1DX8A

Rubredoxin from guillardia theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVIAGFAENQKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Solution structure of a zinc substituted eukaryotic rubredoxin from the cryptomonad alga Guillardia theta.
pubmed doi rcsb
source organism Guillardia theta
molecule tags Electron transport
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1dx8A00
1DVBA 1QYBA 4AR4A 2GMGA 3KYWA 2VL6A 1S24A 1T9QA 1VCXA 1RYTA 1T9PA 1LKMA 1R0GA 3RZ6A 1R0FA 4ME3A 2PVEA 2HR5A 5AI2A 2KN9A 1B2JA 3KYXA 1IROA 5IY0A 1YK5A 1YUZA 4K9FA 1E8JA 2K2DA 1CADA 1B13A 1BQ8A 2DSXA 4POFA 3MPSA 5RXNA 1H7VA 1T9OA 4POGA 1BRFA 1LKOA 1LTLA 1R0HA 3PZAA 4AR5A 2MS3A 2PVXA 1IU6A 1FHHA 1LKPA 3RYGA 1B2OA 4AR3A 2PYAA 1YV1A 1JYBA 5AI3A 4YWLA 1R0JA 3KYVA 3SS2A 3QVDA 7RXNA 1RDVA 2M4YA 1IU5A 3RZTA 4RXNA 8RXNA 3KYUA 1SMMA 1SMWA 4YWMA 1IRNA 2RDVA 1C09A 1S2ZA 1S30A 1YK4A 3PWFA 4AR6A 1RDGA 2QL0A 4TPUA 1B71A 1BQ9A 1BFYA 1R0IA 1QCVA 1FHMA 1CAAA 2KKDA 1DX8A 2LCQA 3KYYA 6RXNA 1SMUA 1NNQA 1YUXA 2V3BB 1BE7A 3A44A 1ZRPA 1RB9A 1RWDA
chains in the Genus database with same CATH superfamily
1DVBA 1QYBA 4AR4A 5DM61 3KYWA 4A3GL 1OWCA 2VL6A 1PZXA 2E2IL 1VCXA 1I50L 3PKJA 3S16L 3WWNB 4ZN1B 2YU9L 2EY4E 4ME3A 2HR5A 5C4JL 1I6HL 2ZIXA 1IROA 1YK5A 3MSUA 1TWGL 2XJQA 1E8JA 4LHNA 1R0HA 5MLC3 2M6PA 3GTJL 2NVQL 2NVYL 1OWBA 2R7ZL 1FHHA 3RZDL 3S2HL 2C6BA 3RZOL 5MGNA 3M3YL 4AI2A 2ERSA 3HOWL 3JR7A 3B08B 3RZTA 2AYJA 3KYUA 4BBRL 3I4NL 4A3JL 4A3LL 1PFWA 2RDVA 5M3FL 3FKIL 2NVXL 1F4LA 1BQ9A 3FDJA 3GTML 1TWCL 6RXNA 4JADA 5MF6A 3PO3L 4C3JL 1NXEA 1YUXA 2HVYC 5C4XL 5GAGc 3K35A 1ZRPA 5H1Sc 3J7Z1 2PPTA 2JA7L 3LNLA 2JA6L 4XGHA 2CR8A 3PIO1 5FLML 4AI1A 2E2JL 3LPEB 1T9PA 4A3ML 1R0FA 2KN9A 3GTQL 2JI1A 2NYDA 1P7PA 3GTKL 4BY7L 2K2DA 4E6YA 4A93L 1B13A 3P2AA 4C3HL 3MPSA 1H7VA 1T9OA 1BRFA 3GTOL 5C3EL 1LKOA 3S2DL 3M4OL 3B0AB 3P8BA 3HOYL 1LKPA 2XJSA 3H9CA 4AR3A 3PO2L 4C3IL 5IYDL 4Y7NL 4TVMA 5M5YL 3J7Y1 1TWHL 5IP7L 1R0JA 3S1ML 3KYVA 3SS2A 4UY81 3MQKB 3PIP1 1I3QL 7RXNA 1IU5A 4BY1L 2RFKB 3CQZL 4A3CL 4A3EL 3S15L 3HJWB 2ERJA 2R92L 5IYCL 2B63L 4AHXA 1S30A 2E2HL 1QQTA 1RDGA 3GTGL 2QL0A 3H9BA 1R0IA 3PKIA 4BBSL 2PMZP 1FHMA 4V196 5MFPA 4XXBB 4A3IL 3KYYA 1SMUA 3S17L 1TWAL 2CKCA 2NVTL 4C2M1 5DM71 3A44A 1VZGA 1RB9A 3S1NL 2Y0SP 4JAGA 3LWQB 3QQCE 2GMGA 1PFVA 2B5ID 1ODHA 1VZIA 1S24A 1NXGA 2AQCA 3H0GL 5C44L 4G6BA 1Y1WL 2JA5L 1RYTA 3RZ6A 3HJYB 5AI2A 1PFYA 2Z3QB 1B2JA 3KYXA 1R9TL 5IY0A 2J9UB 4K9FA 4LHLA 5IP9L 2C6AA 2XJPA 2DSXA 5RXNA 2M4VA 4POGA 3LWRB 5JVH1 4A3KL 1LTLA 3H99A 2XJTA 5K2ME 2MS3A 2PVXA 3K7AL 2JI2A 2R93L 3RYGA 2AUSB 2PYAA 4X6AL 2M6OA 3HOZL 5AI3A 4B8CD 3QVDA 1PFUA 1IW7D 1SFOL 4U671 3H3VM 2M4YA 5M5XL 4RXNA 3LWVB 8RXNA 2XJUA 1RYQA 5AN9H 5MFZA 1IRNA 2Z3RB 3PWFA 2O5JD 1B71A 2KKDA 2H12A 2LCQA 2WB1P 2V3BB 3ZG6A 5FJ8L 1Z92B 4A3DL 1T9QA 4JAFA 1WCML 3LWOB 1LKMA 1R0GA 4AHYA 2VUML 4Y52L 2PVEA 1K83L 2WAQP 2JI3A 4AYBP 4AHWA 2JA8L 3HAXC 4QIWP 1Y1VL 3LWPB 3WWLA 1YUZA 2A6ED 3HKZP 4WFN1 1CADA 1BQ8A 4POFA 4A3FL 3HOVL 3GTLL 2BE5D 3PZAA 4AI3A 4AR5A 2A68D 1IU6A 1VZHA 3H97A 1B2OA 1YV1A 1JYBA 3NFPI 4YWLA 3PL5A 2PSMC 1TWFL 2XJRA 2CKAA 4A3BL 1RDVA 5EINC 3VPBE 5GAEc 2A69D 3HOUL 4JAEA 1SMMA 1SMWA 3S1QL 4YWMA 5JVG1 4ZN3B 4GS7D 2APOB 2XJVA 1C09A 1S2ZA 1WJVA 1YK4A 4AR6A 2L0ZA 3I4ML 3GTPL 4TPUA 1BFYA 5IYBL 1QCVA 2V0FA 1CAAA 5M3ML 2V0EA 3S14L 1DX8A 4AI0A 3S1RL 5M5WL 5EIOC 1NNQA 4BXXL 1BE7A 2A6HD 3HOXL 4AHZA 5GAHc 5GADc 3IU3I 1RWDA
chains in the Genus database with same CATH topology
1DVBA 4JAGA 1QYBA 4AR4A 5H1Sc 3J7Z1 3QQCE 5DM61 2GMGA 2PPTA 3KYWA 1OWCA 3LNLA 2VL6A 2B5ID 1ODHA 4XGHA 1VZIA 2CR8A 1S24A 3PIO1 1NXGA 1T9QA 1VCXA 4G6BA 4AI1A 3LPEB 3PKJA 4JAFA 1RYTA 1T9PA 1LKMA 1R0GA 3RZ6A 3WWNB 4AHYA 4ZN1B 1R0FA 4ME3A 2PVEA 2HR5A 5AI2A 2ZIXA 2KN9A 2JI3A 2JI1A 2Z3QB 4AHWA 1B2JA 2NYDA 3KYXA 1IROA 5IY0A 1YK5A 3MSUA 3WWLA 2J9UB 1YUZA 2A6ED 2XJQA 4K9FA 4LHLA 4WFN1 1E8JA 2K2DA 2C6AA 1CADA 1B13A 1BQ8A 2DSXA 2XJPA 4E6YA 4POFA 3P2AA 4LHNA 3MPSA 5RXNA 1H7VA 1T9OA 2M4VA 4POGA 1BRFA 5JVH1 1LKOA 2BE5D 3B0AB 1LTLA 1R0HA 5MLC3 2XJTA 3P8BA 2M6PA 3PZAA 4AI3A 4AR5A 5K2ME 2A68D 2MS3A 1OWBA 2PVXA 1IU6A 2JI2A 1VZHA 3IU3I 1FHHA 1LKPA 2XJSA 3RYGA 1B2OA 4AR3A 2C6BA 2PYAA 2M6OA 1YV1A 1JYBA 4TVMA 3NFPI 5MGNA 5AI3A 3J7Y1 4YWLA 1R0JA 4B8CD 2PSMC 3KYVA 3SS2A 4UY81 3QVDA 4AI2A 2ERSA 3PIP1 1IW7D 4U671 2XJRA 2CKAA 3B08B 7RXNA 1RDVA 2M4YA 1IU5A 5EINC 3VPBE 5GAEc 2A69D 3RZTA 4RXNA 2AYJA 4JAEA 3KYUA 8RXNA 2XJUA 2ERJA 1RYQA 1SMMA 1SMWA 4YWMA 5AN9H 5MFZA 5JVG1 4ZN3B 4GS7D 1IRNA 2RDVA 2XJVA 1C09A 1S2ZA 1WJVA 4AHXA 1S30A 2Z3RB 1YK4A 3PWFA 4AR6A 1RDGA 2L0ZA 2O5JD 2QL0A 4TPUA 1B71A 1BQ9A 1BFYA 1R0IA 3PKIA 1QCVA 1FHMA 2V0FA 1CAAA 2KKDA 2V0EA 2H12A 4V196 4AI0A 1DX8A 5MFPA 4XXBB 2LCQA 3KYYA 5EIOC 6RXNA 1SMUA 4JADA 5MF6A 1NXEA 1NNQA 2CKCA 1YUXA 2V3BB 1BE7A 3ZG6A 2A6HD 5GAGc 5DM71 3A44A 1VZGA 3K35A 1ZRPA 4AHZA 5GAHc 1RB9A 5GADc 1Z92B 1RWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVB A;  1QYB A;  4AR4 A;  2GMG A;  3KYW A;  2VL6 A;  1S24 A;  1T9Q A;  1VCX A;  1RYT A;  1T9P A;  1LKM A;  1R0G A;  3RZ6 A;  1R0F A;  4ME3 A;  2PVE A;  2HR5 A;  5AI2 A;  2KN9 A;  1B2J A;  3KYX A;  1IRO A;  5IY0 A;  1YK5 A;  1YUZ A;  4K9F A;  1E8J A;  2K2D A;  1CAD A;  1B13 A;  1BQ8 A;  2DSX A;  4POF A;  3MPS A;  5RXN A;  1H7V A;  1T9O A;  4POG A;  1BRF A;  1LKO A;  1LTL A;  1R0H A;  3PZA A;  4AR5 A;  2MS3 A;  2PVX A;  1IU6 A;  1FHH A;  1LKP A;  3RYG A;  1B2O A;  4AR3 A;  2PYA A;  1YV1 A;  1JYB A;  5AI3 A;  4YWL A;  1R0J A;  3KYV A;  3SS2 A;  3QVD A;  7RXN A;  1RDV A;  2M4Y A;  1IU5 A;  3RZT A;  4RXN A;  8RXN A;  3KYU A;  1SMM A;  1SMW A;  4YWM A;  1IRN A;  2RDV A;  1C09 A;  1S2Z A;  1S30 A;  1YK4 A;  3PWF A;  4AR6 A;  1RDG A;  2QL0 A;  4TPU A;  1B71 A;  1BQ9 A;  1BFY A;  1R0I A;  1QCV A;  1FHM A;  1CAA A;  2KKD A;  1DX8 A;  2LCQ A;  3KYY A;  6RXN A;  1SMU A;  1NNQ A;  1YUX A;  2V3B B;  1BE7 A;  3A44 A;  1ZRP A;  1RB9 A;  1RWD A; 
#chains in the Genus database with same CATH topology
 1DVB A;  1QYB A;  4AR4 A;  5DM6 1;  3KYW A;  4A3G L;  1OWC A;  2VL6 A;  1PZX A;  2E2I L;  1VCX A;  1I50 L;  3PKJ A;  3S16 L;  3WWN B;  4ZN1 B;  2YU9 L;  2EY4 E;  4ME3 A;  2HR5 A;  5C4J L;  1I6H L;  2ZIX A;  1IRO A;  1YK5 A;  3MSU A;  1TWG L;  2XJQ A;  1E8J A;  4LHN A;  1R0H A;  5MLC 3;  2M6P A;  3GTJ L;  2NVQ L;  2NVY L;  1OWB A;  2R7Z L;  1FHH A;  3RZD L;  3S2H L;  2C6B A;  3RZO L;  5MGN A;  3M3Y L;  4AI2 A;  2ERS A;  3HOW L;  3JR7 A;  3B08 B;  3RZT A;  2AYJ A;  3KYU A;  4BBR L;  3I4N L;  4A3J L;  4A3L L;  1PFW A;  2RDV A;  5M3F L;  3FKI L;  2NVX L;  1F4L A;  1BQ9 A;  3FDJ A;  3GTM L;  1TWC L;  6RXN A;  4JAD A;  5MF6 A;  3PO3 L;  4C3J L;  1NXE A;  1YUX A;  2HVY C;  5C4X L;  5GAG c;  3K35 A;  1ZRP A;  5H1S c;  3J7Z 1;  2PPT A;  2JA7 L;  3LNL A;  2JA6 L;  4XGH A;  2CR8 A;  3PIO 1;  5FLM L;  4AI1 A;  2E2J L;  3LPE B;  1T9P A;  4A3M L;  1R0F A;  2KN9 A;  3GTQ L;  2JI1 A;  2NYD A;  1P7P A;  3GTK L;  4BY7 L;  2K2D A;  4E6Y A;  4A93 L;  1B13 A;  3P2A A;  4C3H L;  3MPS A;  1H7V A;  1T9O A;  1BRF A;  3GTO L;  5C3E L;  1LKO A;  3S2D L;  3M4O L;  3B0A B;  3P8B A;  3HOY L;  1LKP A;  2XJS A;  3H9C A;  4AR3 A;  3PO2 L;  4C3I L;  5IYD L;  4Y7N L;  4TVM A;  5M5Y L;  3J7Y 1;  1TWH L;  5IP7 L;  1R0J A;  3S1M L;  3KYV A;  3SS2 A;  4UY8 1;  3MQK B;  3PIP 1;  1I3Q L;  7RXN A;  1IU5 A;  4BY1 L;  2RFK B;  3CQZ L;  4A3C L;  4A3E L;  3S15 L;  3HJW B;  2ERJ A;  2R92 L;  5IYC L;  2B63 L;  4AHX A;  1S30 A;  2E2H L;  1QQT A;  1RDG A;  3GTG L;  2QL0 A;  3H9B A;  1R0I A;  3PKI A;  4BBS L;  2PMZ P;  1FHM A;  4V19 6;  5MFP A;  4XXB B;  4A3I L;  3KYY A;  1SMU A;  3S17 L;  1TWA L;  2CKC A;  2NVT L;  4C2M 1;  5DM7 1;  3A44 A;  1VZG A;  1RB9 A;  3S1N L;  2Y0S P;  4JAG A;  3LWQ B;  3QQC E;  2GMG A;  1PFV A;  2B5I D;  1ODH A;  1VZI A;  1S24 A;  1NXG A;  2AQC A;  3H0G L;  5C44 L;  4G6B A;  1Y1W L;  2JA5 L;  1RYT A;  3RZ6 A;  3HJY B;  5AI2 A;  1PFY A;  2Z3Q B;  1B2J A;  3KYX A;  1R9T L;  5IY0 A;  2J9U B;  4K9F A;  4LHL A;  5IP9 L;  2C6A A;  2XJP A;  2DSX A;  5RXN A;  2M4V A;  4POG A;  3LWR B;  5JVH 1;  4A3K L;  1LTL A;  3H99 A;  2XJT A;  5K2M E;  2MS3 A;  2PVX A;  3K7A L;  2JI2 A;  2R93 L;  3RYG A;  2AUS B;  2PYA A;  4X6A L;  2M6O A;  3HOZ L;  5AI3 A;  4B8C D;  3QVD A;  1PFU A;  1IW7 D;  1SFO L;  4U67 1;  3H3V M;  2M4Y A;  5M5X L;  4RXN A;  3LWV B;  8RXN A;  2XJU A;  1RYQ A;  5AN9 H;  5MFZ A;  1IRN A;  2Z3R B;  3PWF A;  2O5J D;  1B71 A;  2KKD A;  2H12 A;  2LCQ A;  2WB1 P;  2V3B B;  3ZG6 A;  5FJ8 L;  1Z92 B;  4A3D L;  1T9Q A;  4JAF A;  1WCM L;  3LWO B;  1LKM A;  1R0G A;  4AHY A;  2VUM L;  4Y52 L;  2PVE A;  1K83 L;  2WAQ P;  2JI3 A;  4AYB P;  4AHW A;  2JA8 L;  3HAX C;  4QIW P;  1Y1V L;  3LWP B;  3WWL A;  1YUZ A;  2A6E D;  3HKZ P;  4WFN 1;  1CAD A;  1BQ8 A;  4POF A;  4A3F L;  3HOV L;  3GTL L;  2BE5 D;  3PZA A;  4AI3 A;  4AR5 A;  2A68 D;  1IU6 A;  1VZH A;  3H97 A;  1B2O A;  1YV1 A;  1JYB A;  3NFP I;  4YWL A;  3PL5 A;  2PSM C;  1TWF L;  2XJR A;  2CKA A;  4A3B L;  1RDV A;  5EIN C;  3VPB E;  5GAE c;  2A69 D;  3HOU L;  4JAE A;  1SMM A;  1SMW A;  3S1Q L;  4YWM A;  5JVG 1;  4ZN3 B;  4GS7 D;  2APO B;  2XJV A;  1C09 A;  1S2Z A;  1WJV A;  1YK4 A;  4AR6 A;  2L0Z A;  3I4M L;  3GTP L;  4TPU A;  1BFY A;  5IYB L;  1QCV A;  2V0F A;  1CAA A;  5M3M L;  2V0E A;  3S14 L;  1DX8 A;  4AI0 A;  3S1R L;  5M5W L;  5EIO C;  1NNQ A;  4BXX L;  1BE7 A;  2A6H D;  3HOX L;  4AHZ A;  5GAH c;  5GAD c;  3IU3 I;  1RWD A; 
#chains in the Genus database with same CATH homology
 1DVB A;  4JAG A;  1QYB A;  4AR4 A;  5H1S c;  3J7Z 1;  3QQC E;  5DM6 1;  2GMG A;  2PPT A;  3KYW A;  1OWC A;  3LNL A;  2VL6 A;  2B5I D;  1ODH A;  4XGH A;  1VZI A;  2CR8 A;  1S24 A;  3PIO 1;  1NXG A;  1T9Q A;  1VCX A;  4G6B A;  4AI1 A;  3LPE B;  3PKJ A;  4JAF A;  1RYT A;  1T9P A;  1LKM A;  1R0G A;  3RZ6 A;  3WWN B;  4AHY A;  4ZN1 B;  1R0F A;  4ME3 A;  2PVE A;  2HR5 A;  5AI2 A;  2ZIX A;  2KN9 A;  2JI3 A;  2JI1 A;  2Z3Q B;  4AHW A;  1B2J A;  2NYD A;  3KYX A;  1IRO A;  5IY0 A;  1YK5 A;  3MSU A;  3WWL A;  2J9U B;  1YUZ A;  2A6E D;  2XJQ A;  4K9F A;  4LHL A;  4WFN 1;  1E8J A;  2K2D A;  2C6A A;  1CAD A;  1B13 A;  1BQ8 A;  2DSX A;  2XJP A;  4E6Y A;  4POF A;  3P2A A;  4LHN A;  3MPS A;  5RXN A;  1H7V A;  1T9O A;  2M4V A;  4POG A;  1BRF A;  5JVH 1;  1LKO A;  2BE5 D;  3B0A B;  1LTL A;  1R0H A;  5MLC 3;  2XJT A;  3P8B A;  2M6P A;  3PZA A;  4AI3 A;  4AR5 A;  5K2M E;  2A68 D;  2MS3 A;  1OWB A;  2PVX A;  1IU6 A;  2JI2 A;  1VZH A;  3IU3 I;  1FHH A;  1LKP A;  2XJS A;  3RYG A;  1B2O A;  4AR3 A;  2C6B A;  2PYA A;  2M6O A;  1YV1 A;  1JYB A;  4TVM A;  3NFP I;  5MGN A;  5AI3 A;  3J7Y 1;  4YWL A;  1R0J A;  4B8C D;  2PSM C;  3KYV A;  3SS2 A;  4UY8 1;  3QVD A;  4AI2 A;  2ERS A;  3PIP 1;  1IW7 D;  4U67 1;  2XJR A;  2CKA A;  3B08 B;  7RXN A;  1RDV A;  2M4Y A;  1IU5 A;  5EIN C;  3VPB E;  5GAE c;  2A69 D;  3RZT A;  4RXN A;  2AYJ A;  4JAE A;  3KYU A;  8RXN A;  2XJU A;  2ERJ A;  1RYQ A;  1SMM A;  1SMW A;  4YWM A;  5AN9 H;  5MFZ A;  5JVG 1;  4ZN3 B;  4GS7 D;  1IRN A;  2RDV A;  2XJV A;  1C09 A;  1S2Z A;  1WJV A;  4AHX A;  1S30 A;  2Z3R B;  1YK4 A;  3PWF A;  4AR6 A;  1RDG A;  2L0Z A;  2O5J D;  2QL0 A;  4TPU A;  1B71 A;  1BQ9 A;  1BFY A;  1R0I A;  3PKI A;  1QCV A;  1FHM A;  2V0F A;  1CAA A;  2KKD A;  2V0E A;  2H12 A;  4V19 6;  4AI0 A;  1DX8 A;  5MFP A;  4XXB B;  2LCQ A;  3KYY A;  5EIO C;  6RXN A;  1SMU A;  4JAD A;  5MF6 A;  1NXE A;  1NNQ A;  2CKC A;  1YUX A;  2V3B B;  1BE7 A;  3ZG6 A;  2A6H D;  5GAG c;  5DM7 1;  3A44 A;  1VZG A;  3K35 A;  1ZRP A;  4AHZ A;  5GAH c;  1RB9 A;  5GAD c;  1Z92 B;  1RWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...