1DX8A

Rubredoxin from guillardia theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVIAGFAENQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Solution structure of a zinc substituted eukaryotic rubredoxin from the cryptomonad alga Guillardia theta.
pubmed doi rcsb
source organism Guillardia theta
molecule tags Electron transport
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1dx8A00
1S24A 1RDGA 5AI3A 1C09A 3KYXA 2MS3A 1E8JA 2QL0A 1R0FA 4YWMA 2RDVA 1LKOA 2HR5A 1H7VA 4YWLA 2DSXA 1YK4A 1RYTA 1CADA 2M4YA 1YV1A 1QCVA 4K9FA 1IU5A 1SMWA 1SMMA 1NNQA 1BFYA 2V3BB 2VL6A 5IY0A 1R0IA 1IRNA 5RXNA 2PVXA 3KYUA 1BE7A 1JYBA 2PVEA 3QVDA 1DX8A 1FHHA 1S30A 1YUXA 3KYWA 3KYYA 1RB9A 1R0GA 1LTLA 2GMGA 1R0HA 1B13A 1LKMA 4POFA 2LCQA 1S2ZA 1LKPA 1T9QA 1YUZA 2KN9A 1FHMA 1VCXA 2K2DA 3KYVA 1IU6A 2PYAA 4AR4A 4ME3A 1CAAA 4AR3A 7RXNA 1BRFA 1BQ8A 3PZAA 1BQ9A 4RXNA 4AR5A 2KKDA 1ZRPA 4POGA 1YK5A 1B71A 1SMUA 5AI2A 3A44A 1QYBA 4AR6A 3MPSA 1R0JA 8RXNA 4TPUA 1IROA 1T9PA 1B2OA 1DVBA 1RDVA 1B2JA 3PWFA 6RXNA 3RYGA 1T9OA 3RZ6A 3RZTA 1RWDA 3SS2A
chains in the Genus database with same CATH superfamily
1S24A 4AI2A 4C2M1 3S14L 1RDGA 1C09A 4BY7L 3M3YL 2PSMC 2RDVA 1H7VA 3RZDL 2J9UB 2L0ZA 3S2HL 2B5ID 3LNLA 1PFUA 3S16L 3GTOL 3LWRB 1YK4A 4V196 2M4YA 2ERJA 5JVG1 4UY81 1OWCA 1I3QL 1SMWA 2NVYL 2A6ED 4AHYA 3IU3I 3LWOB 3GTKL 2O5JD 1OWBA 5M5YL 1NXEA 1BE7A 2PVEA 5H1Sc 1FHHA 4X6AL 3FDJA 1R0GA 5AN9H 3HOXL 4C3JL 4A3LL 1T9QA 3ZG6A 4Y52L 1VCXA 5IYDL 3HKZP 3KYVA 1I50L 2PYAA 5GAGc 4AI0A 4AR4A 4ME3A 2XJQA 5FLML 4A3JL 4B8CD 7RXNA 4GS7D 4AHZA 3WWNB 4AR5A 1P7PA 4BY1L 1TWFL 2KKDA 1ZRPA 4AHXA 2CKCA 4POGA 3GTLL 2C6AA 2XJVA 4AR6A 3MPSA 8RXNA 3HOZL 3GTML 4AI1A 1DVBA 1RDVA 5FJ8L 1B2JA 3H99A 4Y7NL 3RZ6A 3GTJL 3SS2A 3GTGL 1NXGA 1SFOL 3GTPL 4WFN1 2QL0A 2R7ZL 3S1NL 4A3GL 5C3EL 2B63L 3B0AB 4A3FL 5JVH1 3PIO1 3J7Z1 2APOB 2H12A 1YV1A 5IP9L 5MF6A 2BE5D 1QCVA 1Z92B 2V0FA 2V3BB 2VL6A 1TWAL 3LWPB 5GAEc 2E2JL 5RXNA 5DM71 2NYDA 3KYUA 5M5XL 1PFYA 1DX8A 1PFVA 4QIWP 3KYYA 1VZHA 2R93L 3HAXC 3FKIL 1B13A 2LCQA 2CKAA 2JI2A 1VZGA 2JI1A 1IU6A 1WCML 2NVXL 2VUML 4C3IL 4A93L 5EIOC 2HVYC 3PKJA 1BRFA 3S2DL 4BXXL 1F4LA 3PZAA 2NVQL 1BQ9A 3I4NL 3CQZL 4AHWA 3HJWB 1YK5A 1B71A 5AI2A 3A44A 5IP7L 2JA5L 5M3FL 1B2OA 2AUSB 4A3KL 3HOYL 3JR7A 2Z3RB 3HOVL 4C3HL 2JI3A 3WWLA 1TWGL 1TWHL 1E8JA 4BBRL 4ZN3B 1LKOA 2HR5A 2WAQP 4BBSL 2CR8A 2PMZP 4A3BL 1RYTA 2WB1P 4A3ML 4K9FA 3MSUA 5IYCL 1SMMA 1BFYA 2A6HD 5K2ME 5IY0A 2V0EA 1PFWA 5MGNA 1JYBA 2Y0SP 2E2HL 1S30A 1YUXA 3K35A 3NFPI 3PO2L 1RB9A 4G6BA 1LTLA 1R0HA 5C44L 4ZN1B 3H9BA 1LKPA 4A3EL 2YU9L 1R9TL 2JA7L 3PO3L 1YUZA 2KN9A 2RFKB 1QQTA 3LWVB 3LPEB 2K2DA 3P8BA 2AYJA 3LWQB 2PPTA 1RYQA 1BQ8A 3HOWL 3QQCE 3S1ML 4XGHA 3K7AL 3P2AA 5GAHc 1SMUA 3H97A 1QYBA 1R0JA 1VZIA 1TWCL 3S1QL 1T9PA 1ODHA 2E2IL 3PWFA 6RXNA 3S1RL 3RZTA 1RWDA 3GTQL 4XXBB 5MFPA 1PZXA 5AI3A 3M4OL 2A69D 3KYXA 2MS3A 1R0FA 4YWMA 2EY4E 2AQCA 4TVMA 5MFZA 5M5WL 4YWLA 2DSXA 4LHLA 3HJYB 3PIP1 3RZOL 1IW7D 5GADc 1CADA 2C6BA 3PKIA 1IU5A 4A3IL 3B08B 2A68D 1NNQA 2NVTL 4JADA 1R0IA 3S17L 1IRNA 2PVXA 2M6PA 1Y1VL 2XJTA 3VPBE 4AI3A 3QVDA 5C4JL 3KYWA 4JAEA 2R92L 4E6YA 2M4VA 2GMGA 2JA8L 2XJUA 1LKMA 4LHNA 4POFA 3H9CA 3HOUL 1S2ZA 3I4ML 5DM61 4JAGA 2XJPA 1FHMA 5M3ML 2M6OA 4A3CL 1I6HL 1CAAA 4AR3A 2Z3QB 5MLC3 1K83L 3S15L 1WJVA 2ZIXA 5IYBL 4RXNA 1Y1WL 3H3VM 3H0GL 3J7Y1 5EINC 4JAFA 4TPUA 1IROA 5C4XL 4AYBP 2ERSA 3MQKB 3PL5A 2JA6L 2XJSA 3RYGA 1T9OA 4U671 4A3DL 2XJRA
chains in the Genus database with same CATH topology
1S24A 4AI2A 1NXGA 2JI3A 4XXBB 5MFPA 3WWLA 1RDGA 5AI3A 2A69D 1C09A 3KYXA 4WFN1 2MS3A 1E8JA 2QL0A 2PSMC 1R0FA 4YWMA 2RDVA 4ZN3B 1LKOA 2HR5A 2J9UB 2L0ZA 2XJRA 1H7VA 4TVMA 5MFZA 4YWLA 2B5ID 3B0AB 3LNLA 2DSXA 4LHLA 2CR8A 3PIP1 5JVH1 3PIO1 1YK4A 1IW7D 3J7Z1 5GADc 1RYTA 4V196 1CADA 2M4YA 2H12A 2C6BA 1YV1A 2ERJA 3PKIA 5JVG1 5MF6A 2BE5D 1QCVA 4UY81 4K9FA 1Z92B 3MSUA 1IU5A 1OWCA 1SMWA 2V0FA 3B08B 2A68D 2A6ED 1SMMA 1NNQA 1BFYA 2V3BB 2A6HD 2VL6A 4AHYA 3IU3I 4JADA 5IY0A 1R0IA 5K2ME 5GAEc 1IRNA 2O5JD 1OWBA 5RXNA 2V0EA 5DM71 2NYDA 2PVXA 3KYUA 5MGNA 1NXEA 2M6PA 1BE7A 1JYBA 2XJTA 3VPBE 2PVEA 4AI3A 3QVDA 5H1Sc 1DX8A 1FHHA 1S30A 1YUXA 3KYWA 4JAEA 3KYYA 3K35A 3NFPI 4E6YA 1RB9A 1VZHA 2M4VA 4G6BA 1R0GA 1LTLA 2GMGA 5AN9H 1R0HA 2XJUA 1B13A 1LKMA 4LHNA 4POFA 2LCQA 1S2ZA 4ZN1B 1LKPA 2CKAA 1T9QA 2JI2A 4JAGA 5DM61 1YUZA 1VZGA 2KN9A 3ZG6A 2XJPA 1FHMA 1VCXA 2M6OA 3LPEB 2JI1A 2K2DA 3KYVA 1IU6A 2PYAA 3P8BA 2AYJA 5GAGc 4AI0A 4AR4A 4ME3A 2XJQA 1CAAA 5EIOC 2PPTA 4B8CD 4AR3A 7RXNA 2Z3QB 3PKJA 4GS7D 1BRFA 4AHZA 3WWNB 1RYQA 5MLC3 1BQ8A 1WJVA 2ZIXA 3QQCE 3PZAA 1BQ9A 4RXNA 4AR5A 2KKDA 1ZRPA 4XGHA 2CKCA 4AHXA 4AHWA 3J7Y1 4POGA 3P2AA 1YK5A 1B71A 5GAHc 1SMUA 5AI2A 3A44A 2C6AA 1QYBA 2XJVA 4AR6A 3MPSA 1R0JA 8RXNA 1VZIA 5EINC 4JAFA 4TPUA 1IROA 1T9PA 1B2OA 4AI1A 1DVBA 1RDVA 1ODHA 2ERSA 1B2JA 3PWFA 6RXNA 2XJSA 3RYGA 1T9OA 4U671 3RZ6A 2Z3RB 3RZTA 1RWDA 3SS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S24 A;  1RDG A;  5AI3 A;  1C09 A;  3KYX A;  2MS3 A;  1E8J A;  2QL0 A;  1R0F A;  4YWM A;  2RDV A;  1LKO A;  2HR5 A;  1H7V A;  4YWL A;  2DSX A;  1YK4 A;  1RYT A;  1CAD A;  2M4Y A;  1YV1 A;  1QCV A;  4K9F A;  1IU5 A;  1SMW A;  1SMM A;  1NNQ A;  1BFY A;  2V3B B;  2VL6 A;  5IY0 A;  1R0I A;  1IRN A;  5RXN A;  2PVX A;  3KYU A;  1BE7 A;  1JYB A;  2PVE A;  3QVD A;  1DX8 A;  1FHH A;  1S30 A;  1YUX A;  3KYW A;  3KYY A;  1RB9 A;  1R0G A;  1LTL A;  2GMG A;  1R0H A;  1B13 A;  1LKM A;  4POF A;  2LCQ A;  1S2Z A;  1LKP A;  1T9Q A;  1YUZ A;  2KN9 A;  1FHM A;  1VCX A;  2K2D A;  3KYV A;  1IU6 A;  2PYA A;  4AR4 A;  4ME3 A;  1CAA A;  4AR3 A;  7RXN A;  1BRF A;  1BQ8 A;  3PZA A;  1BQ9 A;  4RXN A;  4AR5 A;  2KKD A;  1ZRP A;  4POG A;  1YK5 A;  1B71 A;  1SMU A;  5AI2 A;  3A44 A;  1QYB A;  4AR6 A;  3MPS A;  1R0J A;  8RXN A;  4TPU A;  1IRO A;  1T9P A;  1B2O A;  1DVB A;  1RDV A;  1B2J A;  3PWF A;  6RXN A;  3RYG A;  1T9O A;  3RZ6 A;  3RZT A;  1RWD A;  3SS2 A; 
#chains in the Genus database with same CATH topology
 1S24 A;  4AI2 A;  4C2M 1;  3S14 L;  1RDG A;  1C09 A;  4BY7 L;  3M3Y L;  2PSM C;  2RDV A;  1H7V A;  3RZD L;  2J9U B;  2L0Z A;  3S2H L;  2B5I D;  3LNL A;  1PFU A;  3S16 L;  3GTO L;  3LWR B;  1YK4 A;  4V19 6;  2M4Y A;  2ERJ A;  5JVG 1;  4UY8 1;  1OWC A;  1I3Q L;  1SMW A;  2NVY L;  2A6E D;  4AHY A;  3IU3 I;  3LWO B;  3GTK L;  2O5J D;  1OWB A;  5M5Y L;  1NXE A;  1BE7 A;  2PVE A;  5H1S c;  1FHH A;  4X6A L;  3FDJ A;  1R0G A;  5AN9 H;  3HOX L;  4C3J L;  4A3L L;  1T9Q A;  3ZG6 A;  4Y52 L;  1VCX A;  5IYD L;  3HKZ P;  3KYV A;  1I50 L;  2PYA A;  5GAG c;  4AI0 A;  4AR4 A;  4ME3 A;  2XJQ A;  5FLM L;  4A3J L;  4B8C D;  7RXN A;  4GS7 D;  4AHZ A;  3WWN B;  4AR5 A;  1P7P A;  4BY1 L;  1TWF L;  2KKD A;  1ZRP A;  4AHX A;  2CKC A;  4POG A;  3GTL L;  2C6A A;  2XJV A;  4AR6 A;  3MPS A;  8RXN A;  3HOZ L;  3GTM L;  4AI1 A;  1DVB A;  1RDV A;  5FJ8 L;  1B2J A;  3H99 A;  4Y7N L;  3RZ6 A;  3GTJ L;  3SS2 A;  3GTG L;  1NXG A;  1SFO L;  3GTP L;  4WFN 1;  2QL0 A;  2R7Z L;  3S1N L;  4A3G L;  5C3E L;  2B63 L;  3B0A B;  4A3F L;  5JVH 1;  3PIO 1;  3J7Z 1;  2APO B;  2H12 A;  1YV1 A;  5IP9 L;  5MF6 A;  2BE5 D;  1QCV A;  1Z92 B;  2V0F A;  2V3B B;  2VL6 A;  1TWA L;  3LWP B;  5GAE c;  2E2J L;  5RXN A;  5DM7 1;  2NYD A;  3KYU A;  5M5X L;  1PFY A;  1DX8 A;  1PFV A;  4QIW P;  3KYY A;  1VZH A;  2R93 L;  3HAX C;  3FKI L;  1B13 A;  2LCQ A;  2CKA A;  2JI2 A;  1VZG A;  2JI1 A;  1IU6 A;  1WCM L;  2NVX L;  2VUM L;  4C3I L;  4A93 L;  5EIO C;  2HVY C;  3PKJ A;  1BRF A;  3S2D L;  4BXX L;  1F4L A;  3PZA A;  2NVQ L;  1BQ9 A;  3I4N L;  3CQZ L;  4AHW A;  3HJW B;  1YK5 A;  1B71 A;  5AI2 A;  3A44 A;  5IP7 L;  2JA5 L;  5M3F L;  1B2O A;  2AUS B;  4A3K L;  3HOY L;  3JR7 A;  2Z3R B;  3HOV L;  4C3H L;  2JI3 A;  3WWL A;  1TWG L;  1TWH L;  1E8J A;  4BBR L;  4ZN3 B;  1LKO A;  2HR5 A;  2WAQ P;  4BBS L;  2CR8 A;  2PMZ P;  4A3B L;  1RYT A;  2WB1 P;  4A3M L;  4K9F A;  3MSU A;  5IYC L;  1SMM A;  1BFY A;  2A6H D;  5K2M E;  5IY0 A;  2V0E A;  1PFW A;  5MGN A;  1JYB A;  2Y0S P;  2E2H L;  1S30 A;  1YUX A;  3K35 A;  3NFP I;  3PO2 L;  1RB9 A;  4G6B A;  1LTL A;  1R0H A;  5C44 L;  4ZN1 B;  3H9B A;  1LKP A;  4A3E L;  2YU9 L;  1R9T L;  2JA7 L;  3PO3 L;  1YUZ A;  2KN9 A;  2RFK B;  1QQT A;  3LWV B;  3LPE B;  2K2D A;  3P8B A;  2AYJ A;  3LWQ B;  2PPT A;  1RYQ A;  1BQ8 A;  3HOW L;  3QQC E;  3S1M L;  4XGH A;  3K7A L;  3P2A A;  5GAH c;  1SMU A;  3H97 A;  1QYB A;  1R0J A;  1VZI A;  1TWC L;  3S1Q L;  1T9P A;  1ODH A;  2E2I L;  3PWF A;  6RXN A;  3S1R L;  3RZT A;  1RWD A;  3GTQ L;  4XXB B;  5MFP A;  1PZX A;  5AI3 A;  3M4O L;  2A69 D;  3KYX A;  2MS3 A;  1R0F A;  4YWM A;  2EY4 E;  2AQC A;  4TVM A;  5MFZ A;  5M5W L;  4YWL A;  2DSX A;  4LHL A;  3HJY B;  3PIP 1;  3RZO L;  1IW7 D;  5GAD c;  1CAD A;  2C6B A;  3PKI A;  1IU5 A;  4A3I L;  3B08 B;  2A68 D;  1NNQ A;  2NVT L;  4JAD A;  1R0I A;  3S17 L;  1IRN A;  2PVX A;  2M6P A;  1Y1V L;  2XJT A;  3VPB E;  4AI3 A;  3QVD A;  5C4J L;  3KYW A;  4JAE A;  2R92 L;  4E6Y A;  2M4V A;  2GMG A;  2JA8 L;  2XJU A;  1LKM A;  4LHN A;  4POF A;  3H9C A;  3HOU L;  1S2Z A;  3I4M L;  5DM6 1;  4JAG A;  2XJP A;  1FHM A;  5M3M L;  2M6O A;  4A3C L;  1I6H L;  1CAA A;  4AR3 A;  2Z3Q B;  5MLC 3;  1K83 L;  3S15 L;  1WJV A;  2ZIX A;  5IYB L;  4RXN A;  1Y1W L;  3H3V M;  3H0G L;  3J7Y 1;  5EIN C;  4JAF A;  4TPU A;  1IRO A;  5C4X L;  4AYB P;  2ERS A;  3MQK B;  3PL5 A;  2JA6 L;  2XJS A;  3RYG A;  1T9O A;  4U67 1;  4A3D L;  2XJR A; 
#chains in the Genus database with same CATH homology
 1S24 A;  4AI2 A;  1NXG A;  2JI3 A;  4XXB B;  5MFP A;  3WWL A;  1RDG A;  5AI3 A;  2A69 D;  1C09 A;  3KYX A;  4WFN 1;  2MS3 A;  1E8J A;  2QL0 A;  2PSM C;  1R0F A;  4YWM A;  2RDV A;  4ZN3 B;  1LKO A;  2HR5 A;  2J9U B;  2L0Z A;  2XJR A;  1H7V A;  4TVM A;  5MFZ A;  4YWL A;  2B5I D;  3B0A B;  3LNL A;  2DSX A;  4LHL A;  2CR8 A;  3PIP 1;  5JVH 1;  3PIO 1;  1YK4 A;  1IW7 D;  3J7Z 1;  5GAD c;  1RYT A;  4V19 6;  1CAD A;  2M4Y A;  2H12 A;  2C6B A;  1YV1 A;  2ERJ A;  3PKI A;  5JVG 1;  5MF6 A;  2BE5 D;  1QCV A;  4UY8 1;  4K9F A;  1Z92 B;  3MSU A;  1IU5 A;  1OWC A;  1SMW A;  2V0F A;  3B08 B;  2A68 D;  2A6E D;  1SMM A;  1NNQ A;  1BFY A;  2V3B B;  2A6H D;  2VL6 A;  4AHY A;  3IU3 I;  4JAD A;  5IY0 A;  1R0I A;  5K2M E;  5GAE c;  1IRN A;  2O5J D;  1OWB A;  5RXN A;  2V0E A;  5DM7 1;  2NYD A;  2PVX A;  3KYU A;  5MGN A;  1NXE A;  2M6P A;  1BE7 A;  1JYB A;  2XJT A;  3VPB E;  2PVE A;  4AI3 A;  3QVD A;  5H1S c;  1DX8 A;  1FHH A;  1S30 A;  1YUX A;  3KYW A;  4JAE A;  3KYY A;  3K35 A;  3NFP I;  4E6Y A;  1RB9 A;  1VZH A;  2M4V A;  4G6B A;  1R0G A;  1LTL A;  2GMG A;  5AN9 H;  1R0H A;  2XJU A;  1B13 A;  1LKM A;  4LHN A;  4POF A;  2LCQ A;  1S2Z A;  4ZN1 B;  1LKP A;  2CKA A;  1T9Q A;  2JI2 A;  4JAG A;  5DM6 1;  1YUZ A;  1VZG A;  2KN9 A;  3ZG6 A;  2XJP A;  1FHM A;  1VCX A;  2M6O A;  3LPE B;  2JI1 A;  2K2D A;  3KYV A;  1IU6 A;  2PYA A;  3P8B A;  2AYJ A;  5GAG c;  4AI0 A;  4AR4 A;  4ME3 A;  2XJQ A;  1CAA A;  5EIO C;  2PPT A;  4B8C D;  4AR3 A;  7RXN A;  2Z3Q B;  3PKJ A;  4GS7 D;  1BRF A;  4AHZ A;  3WWN B;  1RYQ A;  5MLC 3;  1BQ8 A;  1WJV A;  2ZIX A;  3QQC E;  3PZA A;  1BQ9 A;  4RXN A;  4AR5 A;  2KKD A;  1ZRP A;  4XGH A;  2CKC A;  4AHX A;  4AHW A;  3J7Y 1;  4POG A;  3P2A A;  1YK5 A;  1B71 A;  5GAH c;  1SMU A;  5AI2 A;  3A44 A;  2C6A A;  1QYB A;  2XJV A;  4AR6 A;  3MPS A;  1R0J A;  8RXN A;  1VZI A;  5EIN C;  4JAF A;  4TPU A;  1IRO A;  1T9P A;  1B2O A;  4AI1 A;  1DVB A;  1RDV A;  1ODH A;  2ERS A;  1B2J A;  3PWF A;  6RXN A;  2XJS A;  3RYG A;  1T9O A;  4U67 1;  3RZ6 A;  2Z3R B;  3RZT A;  1RWD A;  3SS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...