P2UA 3PIRA 2HDOA 3BTUA 3OQPA 2J5BA 2WTXA 3PG5A 4ZPXA 3ZUGA 3GT0A 5CLQA 3QBEA 4HO1X 4ZT4A 1BN7A 4CDRA 4PYRA 3OJEA 2P40A 2R1VA 3RJMA 4JS0A 1CDOA 1C7ZA 4QAJA 4FJ0A 5EE3A 2J0VA 1FNDA 3KQTA 3GFVA 4MIYA 1MENA 5JAOA 3GFFA 4KLAA 4IBOA 5JU6A 2RGGA 4AYXA 1J24A 4XPIA 1CC1S 4FXOA 5H7XA 3ETJA 3K2EA 5GOTA 3JQQA 3CUYA 2H1WA 2PFSA 3LUFA 4EGJA 4GMFA 2V1UA 4HL6A 4JBIA 1Q44A 4PIVA 1BDJA 2OECA 4ARZA 5JISA 4X6YA 2XRZA 3MQFA 5JYEA 3BEOA 4D8TA 4U8GA 4UUMA 2EYQA 3HO6A 3Q1LA 3Q0IA 4JBLA 4ZTZB 4FNGA 5TNXA 3N7AA 4MRAA 4DGQA 2CLKB 3EIXA 3FWPA 5HMLA 4Z3OA 4WFJA 1UEIA 1KEWA 3HL4A 3CR3C 1AHHA 3SU8A 4ZQBA 4WKCA 1O6FA 2QP4A 3EZ2A 3ZY2A 5BSTA 1NVFA 1N75A 1CJBA 3HA3A 1FBNA 2GB4A 1H2WA 5F1YA 1H5UA 2HC9A 4CQLB 1G8JA 1SIWA 1ZK1A 4C7MA 3LI2A 4ENUA 2R6GA 4UDOA 3A9WA 2HLPA 2Q1XA 1EVQA 1DIRA 3LFUA 4BJ5A 4S1NA 4K8OA 1U0RA 3BE6A 4PBSA 5DM4A 2ZUFA 1YDWA 2DTDA 4BO8A 3RTEA 1RM5A 1V96A 4KN9S 1OSNA 2V7QA 1V6SA 3PD7A 1QIHA 4FT2A 4DSUA 1ZR4A 4EJFA 3EDOA 1QBGA 1RM4A 4JUIA 3TD6A 3OJLA 1BE8A 3GFRA 1KY3A 1JQ3A 1FPQA 4UVEA 4ZRDA 3GI1A 5HX7A 3L5KA 2CCKA 1UK7A 1IEVA 1X94A 2VK4A 3OUZA 4PINA 4PSDA 5D2CA 1L3IA 4X1IB 4AUNA 5ALSA 4E3ZA 1IUNA 1F2TB 1KZ9A 3R20A 5FOQA 3LWZA 3C3BA 4U1RA 3UMCA 2TRSB 3NPMA 4G0NA 3LQ4A 4B73A 4QO8A 4FWBA 3TRFA 1J8MF 1HM5A 4FOSA 3HRIA 5CRIA 1I10A 3RO7A 2A33A 5C7OO 2FG5A 3JVIA 3LBHA 4OFWA 4GMDA 3UC9A 1Z28A 1RPAA 1SUWA 1Y7PA 3VVCA 5A5VA 3OZIA 3SF8A 1D2MA 1GVHA 2CDRA 1Y6RA 3LZCA 3N0TA 2W2KB 1G20B 4JLJA 4LK2A 5CT9A 5F77A 5P8WA 4BLPA 4PNHA 2ONJA 2XCSB 4UHFA 2FE4A 2E3JA 2ZIUB 2XXAA 1R4ZA 5LBIA 1CF9A 3EGVA 3QKSA 4INAA 4D4GA 5EIEA 4TXMA 4P38A 1W5FA 4RQBA 1E69A 3OQBA 2YWRA 3MIZA 3EEIA 2B7BA 3I5AA 1UFOA 3UJBA 3DCJA 4QSHA 2RHCA 1NP7A 2ACVA 1NYQA 1E2NA 1K9SA 2NQ8A 4QXAA 3MCTA 3CX8A 4P3XA 3EMBA 3T34A 2FEWB 1ZL0A 2GBFA 2V03A 4MPDA 4BVGA 5AKHA 3UMGA 3I2YX 2P78A 4UTVA 4FZ5A 5T3UA 1NLMA 5B1DA 4KN6A 3UJPA 1AXEA 4CFYA 3HKEA 2AOVA 4EJ0A 3E7WA 4Y6LA 2II6A 4FMDF 1G6Q1 3UAVA 1VRWA 3IOMA 4TWZA 1JR3E 3RTAA 1ACLA 4TS9A 3UQZA 4ZGWA 3D59A 4PU0A 1GFSA 3QVSA 5GVSA 1XMJA 3QEOA 4UJ3A 4LPKA 4ZQIA 4X95A 1H6BA 3MCZA 5BUZA 3CZQA 3SEQA 3VDQA 4AN1A 1JX6A 5DYGA 3GA5A 4K5QA 3E1GA 4CG3A 1YC2A 4F8EA 2B4YA 1G5FA 2OD7A 3HKBA 3V2GA 4FZJA 4JCCA 1R0LA 3M1IA 4I66A 4PX9A 3VVBA 3LCMA 3FCSB 3ZTWA 1YZQA 2O3UA 2XD9A 2NYVA 3FPGA 2W90A 3FROA 4B1FA 2XZDA 4XI9A 3WWYA 3THWA 4ZRMA 2O2HA 2BRUC 2P6NA 2ZI4A 3BJIC 3BX1A 4JODA 3QQ5A 4CMCA 2XCQA 4C78A 1SK8A 1QMGA 4EOGA 4K6OA 2BKUA 3KYBA 3LDFA 3R9XB 3ZE0B 1KQOA 5FLEX 4S12A 1TYBE 4I50B 5BR1A 1VOTA 2GFIA 1GTZA 1E2PA 2ORYA 2Z4SA 4US1R 4KE7A 4HR7A 5FWAA 3DLIA 3BPSA 3O7MA 4MQLA 4C0WA 2VDNB 4WN9B 1UCFA 2H9YA 4KRYA 4YK7A 4JUAA 1L5HA 1ECFA 5C8YF 1ZVKA 4QDUA 4ZA2A 4RJ2A 2B5WA 4O29A 5ELXA 1UPTA 1KIMA 3AG6A 2YHBA 3QXXA 1KVRA 4BX9A 1U0JA 3GNQA 5LDGA 3I52A 1W36D 2D1SA 1RHRA 4QHSA 4MVJM 1J20A 4OMUA 1W5AA 1J5EB 3L2OB 3L7AA 2Q7DA 4LJRA 3D0RA 1N1GA 1XTKA 4U8HA 3BM5A 1W36B 5JUWA 2AKEA 2QQ0A 1Q7BA 2FRDC 2XQJA 1I8TA 1DLJA 1XHFA 3GAZA 3QUBA 4MQBA 4KLCA 1CY2A 3UWSA 1NUTA 2I2DA 4L4YA 4OQFA 1ESCA 2O8BA 5CT8A 1E4EA 4JB3A 4I36A 1L5LA 4GE3A 1QQTA 3Q4GA 1RHQA 3KV1A 4F5DA 3Q6NA 5CCEA 1SB9A 4MLZA 4AU1A 3UT5A 4DBLE 3EXAA 1BQ4A 4ZI3A 5JTTA 3E15A 4URFA 3UCFA 1VTKA 1HY3A 5AK4A 3UTCA 4B84A 5A7FA 1NBIA 1TJ5A 1YR3A 1F0PA 2L17A 3AINA 3HUDA 1YS1X 3EWSA 3B60A 4FR5A 1JKIA 3LGXA 4EA6A 5KC8A 2MR5A 4RD6A 5BW6B 2OBYA 2OP1A 3PX2A 2J09A 3REFA 4OV6B 2IU4A 4NE9A 5CT4A 4KC0A 3GO4A 2D13A 3EQZA 4TT8A 3TLEA 5JJIA 2A5YB 2C0PA 1JN0A 2O19A 3TRHA 4CM4A 2D2EA 2QLNA 3ZV3A 1NVVQ 1ZESA 1NC3A 3EUAA 2J32A 3IVRA 3O74A 2IHVA 4W6QA 4YT5A 3DBLA 4IJ6A 4LYGA 4TVBA 1GR1A 2C58A 3HXLA 3H4IA 3KT0A 1EFDN 5DYIA 2CHFA 3O7WA 1E2LA 2JGFA 2V6MA 1B1CA 1DFIA 5C4GB 3TZBA 3KSRA 5COAA 3MMZA 4FN4A 1CB7A 1VHTA 2PGXA 4HSGA 4NK4A 4YCAA 5HFNA 1LC3A 1MJNA 1X19A 1ZAKA 1R8SA 4LXQA 4D0NA 4JYMA 3ZGZA 3IX7A 2JAUA 3C1AA 4M0UA 3BFPA 4RYLA 4XRRA 3RAPR 2IYRA 2XZOA 2QTWB 5JMTA 1G8FA 1Z36A 4QXPA 4UCXA 2YVQA 1OLSA 3QXHA 5K3CA 1CQPA 4P6VF 2QTGA 5ES3A 1OT3A 4AYWA 4Q3EA 1L0BA 3R75A 4UEKA 2W6MA 3IPLA 5I6DA 1PR5A 2YUTA 1HTTA 1S2NA 1JHAA 3ZDRA 3SMVA 3TSWA 2C29D 3ZGYA 2RHWA 1OZHA 3ZIUA 4MVJP 2WTUA 3VNRA 1V47A 1EZ4A 2GSDA 3OCYA 2J9RA 4B5LA 5HOEA 1YKFA 3R9KA 4C0HA 1BHO1 4E51A 3OM8A 1RQLA 4MW7A 2DCMA 1L5SA 2A9KA 2PM8A 2ZYIA 1OBHA 2WYIA 5B6JA 1NMEA 5BNWA 1W1UA 3PFGA 5EZQA 1XE3A 4KPGA 2QMUA 3HWRA 1D2EA 3THOA 3QP9A 4UTRA 1I9GA 5C4MA 1VC2A 1SM4A 5T6MA 3RTDA 5KNBA 1Z0UA 1TAGA 1B8OA 4Z51A 2Y77A 3HJCA 2G9RA 3DC7A 3QKUA 1A69A 1JU9A 2J3KA 1QONA 3A4TA 4BEBA 3SR4A 3CO0S 3BXPA 3RTCA 3V42A 4BVLA 1M0EA 2D7JA 4IJKA 4CU5A 2PT6A 4TMZA 2A5JA 5DHUA 3RYCA 2FPIA 3EZYA 3GX1A 4JZKA 3ZC3A 5B30A 3IKLA 3P0HA 3K9FC 4IWNA 3JYLA 1VG9B 4M6WB 3GELA 1XRNA 3JYNA 2FPKA 3TLJA 4J16A 1U7UA 4B6JA 1JIXA 4HDMB 4D9EA 4KGXA 5CURA 2OCIA 1Q3HA 2KMLA 3GZNB 3FDXA 3H2JA 3HMQA 3K2QA 1KO1A 3PHIA 4MS1A 4PFSA 4TXNA 5ER6A 3RC2A 1NZFA 2ANCA 1OW3B 2B0JA 3AJ8A 3BN3A 3OJOA 1QHYA 1R6UA 1ZD3A 3QNUA 4URUR 2BGTA 4ZWNA 3SC3A 3ZUPA 4AC9A 2XUDA 1QPZA 1YOBA 3DZDA 1GEGA 3JQ8B 2PD4A 3G5UA 4MWGA 3ENNA 4Z9YA 4ZYLA 4R2XA 2QW0X 1FSPA 1X2BA 3ZZ1A 2MWMA 4AMZA 5JECA 3BZUA 3HNRA 3CEMA 3KR2A 3TS1A 1KQGA 4NU0A 1EFVB 2EKBA 4ND8A 1S3SA 4IILA 4LW8A 1V6AA 1VJ0A 2R8RA 3F2IA 4ZCSA 2ZM5A 3SQOA 1ODTC 1DAIA 3O8LA 3NQ41 4R3WA 4BB0A 4DJAA 2JLUA 4RVFA 5B5SA 1UZUA 5D87A 3VC1A 2YY5A 4WXHA 1SA0A 4YRLA 4DM4A 2IY8A 1EPUA 3UAWA 2GM5A 3DE3X 3PC3A 1FMJA 1CUAA 4U0KA 4WJZA 4I4CA 1YNOA 2O2SA 5LJIA 2WYUA 1WW2A 3UXHA 2XCLA 4I5DA 2NVWA 2HA0A 2OAEA 1TCVA 1GZ4A 3E7FA 1H2BA 5F5LA 1E3WA 2AVDA 1OX4B 1NRXA 1T5OA 4P54A 1XDUA 1Z5PA 3N2NA 3O03A 3W78A 1YB1A 3EXHA 1B76A 1RI3A 1WD5A 2FUNB 1JG6A 2IA5A 1LLDA 2HADA 4GRAA 4MO9A 1DEAA 2W2OA 2JIQA 3FCOA 3O82A 1ZK3A 1CQIA 2Y66A 4RL6A 3WO1A 2P7IA 2W8BA 4TL7A 5BQXA 1H85A 1D4FA 3K6KA 4DXHA 3FIJA 1JG3A 2QUBA 3RSFA 5H81A 4PPYA 2VP6A 5BWCA 2A9PA 5JYCA 4L0CA 4JD5A 4QM7A 3CSDA 2CHGA 3KELA 4I5FA 3Q10A 4N6NA 4Z53A 4L0DA 3OTQA 3L4EA 3R8CA 1X9GA 1NI4B 5SY9A 4JT8A 2GMWA 1KZYC 4FNMA 1YVEI 4ZIRA 2FOXA 3KYCA 4OYYA 5EHIA 2C00A 3RS0A 4U00A 4MW6A 4FUTA 4RD0A 4EHFA 3KJIA 1JH8A 3ZJYA 5EJMA 1SBCA 3L8DA 2CXOA 1IOZA 4J75A 1U98A 5IXJA 1I7LA 1DJPA 3CKKA 3P97A 2Z98A 3L0PA 3FW1A 1KYTA 2NYAA 2GZSA 3ETGA 3C3XA 3FN4A 3ONWA 2UVPB 1Z5UA 3FCXA 3ZLJA 3ELBA 1QIDA 4NEHB 5C1IA 5A02A 4CMEA 2GLTA 4DVGA 1FTSA 2YMLA 2B21A 2P3OA 3B89A 3JD3A 3DOHA 3GFQA 1ZISA 2GASA 3K92A 4YRCA 4IQ8A 4HN2A 2G7MC 1YRYE 1Z39A 2BEWA 4FD2A 4E70A 4TGLA 5J9FA 5TR9A 2ECQA 3E9QA 5CGZA 2BSAA 2GN6A 4XH9B 4YEDA 1PHPA 3PJRA 3DBRB 3HEAA 3HN7A 1E79D 2BFWA 4M0CA 4BCDA 1HNNA 5A5EA 5DGTA 2E48A 3PR1A 1QAMA 5J2TF 1CEYA 1WKBA 2WVHA 3LY5A 4B3CA 3VOSA 4KLRA 2Y99A 5AVKA 2WMDA 3FBGA 1OGJA 3I4FA 4HLUA 4JN6B 1H1DA 2GCOA 5DTRA 3WJ1A 5CFMA 2VBGA 4MGYR 1C4KA 3BSFA 2DSTA 1BJTA 2IY9A 2XB4A 4LJ8A 4RX1A 3W4KA 5GJBA 3V4SA 2IHZA 2HV8A 3ESZA 4EY6A 4XASA 3DTVA 2VDUE 1SBNE 2C2HA 2Z04A 3TNDA 3NPAA 5J3JA 5CA0B 4LZAA 5SY4A 3QF7A 1QS0A 3PNVA 2GDJA 3B9RA 3CF0A 5CLHA 1QLHA 2DWOA 3CLHA 3NHBA 4J43A 4MS4B 3F2VA 2BYTA 5D6NA 2X3FA 4TV8A 1GNSA 1QFSA 1T9GS 4IJUA 4LG1A 3K6SA 3EVBA 2GPNA 5DCUA 4TOIA 4WZAB 3JRNA 3LECA 5E1BA 4I4LA 1X38A 1JLSA 4MO2A 1V1MB 5F12A 2A5DA 3JALA 2JIBA 3ZN2A 3R7DA 3N28A 1U65A 1U2PA 1VSQA 5BN4B 2GF0A 2FSSA 2GD2A 3HJFA 1PVOA 1JIKA 1GXSB 2F1OA 1M74A 4AIRA 4X8MA 2B5OA 1HZZC 2OILA 3KEFA 1E9VA 3MIIA 5AM0A 1FVHA 1U0HC 3L7NA 1AB5A 3V7NA 1ADBA 1ADYA 4I4IA 3FYHA 2VZ9A 4XARA 3FM9A 4EKEA 4PLTA 2X0JA 4X41A 1P4SA 5K3FB 1UDRA 3BE4A 2CD9A 2XKJE 3C8MA 4KIFA 2XOXA 4JFRA 1AOXA 2GHRA 4DYHA 4YQFA 2Q0XA 2ZSDA 2XH8A 3MRXA 3PBKA 3IESA 3VZRA 2QT1A 4CKYA 1JILA 1Y6ZA 2R751 3TGPA 1PJLA 3RTGA 4EG8A 2X4GA 6PFKA 1E7WA 1VLHA 2UZ0A 4GS5A 2FJUA 4NJMB 1AV6A 4I8DA 4M0FA 4NYMQ 1VE5A 4JI3B 2G1KA 2CEKA 5KNBH 1I1OA 3H6GA 1RM0A 5JEDA 4RMNA 1JRLA 4KPEC 2ZJZA 2IPLA 3VYUB 1MQAA 1Z82A 1OXVA 3ABIA 3II6X 5BRJA 5K3EA 3KEQA 4DSTA 3BYZA 3DE1X 3R6DA 4Q34A 3KAQA 2NUPA 5FUVA 5FBWB 2G0AA 2UVQA 4BNLA 1PJBA 2QIOA 2XVMA 2JK0A 5E1DA 3VI3B 1N5MA 3G9XA 1I33A 2CB9A 2XVZA 4HS9A 4ZOEA 4AXXA 4F3YA 3NXSA 2IXGA 1I7NA 3T9EA 1CD5A 2HJSA 2W2NA 4EEKA 3OCVA 2WDPA 1XYVA 3QOYA 1VB3A 3IQXA 2DM6A 1MT3A 4QNMA 3DTYA 4M0DA 2A0WA 3RQIA 4YWJA 2NMVA 4FN5A 4A8PA 3GXBA 2AK2A 4MQFA 4KE8A 1A7JA 1MP0A 2XDYA 4AYTA 4CUKA 5IC4A 4KQHA 2C0QA 1FFCA 3KKQA 5LQCA 1E1RD 2YHSA 3DG9A 3QFTA 3N8GA 3G2QA 4BE4A 3K15A 2ZWOA 1C0IA 3HY6A 2FA9A 2P6MA 4JP3A 5FPTA 3W9SA 2N75A 2OD9A 1MAVA 2F4VB 2CVFA 3C39A 1QRUA 4L7QA 2D1TA 3EHEA 2SCUB 3B7PA 3D3WB 3MWJA 1OE0A 4YQEA 5EHXA 4MYDA 5ALOA 3TTUA 2AIRA 3D8NA 3NHSA 2FPOA 4BMVA 1O4VA 1E1MA 2CXHA 3EC2A 5KSYA 1GDDA 1XCGB 5HR5A 1BCRA 3G5LA 2QG9A 3U7GA 1UBNA 2RHRA 3NU1A 2FI1A 4UJ5A 5FNVA 1N2CE 1Y3AA 1VYTA 2W7TA 2C2YA 1ZITA 5E6RA 1QVAA 4K6FA 5IJWA 1GAEO 3F4BA 3LKVA 5FYDA 5JI3E 1SKUA 2V7BA 3U60B 3T38A 1IBMB 1PEYA 3QPBA 4CLRA 4DB2A 3Q9SA 3NNNA 3RYHA 2DLCX 3GBVA 3PCXA 3OZ7A 2FW0A 4U4AA 1AUOA 2QRQA 3RV3A 3O3MB 4BFZA 3UHPA 2C83A 3F73A 1ES9A 1MRNA 3A6PC 3QX9A 4KYIB 5ICGA 1QBKC 4Y2SA 1R27A 5EJ6A 4HNRA 1G4HA 4OXKA 4TLMB 2GQ0A 4V38A 5HMMA 1I2DA 1MF7A 3TLAA 5KYNA 2RJNA 3QELA 4UUNA 3H2YA 4EMBA 5CB8A 3IP9A 3QVXA 2M98A 2OBNA 5JLJA 2PR7A 2PHZA 4V3CA 1LBIA 3C85A 1WHTA 2J9YB 4MWBA 2PL5A 3A0RB 1QTIA 2PXHA 3HM2A 1TT7A 5JWOA 2AH5A 2F8SA 3FRHA 3C6KA 1KEUA 1CNEA 1NQAO 3DKRA 3IHLA 1JB1A 4QBTA 1SCQA 3FSGA 1GGMA 1BGXT 1GL9B 2XCIA 2BFDB 2NZWA 4S1OA 1EEXB 2PFGA 2QN9A 4K05A 3Q8MA 1I30A 3GJSA 3LK6A 4GX1A 4KVZA 4BX2A 4IGKA 1EVYA 3K6RA 1OBFO 1DTSA 2RBEA 2PZFA 3OECA 3RSCA 4DG5A 1MVLA 1EGQA 2EF1A 1JDPA 3H1FA 2AOTB 2PJDA 2NO1A 4J1SA 4RAQA 4AZ3B 4LBVA 1XZLA 1KDVA 2PL1A 2RONA 4D02A 4HAWA 1XZJA 3JQ9C 5I7HA 1OI2A 1Z0JA 5IC5A 2VJQA 4F6CA 1UEJA 2I6QA 1AO0A 2GPAA 2BFMA 1ZVMA 4I14A 1LPPA 1TM3E 1Y8QA 3KEOA 4JZYA 4BE9A 5LQNA 3FPLA 3DW3X 1CHDA 2AG5A 4G6ZA 4V0OA 2V55B 4X63A 2O8CA 3TKYA 5J2UA 2B99A 5DI9A 4A03A 1I5OA 3OX1A 2YYAA 5JBQA 4ONEA 3PKIA 4AWAA 1YQXA 1KK1A 1ZGAA 4MMXB 4O5OA 5D3KA 2ZTUA 3CBGA 2NPOA 3B1KA 1BGWA 3SQLA 1BA3A 1C1DB 1VLZA 2GN9A 2RAVA 4ZO4A 5CJPA 1MH9A 1AM4D 3M5DA 4CHTA 4IM7A 3TINA 3WLJA 1H4TA 3P9ZA 3NP7A 5LWQA 1O4WA 2D54A 1BA2A 1Z4OA 1RYMA 2LBPA 4Y2UA 4JDPA 4Q3NA 1KZ6A 3A6JA 2PWPA 3V5NA 3WWZA 3T3GA 4AROA 2D1RA 3E0XA 2Y1CA 1W4AA 3AJRA 3PUZA 4G1UC 1V3TA 2DQSA 1TK9A 3B5JA 3DD1A 4XX1A 2AOUB 4UNNA 3RKUA 4BV2A 5E1OA 1D7OA 3OF3A 2PWZA 3AG5A 1RMQA 2ZKLA 2D1FA 4GOMD 4JB2A 5D86A 5LP6A 4X7RA 5TQ0A 5T4EA 1IJEA 3MJEA 3ZWVA 1NOJA 4G2NA 3USZA 3ZDEA 1QGZA 5GZ6A 4FI3C 4QJ5A 2HPHA 5FDFA 4O4IF 5C1BA 2FW9A 2HRZA 2R1TA 1TQ2A 2A1TS 1HLDA 2FFHA 4PZYA 1K7FB 3SEAA 4EGQA 2R9VA 5C37A 4WY8A 1K7SN 4MWZA 1DQNA 6ABPA 3MS2A 1Y5NA 2QXUA 1JQLB 3IT1A 2XJ4A 4DWJA 4B3XA 4D4JA 5JVDA 2OZEA 4KQWA 1CY4A 5BN5B 1R6VA 1QM5A 3ICWA 2OFXA 5JCOC 3ANYB 2PGLA 2R60A 4K28A 1GZHB 4KZKA 3VPSA 1V5FA 2N3ZA 3OAAD 5KOHA 1XVUA 2J7KA 1ZA2A 4OLBA 1VPDA 3H18A 3L6CA 2QNRA 1WTCA 2BLNA 4I5GA 3C3EA 2Z95A 2CNLA 3B12A 3TRJA 2O0KA 4H4EA 3M6LA 4Y30A 1P4AA 2A1UA 1Y6JA 5B55A 2XNCA 1KXZA 3O93A 3VA7A 4GM4A 5FO1A 3T3NA 4RH1A 1QIMA 4QREA 5TSDA 4TKMA 3KKMA 1W2GA 1DKMA 1VFPA 2Z1MA 4NBVA 4EJSA 1V71A 3H0EA 1SO8A 5J5CA 3CPJB 2B5VA 3HPRA 2ZSBA 1JG1A 2JI8A 4OHPA 1Y1TA 1PVDA 3VSBA 1HDIA 1AH2A 2VHZA 1XTSA 2Z08A 3A36A 5JYDA 1XD2A 4QBFA 4BWYA 1WP4A 2I7VA 4HDRA 2ODPA 3U3JA 4YRDA 1YL6A 4G4SO 1JHMA 2IYPA 2JG3A 4E2FA 3C70A 1T4CA 5EC8A 1YZYA 2IEBA 3D3QA 3OJWA 3A7DA 3IEPA 4H2DA 3VU8A 4BFYA 2GZRA 1QH1A 4DCSA 1Z08A 5CW1A 1RYFA 4GL4A 5HJ2A 2VT6A 1XTIA 3KO8A 3MCVA 4KWHA 1ESDA 1PX2A 1ZWLA 2QN3A 4AY5A 2UUAB 4G9GA 1E9FA 4EA8A 3DE0X 1GO2A 1KI3A 3G2JA 4KO4S 4L3OA 4YJGB 1C30B 1U7HA 2VEDA 1OAAA 1W85B 2NQ2C 3EDYA 3GQBA 2F3PA 1BKYA 1JQDA 4GO1A 3GGGA 1VGRA 4RHTA 3WAJA 1YB6A 4DUYB 1JYSA 4FGLA 1S0UA 5A1JA 4Y2VA 1LNSA 2NO9A 3UXEA 4KRXA 4WERA 1SK9A 4IIJF 2HUNA 4O33A 4PYNA 2H1VA 1X42A 3TLGA 2IV2X 4XWKA 2OHGA 1LV8A 4FGJA 4P84A 2BMFA 3HTXA 1RJWA 4AQ7A 2J3MA 2YICA 1DCMA 1SAYA 3S44A 4QGAA 1SVSA 2A9RA 3TNJA 3PZBA 4Q93A 4ACAA 4DIDA 4TTJA 2ODQA 1DWPA 4WACA 3LVFO 4I1VA 3IBCA 5AHWA 5TE9A 4PCVA 5C53B 4XJVA 4IIEA 3R9IA 1TJPB 4J7XA 4DLBA 1GTVA 2EKLA 3CRZA 2CL5A 4EHKA 4J0HA 3KLMX 5DHQA 1X92A 4OIMA 5IKOA 4DRXB 1MHPA 1R0SA 4MLPA 4YJHB 3V4VB 3ASUA 1NQTA 3DFZA 2YUIA 1L2TA 1ORIA 5DOVA 2G63A 3C87A 4BLTA 2PNFA 3V55A 3SVTA 1AQLA 1NATA 1ZINA 1X8LA 1MJGM 1S2MA 3C1OA 2NM0A 2EFHB 2AVNA 2AI3A 2PO5A 4PX5A 3N76A 2VPIA 5FV4A 1PU2A 3R7FA 3WYAA 4F1WA 3X1JA 1CNMA 2QJTA 2I03A 1JNYA 3R44A 5LB4A 3WIBA 5HRCA 5DLPA 1CS4C 2QY9A 2VFAA 4X8HA 3HCEA 3RIXA 4YAKA 1P0QA 1TVMA 3PFFA 1XQVA 2OQ2A 4GPZA 1P44A 3FYTA 4ZEXA 3TTVA 4M1SA 4DCJA 3JAKA 5BVHB 4Z4GA 4BNTA 1BFKA 4N6GA 3WWDA 4A7PA 3T1QA 2GETA 1MPTA 1ORTA 1AURA 1VBNA 1PVVA 2ZQZA 5AESA 1Q1QA 1RM3A 3N70A 3PFBA 5BOSB 5DM70 1ZX1A 2ZT8A 1RLTA 4CIWA 3MJHA 2GX6A 2D00A 2ZVPX 5LYJA 1KDZA 3K0CA 4EA9A 2EFGA 3ELYA 3RGWS 3JWEA 3FY4A 4DCVA 5LIRA 2AR9A 3NBAA 4EY3A 2O5CA 1GAXA 3HGTA 2PQ6A 4N40A 4MQ5A 4FMCB 3OIWA 4R1TA 2EW2A 2POQX 2DMRA 4J1TA 1VGQA 5IP5A 5A5FA 2AG6A 3BKWA 4FCTA 4FGWA 4HWTA 3DHVA 3AFGA 4CUZA 3RLIA 4PSAA 1JAXA 3W3AA 2WU8A 4U9IS 5EP2A 3NV9A 1L5GB 1TKRA 1AS0A 3GBPA 1W0JD 2D8AA 3LQRA 5DI3A 4A10A 1TEZA 1P5HA 4COOA 4RTOA 2GESA 1EXDA 2XBMA 3I12A 3MTDA 2RJOA 3HCBA 1RI2A 2H0AA 4IO0A 4A4DA 5CG2A 4G5GA 3G8BA 3JR7A 2JH9A 4TKUB 2QTFA 1KBOA 3L49A 4H3KB 4P1ZA 5HKOA 1XKTA 4KREA 2Y1OA 1THTA 4GC9A 4JNKA 1F2DA 1CJSA 4Z99A 2C84A 4DMRA 1JIJA 3IQFA 2GD1O 1DMRA 4LRXA 2HJ9A 2X8LA 3UAXA 1OJLA 5LMZA 2BM1A 1E9EA 2Z5GA 1N9ZA 4EKIA 2XYGA 4ISBA 1IBSA 4CKBA 3ZVMA 2F62A 2ZXFA 3BJZA 4JP1A 1EG7A 4BNDB 2YR0A 4EQ6A 2PMEA 5FPYA 1ZIDA 1WIWA 4NYIR 3TLMA 2J4FA 4LWQA 2OAGA 1YZGA 2H5JA 3F6EX 3GDWA 121PA 4H59A 4U7GA 3ETHA 5AWFC 5IARA 2WAMA 3LF1A 2XMZA 3MVEA 1S9HA 2GCPA 4ZK6A 1ECGA 1U1FA 3HYCA 4NECA 2IU6A 3ISVA 2OZLA 4Z0NA 1PW5A 2ZBVA 3MSXA 4G85A 3X3HA 1W36C 1YTUA 3W5SA 1TKBA 1GRQA 2XWSA 1KZHA 3OQJA 2X3UA 1OV4A 5DNAA 2BEVA 2EWMA 4MUBA 5IZCC 2R96A 3ABZA 3NC4A 3ICCA 4PONA 3VX3A 3TFWA 5AIBA 4LQ4A 1Q1BA 4JI7B 1II0A 4QUKA 3O8CA 3GT4A 1J2UA 1KVSA 4OM7A 4AURA 5CMLA 3WQSB 1W73A 1H65A 3E22B 2JLZA 4U2BA 1R8QA 1ELOA 1SUSA 3HWWA 1E2QA 2JANA 2P9YA 3BTOA 4FQ5A 4HLNA 4O4LA 5KOYA 3TDKA 1DVRA 1REQA 4D6PA 2LUOA 4UE3S 5DN6A 1FNNA 2R48A 2V0NA 3L8ZA 1Y81A 1PZFA 3QVGA 1USWA 1Z6PA 4KIJA 4U7JA 3CONA 4G0YA 3FSEA 3I58A 1MB2A 3FLEA 3DJYA 1YR8A 3RRYA 3DR5A 4ENTA 4W6ZA 4YRZA 3IBFA 4HK4A 2C3MA 1L5FA 3P2KA 1EM8A 1B6TA 4CF4A 2CNKA 4H3VA 4HX5A 4C43A 5EJ5A 5IKPA 4P35A 1HEYA 3H9QA 3SJBA 2YHAA 1ISFA 3K0FB 3IVCA 4AT1A 1NJSA 4TM8A 4WBNF 5JAHA 3EDRA 1GOTA 1M75A 1R15A 3FNQA 1AN0A 1RJEA 3EQ7A 3IIIA 3P9YA 1WZUA 2Z6UA 3LCUA 2VUTA 1XZQA 1SCDA 2ATVA 1WCIB 2PBFA 5THKA 1O89A 3KVYA 1AK1A 1T8PA 4WQMA 2MDTA 1YCGA 1FTGA 3O83A 4OAQA 2CZCA 2OCDA 2GPTA 5WRFA 1QZ3A 1KEEB 4UVGA 4OHZA 2XCUA 4HAZA 5FPKA 3SBOA 3AVQA 4NDZA 5DOZA 3L7DA 1NYLA 3PNOA 1B73A 2YZKA 1FYXA 1TC2A 3HUFA 4RPGA 4HY3A 3EQ6A 4MVXA 3TOCA 3OH8A 4AICA 4HQRA 3HZRA 4J16C 2QVLA 1PZMA 3TDMA 2XMRA 3B1JA 2PKXA 3W2EA 3MOIA 1NV9A 1AZLA 3T7DA 2W71A 2G5TA 5HXAA 4QUGA 3PSAA 3PNPA 4HMQA 4ZI7A 2B4RO 3ENQA 4OQXA 2ZBQA 3FNGA 5I9BA 4ZOLB 5AW2A 2ZVQX 2ZUUA 4TM7A 2MJLA 2QMOA 2QZSA 4M1WA 4O4JB 4PG5A 4HWGA 1PT8A 5DRYA 3EEBA 3T9AA 3AKDA 2XAAA 4ZXFA 2IIVA 3TI7A 2L69A 2J6BA 4JWTA 4TUYB 1O95A 5J40A 4D0SA 4RFSA 2XTAA 4UE2A 4UREA 4A9AA 1UJ6A 1RRPA 2Q8PA 1CERA 4GZ6A 3VPDA 2RGWA 3CZRA 2CXNA 5FEMA 4DJDC 1CUEA 2I2BA 5JXWA 3ICEA 1XG5A 4KV9A 1XAGA 2H48A 1XPRA 3I53A 3RANA 3AV3A 1ECCA 4OP1A 4YJ3A 5DGIA 5E6SB 1KI7A 2COEA 1ZLXA 1QE3A 4PICA 4M3NA 1A9RA 3DEYX 3AP3A 4URXR 2O0JA 2F3TA 3HFGA 2JFBA 4EUSA 3G5AA 4OY3A 2ZYSA 4PHCA 4B9AA 2EJBA 1IEXA 4K81B