1DWOA

Crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Hydroxynitrile lyase
total genus 97
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwoA00
3PICA 2D0DA 1MX9A 2VEOA 2XUPA 1DWQA 1DX6A 3VJKA 2OGZA 3GROA 5AI4A 2XLCA 2W22A 4X85A 4U2CA 4AMYA 2HA7A 3O9VA 1EK2A 3C87A 3B3QA 1VZ2A 4HRYA 2XQJA 2HA3A 1W76A 5CH3A 4GI1A 3LP5A 5LZ5A 2XMCA 3PDCA 4FNMA 5AKKA 2VJDA 4K6HA 3FLBA 2BGNA 3HABA 4PF1A 3TGLA 1AC5A 2XLBA 4Q3LA 5A7HA 1ZGCA 5ALIA 1K5PA 1JT2A 3EIOA 4FOLA 3DYVA 2QVBA 1WB4A 3H19A 5EHXA 4B6GA 5AKZA 3WKEA 1X2BA 3AINA 4FKBA 3B12A 4X97A 2J3DA 4BAGA 4W1QA 3G7NA 1L7AA 1XROA 2QM0A 2X76A 4QE3A 3V1MA 1B41A 2ZJFA 1AZWA 4AMZA 4AN0A 1UXOA 2ZJ7A 2XUGA 5AM0A 3SK0A 2IITA 2HL6A 2ZSHA 1D07A 2G5TA 3PF8A 1Q84A 1DTEA 2OAEA 2HA5A 1JU3A 1EDBA 4GWLA 3BIWA 3R3WA 2BFNA 4BCDA 2EEPA 1ODCA 2VAXA 4PSDA 3I1IA 1RP1A 2WM2A 1XRRA 2JBWA 2O7VA 3G0GA 4YPVA 4CG3A 1MT3A 4QA9A 1FFAA 4EZIA 1CUBA 2XUJA 1XZKA 4E15A 4QDOA 1G42A 4HZGA 4YK7A 1UK8A 4N8EA 1LPAB 1XZDA 5DYYA 1QONA 1E89A 1YASA 4KR0A 5JATA 1XQWA 1P0PA 3FYUA 3NOXA 3ZLUA 3PUHA 3HRHA 5C8ZA 3W9UA 3W04A 3YASA 2BJHA 2VTVA 3ZLTA 5ALFA 3WYDA 1LPOA 4OCZA 4LHEA 4Y9SA 5JAHA 3SWWA 3I6MA 3RKSA 3L1IA 4ARBA 4B0PA 1X2EA 4I19A 2HU7A 2PSDA 4Q34A 4KE7A 3N2ZB 4B82A 2C5GA 4G9EA 2AJBA 2ZVDA 4LYEA 4MYDA 1BCRA 4P92A 1JMYA 1VE7A 5EIAA 2WFLA 4IH9A 4V2IA 3WJ1A 4X6YA 1F8UA 4J0IA 2WU4A 1ISPA 5BWCA 1YR2A 3C8HA 2B61A 2GYUA 5E4YA 3BDIA 3BXPA 1IUOA 3I28A 2HHAA 2ZJ6A 2Y2UA 4ZREA 3WZMA 3FNBA 4QDUA 2LIPA 3WIBA 2WJ4A 3WWCA 3F98A 2PSEA 2XE4A 4J0HA 4BC1A 4BZZA 3R0VA 1BROA 2JEYA 1VJ5A 2FJPA 3WLAA 1W1IA 4H7EA 1QGED 5ALSA 5DTJA 1LPBB 2HA2A 1QZ3A 5BOVA 1EI9A 2OGSA 4AQDA 3W9BA 5DYWA 1ACJA 3NWOA 4ZGBA 1BCSA 3DOHA 3FVRA 4GECA 3V1KA 2PL5A 4ZWNA 4KRXA 2I3ZA 2FJ0A 1HBJA 5EIHA 5DWDA 1TAHA 1IUPA 1JI3A 2I03A 2JGJA 2WJ3A 4TVKA 2C58A 2DHEA 3DL4A 4DNQA 3R3ZA 3SX4A 4UFNA 1SCQA 5AM1A 3G0DA 5IVKA 4UHDA 3WL7A 4HAIA 3GELA 3EQ7A 1QOZA 5IKXA 5HF6A 1G66A 2XUIA 2XDWA 3V9AA 3G0IA 3F9CA 4KE6A 4Y2YA 4X90A 2P8SA 1ZD2P 2WHPA 2J4FA 1MTZA 1ETHA 3DJYA 4KAJA 5AM5A 4FLEA 2Z3ZA 2CEKA 5HF5A 3HXKA 5CT4A 1E8MA 4FMPA 4KYVA 3H17A 4B9EA 1ZOIA 4B81A 4NMWA 4JNCA 4JH0A 1C7IA 1T4MA 3TJMA 3IB3A 1IVYA 5KWJA 1CUDA 4MWSA 3MGAA 2C5FA 3KD2A 2IX9A 2ZYRA 1LBTA 2YYSA 2YASA 4EY7A 3CCCA 4HXFB 2HFKA 5CBKA 3R40A 1FSSA 2RGUA 4KAFA 3QMMA 5ALVA 4OYYA 3WYNA 2BAGA 4FFVA 4AZ0A 2RIPA 1KEZA 1ZI9A 2PPLA 2Z8XA 3GUUA 3WKBA 2QJRA 5ALYA 1YA8A 5K3DA 5FXMA 1E8DA 3M82A 1RWQA 3H1BA 3ICWA 4X7BA 5KBYA 4UBKA 3BDVA 2WU3A 3BJMA 5I7UA 1LZLA 3EF3A 4W1PA 1JU4A 2CJPA 5AIAA 5D3KA 5T4EA 2QS9A 4H7KA 1CUFA 2OCLA 3K9BA 4XJVA 4M0FA 2WIJA 3FSGA 3G9TA 1OXMA 1N5MA 1XZGA 1EDDA 4AXBA 4B85A 3PF9A 2ECFA 1LPSA 5ALOA 3VJLA 2OPHA 4PQEA 3O4GA 3ZPXA 1CR6A 1MNQA 1WM1A 3BIXA 1H23A 4XX1A 2AJDA 4X93A 4W63A 2WUDA 4RNCA 2PSJA 3WK9A 2XUFA 2H7CA 1XZCA 2ACEA 1UKAA 1VXOA 3ANSA 4Q3KA 3WL6A 1PFQA 1DU4A 1SC9A 5LKRA 1ZJ5A 2WHRA 5CTAA 2BKLA 4X94A 4GHWA 1MX5A 4BCBA 5FLKA 3DYIA 1ACLA 4BZWA 2HRRA 1CUHA 3A2NA 2JGEA 5C8VA 2GBCA 1FFDA 2OCGA 1BS9A 4C4ZA 2GYWA 2ZYHA 2Y2VA 3E0XA 3O4HA 3R3VA 1XZLA 4WDRA 1Q83A 3H0CA 1E5TA 3HACA 1U2EA 1R50A 4OB8A 5AICA 2H7YA 1WB6A 4Y7DA 1F0PA 1ZI8A 3IUJA 5JANA 3W06A 1B6GA 2XUAA 2JGMA 5C8XA 5JADA 1EH5A 4G4IA 3QZUA 2DHCA 4F5ZA 1CQWA 4MQLA 3IURA 4E46A 1HL7A 1LPPA 2PSHA 3U1TA 2QT9A 4U2GA 1UOQA 5LZ9A 4DMCA 2VJBA 3D4LA 5CRIA 4BRSA 4INZA 1QO7A 2OCIA 4TGLA 3PUIA 4CIBA 3CXUA 3IUMA 5AKEA 1SCIA 4IO0A 4XVCA 1PV1A 4DTCA 1NU8A 2OXEA 1BN7A 3FYUB 1PJAA 3QPDA 4NZZA 1QFSA 4LYDA 2G5PA 2GZSA 1ZD3A 2WUGA 3S2ZA 4B7ZA 1BEEA 3VISA 2X5XA 3ZI7A 4MEAA 3WQHA 4C4XA 4OU5A 4Q82A 1YAJA 5C81A 1THTA 2YH2A 1VA5A 2XMDA 1HKHA 4LKOA 1CEXA 3C5VA 2WFLB 2R11A 1VLQA 5JASA 4EY4A 1AQLA 1BE0A 5HFNA 4L9AA 1WHSA 5EI5A 3QBJA 5AIBA 4X6UA 2QTBA 5CXXA 4C87A 4CG1A 1BU8A 5K3CA 1P0IA 2B20A 1EVQA 1YCDA 4FBLA 4AN1A 4BVJA 5KWIA 4IH1A 3L1HA 2XUHA 2XI4A 3M81A 2BCEA 4G8BA 2HA4A 2V98A 3IA2A 2C7BA 2HADA 5LZ7A 2CMFA 1EA5A 5AKLA 1XZIA 3ILSA 4L72A 5ALNA 4BVKA 4KAAA 4O08A 1MPXA 1EXWA 5HZGA 4A23A 4J3JA 4OD0A 3CCBA 3QITA 4DNOA 3STYA 3WK6A 4UFOA 5CH8A 3D2AA 4M0MA 1VOTA 1YA4A 1NU6A 1XZFA 2WFZA 2Q0XA 1N5RA 1CUEA 4UHFA 4C6HA 2RONA 5AM4A 6YASA 1A88A 3K2IA 1IZ8A 1XZHA 1EK1A 4DMFA 3H18A 2DCMA 3D59A 4Y2UA 3FYTA 2XMBA 1EX9A 2WHPB 1AUOA 5CURA 2EDAA 5IVDA 3IVMA 3A6ZA 4WDQA 2XUDA 2H1IA 1K4YA 2WTNA 4QEKA 1ODTC 2HFJA 4P08A 1QE3A 3ESAA 3AIMA 1GQSA 3H2JA 3G8YA 1LPMA 2HA6A 5AI0A 4MEBA 4PW0A 3AJAA 3I6ZA 5JAUA 2Z3WA 5ALTA 4KJXA 1P0MA 3LCRA 1CUAA 1CFJA 2QJWA 5CT9A 4DMHA 3KSRA 4NVRA 2GBFA 2OQIA 5FOQA 3OPMA 3WZLA 1CUWA 2XUOA 1Z68A 3MVEA 2PX6A 3WL8A 1DQZA 1I6WA 5ALDA 2VSQA 3BJRA 5ALWA 1XQYA 1R3DA 4AO6A 4G4JA 5LKAA 4X00A 3FOBA 1UOPA 2VF2A 4LXGA 1XRQA 4Y2PA 4NS4A 1ZIYA 1WOMA 1R88A 1UOOA 1YB7A 4M0EA 4CG2A 2JEZA 1YSCA 3A2MA 3QH4A 1LPNA 1U65A 1QIEA 4G4GA 1UKCA 5EHZA 1FFEA 4Y2RA 2PUHA 3WIOA 4UBIA 2WIDA 3G02A 3WKAA 1LGYA 4Z49A 4J0JA 3ICVA 4WCVA 3WK5A 4OB7A 3RLIA 3HJUA 3NGMA 1XKLA 3WWPA 1HLGA 4UHEA 3WL5A 1A8SA 1CPYA 2WHQA 5LIPA 5FPQA 1J2EA 1Q0ZA 1NX9A 3O4JA 3GA7A 1MN6A 1EINA 2ACKA 1CUYA 3HSSA 5CH5A 1LBSA 3ESDA 3WKCA 2V97A 5EIEA 1R1DA 4PNZA 1CLEA 2D5LA 5JZSA 1MJ5A 3SC2A 3QVMA 5JD5A 3FSGD 4N5IX 2OGTA 1LZKA 2J4CA 4DM7A 4Y2QA 2K2QB 3FCYA 2I78A 2PU7A 2YXPX 1CUCA 3WMRA 3H2GA 3DCNA 1ZD5A 4Y2XA 2VA9A 3FWHA 5D6OA 4EY8A 2WG0A 3OG9A 5I9IA 4AB1A 3HLKA 5F4ZA 3G9UA 1XZAA 3O95A 2V96A 1AX9A 2Z8ZA 2WUEA 1WHTA 3A70A 3WK4A 4QDTA 4UUQA 4B80A 4EUSA 2EDCA 4B83A 3WWDA 5AOCA 3UUEA 2VT7A 4ZRDA 4PSUA 4LXIA 3DL7A 1J06A 3G9XA 3G0CA 2DSNA 4C88A 3UMJA 3AILA 3OTQA 4G8CA 1TKRA 4P93A 4UFPA 3AZOA 2RAUA 2I3DA 3C70A 1QIMA 1F6WA 4CCYB 1CUZA 5C7YA 5AKGA 3WK8A 5AI5A 4UPDA 3OURA 1WPRA 2BGRA 5E4TA 3DOIA 4J0GA 2RI6A 3BF7A 3T4UA 5A62A 2XUQA 3R3XA 4EY6A 3OOSA 3G9ZA 4BDSA 2CB9A 4GBGA 3JWEA 3E1GA 4UBOA 5A6VA 1UK9A 2HU5A 2RHWA 5IVHA 5SYMA 3D0KA 3STVA 1XLWA 2BUAA 3DKRA 2W6CX 4Y2JA 4BC0A 2HM7A 5A7GA 4GDMA 5FP0A 3U0VA 5ALRA 4BTVA 4X91A 5AH0A 5JD6A 4B0OA 4KEAA 3F97A 4H7JA 2AJLI 1VA4A 3H2IA 3OC0A 3GBSA 3C6YA 4HVTA 1QFMA 2WIFA 3Q0TA 1WCYA 1UT6A 1UK6A 5AKYA 4OU4A 4PV7A 5ALHA 4K6GA 1JKMA 2G4LA 3C45A 3A2LA 3HZOA 5AOBA 4HRXA 1CRLA 5E4JA 1SOMA 4H7HA 5AK4A 3DNMA 5BV7A 3JYHA 1C7JA 4WFIA 4YX9A 5LZ8A 2XQKA 5AKIA 3R3UA 2WIKA 1ZI6A 4H18A 1FFBA 1CUIA 4X6XA 3LIPA 4U2FA 5ALQA 1A7UA 2GBIA 2AJ8A 5I8PA 2VQ6A 4WY8A 3IUQA 3AZQA 1HPLA 3ZLVA 2WQZA 2VATA 4FWBA 2OLEA 4DGQA 5LLSA 3BWXA 3ESBA 2PM8A 2VJCA 3QPCA 5DNVA 1TCAA 4W1SA 4BBZA 3DD5A 5A2GA 3FYUC 1J07A 3KDAA 4RE5A 5FKJA 3C43A 1XKTA 4MXDA 5AKJA 7YASA 4C89A 3I1YA 3VXKA 4RGYA 1TK3A 5DYTA 3QPAA 1ZGBA 4G9GA 5AI6A 1U8EA 5ALXA 2AXEA 3G0BA 5AKHA 4CIAA 3DDUA 2JGLA 4JEIA 5LZ2A 3PI6A 4BCCA 5JALA 1UK7A 1XQVA 3WKDA 3D2BA 1MNAA 5ALEA 1MU0A 2BUBA 3VVLA 5JIBA 4EBBA 2HA0A 4ETWA 1SFRA 5HK9A 4E11A 4PSCA 1N1MA 5LZ4A 5IVIA 4Q3OA 2QZPA 1QIDA 1CUVA 3VJMA 4CCYA 4BYMA 5JAPA 1GXSA 1YB6A 1ZIXA 2JGKA 1GPKA 1OCEA 3STXA 5ALLA 4H77A 4WFJA 4JYPA 3P2MA 1CUGA 3VKFA 3STWA 3O9MA 1CVLA 3C5WP 3GFFA 5AP9A 5FV4A 1IZ7A 1TRHA 4DNFA 1L7QA 1CQZA 1K63A 2CUTA 1L7RA 1IUNA 4BATA 1VXRA 1F0NA 1G5FA 1HQDA 4Q05A 1J1IA 4MQMA 4QZVA 3CN7A 4F0JA 5AK6A 1Y7HA 3IIIA 5EFZA 4GLBA 4OPMA 4H7FA 2OAGA 1E66A 4MJ3A 5JZ9A 2O2GA 5T4BA 3IUNA 5AOAA 4BDTA 2QRUA 1VE6A 4IH4A 1EB9A 4K5QA 4IQ4A 2PSFA 5ALGA 5J3JA 1MAAA 1E8NA 3UUFA 3I6YA 4WJLA 4KE8A 2PU5A 3R3YA 2G63A 4EY5A 2ONCA 5E2IA 5AKXA 3D2CA 3VDXA 1UKBA 1XRMA 3FCXA 1EB8A 1XZEA 1TIBA 5HKBA 3TRDA 4IHAA 4L0CA 1T2NA 3D7RA 2C4HA 3H2KA 4BVLA 4GW3A 1YS1X 5FPPA 3I2IA 4UBMA 2XB6A 5KREA 3NUZA 5AJHA 4TPKA 3QMVA 3ZWQA 1H2ZA 1CUUA 3N0TA 1DT3A 1C4XA 4DMKA 1DT5A 4J0CA 5K3FA 1SCKA 4UBLA 5JZBA 3V48A 5SYNA 3H2HA 5CMLA 4OYLA 5HQ3A 1DWPA 1U4NA 4Y2VA 3KOOA 1ODSA 3IULA 2QMQA 5HK8A 4B9AA 1GKLA 4HTAA 4UHHA 3F67A 4G1FA 3WK7A 4Y2SA 2DR0A 2ORYA 2WUFA 2XQGA 4HXEB 1R4ZA 3WA7A 4S0XA 1K6EA 3RARA 2XMQA 5AK3A 4FHZA 5HCUA 1E3QA 2ES4A 3FVTA 4J0KA 2WIGA 2DQZA 5EHNA 4F21A 4ARAA 3WJ2A 1MAHA 4OUKX 3AIOA 4ROTA 1EHYA 5ALPA 1O6FA 3DKKA 3T52A 4Q1VA 3I2FA 4J0DA 4X71A 2WLSA 3I2GA 4X95A 5EHQA 1KU0A 4RPCA 1XZJA 4HS9A 5CW2A 4KACA 4E14A 2VT6A 4XIIA 1XLVA 1VKHA 1JMKC 3C6BA 3FLAA 4QWWA 1N8SA 1LLFA 3O0DA 2WG1A 2Y1KA 4C4YA 4EA6A 4JUIA 1DINA 5ALMA 4CI9A 1WB5A 5BWBA 4L3WA 1FFCA 4UHBA 2DQYA 3WWOA 2HDWA 1K8QA 4QNNA 1M33A 4DLNA 5HF9A 1XLUA 5AO9A 1A8QA 4AO7A 1QIGA 4B84A 1JJFA 1GGVA 4OB6A 1THGA 4PO3X 5LYYA 1CUSA 2PKYX 4XWGA 1ZD4A 2H7XA 2AJCA 4K6KA 3Q8WA 5K3AA 5DLPA 2E3JA 2RHTA 3E4DA 1MX1A 2QOEA 2ZYSA 4AO8A 5H3HA 3EQ8A 4J7AA 2QR5A 3AUKA 2CZQA 4DSZA 3M3DA 1EVEA 1YAHA 1GPNA 2VJAA 3PE6A 1CIJA 2DHDA 1W52X 2JIDA 1RYYA 1W4LA 1UWCA 2XT0A 3WI7A 2QXTA 4BB0A 1CV2A 1XFDA 4DIUA 5FUMA 1IMJA 1Y7IA 4X3CA 4BRZA 4WFKA 4FTWA 4X92A 1BN6A 3CN9A 3ZV7A 5A71A 3DLTA 4ZV9A 2NW6A 3B5EA 5LP1A 4BE9A 4ZXFA 1GPLA 3DS8A 1AURA 4MWTA 5AHXA 5D3ZA 4H35A 1GT6A 5CXUA 2PUJA 4OSEA 3X3HA 4AZ3A 3LLCA 1QO9A 1XRLA 3DQZA 3V1LA 3I2JA 4LIPD 1VZ3A 4U2EA 1XRNA 4U2BA 2ZSIA 3C6ZA 4UBNA 1DQYA 3FAKA 2OG1A 3QYJA 3LIIA 2R8BA 1XQXA 1H2WA 1QJ4A 3S8YA 3F8SA 1ORWA 3W05A 3W2TA 4A5SA 1QTIA 2Y6UA 1ZICA 2XQFA 5IH7A 2GZRA 2WJ6A 3M83A 4BP8A 3O4IA 2PBLA 2Y6VA 4N8SA 2IIVA 4ZV7A 1TCCA 3HC7A 3BF8A 2B9VA 4CFSA 4QDXA 3EQ9A 3MUOA 4J03A 1EDEA 4N5HX 5DNUA 4I4CA 5ALZA 3DEAA 2XMGA 3JW8A 4G5XA 4A16A 4FNGA 1Q0RA 4LXHA 4AX4A 4DYHA 2C0PA 3AFIA 4I3FA 2H9YA 3STUA 2VAVA 5T4FA 3K6KA 4H0CA 5AI8A 2PVSA 3QM1A 5JD4A 1HDEA 1GZ7A 2WTMA 1ZJ4A 4G8DA 3I2KA 1QTRA 3ESCA 1X70A 3H04A 1USWA 1TCBA 5DTIA 5CT5A 3KWFA 4C01A 1R9NA 2ZYIA 4UHCA 5DJ5A 3LS2A 3QMWA 3WA6A 1A8UA 1G4HA 2QUBA 2DFPA 3FBWA 5K3EA 4FLMA 5AM3A 4H7DA 2O7RA 1XRPA 3F96A 1QIJA 5A7FA 4BTLA 5ISMA 4RE6A 1LNSA 4QLAA 5HFAA 4DSAA 3H1AA 2V9ZA 3STTA 1ORVA 2OCKA 2CKMA 1OILA 2CBGA 4QDZA 4UBJA 1Y37A 1UFOA 4KRYA 1S8OA 3ANTA 3C8DA 1FJ2A 2O2IA 3I2HA 5HF8A 2XQIA 3PFCA 3RK4A 4DNPA 4MYSA 4Y2TA 5K3FB 4EHBA 1DWOA 3AIKA 1KU6A 2HU8A 5HQ3B 4N8DA 4FDMA 5AM2A 1XZMA 5T4HA 1GKKA 4H7IA 4ZI5A 3OM8A 5AK5A 5K5EA 2BUCA 2WSLA 5DNWA 5EGNA 1QIFA 1W75A 1R9MA 1AKNA 4K2AA 1QIHA 1CUJA 5JAOA 1QIIA 2Z5GA 1H2XA 2GYVA 4QLOA 2GBGA 4ITVA 3AZPA 4FLFA 3L1JA 4BAUA 2B4KA 1YS2X 4BAZA 3D3NA 3R41A 5ALJA 4FBMA 3WWEA 3BL8A 4JYMA 3C6XA 1QIKA 2WKWA 3IDAA 2XMZA 3HI4A 3PFBA 4U2DA 2WG2A 1WPXA 4FFWA 4HXGA 2HRQA 3GZJA 1H2YA 3VVMA 3IBTA 1AMNA 4KE9A 1JJBA 2XMRA 2WFMA 5CT6A 2JGFA 5FRDA 4GEGA 3RM3A 1JJIA 2X8BA 3HYSA 2C0QA 2J3QA 5D7BA 4W9RA 3MUNA 3EBLA 3ED1A 3D5EA 5CT8A 1TQHA 1JFRA 5JYCA 1CUXA 1O6GA 5K3BA 3V1NA 2FUKA 4BP9A 1UZAA 4QWMA 2HIHA 2UZ0A 1GQRA 1P0QA 1BEZA 4GXNA 5JARA 2JF0A 2FX5A 3KXPA 5HKAA 3BE8A 2XMSA 2O2HA 2OQVA 4YASA 1H22A 5AI9A 3TEJA 4W1RA 3KWJA 1XZBA 1MO2A 4BE4A 2XUKA 1QLWA 5ALKA 2WILA 1DX4A 4D9JA 5ALUA 2QUAA 2QKYA 4F60A 2QXUA 5ESRA 4EB0A 2JGIA 3FLEA 3HEAA 4P9NA 2ROQA 1AGYA 5FDFA 4WY5A 3E3AA 4CCWA 5YASA 1W6RA 1BRTA
chains in the Genus database with same CATH superfamily
2FSHA 1XJ0A 1CQJA 3T3PB 3TYXA 2D0DA 4AF8A 3DAGA 2LCQA 2I8CA 3KR2A 2XAUA 1QANA 2VEOA 5B64A 1ESCA 2GZDA 3BDAA 5L40A 5DT2A 5GY7A 3GOHA 3DCYA 5FWAA 1I36A 3TINA 1USVA 5FX2A 2GETA 3WGKA 1XKXA 3LUAA 5AI4A 2QG6A 2ONZA 3O91A 1JYFA 1NN0A 4PZ0A 3AUFA 5DHRA 1V39A 3VVBA 3E4CA 3B1VA 5IJXA 2OFOA 5CG2A 3ZGNA 3EC1A 1RYDA 1E0AA 1JKJA 1TT5A 4PEVA 4CV2A 3VYUB 1X3LA 3A25A 4FMCF 1G0NA 2PR2A 3C87A 4N03A 2FW0A 2QE7A 1RTTA 4I4NA 3TJZA 3PHGA 3QHAA 4ANFA 3QE3A 4PLCA 5I3CA 3W5BA 3MQFA 4JY7A 1FVOA 5CH3A 1E0KA 2HBRA 2RGWA 4YACA 1OT3A 2C29D 5FWYB 1NKVA 1PFUA 1LVGA 2VNHA 5EWMA 1P6XA 1UPFA 4BNVA 2FPXA 2VPQA 1JDZA 4R81A 3UHJA 3A1WA 4FNMA 4V1CI 2LPMA 4LDPA 4G67A 4B3CA 4J90A 4OAOA 3TLAA 5KTMA 1GY8A 1ZOSA 1R0WA 1QO0A 4M54A 4ZQCB 4ZDJA 4JP1A 1N6RA 2J30A 1O94C 3PUZA 4R2IA 5JVDB 3TGLA 4M7OA 1W9HA 3U26A 4CQJA 4G1UC 1BOOA 4Q3LA 5L53A 1RYEA 2VT2A 4DIBA 1PQ4A 2WF6A 3MTQA 2LUOA 1Z82A 4B2LA 3FNFA 3C1AA 3CZMA 5JWHA 3A11A 3DBHA 1UAYA 4P84A 4DCCA 3LVRE 4DLLA 2PKCA 1JT2A 1J24A 3ASUA 4OGLA 1RC1A 3O7WA 4MW0A 4LRQA 4TRNA 1KC3A 1WSDA 2Y8EA 4B6GA 2TYSB 3O82A 4NBVA 5TPWA 3HBFA 3M6UA 3KBOA 3MFQA 5DASA 5AKZA 3AINA 1E5LA 2EC5A 2FN3A 3I9NA 2AXNA 4W1QA 2Y1EA 3P9CA 3G7NA 2EJTA 3NRBA 1ZCFA 1JH8A 2CLDX 3R6TA 1N7HA 1VE9A 4HDQB 4AZ3B 1K1EA 4DV4B 2Z0MA 1D6MA 3HVJA 5I6DA 3IXMA 3W6UA 3RYTC 2AV6A 2H1LA 4ENTA 2IF2A 4NK5A 1PR2A 5AM0A 1LW7A 3IQWA 5K0CA 1E1CB 3EJ6A 3G5MA 4L4RA 1NW8A 5HILA 2VH5R 3ZOKA 2JHAA 4EHAA 4GL2A 3AOEC 3ZKWB 4ZCRA 3AU9A 1ISMA 3AERA 4AMVA 3CMMA 3PF8A 4PS0A 4R16A 2HBYA 1E4YA 4INAA 2XRFA 3UUGA 2OAEA 3CEHA 5T57A 3V8MA 4D9NA 5LQNA 2HA5A 3AJDA 3QLVA 2YIVX 2QHXA 1M8JA 1PT6A 3IEKA 4AUEA 1QF9A 3GGOA 1F38A 3NEJA 2POCA 4LWZA 1NWCA 4HTFB 3RHZA 1CT9A 2QUZA 3R3WA 1GGJA 4BCDA 1YZQA 4CF5A 4HPXB 5G1PA 1EFTA 3K31A 1YVUA 3VRHA 5MGBA 2NVOA 1GFZA 1QZXA 5EJ2A 2PNJA 4AW9A 5FBQB 1PVOA 3I1IA 1PFGA 3WGQA 3GJ8A 3EVCA 1XRRA 2QUIA 2Y1CA 2JBWA 2Q6KA 3QWIA 4QPCA 1XP8A 2BMAA 4IHJB 3TL3A 3O2JA 1W96A 4PHHA 3U9LA 4YPVA 3LKDA 3CB4A 1FPMA 4ZJUA 1J5XA 4GD3Q 5KYYB 3RYFB 4D1YA 3D5QA 2K5UA 1F51E 1YHYA 5J2UB 4UJ3A 5FV7A 1ADBA 1NW4A 1T3TA 2O6HA 3KUUA 4D3ZA 1I4EB 2H0QA 2EJCA 1N9GA 1FJHA 4AJ1A 3RNLA 1UP4A 2OB2A 4ZTZB 1LRJA 4O4LF 4QDOA 4MO2A 2A0XA 2IYEA 4GEKA 5E9AA 4U02A 1IJEA 2VHUA 1KYXA 1COWA 2Z2ZA 3IHLA 2GAIA 3ZY4A 5JNUA 4EMUA 1HMYA 6GPBA 4U39A 1NF2A 1V9SA 1C30B 1ZKDA 3QWBA 4U9UA 3ZDBA 4FDUA 1ZK2A 5F23A 3ZU3A 4WBXC 1NLUA 1JHZA 4N8EA 4XJSA 3C3CA 4IEEA 1G19A 1Z7BA 2GPWA 4EMSA 3CVOA 1M8FA 4OAPA 1FIUA 3DEHA 2K7FA 1QHHA 2P4QA 2HLDA 1DPGA 1MO3A 3AR6A 3SIWA 2Q45A 2Q50A 1GNSA 2EZ4A 4HQFA 4IV0A 2WV9A 1NUTA 1A9YA 3IT1A 2FZEA 2VDRB 1XQWA 1S3FA 1F4LA 3LRPA 1ZMTA 2YZKA 4MA0A 1P0PA 3KR0A 4OMCA 5AVOA 1O96B 3NTUA 1AG9A 3DE4X 1CETA 2VDLB 4DLYA 4LQLA 2UU9B 4H6XA 3SP1A 4BZQA 4U5QA 3SZRA 5C8ZA 3PDWA 1C9MA 4X8OA 5HJ7A 1XCOA 2V7EA 4H1VA 4Z2AA 3W9UA 3W04A 1C3VA 3DKVA 3VPHA 1AHPA 1PZFA 2BJHA 3WFIA 5KCMA 4BV8A 3D3WB 3ME5A 2V65A 4IOLA 4OCZA 4NYIR 2PMFA 3H0EA 4D74A 1KMHB 2GCGA 2GM5A 4JELA 4UAGA 2QSZA 1OXUA 3VTAA 2X9GA 1S5PA 1BVYF 3AESA 1QG6A 3F2IA 3L1IA 4JJAA 3VHQA 5A9SB 1RYHA 3X1JA 1EFVB 2DQSA 3N2ZB 1NMQA 4JYCA 3CEAA 4TV8F 2H2WA 4Z9XA 4LYEA 3GZNA 4P92A 3AR8A 2BI7A 3GVPA 3PE4A 3VU9A 3ZH2A 1JMYA 1O58A 1R6XA 4UHJA 1CS0A 3RO7A 3PQFA 3QE4A 2FN4A 3C3EA 3CFYA 2HTEA 3GLUA 4G4SO 4IH9A 1GRCA 1O1YA 3WJ1A 2ZKIA 4X6YA 3WHIA 4ASUD 4EZBA 1RXWA 4XGRA 5CGZA 4J0IA 2AMYA 2GAOA 3PPWA 3UJCA 3URKA 3FOEC 5AYVA 3NHFA 1UF9A 2NYRA 5BWMA 2HMVA 2FPGB 4DILA 4XTCS 4B31A 3JTMA 4U6NA 1YR2A 3AI2A 2GYUA 5E4YA 1YKFA 1QXSA 3C4JA 3O6VA 1N0IA 4GPBA 3CLRC 1X39A 3AKYA 2AL7A 4PO8A 4QARA 1NQXA 3B3JA 5KOJB 4I6GA 1ISIA 3EFOA 1Q7RA 2CLCX 2HWUA 1RHQA 4FK8A 3FNBA 2NAPA 2AB0A 1DS6A 1XHFA 4HB2A 4NZOA 1PS8A 2LIPA 4L6IA 2WJAA 1SIWA 3NU1A 4KQ1A 3F98A 1J5PA 1FXWF 2FH5B 4MV7A 1L5KA 3T94A 3KKZA 4BC1A 2XRYA 4UZSA 3NAMA 1DG1G 2XYRA 1ABBA 1VJ5A 1RM0A 2SCUA 3WLAA 1KJYA 3DLAA 2O0JA 4TX1A 3LTNC 1QGED 2PR7A 3MWEA 5CJJA 2J07A 1O08A 3HZZA 4HLCA 1NVXQ 4UNSA 1Z0JA 4FMCB 1QZ3A 5BOVA 4DWJA 5CR9A 2QMUA 2RDMA 2OZPA 2I1WA 3QVJA 2A84A 1JAZA 1YE3A 2VDQB 3ILHA 3WQRA 2GD1O 4ER3A 5EHGA 1NMSA 3WLJA 3PTAA 1YO6A 4PO1A 1RJWA 3R0QA 4TRMA 4Y6GB 3UQYS 4GSLA 3L6EA 4O59O 3FVRA 3ZCTA 2I6QA 4BRUA 3IQDB 5A4IS 1O2DA 1J8YF 2VFAA 3LC1O 4L8WB 1T5LA 1EGMB 5HIMA 3R8XA 4UUBA 2DFNA 3WDKA 2O8DB 1PWXA 1U9IA 4I14A 3NC1C 4DA7A 3WGOA 3IV6A 4MVJI 3I6IA 2FQQA 2WM3A 3DKIA 2H4HA 1GAWA 1U0BB 2JFQA 3TEFA 3E7FA 2YHIB 4TVKA 1U3DA 4DB4A 5C8DA 3DLBA 2G1JA 3FGOA 3IVGA 4IXTA 4RNDB 3T35A 4J91A 1WXXA 3I09A 1U98A 3H1EA 5I4IA 1ZZGA 4UFNA 2V8OA 1EFRD 4UATA 4DMMA 3RC8A 1L7NA 2I2CA 5EOVA 3GNTA 3OA0A 2VNAA 4ALNA 2Q0QA 2BZGA 3G0DA 2QU7A 4TMVA 1BS1A 3UJDA 4IV5A 4CKXA 3WAJA 1RAEA 4ZTUB 1N2EA 2QQFA 3V8NA 1ZVKA 1ES9A 3KU4A 5LVAA 1YF3A 4LKRA 3EXHA 4IGFA 3QVTA 4JBNA 1QOZA 5IKXA 2OLKA 4MQUA 4NPHA 2XUIA 2EGHA 1X7DA 3C1UA 3OKCA 5DU2A 3M9XA 1DIOB 4RCZA 5TGZA 1Z34A 4NI5A 3G2KA 2C2YA 1HYHA 3V9AA 4FZRA 1Z5PA 3JYNA 5KYVA 1WY5A 3LH5A 2ZR7A 2JVKA 4DT1A 1SVSA 2P8SA 4FC6A 4UC0A 5DNCA 1KJ9A 2UYCA 1ETHA 4QXMA 3IQEA 2YUIA 1KY4A 5D6NA 3KB1A 4F4UA 1S2NA 2ZI5A 4FLEA 5K0BA 1VMEA 3C98A 1G7TA 3LUPA 3SLRA 2JFFA 1KAQA 5AVKA 2YWXA 3OVMA 2CEKA 4UBNA 3W2EA 3WDLA 4BLRA 5HF5A 3DT9A 3AVXA 1XRJA 1KQPA 2XE8A 1AKYA 3DE2X 4DL9A 1YNOA 4HGQA 3R6WA 3DLIA 3GEPA 3UWMA 1T8SA 4YWHA 4Y98A 5E1BA 4U5XA 3PNYA 2O8CA 2ACWA 1CDDA 4DJDC 4LJRA 4U7JA 4PX5A 1ZOIA 1NFQA 4ZO9A 4NMWA 1X38A 2QDKA 3L8EA 3ZZ1A 1P2DA 2C8VA 3HFGA 1JSRA 1O6ZA 3IB3A 2N3ZA 5DRTA 5J58A 2GPJA 3HRIA 5KWJA 1QH1A 1RNLA 3UV3A 5KVVA 3T5PA 3OOJA 1HUQA 1CUDA 1L6IA 1N5LA 3L8CA 1BMTA 3CLSC 3I72A 2Z5LA 3KD2A 1JEOA 2X1LA 4K9NA 1LBTA 2VHCA 2YASA 3D0RA 2Q9AA 3FNEA 2BTQB 1EPUA 4O4LB 2W2OA 5I51A 1DJQA 3H7IA 4D25A 4DLVA 5KI6A 4U8GA 2D2FA 1DO0A 1F4VA 5IDXA 4RPIA 3R40A 3T7IA 1UBHS 5B2FA 2WV7A 3WYNA 4DA0A 1LU9A 2REXB 3ZWKA 5JWRA 5LNK6 3ITDA 2OP1A 4G1MB 2Z9DA 1GPWB 4O4IA 4AZ0A 2ZROA 1I5EA 1RRGA 1RWBA 1YRLA 2RIPA 2J32A 4YT2A 5CYGA 1V7PC 1YVRA 3UAZA 2JGDB 3BQMB 4MYRA 1YZGA 3UGKA 1FFYA 4FYKA 1L7XA 3IA7A 4ASUA 3SXUA 3OJXA 1GKUB 4BEVA 4UW9A 4KVAA 2WD9A 1RSZA 2XA2A 3R9KA 4DMRA 4MS3A 3X1DA 3KQPA 3KZ1E 4IXMA 2OXCA 2W93A 1RWQA 3ZEAA 3H1BA 3ICWA 1RD4A 2IEGA 3IJPA 3B6EA 5HX7A 3ZHTA 1PL0A 2DECA 1Q0HA 3BMQA 3BJMA 4H2DA 3ORYA 5EMLA 2KW5A 2Q2NA 3C6KA 3D7LA 3P26A 3SZMA 4KKVA 1VBNA 3PDIB 3U9TA 1DQNA 1P1JA 4KNVA 1PP4A 5EE1A 3B6JA 4CN8A 1NI4B 2GT1A 2LV8A 3Q7EA 3QOXA 4JVOA 4M53A 2PWBA 5EXDA 1B15A 2BR5A 2I76A 1DXQA 3K72B 1AKUA 5CCDA 1VSUA 4C3VA 5IKEA 2CJPA 3A32A 4L8FA 3SVTA 1ZRMA 2NXWA 2RI1A 3L8FA 2N47A 1GDTA 3RRFA 3PQ4A 2FRVA 2V6IA 4X8HA 2CXXA 3JALB 4LV6A 4R8KA 1YQDA 4TV8B 1KAEA 4H7KA 1CUFA 2H16A 3UCFA 1PUIA 1NVKA 1NFRA 2XNSA 3HKBB 4QPNA 4R1TA 4AROA 5ULLA 2VHTA 3CUUA 5B12A 1YZNA 2IPNA 3FSGA 4A10A 4D9FA 2EQ5A 1E3MA 1FK8A 1Q20A 3WNCA 1N5MA 2AN5A 1XZGA 4PPYA 2QTCA 3C8MA 3DP7A 4Z8XA 1W2GA 1Y6ZA 2CVZA 1PX2A 1MA0A 2FLWA 2HK9A 2J0UB 3EZLA 1VL6A 1EDDA 3GGSA 2W6JD 2JIBA 3X2FA 2DUJA 1ONPA 1ZN9A 3PF9A 4MQEA 5F9MA 3UXEA 4B85A 1X14A 1LPSA 2ECFA 2GARA 2O3QA 1N77A 2ASVA 3DTNA 1NLYA 3DTVB 3TCXB 1F12A 1C9EA 3VJLA 3SQWA 2WKQA 2AF4C 3MWYW 4WCFA 3HA5A 3SR4A 3S8EA 3PC2A 4TTQA 1PNVA 2YVLA 4RTMA 2QAJA 1C7RA 1DJMA 4KO8A 2H11A 2I6XA 4PQGA 4IQ8A 1TUBA 2HYIC 4XX1A 2D4HA 4HDAA 1NJFA 4PONA 4C30A 4PPFA 2Y1FA 4P7GA 2FQYA 2PJDA 3HUUA 2WUDA 5EESA 1O95C 3P19A 4KFRA 2PSJA 2H7CA 2ACEA 2IIPA 1EFRA 4BRWA 3T1HB 1YIOA 2JLYA 4V0LA 1UZNA 3BH0A 4ARIA 2O59A 1P7YA 1K7EB 1LA2A 2J5RA 1DU4A 1GO2A 3K0FB 3WL6A 4PCLA 5LKRA 3GCGA 1RWKA 1LI7A 1AS0A 3MYYA 4URUR 2MR6A 5LCXA 1L7BA 2AA3A 4LQDA 1Y1PA 1A04A 1MH1A 2F00A 2Q2WA 4GZ3A 3SHQA 2JCGA 4EGCB 4OJNA 5JW6A 1G8KA 1YRWA 1E9VA 2CXUA 5JZMA 4QPPA 3AVTA 4DW8A 1K92A 1N92A 3DF9A 1TU3A 2PBZA 3TQTA 4KDRA 4TL6A 4Z0HO 1HFKA 3QF4A 3L4BC 4FYIA 3JQEA 3HLTA 3L4JA 2QN6A 2HJWA 2P68A 5TGTA 3PPVA 1IULA 1M72A 2X0RA 3AF5A 3B5IA 2GYWA 2J3EA 1E92A 2NSDA 2ZR9A 1XYGA 3IP8A 1J0DA 4ZA2A 4AICA 5EYPA 3THXA 3LNTA 3ROZA 4XYMA 4XWTA 1AZLA 3ZBPA 5IU6A 2IZ5A 4C4OA 1G7RA 1XZLA 1WCIA 1CP2A 1Q83A 2KE5A 2UZIR 2FWMX 4U3JB 2XYHA 1R5NA 3VGJA 2PZLA 3HACA 4BX9A 1IMOA 1AN0A 3MT9A 4UTXA 1HQCA 4JXXA 2PX3A 4HNAB 2B8EA 1E3EA 2H7YA 3P5SA 4Q24A 4O0MA 3QENA 4Y7DA 3EJWA 3BHJA 3PQ2A 4QIHA 1ZI8A 1KMMA 3W06A 1B6GA 2VXYA 4NARA 1GGKA 2G08A 2XUAA 1RHJA 2DKOA 1K2VN 3LAWA 4FR2A 1DQRA 4C43A 2AJTA 4CJXA 5BQFA 5JXIA 1O8CA 1F1BA 3LY8A 3O93A 3PNMA 5CK5A 4EUEA 4FSXA 1FNNA 3SF0A 2FMUA 3HU1A 3KM0A 5FHQA 3ZW9A 5E0KB 1EE1A 2X4LA 4PN7A 1NJGA 4QU9A 3UB4A 1SKYB 1IZ0A 3KG2A 3IR5A 4PHGA 3RHTA 4AG3A 4E46A 2BW0A 3E3OA 4U2GA 1UOQA 3F7TA 3PFIA 1K89A 2C4KA 2IZ7A 1RLOA 4ZN6A 3HB0A 1HT2E 2FPPA 4QUIA 1T24A 1TFUA 3G8DA 1QO7A 3EZNA 1CYDA 1LLUA 4YDRA 3OKAA 1SVKA 4U7WA 5CX4A 1YJ8A 1THMA 3D8RA 5LOVB 5CB4A 2X8WA 4RF5A 4YAKA 4G1VA 1QGYA 1E4OA 2CVFA 2GLUA 2LDXA 5DSXA 4BLSA 2C92A 1DZIA 2OOKA 1TECE 3FKQA 4KXWA 4W8GA 3PXGA 2G0NA 2GAJA 4NE9A 3IUMA 4I1UA 1ZNZA 3N8HA 2P9YA 5AKEA 3GIWA 4TMTA 4TQUS 1NNI1 4IO0A 3W5DA 4OIFA 2B5VA 4GL4A 4GS5A 4BUCA 1G7CA 4TYMA 3H3XA 3IE0A 4G65A 4LWQA 4GPZA 5JJ5A 5HRUA 2P3OA 4OGKA 5K0SA 2AC7A 2IXGA 2OBYA 4U6QA 2O5EA 3FYUB 3EMKA 4H60A 1V3UA 5F73A 4CL3A 3QPDA 3RFCA 4CR8A 1A76A 3COSA 4NNOA 3I83A 1GRQA 3AF6A 4Y9TA 2O2JA 3PIIA 3JASA 1JLLB 2G5PA 4JP2A 2XDAA 2GZSA 2WAOA 1ZD3A 4LYDA 5CUQA 3S2ZA 5A05A 5DTMA 3OF3A 2HAEA 1QFXA 4ZAFA 3LPCA 3ENNA 3N87A 4A0RA 1EWYA 3C7KA 4P83A 2BEVB 4E6EA 2O3RA 3MMSA 1M2OB 4XB1A 4B73A 5I4KA 4JLNA 3BT7A 3RNOA 1SD1A 3L07A 4INPA 1YAJA 1CRPA 2YH2A 1VA5A 2B2CA 2HMSA 2NVUA 2XMDA 2ZB3A 3HYNA 4NONA 1RKBA 1G60A 3EG5A 1HKHA 1ZXXA 1L2TA 2UKDA 3HDQA 2ODWA 1BCRB 4KWTA 5KJEA 5LPNA 1TRKA 3C15C 3DFFA 1FMFA 3V8QA 5DTRA 1EK6A 3C5VA 2G4VA 2XBUA 4HLNA 1BXRA 2WFLB 4CU2A 1GLGA 2R11A 1HH4A 2PK3A 1DKLA 2C9YA 1OC2A 2BD0A 1U7HA 1VRWA 1VLQA 2YMLA 3MWKA 4MP8A 3T8YA 4IIBA 3QXJA 4I5DA 3WOHA 5DW0A 5I4BA 2PX0A 4EY4A 5JASA 4LBVA 4E2WA 2PG3A 2E37A 2WSYB 3KWMA 3RJ9A 1BVRA 1XP5A 4EX7A 2J4DA 1HR0B 1ZG3A 2OC4A 1LRLA 1YGYA 2I6SA 3H1TA 1NKTA 4DC1A 1UBOS 1WHSA 5BW6B 5TQ2B 3T0GA 4MWOA 1Y42X 1SKYE 1U5BA 3EW9A 3MTIA 4N0EA 4TS4A 4TYQA 2NU6B 4C06A 1E9BA 2IXDA 4A8JA 4XGKA 3I30X 2CLLB 3SC3A 1OXVA 1QZZA 3TRHA 1J97A 2AWNA 3NHYA 4YDSA 5K3CA 3FTFA 1QJCA 3EGVA 4Z4EA 2B20A 2P2NA 1EVQA 4WXMA 5DMXA 1WD7A 1YCDA 3ZIAD 1MRZA 2NU7B 3TSZA 3DDWA 1KGDA 2AOUA 3WOVA 3B3AA 4O0LA 1PTJA 1JHMA 2J3JA 3U7JA 5F52A 3VAYA 5JS6A 2PVPA 4QQFA 2G36A 4I8DA 2V7XA 3LK7A 5I5GA 3A6LA 2NOAA 2Y71A 1Q6YA 2JLQA 3W2HA 4ZIRB 5K0EA 2BBTA 2HEGA 2R8ZA 2UUBB 2HY7A 4NOLA 2IYQA 3ONVA 3W4JA 1RT9A 5FQNA 5JH7B 5HQTA 1OE0A 1EQUA 1QS0B 1SCDA 2HADA 4GMHA 4WE3A 5BUCA 2AG8A 3I2YX 3L7BA 4ER5A 1TM1E 4Z86A 1VG1A 4NV1A 1EA5A 1FS6A 3OD5A 2LGJA 4V3BA 2R4UA 1QGUA 2XRZA 1L5HB 3LGAA 1R00A 3ILSA 4GSKA 1KQFA 3LECA 4BVKA 1ABFA 3LOQA 2B82A 3EW7A 3COWA 1G21A 2X2EA 3OTWA 3SYRA 4A91A 1YDWA 4XYLA 3FCUB 4XUDA 1RRVA 2OYCA 4A23A 4J3JA 4TSFA 1KGSA 3QITA 4DNOA 4L5AA 3ESZA 2OCYC 2P6MA 3IAS1 4UFOA 2IKSA 1TCUA 2IW3A 1I2BA 2ZRPA 4M0MA 2PANA 1GUZA 1Y1SA 5LYJA 4LDJA 1WWKA 1H2HA 2C4WA 4RSHA 3TIIA 3ADDA 1K68A 3OCUA 1RE0A 1H94A 1VRVA 5BUZA 8MHTA 2VOJA 3HJRA 1C3EA 1HOXA 1OBVA 1XEWX 1XZFA 1Z5VA 3E2PA 1X8JA 3KQQA 5JI2E 2Q0XA 4U7DA 1SC3A 1UP6A 1WBJB 1CUEA 3ZJTA 2NXEA 4UHFA 4C6HA 2JIRA 5LUAA 5KVAA 4J1TA 1I6LA 2FZVA 2RD2A 3F47A 2QQGA 6YASA 4JVMA 4C04A 2CLSA 1EKXA 1D2MA 4PRKA 5LP6F 2ODBA 3NTQA 2H63A 3QP9A 5C80A 2B4QA 1Q2UA 1Y5IA 1ZITA 3B9BA 1XZHA 3OEED 4MW1A 1UBJS 3H18A 2DCMA 5JU6A 3D59A 1R27A 4RAQA 1XNGA 2NO9A 4LZOA 3VR3D 2RCNA 2J33A 2FRXA 2RGNC 4OKNA 2UUAB 1PLLA 4BNJA 2PE5A 3PEFA 1AUOA 1PX0A 1Z7WA 5C2JB 1EVLA 1CF2O 3CONA 1O89A 4BFWA 3PP8A 4L78A 4CL0A 1EX1A 3Q8LA 2H5EA 1JA9A 2XHZA 3QYPA 1UADA 5EPUA 2QENA 4BGEA 2NT4A 3MT8A 1RBMA 3PQ7A 3LT5A 3OOEA 2FW6A 1K4YA 1KP2A 1DUIA 1R4MA 3RVRA 3FOWA 1FYDA 1JPUA 4K7JA 2AFVA 2Q0HA 3AKZA 3DB2A 4D0RA 3LC0A 1YKGA 2X8LA 3KPWA 3CR8A 4QELA 4LXQA 3W1WA 1G5QA 3VSAA 3IBYA 2DEUA 3E5MA 4OVKA 3AEZA 3HVUA 1WXGA 4MEBA 1TM4E 5KJFA 4P7KA 2XOXA 3VU1A 5B3JA 1UZLA 3REQA 2LNDA 4UDXX 1F9EA 1YWGO 2P79A 2WNIA 2Y1GA 2Z3WA 2ZQ5A 1MQAA 3A37A 3P2JA 3QVXA 2UAGA 4CDNA 1P0MA 2RH4A 3KV1A 3LCRA 1Z4QA 4NS1A 3LDHA 4PPNA 1GZ6A 1LEHA 1JQKA 4G56A 1CUAA 1FBNA 4RY8A 2P3LA 4M46A 5GQSA 1BWQA 4DMHA 1Z8DA 3PJRA 1W2HA 3A1CA 3RBZA 1Y48E 1W4RA 3HXTA 2G76A 2EV9A 5HDQA 2A1UB 1T5SA 2Q1UA 3JWIA 5TXGA 3WZLA 2XUOA 2CCKA 2WFAA 3LK6A 2Z4RA 1Z68A 3NDIA 3A1TA 3AI1A 1GYPA 1TD1A 3RFUA 4G84A 4QUDA 1E9SA 1Z74A 3EK2A 3PDUA 4NIMA 1LVUA 3O1IC 2GOYA 2BTEA 1NLFA 1Z0AA 4QGHA 1TAGA 3T12A 5IMBA 2P2GA 1NYRA 3O94A 5C7IO 2GKGA 1JHAA 1I6WA 4M9QA 5DBOA 3GQBB 4QJ5A 4MIOA 1AQUA 1SOAA 1XQYA 4CMGA 1R3DA 4M8KA 3R74A 2J3LA 1VI5A 5I9MA 3PVSA 3RSFA 1WMBA 3OOHA 4D3FA 5JFOA 3A1FA 5TB5A 4NS4A 4XDYA 3M70A 3H9UA 2JCSA 4DIEA 3AFGA 2OKGA 3O8OB 1CP3A 2YV2A 1R88A 2EWWA 2DBYA 5EIFA 2ZYVX 2V3CC 4KTVE 3V5NA 1Z5UA 1C80A 1EVZA 3FAZA 4QT0A 1QBGA 4O6VA 3WLQA 5FEUA 1EIZA 2XCSB 1UC9A 1L4FA 4N7MA 1QQTA 4FGZA 3H75A 3RYIB 4JMPA 3KQNA 1Q22A 3ASVA 3WB2A 4ABTA 2GK3A 1YSCA 121PA 3QH4A 2VTBA 3H5LA 1JB1A 3AY3A 3S99A 1R6BX 2L18A 1QU3A 1U4OA 4X8MA 3FCCA 1Z0DA 3FWKA 5CDFE 4JLVA 2N75A 3EG9A 4G4GA 1UKCA 4YRAA 3SPXA 1PR0A 4BV9A 3UV7A 4Y2RA 2H31A 5I9BA 5KNBD 3WQBA 2PUHA 3UF0A 4UBIA 2I80A 3THOA 1GZUA 2CHEA 3G02A 3UFXB 2M6RA 3L77A 3ZIAA 1ACMA 1QYDA 4HN2A 1PLJA 3ZV4A 4TYPA 1O94D 4WCVA 3H5RA 2H9AA 3WK5A 4B40A 4EP1A 3NHBA 3TEMA 3HJUA 3G5UA 3NGMA 1QHFA 5CVTA 2X13A 5CA1F 1NT4A 1RCFA 1RYMA 1TEVA 3CPJB 2AZ4A 3LXXA 4WNYA 2FV8A 3QNWA 4RQUA 4LYAA 2FSSA 4PZUA 1A8SA 1ZRSA 3O21A 4FHCA 1CPYA 5FORA 3J81A 2EKBA 2RK3A 1XVIA 3CRQA 4P5PA 1J2TA 4FFOA 4JL6A 1APBA 5IT0A 1CWUA 4XIYA 2NU8B 1JIUA 1KA9H 3MT7A 2V3VA 3BFPA 4KYTA 2XX3A 3OU2A 4PZ9A 3GDWA 5TVKA 2VUHB 4E70A 3ZWWA 4ITRC 2ZM5A 4ZHQA 3BWDD 4B3DA 4NCBA 4M7RA 4TYYA 4KO3S 1CUYA 3V4RA 2IGTA 2AMJA 4RVGA 1EP9A 4BO2A 3KKEA 2BFMA 2V97A 3AYXB 3BWEA 1DV1A 3NDJA 3PDHA 4WXPA 3T61A 1T0BA 3AR5A 3L6OO 4EYEA 3SC2A 4MS1B 3K0BA 2GN6A 3OJOA 4LS3A 3OUZA 5JD5A 1S3GA 1M0TA 2OO3A 3KYDA 4JLJA 1GSOA 2E4AA 3JSAA 4FYHA 3UMRA 2KB0A 4DM7A 3RS3A 3B2NA 3IO5A 1MG0A 4WMLA 3M5WA 4LWPA 4CLEA 4CGYA 5L95A 2P8JA 2TECE 4QFMA 1SUFA 3IPXA 5C34B 3SX2A 3TIFA 2ZJ5A 2UUPA 4OQZA 3WNQA 4PM4A 2IUEA 2F3UA 3PC8A 3Q6MA 4GLJA 5CLHA 3VSBA 3I5YA 3OFVA 2C7PA 3HR7A 3MA0A 4HDRA 3W8NA 4CKBB 5EP3A 1I0LA 3H2GA 3NHJA 3KOUA 4AN4A 3OEEA 1F0YA 1RCTE 2ZEJA 4ZVUA 4CMIA 3Q7TA 3DCNA 2GLTA 3HV0A 4FQ8A 1GNTA 2FMFA 4FUQA 4XVQA 4ZAZA 1ZD5A 1K27A 2ZRGA 4RD3A 3VR3A 5AVUA 2PO5A 1G7SA 2VA9A 3EAQA 3L40A 4WKOA 3K05A 2WNSA 4AS1A 3R7LA 3RQSA 1ZH6A 4AB1A 1WW3A 4CMEC 3OY2A 3K9CA 1XMSA 4W6ZA 1KRWA 2H59A 3BWBA 1M2JA 5DCLA 4NC9A 4AI6A 1TQ4A 2AR9A 1PRYA 2WP8J 4ML3A 3OPVA 4HVLA 5KTPA 4LFBB 3OZGA 1OPXA 2Z8ZA 1NBIA 2CGEA 2RH5A 3WK4A 5IT5A 1JEYA 4AIRA 1J1UA 2C20A 1U3VA 4AJEA 3RU9A 3R8FA 3GK3A 1U7WA 1Z6XA 1JP7A 4FR0A 1YS9A 1IBSA 2ZQYA 5FHRA 3EGWA 3HXLA 3H8JA 1J90A 3NT4A 2W2KA 3OLXA 3TOSA 2I2WA 1UC4B 3PWSA 1W35A 2WMNB 3OFSA 2CYCA 3DOUA 1Q1ZA 2IHTA 3C3KA 3QLEA 2CUKA 2E48A 3OM9A 4OI0A 4UQLA 3UUEA 4ZRDA 2JLAA 3ISVA 1NRWA 3KCQA 1OWLA 1ZIDA 5IG2A 2DC1A 5IC4A 3VKUA 2XR1A 3VZSA 3E18A 4F3RA 3S28A 1U7DA 2C3PA 2B83A 2MYPA 3OP1A 5GWXA 1DUSA 2JZOA 3UHFA 1J70A 3SM3A 3ZV6A 1BGXT 2G07A 2XB4A 5D3MA 3FPFA 4C88A 3I6QA 4XPZA 4YYEA 2N42A 3AILA 4Z7JA 1JS1X 3OTQA 1OASA 1Q11A 2G77B 4HEJA 3GA5A 2C2WA 1TQDA 3W8RA 5A5EA 3E9RA 1HLDA 1C8BA 3EE6A 4Q4JA 1MTOA 3F6EX 1SULA 3AZOA 2DWOA 3TCNA 2A9KA 4DCTA 3DM5A 4RDCA 1MOQA 2R2GA 4D9MA 2RGCA 1PGPA 5K0LA 1E6WA 3SKVA 1FVHA 3OFKA 3WAGA 3B51X 4M1OA 1UFKA 1Z26A 4J94A 1YI8A 1B4DA 2V7QA 2TMDA 3CHYA 1U7TA 2QYTA 3ER6A 2CWWA 2G5CA 3A28A 1BDBA 3JAKA 4QULA 4UPDA 3V8EA 1XAHA 3RE1A 3FTQA 1DJNA 1JVSA 2V54A 2VEDA 3ONWA 2BGRA 4JBXA 4ZCPA 5E4TA 5J5CA 1AO0A 3W7AA 1ZGGA 3KOXA 1KDYA 1KZYC 5LBUA 4TSKA 1ZOLA 2O50A 4R83A 1VPVA 4RIHA 1N8TA 2FEAA 2RI6A 4V0OA 5TSDA 4CFZA 2Q7XA 3OPQA 1P33A 3IALA 4NJMB 1FXSA 2XUQA 4YCSA 2D1QA 2R6R1 3UT5A 4DANA 2QP4A 4HWOA 4BDSA 1X13A 1AF7A 3TDMA 5H8WA 3TI9A 1SMKA 2XJ9A 3AEQA 4GPEA 1G3IA 4ZVOA 1SUBA 3CIFA 3REFA 3TTXA 1AUPA 3CLRD 4B3XA 3A9WA 2C9BA 3NG1A 1AB5A 3NHZA 1XWFA 2UYYA 1Y89A 4RESA 3SNKA 1QV7A 1CR4A 4Y2JA 3W77A 4TS9A 4R2WA 5KNBA 1RLIA 2HM7A 4BC0A 1Y6FA 4PGHA 3RYCB 1T8PA 1XK7A 2XAAA 1GN9A 4DBLC 1M66A 2PRKA 4HI0E 1E3WB 2CDBA 4RA9A 3ECCA 5H5JA 3U0VA 1O94A 3JD3A 4DJFC 3FMPB 5KNCD 3VPFA 3GPCA 3OD1A 4BTVA 1YZ3A 4PNEA 3AGPA 2GFQA 5A4JA 4JEMA 1QOPB 4NABA 1OWMA 4W99A 3G6KA 3QVGA 1YFLA 4FZ5A 1E9CA 1DAKA 4B17A 2QL9A 2JW5A 1N2GA 2B4RO 3GBSA 4YJFB 1KFJB 3C6YA 5TQVA 3PFGA 4HVTA 2ETXA 1TIPA 4K2HA 2EX1A 4Q19A 3D1LA 2ZAOA 3FG9A 4UAVA 3JARA 1OH5A 2YYAA 1F6BA 5AKYA 1HDYA 1RKVA 1IN5A 3KWLA 4JLOA 4UULA 5ENVA 1KMIY 2B7CA 1P7CA 4EGQA 4EG5A 5CFNA 2C8LA 1RP7A 1T5OA 3QHPA 2A3RA 4Y2GA 1N0UA 4GKKB 3LYUA 4RYDA 3LQQA 2OLJA 4LXXA 4B6JA 4CWAA 1E6UA 1JKXA 3D9QX 3K2BA 1FX0B 2W2LA 5THXA 4D5EA 4JCCA 2PV7A 3UBTA 2CMDA 5D84A 2JIOA 1RI3A 1W9MA 5T6BA 4BQNA 3BD7A 3AOEA 2BEKA 2GX6A 4IMIB 3DNMA 3Q3CA 5BV7A 3K15A 4WFIA 5HGJA 3CO0S 5LZ8A 4YX9A 1DJLA 1U31A 1W8IA 5AKIA 2R62A 3OTGA 1GTSA 5CA1B 3QE2A 4TKUB 5FOVA 1O54A 3RUDA 4CLOA 4RGVA 4AFNA 1NXVA 2WIKA 2HSEA 1P61B 4TLLB 4BWVA 4JDUA 4PCVA 1W4BA 4JJIA 2QD2A 1Z06A 2I1QA 2RHGB 4EG0A 4OK6A 4XRGA 3GJRA 4RPGA 1YT5A 3SR3A 1F3LA 2AR0A 4Q21A 3QI7A 3LIPA 2KMLA 4A2CA 3K4HA 2QRZA 4KI0A 1EEHA 2H1SA 2X4GA 4MW6A 4WJKB 2B8NA 3SGLA 4B47A 2O2EA 4RD2A 2VQ6A 4P38A 4WY8A 3IUQA 1C7FA 1HPLA 4JX8A 2ATCA 2Q0SA 3NBKA 3WFZA 4YMTA 1ECFA 4GGPA 4X63A 1HK7A 4TTJA 1GCUA 2VATA 3KVVA 1T8RA 3ZNQA 4C22A 2JIZD 5CG1A 1UBNA 3H05A 1Q12A 1NC3A 1YA6A 3GRFA 1M5TA 2VXBA 5TC4A 1T9GR 1EZ4A 1R10A 3G2IA 3A10A 4D9EA 4EELA 4JR2A 2PM8A 1HE5A 2PY6A 4QU0A 1YU6A 2QSJA 4B6FA 1SCJA 4I5GA 1MV8A 1I13A 3RAGA 5IAEA 3BS4A 3N2NA 4JT4A 1I2ZA 2ZWOA 3L93A 5ELMA 1IRXA 1YZYA 3FROA 4CLRA 3V8VA 1F8FA 4BBZA 2FVXA 3GLHB 3DD5A 3HO8A 4II7A 1KMQA 2ZWPA 4IEIA 4XA8A 1X7HA 5A2GA 2XGJA 2X9QA 1KYWA 1Z0ZA 1ORIA 4LNUB 4Q00A 3KDAA 2HJVA 3O3MB 1MXHA 1XKTA 2BKAA 4MXDA 1GM5A 1ZLYA 1YIDA 5AKJA 4I0WB 4C89A 2F6RA 4N3BA 2X0EA 2H54A 4RGYA 1NBWB 3B9QA 4YP9A 4WESB 2I99A 3TNFA 2I54A 3CUWA 4S0ZA 5EMMA 4KWIA 4MX8A 3QF7A 1I9GA 1TJPB 4CL8A 1YL5A 5AI6A 4KSYA 5ALXA 2H4FA 1XHEA 2DTDA 2AXEA 2RHRA 2WF5A 3EMDA 1GZSA 4OQYA 5KYXB 2H1VA 3QKUA 5AKHA 4DR5B 3CLSD 3INNA 4GX2A 3KEQA 4JI3B 1GNLA 2WAAA 3RUAA 3VKWA 3J7AC 3MXTA 3GPIA 1KBOA 4FE3A 1Z18A 2B1JA 3HU5A 4E2YA 4EA6A 5CDYA 4WKPA 2JGLA 4EYKA 4XCXA 5LZ2A 1YBFA 3PI6A 1ADFA 3PNOA 1FVFA 1XVVA 2E5LB 5MDHA 1ODJA 4I6EA 4UEJA 3JZMA 4WOPA 5JECA 4IL5A 1OJLA 4UMEA 1KHTA 2FCAA 2XYVA 5JXWA 2W42A 5GVRA 3F9IA 3P8ZA 1XQVA 3CUSA 3GFOA 4XI9A 3WKDA 1E1YA 1L1RA 3D2BA 1J42A 1MNAA 2JKVA 1Z6TA 3L7DA 3VDMA 1L4BA 2BUBA 1YMQA 5IXJA 1Q1EA 4I46A 2KBEA 4EBBA 3ICEA 4GMFA 1C1XA 5ERXA 3SYKA 4JI8B 3DZKA 3SQLA 3TNLA 3ZU2A 1X1AA 1VJDA 3MMNA 1JR2A 1ZUD1 2VPWA 2WA2A 3LV8A 3EIFA 4BJ5A 3D0QA 3GLIA 4Q3OA 2QZPA 5K8LA 2NTJA 1Y7LA 3R5TA 3OCWA 4K9DA 1AKVA 1J7KA 2CVOA 1VLHA 4CCYA 4YRMA 1CULC 1GXSA 3NS7A 3PIRA 4YJHA 5C4IA 1D3AA 2JEOA 2AFIB 1Z33A 4NENB 5JXJA 1Z4JA 2VNSA 3TFQA 4YMVA 4DR2B 3TFOA 4MPDA 3GGJA 1GPKA 4HH4A 1A8IA 3B6ZA 1AKTA 5DV9A 3STXA 3W1VA 4CTKA 3MUFA 2REQB 2DETA 4WKGA 5FNVA 3R5SA 5KNCA 4H77A 4WFJA 2CLEB 3FNHA 1CB7A 3P2MA 4QJ4A 2IYOA 3OT1A 3STWA 1P7PA 4X1KB 1A82A 2L69A 4WZBA 2NUTA 1CVLA 1B16A 2D2VA 3C5WP 5FV4A 1KE2A 2Q3LA 1KP3A 3QXXA 4GX5A 3K70D 1IZ7A 3DWEX 3OT5A 3AJRA 4IIDA 1Z38A 4RPJA 1TJ3A 4L5IA 1L7QA 1YC2A 2ERCA 2KLHA 2P6PA 3AI3A 3GLHE 1OAKA 4CQLB 5J1SB 2MSWA 3A3NA 4IIJF 4UCQA 3GLRA 1Z13A 5JMTA 3PIDA 3EN0A 2CUTA 1AF4A 2P11A 1U11A 1VXRA 3LHDA 1HX7A 3H4VA 2R0QC 1ANKA 2V03A 4MVWA 4OLHA 1F0NA 2NQ2C 2NTYC 4X44A 4MRRA 5FTMA 4Y1FA 5KAPA 3K1ZA 3T7TA 1QC5B 2O1WA 1O9GA 2PIDA 5KJCA 2DG2A 4TTTS 1C4KA 1SQ6A 2C97A 3GJ4A 2RKBA 1KJJA 2Y1LA 1DBWA 2QROA 3DFUA 4K6CA 3NIGB 3U6KA 2GI4A 4QZVA 4MQMA 4EG3A 1GUBA 4QT4A 2ENUA 3U40A 3U3KA 2XD9A 1XCBA 3VU0A 2GSWA 4AP5A 4C29A 5KVCA 1Q77A 4FCWA 2ZWVA 3AHGA 1UOEA 1KK2A 1Y5MA 1NJ5A 1OBFO 1OHHD 2P0AA 4KTTE 4ACBA 1QVVA 1VM6A 1MZPA 4LE1A 1O95D 1BHQ1 1QLHA 1UPCA 3GH3A 1F2TA 2YFHA 1H9CA 4AMBA 2IBSA 3FPCA 1E66A 5L4SA 1TMKA 2D06A 1VYUA 2A3NA 2WVHA 3FPHA 3VYVA 1KYVA 4TZTA 5KQMA 1E7YA 5IXYA 1E4VA 3H11B 2I4LA 2PWYA 2HDOA 3C48A 3D02A 1VE6A 2AD1A 3KTAB 3EX7C 4IH4A 4NDZA 3BILA 1YFZA 3KV3O 4LOHA 3WJ7A 4IQ4A 3BGDA 1V8PA 4AZTA 1NBMD 2AEMA 1YZLA 3G1WA 3KAJA 4HS4A 1V8DA 2C7RA 1PR6A 3P2YA 1WSWA 3D4PA 4N47A 5F7OA 4KOAA 5LLTA 1QUEA 2IFTA 4P53A 1GLVA 1M3SA 1E8NA 1V1MB 2BEJA 3E03A 4PLZA 4CMHA 1FZTA 4DDWA 3LKZA 4ZCLA 2JIZA 4KE8A 2HIMA 2QAGB 4GXRA 1G2QA 4RK4A 4E12A 3HB7A 1FTYA 4EY5A 1J00A 2QL6A 2IOHA 1TJNA 2HQRA 2IY7A 2KSQA 3GG2A 3NANA 5GAJA 1N8NA 4N12A 2ZE7A 2FDRA 4TMKA 3ETLA 4PYRA 1C0EA 1D6JA 1ZU4A 4PXSA 5AKXA 3Q87B 3GJ0A 3N6XA 4FI3F 2I1LA 3A27A 3T4XA 5HJEA 4YHHB 3QVOA 5A4KA 4PBRA 3SOZA 3FUVA 4LVUA 3W3ZB 2A0UA 5JJLA 1GZHB 1MH9A 1UKBA 3DQPA 4INOA 2G9QA 3D31A 2VWHA 4LMPA 1IOLA 1T0PA 1FLNA 3EARA 3TUZC 2OV6A 3HDYA 2D3WA 5FI5A 1X0XA 3S1AB 3SVLA 4Z53A 4OOFA 2JI6A 5JI3E 1G98A 3OHMA 2BEUB 5HKBA 3TRDA 1CRQA 4IHAA 4HH1A 3DBVO 3D6VA 4IJUA 2PWZA 3QV1A 1IHOA 4Q9AA 1EUZA 5TDHA 5AW0A 2C4HA 3H2KA 4LJLA 1QCZA 4D97A 1HYQA 3PWKA 3GFPA 2P6NA 4H1UA 4Z99A 1YS1X 2ZUEA 4OJMX 2OXFA 3SEQA 4DWVA 1P1IA 1U2TA 1J8FA 4C4PA 1UJNA 4UBMA 3EAGA 1SIOA 4DLBA 2ZCVA 2A0FA 2ZBVA 1X7ZA 2ZJ1A 4XIGS 4XCVA 1RPJA 3UKDA 4M8SA 4EVSA 1ST3A 2C2GA 2I62A 2JPDA 2VF8A 1EFHA 3PC7A 4EFNA 2AQ8A 2VZEA 2A94A 4F84A 2C42A 4QOGA 2RKOA 4KQ9A 5ICFA 1EXNA 3FETA 1VJGA 3FWPA 4F93B 3G2QA 2WU1A 1ZD1A 3G2HA 1EBFA 1P1KA 2JB9A 2DSTA 1GGMA 4TKVB 3R8CA 3HUEA 4DMKA 1LNZA 3LC7O 2OSBA 1U3FA 3QW4B 1M1YB 3VHRA 5JZBA 3U4CA 2VDNB 3WY9A 4RHYA 1Y1QA 4DAEA 2AHRA 3AEYA 3JQ8B 1SBYA 1T13A 6ABPA 1U4NA 1T1GA 1AQNA 2V74B 4Z0TA 5I48A 3KOOA 4JOQA 2LW7A 2Q4DA 2NPOA 3JCZA 3CRMA 4PRLA 4WCDA 1AH2A 5DDIP 3D43A 4B9AA 2QTFA 3EXIB 1OX4B 2HSGA 2WTAA 3HKDB 1NUPA 4BFCA 4D99A 1NMEA 1R64A 3LNCA 2P67A 2W00A 4BNGA 3U4MA 4KGDA 4Y2SA 4P7JA 5KX5B 3DC7A 1OTYA 1XNHA 3FX2A 3KQVA 3W2IA 1ZRNA 1NE2A 4AG6A 3WG9A 5EE9A 1KARA 5CJ2A 2WUFA 1LF0A 2CDNA 3N2KA 2YWRA 1P9LA 2XQGA 4IRUB 3CVUA 3BZBA 2IXTA 1JW9B 4HXEB 2PUEA 16PKA 1TVKB 3WA7A 4R71A 4RY0A 4UPVA 4E5YA 2VCYA 4LWOA 1XXHB 3AHJA 1MFZA 1YR1A 2OILA 2O6LA 3AR9A 2JI9A 4XM1A 1MF7A 5AK3A 4EEKA 3K5IA 1Y8RB 4M9SA 1E3QA 1IY9A 1XSEA 2ES4A 2YWGA 4I8XA 3PA6A 4P3PA 4F2PA 3LVBA 4G5SA 3MHTA 2VYCA 2J9FA 1XTQA 3B52X 3SHVA 3X43A 2DQZA 5K20A 2WKSA 5EHNA 3ESXA 2GQ0A 1RJ9B 4LRWA 4DV6B 1W5EA 3KQLA 4OQPA 3P0EA 4Q7QA 1FDVA 2J9GA 3LHIA 2Z2YA 1OW3B 1SVIA 2PMWB 3FGPA 4OUKX 2IBTA 1TA9A 2OCBA 1ZVQA 2PBRA 3AIOA 1HDZA 5ALPA 3SJBA 5C18A 4RLHA 3K71B 2PUAA 2ODTX 4R2LA 3PT9A 1XTBA 3T52A 1OA0A 2UVPA 4BLVA 2GCEA 1P17A 2K6GA 4J0DA 4KIUA 3HSYA 1PDWA 1RKQA 1UM9A 4P4NA 4IJQA 2O2DA 1D9XA 2PGAA 3DMRA 4I81A 4YRRA 5EWLB 5AESA 2VDWA 5I8ZA 2Q6TA 4G81A 4X71A 1GVHA 1NMZA 1PWYE 4OQFA 3I2GA 1TU0A 3K1JA 1Q95A 4KP7A 4RPCA 3RV3A 1UMBA 1S2LA 3E58A 4HFNA 3T0FA 4C0KA 3PWZA 1OHHA 2QNBA 3RF7A 3AJEA 3MRVA 5TLSA 1T9AA 2YXBA 1NP7A 2XADA 2WYHA 1CY0A 3GXBA 1NSFA 5CW2A 1U3UA 4E14A 1CCWA 1TLTA 4EARA 3SS9X 5JYDA 5JD3A 2PZEA 3TN7A 4LMRA 3VO2A 1XLVA 2XA9A 3EYWA 1M1YE 4PO9A 5K3SA 4IIJB 3DCJA 4NCNA 4RF2A 3U1VA 4AYWA 1E62A 1AXRA 1UFVA 4L8VA 1NG1A 3C6BA 1NQTA 3SBDA 4COKA 2R1UA 5F7XA 4DR6B 5IWAB 4B33A 2X7HA 3NW9A 1U7OA 3ZLBA 2VKTA 5MHTA 2GJ4A 3GQVA 2IU4A 3EWSA 4UASA 5DI3B 3O0DA 1RQ7A 1NBMA 2ABWA 2VXOA 2FWJA 3H4MA 1VLMA 1YS4A 3EB9A 1TB4A 3PUYA 5ALMA 4CI9A 3IVRA 1OJ7A 1JLMA 4NYJQ 3P7MA 1FC0A 3L4BA 3QXCA 4JNKA 4M2LA 1S96A 3QX9A 4GGOA 3BEDA 4AWXA 4AY6A 4ZOBA 4CBVA 1Z36A 3GEIA 4WPGA 4XTRA 2DQYA 3UAYA 5IFLA 1RADA 3FHOA 1K8QA 3OSZA 4QO8A 3TD6A 2IZZA 4PBSA 3KEFA 1GRVA 2AN1A 1IK4A 1OFUA 2ECPA 3NDRA 1QIGA 1U1GA 2VH2A 3RIGA 4D82A 5HZKA 2IU3A 4FKMA 3ZHOA 4OB6A 2PHZA 3NKVA 3EASA 3DV0A 1ZHHA 4N65A 3T5CA 1JEQB 1Z5NA 3COZA 1UWVA 3QUBA 3LBNA 4UDOA 3OJCA 4DG9A 3TOXA 2OESA 3TECE 4H3HB 1ZUNB 3CF4G 4JITA 3M1YA 5IMSA 5FYDA 2G80A 1G8PA 4KLNA 1J9GA 3QIAA 4LY0A 3FOZA 1I0IA 4E13A 1R4NB 4CT4B 4O4JB 3P9PA 5D3QA 2AS0A 3ZJVA 2JFWA 3T3GA 3HCRA 4J7AA 1LWOA 3B2QA 4CM6A 1E1DA 2XVXA 4EHIA 3CPEA 2CZQA 3ET4A 4HDCA 3ZK8A 2F55A 2FSIA 2IRWA 4CQNA 2ACVA 4GYJA 1ZWKA 2IHJA 2GZ1A 4JBLA 4D0SA 5KYWB 3C85A 3N8NA 2YFKA 2YBEA 5JDCC 5NULA 3FMVA 1EVEA 1G55A 1UZUA 2OV4A 2JFXA 1Q0QA 1HDCA 3IKLA 2FHSA 4LY6A 2TMGA 3AR4A 1CIJA 2DHDA 2JAHA 2NNWB 2R1VB 2GN2A 1W52X 3GJTA 3TCKA 4RHEA 4EUKA 5EP1A 4KN9S 1ZIPA 3VPBA 4WN3A 4UEKA 2QV0A 2CT8A 2Y9PB 1W4LA 3TAXA 5E1OA 1GGNA 4ND8B 1RYZA 1N6KA 1UWCA 1BWRA 4EJMA 1SJ9A 2YJ4A 1T5DX 1X7WB 1G20B 3FKSD 1YVEI 3FYSA 5ILQA 2VG8A 3T4PA 3D7MA 2SECE 2GPNA 1ZNYA 1U8ZA 2OHXA 4IKOA 4MW5A 2BFDB 3AUAA 3FPBA 4BB0A 4ARZA 2Q6VA 1XN1A 1QG2A 1E2DA 4OH7A 4FD2A 4GBMA 4XLZA 3QTBA 1IMJA 1IHYA 3KSUA 3L7YA 4YRFA 1E96A 2IHNA 4IDDA 1XEXB 4K9RA 2P3QA 1G3UA 3BXEA 1CE8A 1ARZA 1M2KA 1WVGA 3D54D 1W30A 3Q7PA 1IEXA 1SHUX 1ML3A 4X1OA 4FTWA 4X92A 3EDOA 2H1RA 1SCUA 3D6NB 5A71A 3KOWA 3QG5A 4FFBA 4CUJA 2Y0BA 4PZLA 5JH7A 3T1YB 2NW6A 2V5VA 2ZRBA 4F92B 2ZSDA 1PW5A 1UDCA 5BMVA 1OWPA 1MEEA 1SBTA 1LUAA 1IM8A 2RGDA 1ITZA 1Z4MA 3A6EA 2HRZA 3KS9A 5CNJA 3VAZA 1BX3A 3IL2A 1MVOA 3WTCA 1GPLA 1AURA 1Y8AA 5CHYA 3GW8A 1NONA 2J67A 3D3JA 1LLDA 3H83A 5AHXA 4OQLA 4P81A 4WHMA 5CVJA 4XXHA 1GT6A 1B26A 3CF0A 1R8QA 3CUVA 2PXXA 4DLKA 5CXUA 3AR3A 2BY4A 1H8EA 2DVMA 4D9JA 2OBXA 2VUSA 4QBKA 3R9XB 4CLHA 1A95A 1U1DA 3X3HA 5C8YB 4DADA 3FUTA 4FJ0A 3GJ3A 2QYOA 2QMHA 1G6HA 3CRVA 1CKEA 2ZRKA 3PT5A 1XRSB 4GVPA 4TRJA 4LIPD 3VSCA 3KQSA 2HDNB 4U2EA 3WLEA 3QVKA 4OO3A 2OGWA 5BW5A 2E6KA 4FWIB 4GUDA 4OKSA 2YY5A 2QMEA 1IIRA 3C6ZA 3WDMA 2NIPA 3UPUA 3MTAA 4X64B 5EMNA 4YV2A 3DG9A 3PXAA 1LS6A 1NVEA 8GPBA 4L9RA 2CLOB 3S2FA 2O8VA 3QELB 2R8BA 3ZQJA 1I4OA 4TT3D 3G49A 4OL9A 2LBPA 3FGZA 4JSYA 2CLKB 1PQUA 2Y0PA 3DMNA 3S8YA 1ORWA 2G17A 2N9UA 1KAMA 1US8A 2PFSA 3KNZA 1Y5LA 4IZIA 1RAGA 3ORSA 3F73A 2OOSA 2EL7A 1J6UA 4PN3A 2XXAB 1Y3FE 3GJYA 3HCDA 3O47A 3M1LA 4L74A 2PUGA 5U9CA 2X19A 3WS7A 4CNBA 2J0QA 4ALKA 2Y6UA 1FTQA 2FWIA 2ATEA 3GLSA 2CJYA 1D2RA 1DC3A 1G20E 1QG0A 2GEJA 4QYIB 5K0FA 3Q3IA 5K7SA 4HH3C 5CVDA 5A5FA 3PDJA 2A9PA 1SRRA 3KQTA 2XDQB 4N8SA 1N6PA 3ED5A 4MA4A 4TYWA 5TMEA 3HC7A 1DDOA 3TZKA 1WIWA 1Z6GA 2FFQA 5L6LB 3ZXSA 1SHZA 3IMCA 1E79D 3ZWBA 2FQXA 3CPSA 5E4FA 4J03A 1QMPA 2CCGA 3M6WA 4X24A 3BWMA 4RUKA 4BASA 5DNUA 1U1CA 4Q9KA 4PS1A 5KVQA 2EGGA 2JVJA 3DBRA 3SLGA 3WXBA 4Q1EA 1NN5A 1UJ4A 2CJFA 5IBPA 3GL9A 1L4LA 1PJQA 2ZJ8A 5ALZA 3T99A 1UC5B 4AJJA 1QYIA 3KQOA 1XNRB 4TUYB 3OAAD 4QM6A 1KDZA 4YCLA 3BXOA 3JW8A 3SICE 1YZFA 1RM3A 1OXSC 1NXWA 1UQRA 4HZUA 3ZI0A 4QQRA 1VIVA 3OETA 3U4DA 3DZGA 2VF4X 1Q0RA 1QPGA 1QU2A 3P97A 3P94A 1WMFA 3D0OA 4DYHA 4JXZA 5CIWA 3LJKA 4HYTA 1L5VA 1P2GA 4O1MA 3OX4A 4D8TA 1B43A 4FM9A 3TMKA 1YZTA 3AF2A 2IYZA 4D57A 4LZLA 2ZAIA 2K7ZA 5LUBA 5B4TA 1LLCA 4CVNA 2YHBA 4KVGA 3NASA 4DSNA 2P5SA 4LECA 4MJXA 3IUBA 4PHFA 5H59A 3GRYA 4B4WA 4YB8A 4AJ9A 2ANCA 3EF0A 1E3SA 1WF3A 1XJCA 2ILVA 3JQCA 3L84A 4GQBA 4XX0B 3WRWA 3E9YA 1XD2A 4YLGA 4OX9Y 3QM1A 3FBTA 3PKIA 1UJ2A 2X1MA 3K5HA 4IIYA 3PFKA 5EIWA 1JR3D 3E0QA 4ZYXA 4FYWA 2EW2A 1WMEA 1ZA1A 3QUQA 2WD7B 4UVEA 2RGNA 3DUFA 3ORHA 5CA0F 4GC5A 4QGFA 4EKNB 4BN0A 3ZU6A 2XOEA 4CMCA 1WUYA 1R18A 1GKIA 2MINB 3H04A 1OH8A 5M2QA 1TCBA 1WG8A 3U1BA 3ABSB 3O7MA 5EQJB 3T38A 4MMXB 3LFUA 3ZD9A 3S2SA 4C01A 1R9NA 1VPLA 4UHCA 1Y98A 4KN5A 3RRXA 3TTWA 2ZTHA 3AVYA 2WHEA 3WA6A 1JPNA 5HM6A 1FA9A 3L8GA 2NQ8A 2EOAA 1Z07A 3FKSA 2OWDA 2JAUA 4IDGA 2ZWIA 3RS0A 3FBWA 1QCCA 3C14C 1NP6A 4FLMA 4DF3A 2FNAA 1P4AA 2V5UA 2XV1A 4H7DA 4Q01A 2WE8A 3R4VA 4E1AA 1N2CA 3GJ6A 5BXYA 4KL8S 4I1RA 3FDZB 5ICSA 5ISMA 1A4XA 5IAKA 4RE6A 4ZYVA 5IM4F 3OU7A 4IOKA 3DW3X 3UJNA 1RKXA 2ZB4A 3BTSA 4ZU3A 2GM4A 5HFAA 4BE7B 4AJIA 3UC9A 2QTTA 4A26A 5DWVA 2W90A 1J8DA 3ON5A 2VDPB 2WT8A 5A3RA 1P8JA 4QD3A 2SKEA 2CBGA 2C2ZA 3PQ6A 1KDVA 3VX4A 3DYBA 4B2IA 4D8UA 5BOSB 3OY7A 4XGIA 1Y37A 2GN0A 3G6WA 5KYTA 2P9JA 2D7CA 2KYRA 1S8OA 2H4ZA 4A9AA 1BG6A 3ANTA 2BGIA 4DR1B 5I3ZA 2HO4A 4XZ3A 5GINE 4KXQA 5M3BA 2WWFA 3IIKA 1T91A 5CVCA 5TARA 2QPLA 2XQIA 3PFCA 5K0TA 3RK4A 3HEBA 1UXIA 5I5EA 1DRJA 2Z1DA 5DNYB 1JE0A 1M73E 3NM6B 4FYYA 3U44A 5F64A 2ON6A 3JAWA 3BUSA 4OI1A 2EKLA 4BMDA 1MIHA 3CWZA 4TXHA 3CE6A 3DO8A 3L7CA 4FDMA 3AF0A 3E15A 4N8DA 5EJAA 3CLKA 2QN7A 2X9NA 1XZMA 4ER7A 1DBVO 4F2HA 1KXZA 1GKKA 4ZI5A 2QDXA 2QPTA 2JCXA 3VPDA 2H48A 5AK5A 1HDOA 1KBZA 1V47A 2FEOA 1AHIA 2IEDA 2P69A 4PLYA 3WYBA 5K8CA 2Z6AA 3H2YA 3CWQA 1R0RE 4FJ2A 3DLCA 3EZXA 1E7RA 2VKQA 3DNPA 3NBXX 5DNWA 4C2BA 3I4FA 4MR9B 3AUSA 5EGNA 3DGFC 4DMUB 5LQDA 1G6KA 1QIFA 4FUTA 4RDXA 3DOJA 2ZUFA 3AT1A 1IBMB 4BNNA 1NT2A 1T26A 4N7JA 2NUAB 4NXNB 2H0AA 1AKNA 3S40A 3CGWA 5CTJA 5K45A 1V1JA 2QLBA 4BNUA 5F33A 4B76A 4NZPA 3GHHA 2Q6OA 2J7PD 4PLFA 4EKIA 4TV9F 4GT1A 5EP4A 4MA5A 4RY2A 2B0CA 3N7UA 4K3UA 4Z0PA 5JAOA 1J0XO 2Q4RA 2Z5GA 2NYUA 2W8BA 1H2XA 1MO4A 4TT3A 4AD8A 1XK6A 4RPLA 3CKKA 1IATA 3D8SA 4GE3A 4ITVA 4YECA 2NSLA 2B3DA 3L6BA 2EATA 1YS2X 1FUKA 2HZBA 4HO1X 4RZHA 4BAUA 1T8WA 4MLPA 2EQBA 2I9PA 3HL0A 1WU8A 2CL0X 3NJ8A 4KVFA 4YDHB 1GG2A 5F4BA 3CNNA 4FBMA 3RVMA 1EUYA 2NMVA 4HRVA 2V7GA 4FYMA 4WK0B 1N1DA 4IHKA 1JE1A 5JFTA 5AWFC 1C1HA 4OHKA 1XTPA 2OVBA 4HH0A 1C14A 3MWJA 4B4UA 1SXHA 2ZK7A 4REQA 1YBMA 4BMPB 2CSXA 1QIKA 2WKWA 2YXDA 1AXGA 1II8B 3EYAA 3H16A 4MYUA 2W6ID 2XMZA 2A0YA 3QFFA 2ZSEA 3MJ4A 4U2DA 4UNQA 3AUXA 1RTKA 2UVQA 2PQ2A 4HXGA 4DUPA 1E79A 4ZJYA 3S2UA 3VVMA 2ZSUA 1U28C 3KYCB 2VSXA 3ZWXA 5LQKA 5BSWA 3UAWA 2GZ2A 2DHRA 3K0CC 2RARA 1XFAA 1EFDN 1OYYA 2PUVA 4UCWA 2ODAA 2XGSA 4B5LA 4HG2A 1TM3E 1IY1A 2HCFA 1SU4A 2J45A 2M98A 1T8UA 2P40A 4RADA 3SDBA 3OAAA 2RGYA 1JJIA 4G3XA 4TT8A 3ACBA 2PMDA 2C0QA 1SD2A 2PD6A 2WJJA 4RA6A 4PICA 1MIOA 1X77A 1LV7A 4P4LA 5C3MA 4YCNA 4HQNA 2A9JA 4R7GA 3AL3A 4MGIR 3WP1B 1Z28A 4ZI2A 5CCEA 1U0HC 4JKYA 3AB7A 4NLLA 4YMGA 2OECA 3VPSA