1DXPA

Inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Hepatitis C Virus Ns3/4A Protease the Crystal Structures of Two Protease-Inhibitor Complexes
pubmed doi rcsb
source organism Hepatitis c virus (isolate taiwan)
molecule tags Hydrolase
molecule keywords PROTEASE/HELICASE NS3 (P70)
total genus 36
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxpA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxpA01
5LPRA 1DWCH 1P02A 1C4Y2 2VU8E 2ZEBA 1WCZA 4BTUB 3ZV8A 1GMCF 2BLQA 2C93B 2PKAA 3U8RH 1EPTB 1ZJKA 3PMJA 3STIA 1ZMJA 2FZZA 1IQGA 3ATMA 4Y76A 2QGRA 4NZLA 1LHDH 1GBEA 2BM2A 2NU2E 4HGCA 4BOHA 1Z1JA 2GCTC 2EEKA 3SGBE 4Y6DA 4JZIA 1BIOA 2BX3A 1TGBA 2OP9A 1A46H 3FVFB 3S9CA 1TPSA 2ZHEH 2J38A 1ELGA 3PV5A 1LPGB 2OC1A 1ELFA 2ANWA 4U32A 1FN8A 2AMPA 2XC5A 1O2GH 3A85A 3T62A 3RXGA 1NRPH 2G4TA 2FP7B 1GJ4H 3BTDE 2ZC9H 3A8BA 2PLXA 3OY5U 1UO6A 2WYJA 3MO3A 3SNCA 1K1JA 1NTPA 3SUEA 1DWDH 1OP8A 3SI3H 1EP6A 1P9SA 4ABJA 5EOKA 5LH8A 4VGCB 1C5YB 3CP7A 2XCFA 1AE5A 4LXBH 2C3SA 2F9NA 5AFYH 3FAOA 4AFSA 2OBQA 1MTNB 5GNDA 4K1EA 4X8VH 1ARCA 2ZFTA 3O8RA 1XXFA 1ZSKA 2GMTC 5K0HA 3RM2H 3STJA 1O3PB 2BVXH 1B0EA 2V35A 3UWIA 2ZFQH 1QB6A 3ATWA 5A2MH 2FX4A 1EAXA 2P3UB 3TIUA 4WMEA 2BY6X 4X1NU 1MKWK 1DXWA 3SGQE 1Y59T 3K6YA 4KELA 1S82A 1SFQB 2DUCA 1GL0E 7GCHG 3URCA 1VJAU 2ZI2H 2AGEX 4Y10E 3RXTA 1BTZA 2BY7X 2C90B 4AG1A 1Q3XA 1DICA 2GDEH 4BAKB 1SR5C 1T7CA 1ZSLA 4MNVA 3LH3A 2PW8H 3A8CA 2FESH 2XWBI 2ZDKA 3P95A 2PGQB 5DP9A 1KIGH 1TRMA 4Y8ZA 4DOQA 1BT7A 5JBTA 4B2CA 2VNTA 2RG3A 1IQFA 4DIHH 1O3LA 1C2KA 2Y5FA 3LGTA 1XUKA 1QQUA 2JH5D 3HATH 1YLCA 4RN6A 3GISB 2VIWA 1AHTH 1NFYA 4F4OC 2KAIA 1Y5UT 4B73A 1ARBA 4YM9A 1GVZA 3B8JA 4BAOB 1AQ7A 1P09A 1V2MT 1VITF 4OS4A 2CXVA 4K5ZA 2CHAB 4D7FA 1EOJA 1J9CH 2VINA 4AFUA 2JH6D 1CSOE 1QA0A 1Z7KA 1KYNA 2TGAA 1K1PA 2ZU4A 4U30A 1LKAA 2H9EH 1GBFA 2BY9X 1HAVB 2A7CA 2J95A 3I77A 4R8TB 1UCYH 3OY6U 3GY4A 4HTCH 1O2RA 3ZZ4A 7LPRA 2WV5A 2OC7A 1EQ9A 1O2IA 1O2XA 2W7UA 1T8NA 3F68H 1GI7B 3PROA 4NG9H 1DXPA 1EKBB 1GI0A 2BQ6B 2FI5E 3MH7A 5DK1A 1P04A 2WUCA 3BEFB 5L2ZH 5F6MA 2QXJA 1SGIB 2RA0A 1W11U 2ZDVH 4GVUA 4YO9A 3ZVFA 1W7XH 4FUHA 2O8WA 1IQMA 1DM4B 1M9UA 3ZZ7A 2OQUA 1WU1A 4XSKU 1KTTB 3O8CA 4X2VA 3ZYDA 3LJOA 2HLCA 2ZHDA 3FZDA 2PKSC 1GHZA 1MMJN 2SNVA 1TIOA 3BIVH 3KF2A 1V6DA 5C5NA 1SQOA 3KGPA 4DW2U 1C2JA 1MAYA 1GVKB 1Y3UA 4AZ2B 1C2MA 4J2YB 3UREA 1A61H 2FLBH 3UIRA 2XBYA 3OTPA 1BMNH 2Y82A 4AG2A 3ZVBA 1C1TA 1DUEA 2G55A 3SJKA 1ZYOA 4OM9A 1A3EH 3P70B 1PJPA 2FMJA 1JRTA 3BTGE 3MHWU 2BY5X 1C1NA 1C2GA 4CR9A 3S9AA 2R3YA 1SPJA 3M36A 2G52A 1C5XB 1GI6A 2A45B 2FOEA 2ZPQA 1BQYA 3MFJA 3AW1A 3R0FA 5E0GA 4YZUA 1TWXB 1CGJE 3PMBB 1YCPH 1KLTA 1ANCA 1F92A 3BF6H 3P8GA 1N8OC 3EA7A 1X7AC 2BLWA 4X6MA 2ZCKP 4DGJA 4MDSA 4H6SB 4LZ4B 2GX4A 2Q6FA 5E0HA 3PTNA 2WPMS 2ZIQH 2WZQA 1V2QT 3LOXA 6CHAB 2Z3DA 1MD7A 1AWFH 4FUJA 1V2OT 1IAUA 2FYQA 1RIWB 4JYTA 1DS2E 3LGIA 1P2JA 3CENA 4IMZA 1IHTH 1G3BA 4FVBA 2CGAA 4SGBE 1A3BH 1C2FA 1ORFA 4X8TH 2EI6A 2H1UA 3LT3A 3PO1B 3ITIA 4K69A 2A0QB 3PV4A 2W3IA 1MTVA 1O2JA 2JH0D 1O3OA 3HPTB 1AUJA 1Z8IB 1GMHF 3A87A 1FY1A 2I6QA 1CBWC 1GCTC 3ZVAA 3L3TA 3ODDA 1SG8B 3A8DA 1ESAA 2V0BA 2ULLA 3D49H 3TK5A 3UOUA 5DP5A 1F5RA 3BV9B 9ESTA 4ZHLU 3KQBA 4K60A 1A7SA 1SGTA 5TCCA 4UONA 3ZZ3A 1HJ8A 1MBQA 1CT4E 5I25A 5IDKA 4OS1A 3NK8A 1RGQA 3BEUA 1QB9A 1YKTA 4KTUA 1QBVH 2NU3E 1E38B 4NA9H 1GL1A 2FEQH 1UVUH 2FOAA 3S7KB 4ZROA 1Y3XA 5GXPA 4CRBA 4NA8A 1UVSH 3W94A 3SV6A 1O2VA 2PGBB 3RU4T 3F9GA 1J8AA 3MU0A 1ZMNA 3E0NB 3U8TH 4CRGA 1O5BB 1P3EA 1TMUH 4K2YA 4Y11E 1LDTT 1FAXA 3QTOH 1QRZA 2Z7FE 2PV9B 1VITG 2ZO3H 3H09A 3ELAH 2GVFA 3RXIA 1T32A 1DX5M 5TJXA 1DANH 3LJJA 1NM6A 4E7RG 1XM1A 5E2PA 1IQIA 2HWLB 5GCHG 3IG6B 1K28D 2F83A 2BY8X 1OWJA 1J16A 3JZ1B 2UWOA 1GWAA 1S81A 4FU7A 5EQQA 5A8ZA 2IPHA 5ESBA 1K1IA 1AGJA 3RXFA 2EI8A 1GBCA 3TU7H 2AFQB 4A92A 1GVLA 4AGKA 9LPRA 3F1SB 3TH3H 3Q00A 1V2ST 4NSYA 2H5CA 1W0ZU 2EA3A 3TH4H 1PPCE 2HNTF 2DE8A 2PR3A 4CRDA 5FPTA 1HIAA 1GBHA 3GDUA 3PWBA 2XBWA 3KEEA 4ZKSU 5GWZA 1QFKH 3MU1A 1HXEH 3MU5A 5AVDA 1OWDA 4THNH 3K9XB 1SB1H 1EJMA 1UTKA 5HMAA 4B2BA 2XBVA 1KLIH 4NWKA 1TRYA 3MO6A 1YPHC 4ISOA 3T26A 1MKXK 4K8BA 3UQVA 4GHTA 2ZFFH 1Y3YA 2ZU3A 2CF9H 4FUIA 4D8NA 3MNSA 1VZQH 2PSXA 2BDHA 1S0QA 1ACBE 2XXLA 1CT0E 2A2XH 3OYPA 4WXIA 3D62A 5A0BA 1MU8B 3M3TA 4TWWA 4GSOA 1Y5AT 1C5MD 3MI4A 5DP4A 4GPGA 4X6PA 1L0ZA 3KCGH 2PUXB 2OBOA 5L2YH 1DDJA 4UE7H 4TWYA 1GJ8B 1GHBF 2XNIA 2TRMA 4B75A 4O3UA 4DT7B 1DLEA 1O2ZA 4A1XA 1C9TA 1LQDB 1O2SA 1O34A 5EQRA 3SHAH 5C67A 4OS6A 1BMAA 4MLFB 2PTNA 1BA8B 1S6HA 2BYAX 1QRXA 2SGAA 4DURA 2ASUB 2QXHA 1PQAA 1C5SA 1LQEA 1XUJA 2CJIA 1L1JA 3RU4D 3GY3A 1W13U 3FFGA 3ZZ6A 1HRTH 2VVCA 1AKSB 1EX3A 1T8LA 2YNAA 3PLBA 1TPOA 3LC5A 1GJ5H 3V7TA 3SZEA 3S69A 7ESTE 2GV6A 1AMHA 1O3KA 3P8NA 5F8ZA 3AAVA 4XBCA 1NFUA 1MTNC 1ETSH 4ABDA 3QGNB 4A1VA 4RKOB 1TPPA 1FJSA 5AFZH 1O5AB 3AASA 1WAYB 5F03A 4UFEH 1BTXA 1Y5BT 4X2WA 5T6DA 1OPHB 2P8OB 2Z9LA 2R9PA 4UD9H 3ZZ9A 2F91A 2GTBA 3E90B 1HAGE 1PQ5A 2B7DH 1D6WA 1KTSB 4E7NA 2ODYB 1UMAH 1TAWA 2G81E 4BAHB 1H8DH 3M37A 1TNHA 3RU4E 1C1UH 1OWEA 2BZAA 4ZMAH 2BDYA 5JYIA 4NA7A 1QJ1B 1ELVA 2LNCA 1HAZB 1NY22 2O8LA 5JDUB 2ESTE 3RXCA 2A32A 3MU8A 2ZU5A 1B7XB 2FPZA 2H2ZA 3FP7E 3VFEA 3TPIZ 4NIWA 4DY7B 2Q6DA 4CH2B 1OOKB 1XX9A 3GOVB 3SGAE 1WUNH 1IQEA 2NWNA 4AORA 3E91A 2FOCA 3RXVA 1GI5A 1GJ6A 2FDAA 4GAWA 2J34A 5GJ4B 1C1PA 1UVOA 3ZVEA 3PLKA 1OP0A 5DJ7A 2BXUH 2SGFE 2H5DA 1O38A 3LGUA 1SQAA 1QGFA 4O97A 1F5LA 5A09A 3VEQB 1K1LA 1SBWA 4PROA 1ZHPA 3G01A 1DE7H 1FZZA 3PMAB 1GI3A 1O36A 1TNJA 2GP9B 3M3SA 4AN7A 1GI4A 1SLVB 3QLPH 2UUYA 2EI7A 3V0XA 1CU1A 3RXUA 3P92A 3TNTA 1TGNA 4WMDA 1ANEA 4Y79A 1O5FH 1YGCH 2WV4A 2SNWA 4IN2A 2VB0A 4MQAA 1CQQA 3QGJA 3SNAA 2BQWB 1AIXH 5E2OA 4ABBA 4FU9A 1EXFA 5PTPA 2GCHG 1EPTA 2OLGA 3BTFE 1NESE 4JYUH 2KAIB 3EGKH 1FAKH 2VH6A 3VB4A 2VIPA 1BRUP 1O3AA 1Q2WA 1ZOMA 4GUXA 1GGDB 1O3GA 2C8WB 1K1NA 2NU1E 5FAHA 4I8KA 3QX5H 4NIXA 3RXAA 1C5WB 2WPLS 1O33A 1O37A 2VWNA 1BRAA 3B9FH 3GCHC 5I46H 2WYGA 4CRFA 1FPHH 3U9AH 4XBBA 2QXIA 1GGDC 2ZPRA 5EG4A 2A4QA 2Y7XA 4A5TS 2A4GA 1C2DA 5B6LA 4K1SA 1RXPA 1C5RA 3DHKH 2WINI 1OKXA 2ZQ2A 3PM3A 3RC6A 1BTWA 2UWPA 4D9QA 3Q77A 3S9BA 1LVBA 4MNWA 4M9FA 2ODPA 3IWMA 3K2UA 4JZEH 4ZHMU 2PSYA 4UFDH 4AB9A 2ZG0H 1T4VH 1G2MA 2P93A 1O3DA 4MG3A 3UQOA 1F5KU 3VXFH 3RXHA 1LCYA 2CF8H 1L2EA 5FX6A 3CS0A 1GJBB 1EZXC 3P8OA 1P12E 1NRSH 2ZA5A 3CS7A 1DY8A 1GDQA 4Q7ZA 2GD4B 5ETXA 3ZZDA 4SGAE 3RXMA 1RTFB 2ZHQH 5JBBS 2G4UA 2JETB 5J4QA 1VCWA 3RMOH 4I33A 4B2AA 1GBMA 3RXSA 1SMFE 1BITA 1F0UA 1YLDA 1HPGA 1JOUB 1IHSH 1C5PA 4OGYA 1AKSA 3BN9A 1AI8H 1A5HA 2OD3B 2XW9A 1GMDG 3PV2A 5CHAC 1BMLA 5C1XA 1A2CH 3ZZ8A 1GHBG 4MVNA 1A0JA 3QK1A 1N6XA 1O5CB 1QTFA 4INLA 2F4LA 1YPLH 1Q31A 2AIQA 4CR5A 4ABFA 1HB0B 4Z6AH 4GHQA 1DVAH 5BRRE 3RXBA 3SV7A 2W5EA 2ZKSA 3T29A 1TNGA 2ZF0H 3I78A 1AE8H 1SGFA 3KQDA 4I32A 1EAWA 5HM2A 1VCPA 1GI9B 3HK6B 4E05H 2HRVA 3ZV9A 5C1UA 2P3FH 1LO6A 1HAIH 1K1OA 3SU3A 1UTPA 3A81A 1S6FA 4ZHAA 1EUFA 1TNIA 3DFJA 1VITH 4TPYA 2P8OC 1G37A 1MCVA 2TGDA 1NS3A 1SVPA 2AGGX 4MPVA 3ESTA 3SU5A 3BG4B 2G51A 1P2IA 2ANYA 5DP8A 3TVJB 4WF8A 4BXWA 1KDQA 2FS9A 3RC4A 2YOLA 1HYLA 3MU4A 3P8FA 1H9IE 1UTQA 3A89A 1CO7E 1G2LA 2IOTA 2QA9E 4ZXYH 1KXAA 1AB9C 2WPIS 1O2OA 1GI8B 1O2UA 5FX5A 2VVVA 1MAXA 2QN5T 1O31A 2B0FA 3NPSA 1PQ7A 4DCDA 1G3CA 2Z3EA 1DUAA 1SOTA 6GCHF 2G8TA 1Y8TA 1AFEH 5T6FA 1OX1A 4ABAA 4B1TA 1J15A 3UPEA 2VH0A 1OWHA 1UJ1A 1HLTH 1N8OB 3BTQE 2VJ1A 3FANA 1QL7A 1HAPH 1P2NA 3EA8A 1SGDE 2RCEA 4Y7BA 5JBCS 4FXGH 2J92A 1GHWH 1ZHRA 1GI2A 3SU1A 2GT8A 4FUGA 5HYOA 1WOFA 1O3EA 1MZAA 1TFXA 2ILNA 2OTVA 3U1JB 1OSSA 2GZ9A 1S5SA 3GYMA 3UR6A 3SV9A 2Y80A 1V2PT 4ZKNU 1GMHG 1C5QA 2P16A 2PKAB 4I8GA 5A8XA 3GCOA 1L4ZA 1P0SH 3ZZBA 4D9RA 3RLYH 1P9UA 2V3OH 1QIXB 1GCDA 3TK6A 1KXEA 1MBMA 3HGNA 2THFB 4MPXA 2QC2A 2G5NA 2QAAA 1LVYA 3H5CB 2BDIA 3SNEA 4TPIZ 5EW1H 1ZTLA 2BXTH 1C2LA 4IC5A 4NIVA 1RJXB 1C5VA 1AN1E 5A0AE 4IC6A 1GBKA 2WPJS 1TNLA 3QDZB 5GCHF 2Y5GA 2WPKS 3C27B 1ZR0A 3V13A 2ZQ1A 1V2VT 4A1TA 2R0KA 2TPIZ 4M7GA 2HPQH 2PWXA 2Z9IA 2PUQH 2TBSA 2F9PA 1ELTA 1F2SE 1NZQH 3MWIU 4MPWA 3TJOA 2NU4E 2A31A 3E0PB 3VXEH 1FV9A 1BRBE 4H4FA 1SGCA 3SV8A 2D2DA 1KY9A 3BTEE 1DFPA 3KN2A 5LPEA 1MD8A 1P06A 1C2IA 1JMOH 1C5UA 4B6EA 1KSNA 4U01A 1BBRE 1H1BA 2PKSB 1WBGB 3RXKA 1CA8B 4JCNA 1EOLA 2FTLE 3RXOA 3PO1C 3KNXA 4MPUA 1XMNB 1PPGE 1QQ4A 1BBRH 1W0YH 2IN2A 1IQKA 1O3FA 2VWMA 1CHOF 5CE1A 2HOBA 3KQEA 4NIYA 1SFIA 2ZP0H 4X6NA 3RDZA 1LHCH 1C9PA 2BMGB 1OS8A 2Q1JA 3SQHE 1UTJA 4DIIH 1BTPA 1O3BA 4KTSA 2BDCA 3PYHA 2YNBA 4NWLA 1RD3B 2XWAA 4AB8A 3AK5A 2SFAA 2Z94A 5G4BA 1JXPA 1HJAC 5SGAE 1O3NA 1FUJA 1YM0A 1O5EH 3SV2H 3F9EA 2AGIX 4BTTB 2SGEE 3LGVA 4IW4E 1ZJDA 1UK2A 2WHXA 1E0FD 1SC8U 4ABGA 2HGTH 2FOGA 1H9HE 2VIQA 1GI1A 1EZQA 3U69H 4OS5A 2HPPH 2RA3A 3L33A 3MTYA 2DE9A 1G32B 3GCNA 5C5OA 2M5TA 1ESBA 3A7YA 3RLWH 1TNKA 1QL9A 1ZTKA 1TGTA 3ATIA 1SI5H 1O3HA 2H9TH 1JRSA 2VIVA 1O2WA 1W14U 3KHVA 3A82A 8ESTE 1BDAA 3M5OA 2K1QA 3FP6E 1KXBA 1ABJH 3RMLH 3SU4A 1TX8A 2O8MA 1LPKB 1P3CA 1GJ9B 1QB1A 4CBOA 1SGFG 2FOFA 4AFQA 2ZU1A 1HFDA 1P2KA 2FIRH 5DP6A 4DVAU 4X8UH 1JBUH 3LKWA 1C5OH 2PFEA 3UFAA 1WQVH 1TYNA 1F0RA 1DLKB 4WH6A 2F9UA 3SORA 3T25A 2R2MB 1ELBA 1QJ7B 2ODQA 1A5GH 3GY6A 1P2OA 2FXRA 1GBLA 4YTAA 4LOYH 1D3PB 1RRKA 2O8UA 4OS7A 2PHBA 4WJG2 4NFFA 3S0NA 1ZRBA 5E0JA 2OINA 1EAUA 2QF3A 4FUFA 3M5MA 1EZUC 3SO3A 3SQEE 2FM2A 1QCPA 2C4FH 1P11E 4JYVH 2IJOB 2CN0H 3MNBA 1AB9B 4AX9H 4YLQH 1O5GH 3P17H 5FCKA 3U8OH 1E35B 2J4IA 5CHAB 3V3MA 1PQ8A 3HK3B 2BOKA 1YPMH 2HALA 2FWWA 1A0HB 4ZXXH 2XYAA 4WMFA 1B0FA 1ELCA 4K8YA 1UK3A 2A7JA 1WXRA 5F8XA 1GHAG 4B71A 5C20A 2QYIA 2ZECA 1NPMA 8GCHG 1Z8JB 2WUBA 1TONA 5DKMA 3SJOA 3LGYA 1ZSJA 1Z71A 4HZHA 1TMTH 4ISHH 1HNEE 2O9QA 4RKJB 2OC0A 3OTJE 1Y3VA 1CHGA 1B5GH 1YPGH 2Y7ZA 3GCTG 4XFQA 2Y6TA 1C2EA 3GY7A 5C1YA 2XCNA 1OWIA 2CMYA 3SJ8A 4IS5A 3RM0H 1GHVH 1MTWA 4IMQA 4HI3A 4Q2KA 1E36B 1A4WH 3FP8E 4UDWH 1E34B 2F9BH 4UEHH 1YF4A 1ZRKA 3SUFA 2ZDNA 2XC4A 1UVTH 4CREA 2BD3A 1QBNA 4ABHA 4Z0KA 1NN6A 1TQ7B 2GGVB 3D23A 4YOIA 5CMXH 3SW2B 2F9VA 4Q7YA 1FXYA 1SLUB 1OYQA 3SJ9A 1RFNA 3M35A 1ID5H 2RDLA 4WH8A 5HGGA 1GG6B 1GMDF 1MKWH 1V2UT 3M61U 1FY5A 4XE4A 5EXMA 2R3UA 2ZGBH 4ABIA 3GDSA 2TGPZ 3RP2A 1GBIA 2OCVB 4YT7H 1EB2A 1BJVA 5K7RA 3QWCH 2B5TB 4BANB 1T4UH 4INHA 1AVGH 3E16B 1GG6C 3UR9A 4BAMB 3E8LA 3H7OA 1C2HA 4JK5A 4X1PU 3SHCH 3QUMP 3UWJH 5EPYA 1ETRH 3GYLB 4X6OA 1FNIA 3P6ZB 1G30B 4RSPA 1H9LB 3VB6A 1TE0A 3M7UA 3ATKA 2BD9A 1YPHE 3L6PA 1V2KT 3SUGA 1H8IH 1KXFA 4F49A 2UWLA 3BTWE 5FBIA 3SJIA 2FOBA 3N7OA 3AVZA 1TB6H 4Y8XA 4DG4A 1FONA 4X2XA 1CE5A 3RXQA 1YPJH 4XBDA 2SGQE 2GDDA 2FODA 2BB4A 2R2WU 3RXPA 2QF0A 3JZ2B 3D65E 2ZTYA 1TLDA 2GV7A 4O3TA 4KTCA 1BHXF 1LVOA 1C1VH 1PPFE 3M5NA 3GDVA 1ANBA 3Q3XA 4FUBA 2HNTE 4INKA 2A7HA 3U1IB 4I8LA 1VCQA 5C2ZA 1P8VC 2LPRA 8LPRA 1TGSZ 1HV7A 4K3JA 1Y3WA 4ISNA 3RMNH 4MNYA 4NGAH 1V2JT 1W10U 3MO9A 1J17T 1ELAA 2GMTB 3TGJE 3GY2A 2BZ6H 3IITA 3EDXB 1HXFH 1V2WT 3V12A 1HAVA 1GCTB 3BG4C 1QNJA 2I6SA 1P03A 3SYJA 3NKKA 1AUTC 4IN1A 2F3CE 3PTBA 2AEIH 4JK6A 3K6ZA 4ZAEA 1D6RA 1HAXB 3MNCA 1NT1A 1UK4A 1K2I1 1V3XA 5DP7A 3LONA 3RXJA 1O2HA 3BTHE 4X2YA 3VGCB 1T8MA 2BLOA 3ZVDA 3WY8A 5GIBA 2A4RA 4BNRA 1TBZH 3M7TA 4I31A 2JETC 2FI3E 1UTNA 1FLEE 3TITA 3RC5A 1MUEB 3SNBA 3UY9A 1O2LA 5JB9S 1H4WA 3ZVCA 1SHHB 2FYRA 3PB1E 1HDTH 3DA9B 1TRNA 1K21H 1SGNE 4Y0ZE 1VR1H 1AU8A 2WPHS 1P2QA 4Y7AA 3MOCA 1ZHMA 1BOQA 3EQ0H 2ZFPH 5L30H 1ETTH 3TLOA 6GCHG 1BB0B 3OX7U 5HXFA 2ZDAH 1V2TT 4YT6H 4ISLA 2AMDA 1VGCC 4A6LA 2P95A 4LK4A 2Y81A 3BG8A 2VWLA 2P94A 2STBE 4ABEA 1QHRB 5DGJA 1DPOA 5FBEA 2ZNKH 1ZZZA 2AH4X 4AYVB 4CHAC 2XTTB 3UTUH 1U6QA 1O30A 3BEIB 3HKJB 1O3CA 1VGCB 5DG6A 3URDA 1BTUA 1BHXB 1XKBC 1AVXA 1Z8RA 1MTSA 3I29A 1NRNH 1KDQB 1JIMA 4YLUA 4D76A 1LVMA 2CHAC 1F7ZA 1SSXA 1V2LT 2W3KA 3A8AA 5EGMA 5ESTE 2ZCLP 4XDEA 1QL8A 2A5IA 2HNTC 2HVXA 4GLYA 1O3JA 1THPB 1NRQH 1AZZA 1HCGA 1GBJA 5EU8A 3BTTE 3TH2H 3BSQA 1C1WH 3R3GB 3Q3KA 5B6OA 4FUEA 1G36A 2J9NA 1C5NH 1SGQE 1XXDA 3SNDA 1AFQB 5C3NA 4I8HA 1D4PB 1K1MA 2FO9A 3F9HA 3LPRA 1A1RA 1DT2A 1KXCA 2ZGXH 3UUZA 4X1RU 5HM9A 3QO6A 1QRWA 3NXPA 1T31A 4U2WA 1NU7B 1WTHD 1HAOH 1TABE 2UUJB 4D7GA 3OSYA 2P3TB 2ZFRH 2QY0B 3A7VA 1CGHA 1Z1IA 4X8SH 1BTHH 1ABIH 4ZH8A 1UHBA 3DUXH 4X0WU 3FZZA 3UOPA 1ZGVA 1ANDA 4YESB 1INCA 3TGKE 5BPEA 2BDGA 3QZQA 2ZCHP 4O9VA 5GDSH 1FDPA 2QCYA 3NUMA 3M3VA 1WV7H 2WV9A 1LMWB 1SLWB 1ZGIA 2ZHWH 4JZDH 4E06H 3MH5A 1P2MA 4B6FA 4XOJA 3EA9A 3KQCA 4WXVA 5FHTA 3TJNA 1W8BH 3LH1A 1GJ7B 1KXDA 5GPIB 1GJAB 1SGPE 4CRCA 2VGCB 4FVDA 2D26C 1ZPZA 3RUOA 1FY4A 1FQ3A 2AYWA 1GJDB 5A0CA 1GHYH 3B23B 2B9LA 2IJD1 3MNXA 6CHAC 2OQ5A 3F9FA 2C8ZB 4AOQA 2ZWLH 1EJAA 1UCYK 2GZ7A 3VB3A 5DO4H 7KMEH 1XVMA 1AD8H 2SGDE 1J14A 1NC6A 1NO9H 2A5KA 5EQSA 1W12U 1DSUA 2AMQA 1LHEH 1SQTA 2BD4A 3ZZCA 2D8WA 1LHFH 1ZLRA 3A7TA 3SOSA 3A88A 4BTIB 3HGPA 3TK9A 2ZU2A 1AFQC 3S7HB 4NSVA 1GBBA 3MMGA 2J2UA 4J1YA 1UTLM 2VIDA 2B8OH 3O8BA 4FUCA 1P57B 1EB1H 1TBRH 5EXNA 3LGWA 1Z8GA 2BVRH 3RXRA 4WVPE 1O32A 2ZDMA 3HKIB 4DJZB 1O3MA 2STAE 5L6NH 1G3DA 1L1NA 3Q76A 1TX7A 2AERH 2BTCE 2NU0E 2OC8A 1FI8A 1SL3A 3AW0A 1TQ0B 4IBLH 1MKXH 5TCAA 2FOMB 1XUIA 4JZFH 5IYTA 1D3TB 4WY3A 1ZMLA 1CBWB 5J4SA 2FLRH 1QR3E 4H6TA 5T1VA 4QT8C 4Q7XA 4LZ1H 1ZPBA 3RMMH 1SGEE 4X1QU 1C5LH 3GY8A 2ZGCA 1EP5A 1RTKA 3QZRA 3TJUA 1SOZA 3LDXH 1O2PA 1RS0A 4YOGA 1MTUA 4I7YH 2OUAA 3C1KA 5E8EH 1RTLA 3GICB 1P10A 1BRCE 1LHGH 2TIOA 2J94A 1XKAC 2BOHB 1YCPK 1PPHE 1BCUH 3MH6A 2ALPA 8GCHF 1DWBH 3UNRA 2R0LA 4JZ1A 3U98H 1WSSH 1RIWC 3SU6A 2ZDLA 1NU9A 3LC3A 3SU0A 4B76A 1BZXE 2ZHFH 5DP3A 3PWCA 2V3HH 3ODFA 5FCRA 2GT7A 1OP2A 2Z6BD 3Q3YA 3E3TA 5JBAS 2OK5A 1AZ8A 3MH4A 1EAIA 1CT2E 1EJNA 1THSH 3EE0B 2Q6GA 2W26A 3W95A 2GZ8A 1HJAB 1W7GH 1OYTH 3PMHB 1QBOA 1MU6B 1YP9A 1GHXH 4UFFH 1YCPM 1O2TA 2BLVA 1O0DH 1L4DA 5LPFA 1HUTH 2FI4E 1O2QA 4NFEA 2ZGJA 6ESTA 3VGCC 1SLXB 1O2MA 1QJ6B 1FY3A 1GMCG 2ZTXA 1C5TA 3LIWA 3MYWA 2SGPE 3RXDA 1YBWA 3VB7A 1BBRK 2FS8A 1DY9A 1C1QA 4NCYA 1BTYA 1UTOA 3ATLA 2VIOA 3RXEA 1UTMA 2FX6A 3ZZAA 2VVUA 2AIPA 3KL6A 2Z9GA 1VJ9U 4Y8YA 3A7ZA 3AAUA 4ZKRU 5A8YA 4CRAA 1WQSA 5AF9H 1GBDA 1ELEE 2AS9A 2ZFSA 2GKVE 2ZGHA 1QA7A 2A5AA 1QURH 4I8JA 8KME2 2GCTB 2BQ7B 4AYYB 4BXSA 3BTME 3UNSA 1C5ZB 3LU9B 2P59A 3QTVH 1HIAB 5AHGH 4ZUHA 4RI0A 2GCHF 4K1TA 1ESTA 2H9HA 1AWHB 1JIRA 2Z3CA 3SBKA 1GBTA 2PTCE 2BD2A 3A84A 5FXLA 1BMMH 4ISIH 1FIWA 1O35A 4IGDA 1LPZB 2O8TA 1YYY1 1XUGA 4BAQB 3ENSB 2BD8A 1EASA 1HBTH 1OWKA 2Z9KA 3UNQA 1ZPCA 2UUFB 5FPYA 4X1SU 3ZYEA 4MNXA 4FU8A 4O03A 1ZTJA 4ZKOU 4CHAB 1A0LA 3ZVGA 5FPSA 1C4V2 5EXLA 3VB5A 1DWEH 3EAJA 1XUHA 3GY5A 4AGJA 1Z6EA 1DSTA 4MTBA 1CHOG 5ABWA 2G00A 1IQHA 1WTGH 2BD5A 2XRCA 2G5VA 5DPAA 1CVWH 2ANMH 3E6PH 1S0RA 3KIDU 1IQJA 2FOHA 4CBNA 1O2NA 4CH8B 2A4OA 1P01A 3DT0H 4VGCC 2ZTZA 1GJCB 1N1LA 4NZQA 7GCHF 1MQ5A 1UVPA 1YPKH 1IOEA 2VGCC 1AY6H 1ELDE 5T6GA 1Z6JH 5F8TA 4FUDA 3TNSA 1O5DH 4HFPB 3GCHB 2A1DB 4KKDA 3E1XB 3SUDA 3T27A 1L1GA 1TX6A 1TOMH 2V6NA 1F0TA 2VBCA 1FIZA 3M5LA 5EW2H 3RXLA 1C1SA 1IQLA 4JMYA 1TA2A 3ZZ5A 1F0SA 1HGTH 3DFLA 3OU0A 3DD2H 3NZIA 3O8DA 3VPKA 1TALA 2ZZUH 1JWTA 4B74A 1PYTD 2C8YB 1EZSC 4KP0A 1NROH 1A5IA 1C1RA 1TGCA 1MQ6A 1NRRH 1GPZA 1TMBH 3PLPA 3TJVA 1PPZA 1N6YA 3K65B 1TOCB 2EC9H 1THRH 5JB8S 3EYDA 3A7XA 1PFXC 1FY8E 1P05A 1CA0B 1C1MA 3A86A 1HAHH 1NFXA 2BD7A 3QN7A 1PPEE 3M7QA 5EPNA 1XVOA 3A7WA 3NCLA 1MCTA 1V2NT 3A83A 2Z9JA 4GCHF 2XC0A 1YC0A 1O2KA 1DITH 3F6UH 5JPMH 1K22H 1CA0C 1E37B 5T3HA 1CGIE 3BIUH 1TPAE 2F9OA 1PYTC 4ASHA 1O39A 4Y71A 3T28A 1BUIA 1S85A 1UCYE 2QIQA 4OGXA 2W7SA 3T5FH 1K9OE 2OXSA 1OXGA 1S84A 1D9IA 4KGAA 1GHAF 1UHBB 1AVWA 4H42U 1DOJA 1WYKA 1W3CA 2XBXA 1V2RT 3T2NA 4A7IB 4ESTE 4WWYA 1MZDA 2JKHA 1D3QB 2BDAA 5LGOA 3SI4H 3SZNA 1SHYA 1C1OA 1SGYE 1YPEH 1GDUA 2ZPSA 2C8XB 1GBAA 3BTKE 6LPRA 2BHGA 1NFWA 1BJUA 2Y5HA 3H7TA 1KLJH 4UFGH 2FTMA 4R0IA 1S83A 2TGTA 4OS2A 3A80A 1GDNA 1FN6A 2D1JA 4GCHG 4TYDA 1FPCH 2H6MA 1TA6A 2CV3A 1T8OA 1HJ9A 1O2YA 2BX4A 1PPBH 1C4U2 1LKBA 1W2KH 1D3DB 1G3EA 1G9IE 1IQNA 4YOJA 1QY6A 1LTOA 2BVSH 1XUFA 5EODA 3SU2A 5H4IB 1AO5A 2UUKB 3TGIE 2ALVA 1HAYB 2VWOA 4AFZA 3SN8A 1FMGA 4TY6A 2A2QH 1EATA 2QXGA 1EPTC 3GCTF 2QV1A 4Q80A 3NWUA 1O3IA 1TBQH 2BDBA 1MH0A 1SGRE 4Y0YE 2ANKH 4TY7A
chains in the Genus database with same CATH superfamily
5LPRA 1DWCH 1P02A 1C4Y2 2VU8E 2ZEBA 1WCZA 4BTUB 3ZV8A 1GMCF 2RDEA 2BLQA 2C93B 2PKAA 3U8RH 1EPTB 1ZJKA 3PMJA 3STIA 1ZMJA 2FZZA 1IQGA 3ATMA 4Y76A 2QGRA 4NZLA 1LHDH 1GBEA 1YY3A 2BM2A 2NU2E 4HGCA 4BOHA 1Z1JA 2GCTC 2EEKA 3SGBE 4Y6DA 4JZIA 1BIOA 2BX3A 1TGBA 2OP9A 1A46H 3FVFB 3S9CA 1TPSA 2ZHEH 2J38A 1ELGA 3PV5A 1LPGB 2OC1A 1ELFA 4YXWD 2ANWA 4U32A 1FN8A 2AMPA 2XC5A 1O2GH 3A85A 4I86A 3T62A 3RXGA 1NRPH 2G4TA 2FP7B 1GJ4H 3BTDE 2ZC9H 3A8BA 2PLXA 3OY5U 1UO6A 2WYJA 3MO3A 3SNCA 1K1JA 1NTPA 3SUEA 1DWDH 1OP8A 3SI3H 1EP6A 1P9SA 4ABJA 5EOKA 5LH8A 4VGCB 1C5YB 3CP7A 3DCLA 2XCFA 4DT4A 1AE5A 4LXBH 2C3SA 2F9NA 5AFYH 3FAOA 4AFSA 2OBQA 1MTNB 5GNDA 4K1EA 4X8VH 1ARCA 2ZFTA 3O8RA 1XXFA 1ZSKA 2GMTC 5K0HA 3RM2H 3STJA 1O3PB 2BVXH 1B0EA 2V35A 3UWIA 2ZFQH 1QB6A 3ATWA 5A2MH 2FX4A 1EAXA 2P3UB 3TIUA 4WMEA 2BY6X 4X1NU 1MKWK 1DXWA 3SGQE 1Y59T 3K6YA 4KELA 1S82A 1SFQB 2DUCA 1GL0E 7GCHG 3URCA 1VJAU 2ZI2H 2AGEX 4Y10E 3RXTA 1BTZA 2BY7X 2C90B 4AG1A 1Q3XA 1DICA 2GDEH 5CHBA 4BAKB 1SR5C 1T7CA 1ZSLA 4MNVA 3LH3A 2PW8H 3A8CA 2FESH 2XWBI 2ZDKA 3P95A 2PGQB 5DP9A 1KIGH 1TRMA 4Y8ZA 4DOQA 1BT7A 5JBTA 4B2CA 2VNTA 4Q4LA 2RG3A 1IQFA 4DIHH 1O3LA 1C2KA 2Y5FA 3LGTA 1XUKA 1QQUA 2JH5D 3HATH 1YLCA 4RN6A 3GISB 2VIWA 1AHTH 1NFYA 4F4OC 2KAIA 5C0UA 1Y5UT 4B73A 3DSGA 1ARBA 4YM9A 1GVZA 3B8JA 4BAOB 1AQ7A 1P09A 1V2MT 1VITF 4OS4A 2CXVA 4K5ZA 2CHAB 4D7FA 1EOJA 1J9CH 2VINA 4AFUA 2JH6D 1CSOE 1QA0A 1Z7KA 1KYNA 2TGAA 1K1PA 2ZU4A 4U30A 1LKAA 2H9EH 1GBFA 2BY9X 1HAVB 2A7CA 2J95A 3I77A 4R8TB 1UCYH 3OY6U 2JJ1D 3GY4A 4HTCH 1O2RA 3ZZ4A 7LPRA 2WV5A 2OC7A 1EQ9A 1O2IA 1O2XA 2W7UA 1T8NA 3F68H 1GI7B 3PROA 4NG9H 2KM0A 1DXPA 1EKBB 1GI0A 2BQ6B 2FI5E 3MH7A 5DK1A 4AC9A 1P04A 4XD7D 2WUCA 3BEFB 5L2ZH 3F0PA 5F6MA 2QXJA 3WW7A 1SGIB 2RA0A 1W11U 2ZDVH 4GVUA 4YO9A 3ZVFA 5KEDA 1OHHD 1W7XH 4FUHA 2O8WA 1IQMA 1DM4B 1M9UA 3ZZ7A 2KCAA 2OQUA 1WU1A 4XSKU 1KTTB 3O8CA 4X2VA 3ZYDA 3LJOA 2HLCA 2ZHDA 3FZDA 2PKSC 1GHZA 5HIYA 1MMJN 2SNVA 1TIOA 3BIVH 3KF2A 1V6DA 5C5NA 1SQOA 3KGPA 4DW2U 1C2JA 1MAYA 1GVKB 1Y3UA 4AZ2B 1C2MA 4J2YB 3UREA 1A61H 2FLBH 3UIRA 2XBYA 3OTPA 1BMNH 2Y82A 4AG2A 3ZVBA 1C1TA 1DUEA 2G55A 3SJKA 1ZYOA 4OM9A 1A3EH 3P70B 1PJPA 2FMJA 1JRTA 3BTGE 5CDFE 3MHWU 2BY5X 1C1NA 1C2GA 4CR9A 3S9AA 2R3YA 2J5UA 1SPJA 5F53A 3M36A 3WWFA 2G52A 1C5XB 1GI6A 2A45B 2FOEA 2ZPQA 1BQYA 3MFJA 3AW1A 3R0FA 5E0GA 5IK2D 4YZUA 1TWXB 1CGJE 3PMBB 1YCPH 1KLTA 1ANCA 1F92A 3BF6H 3P8GA 1N8OC 3EA7A 1X7AC 2BLWA 4X6MA 2XOKD 2ZCKP 4DGJA 4MDSA 4H6SB 4LZ4B 2GX4A 2Q6FA 5E0HA 3PTNA 2WPMS 2ZIQH 2WZQA 1V2QT 3LOXA 2IPQX 6CHAB 2Z3DA 1MD7A 1AWFH 4FUJA 1V2OT 1IAUA 2FYQA 1RIWB 4JYTA 1DS2E 3LGIA 4TT3D 3MQKC 1P2JA 3CENA 4IMZA 1IHTH 1G3BA 4FVBA 2CGAA 4SGBE 1A3BH 1C2FA 1ORFA 4X8TH 2EI6A 2H1UA 3LT3A 3PO1B 3ITIA 4K69A 2A0QB 3PV4A 2W3IA 1MTVA 1O2JA 2JH0D 1O3OA 3HPTB 1AUJA 1Z8IB 1GMHF 3A87A 1FY1A 2I6QA 1CBWC 1GCTC 3ZVAA 3L3TA 3ODDA 1SG8B 3A8DA 1ESAA 2EY4C 2ULLA 2V0BA 3D49H 3TK5A 3UOUA 5DP5A 1F5RA 3BV9B 9ESTA 4ZHLU 3KQBA 4K60A 1A7SA 1SGTA 5TCCA 4UONA 3ZZ3A 1HJ8A 1MBQA 1CT4E 5I25A 5IDKA 4OS1A 3NK8A 1RGQA 2YMSC 3BEUA 1QB9A 1YKTA 4KTUA 1QBVH 1YWUA 2NU3E 1E38B 4NA9H 1GL1A 2FEQH 1UVUH 2FOAA 3S7KB 4ZROA 1Y3XA 5GXPA 4CRBA 4NA8A 1UVSH 5DSFA 3W94A 3SV6A 1O2VA 2PGBB 3RU4T 3F9GA 1J8AA 3MU0A 1ZMNA 3E0NB 3U8TH 4CRGA 1O5BB 1P3EA 1TMUH 4K2YA 4Y11E 1LDTT 1FAXA 3QTOH 1VKYA 1QRZA 2Z7FE 2PV9B 1VITG 2ZO3H 3H09A 3ELAH 2GVFA 3RXIA 1T32A 1DX5M 5TJXA 1DANH 3LJJA 1NM6A 3KQ5A 4E7RG 1XM1A 5E2PA 1IQIA 2HWLB 5GCHG 3IG6B 1K28D 2F83A 2BY8X 1OWJA 1J16A 3JZ1B 2UWOA 1GWAA 1S81A 4FU7A 5EQQA 5A8ZA 2IPHA 5ESBA 1K1IA 1AGJA 3RXFA 2EI8A 1GBCA 3TU7H 2AFQB 4A92A 1GVLA 4AGKA 9LPRA 3F1SB 3TH3H 3Q00A 1V2ST 4NSYA 2H5CA 1W0ZU 2EA3A 3TH4H 1PPCE 2HNTF 2DE8A 2PR3A 3N7EA 4CRDA 5FPTA 1HIAA 1GBHA 3GDUA 3PWBA 2XBWA 3KEEA 4ZKSU 5GWZA 1QFKH 3MU1A 1HXEH 3MU5A 5AVDA 1OWDA 4THNH 3K9XB 1SB1H 3OE7D 1EJMA 1UTKA 5HMAA 4B2BA 2XBVA 1KLIH 4NWKA 1TRYA 3MO6A 1YPHC 4ISOA 3T26A 1MKXK 4K8BA 3UQVA 4GHTA 1COWD 2KR7A 2ZFFH 1Y3YA 2ZU3A 2CF9H 4FUIA 4D8NA 3MNSA 1W0KD 1VZQH 2PSXA 2BDHA 1S0QA 4F48B 1ACBE 2XXLA 1CT0E 2A2XH 3OYPA 4WXIA 3D62A 5A0BA 1MU8B 3M3TA 4TWWA 4GSOA 1Y5AT 1C5MD 3MI4A 5DP4A 4GPGA 4X6PA 1L0ZA 3KCGH 2PUXB 2OBOA 5L2YH 1DDJA 4UE7H 4TWYA 1GJ8B 1GHBF 2XNIA 2TRMA 4B75A 4O3UA 4DT7B 1DLEA 1O2ZA 4A1XA 1C9TA 1LQDB 1O2SA 1O34A 5EQRA 3SHAH 5C67A 4OS6A 1BMAA 4MLFB 2PTNA 1BA8B 1S6HA 2BYAX 1QRXA 2SGAA 4DURA 2ASUB 2QXHA 1PQAA 1C5SA 1LQEA 1XUJA 2CJIA 1L1JA 3RU4D 1K0HA 3GY3A 1W13U 3FFGA 3ZZ6A 1H8HD 1HRTH 2VVCA 1AKSB 1EX3A 1T8LA 2YNAA 3PLBA 1TPOA 3LC5A 1GJ5H 3V7TA 3SZEA 3S69A 7ESTE 3DSPA 2GV6A 1AMHA 1O3KA 3P8NA 5F8ZA 3AAVA 4XBCA 1NFUA 1MTNC 1ETSH 4ABDA 3QGNB 4A1VA 4RKOB 1TPPA 1FJSA 5AFZH 1O5AB 3AASA 1WAYB 5F03A 4UFEH 1BTXA 1Y5BT 2F43B 4X2WA 1OPHB 2P8OB 2Z9LA 2R9PA 4UD9H 5T6DA 3ZZ9A 2F91A 2GTBA 3E90B 1HAGE 1PQ5A 2B7DH 1D6WA 1KTSB 4E7NA 2ODYB 1UMAH 1TAWA 2G81E 4BAHB 1H8DH 3M37A 1TNHA 3RU4E 1C1UH 1OWEA 2BZAA 4ZMAH 2BDYA 4RT1A 5JYIA 4NA7A 1QJ1B 1ELVA 2LNCA 1HAZB 5KECA 1NY22 2O8LA 5JDUB 2ESTE 3RXCA 2A32A 3MU8A 2ZU5A 1B7XB 2FPZA 2H2ZA 3FP7E 3VFEA 3TPIZ 4NIWA 4DY7B 2Q6DA 4CH2B 1OOKB 1XX9A 3GOVB 3SGAE 1WUNH 1IQEA 2NWNA 4AORA 3E91A 2FOCA 3RXVA 1GI5A 1GJ6A 2FDAA 4GAWA 2J34A 5GJ4B 1C1PA 1UVOA 3ZVEA 3PLKA 1OP0A 5DJ7A 2BXUH 2SGFE 2H5DA 1O38A 3LGUA 1SQAA 1QGFA 4O97A 1F5LA 5A09A 3VEQB 1K1LA 1SBWA 4PROA 1ZHPA 3G01A 1DE7H 1FZZA 3PMAB 1GI3A 1YLNA 1O36A 1TNJA 2GP9B 3M3SA 4AN7A 1GI4A 1SLVB 3QLPH 2UUYA 2EI7A 2V3MA 3V0XA 1CU1A 3RXUA 3P92A 3TNTA 1TGNA 2PP6A 4WMDA 1ANEA 4Y79A 1O5FH 1YGCH 2WV4A 2SNWA 4IN2A 2VB0A 4MQAA 1CQQA 3QGJA 3SNAA 2BQWB 1AIXH 5E2OA 4ABBA 4FU9A 1EXFA 5PTPA 2GCHG 1EPTA 2OLGA 3BTFE 1NESE 4JYUH 2KAIB 3EGKH 1FAKH 2VH6A 3VB4A 2VIPA 1BRUP 1O3AA 1UW7A 1Q2WA 1ZOMA 4GUXA 1GGDB 1O3GA 2C8WB 1K1NA 2NU1E 3ZIAD 5FAHA 4I8KA 3QX5H 4NIXA 3RXAA 1C5WB 2WPLS 1O33A 1O37A 2VWNA 1BRAA 3B9FH 3GCHC 5I46H 2WYGA 4CRFA 1FPHH 1E1QD 3U9AH 4XBBA 2KX4A 2QXIA 1GGDC 2ZPRA 5EG4A 2A4QA 2Y7XA 4A5TS 2A4GA 1C2DA 5B6LA 4K1SA 1RXPA 1C5RA 3DHKH 4TSFD 2WINI 1OKXA 2ZQ2A 3PM3A 3RC6A 4ACAA 1BTWA 2UWPA 4D9QA 5DN6D 3Q77A 3S9BA 1LVBA 4M9FA 4MNWA 2ODPA 3IWMA 3K2UA 4JZEH 4ZHMU 2PSYA 4UFDH 4AB9A 2ZG0H 1T4VH 1G2MA 2P93A 1O3DA 4MG3A 3UQOA 1F5KU 3VXFH 3RXHA 1LCYA 2CF8H 1L2EA 4ZCNA 5FX6A 3CS0A 1GJBB 1EZXC 3P8OA 1P12E 1NRSH 2ZA5A 3CS7A 1DY8A 1GDQA 4Q7ZA 2GD4B 3UB0A 5ETXA 3ZZDA 4SGAE 3RXMA 1RTFB 2ZHQH 5JBBS 2G4UA 2JETB 2KCYA 5J4QA 1VCWA 3RMOH 2L6OA 4I33A 1GBMA 4B2AA 3RXSA 1SMFE 1BITA 1F0UA 1YLDA 1HPGA 2AHME 1JOUB 1IHSH 1C5PA 4OGYA 1AKSA 3BN9A 1AI8H 1A5HA 2L74A 2OD3B 2XW9A 1GMDG 3PV2A 2V7QD 5CHAC 1BMLA 5C1XA 1A2CH 3ZZ8A 1GHBG 4MVNA 1A0JA 3QK1A 1N6XA 1O5CB 1QTFA 2F4LA 4INLA 1YPLH 1Q31A 2AIQA 4CR5A 4ABFA 1HB0B 4Z6AH 4GHQA 1DVAH 5EIYA 5BRRE 3RXBA 3SV7A 2W5EA 2ZKSA 3T29A 1TNGA 2ZF0H 3I78A 1AE8H 1SGFA 3KQDA 4I32A 1EAWA 5HM2A 1VCPA 1GI9B 3HK6B 4E05H 2HRVA 3ZV9A 5C1UA 2P3FH 1LO6A 1HAIH 1K1OA 3SU3A 1UTPA 3A81A 1S6FA 4ZHAA 1EUFA 1TNIA 3DFJA 1VITH 4TPYA 2P8OC 1G37A 1MCVA 2TGDA 1NS3A 1SVPA 2AGGX 4MPVA 2CK3D 3ESTA 3SU5A 3BG4B 2G51A 1P2IA 2ANYA 5DP8A 3TVJB 4WF8A 5C17A 4BXWA 1KDQA 2FS9A 3RC4A 2YOLA 1HYLA 3MU4A 3P8FA 1H9IE 1UTQA 3A89A 1CO7E 1G2LA 2IOTA 2QA9E 4ZXYH 1KXAA 1AB9C 2WPIS 3W1EA 1O2OA 1GI8B 1O2UA 5FX5A 2VVVA 1MAXA 2QN5T 1O31A 2B0FA 3NPSA 1PQ7A 4DCDA 3OAAD 1G3CA 2M2AA 2Z3EA 1DUAA 3F2GA 1SOTA 6GCHF 2G8TA 1Y8TA 1AFEH 5T6FA 1OX1A 4ABAA 4B1TA 1J15A 3UPEA 2JJ2D 3F3BA 2VH0A 1OWHA 1UJ1A 1HLTH 1N8OB 3BTQE 2VJ1A 1EFRD 3FANA 1QL7A 1HAPH 1P2NA 3EA8A 1SGDE 2RCEA 4Y7BA 5JBCS 4FXGH 3OFND 2J92A 1GHWH 1ZHRA 1GI2A 3SU1A 2GT8A 4FUGA 5HYOA 1WOFA 2XNDD 1O3EA 1MZAA 1TFXA 2ILNA 2OTVA 3U1JB 1OSSA 2GZ9A 1S5SA 3GYMA 3UR6A 3SV9A 2Y80A 1V2PT 4ZKNU 1GMHG 1C5QA 2P16A 2PKAB 4I8GA 3WWBA 5A8XA 3GCOA 1L4ZA 1P0SH 3ZZBA 4D9RA 3RLYH 1P9UA 2V3OH 1QIXB 1GCDA 3OEED 1KXEA 1MBMA 3HGNA 2THFB 4MPXA 2QC2A 3TK6A 2G5NA 2QAAA 1LVYA 3H5CB 2BDIA 3SNEA 4TPIZ 5EW1H 1ZTLA 2BXTH 1C2LA 4IC5A 4NIVA 1RJXB 1C5VA 1AN1E 5A0AE 4IC6A 1GBKA 2WPJS 1TNLA 3QDZB 5GCHF 2Y5GA 2WPKS 3C27B 1ZR0A 3V13A 2ZQ1A 1V2VT 4A1TA 2R0KA 2TPIZ 4M7GA 2HPQH 2PWXA 2Z9IA 2PUQH 2TBSA 2F9PA 1ELTA 1F2SE 1NZQH 1W0JD 3MWIU 4MPWA 3TJOA 2NU4E 2A31A 3E0PB 3VXEH 3N7DA 1FV9A 1BRBE 4H4FA 1SGCA 3SV8A 2D2DA 1KY9A 3BTEE 3CNRA 1DFPA 3KN2A 5LPEA 1MD8A 2HLDD 1P06A 1C2IA 2WPDD 1JMOH 1C5UA 4B6EA 1MABB 1KSNA 4U01A 1BBRE 1H1BA 2PKSB 1WBGB 3RXKA 3F2FA 1CA8B 4JCNA 1EOLA 2FTLE 3RXOA 1H8ED 3PO1C 3KNXA 4MPUA 1XMNB 1PPGE 1QQ4A 1BBRH 1W0YH 2IN2A 1IQKA 1O3FA 2VWMA 1CHOF 5CE1A 2HOBA 3KQEA 4NIYA 1SFIA 2ZP0H 4X6NA 3RDZA 1LHCH 1C9PA 2BMGB 1OS8A 2Q1JA 3FN8A 3SQHE 1UTJA 4DIIH 1BTPA 1O3BA 4KTSA 2BDCA 3PYHA 2YNBA 4NWLA 1RD3B 2XWAA 4AB8A 3AK5A 2SFAA 2Z94A 4Q63A 5G4BA 1JXPA 1HJAC 5SGAE 1O3NA 1FUJA 1YM0A 1O5EH 3SV2H 3F9EA 2AGIX 4BTTB 2SGEE 3LGVA 4IW4E 1ZJDA 1UK2A 2WHXA 1E0FD 1SC8U 4ABGA 2HGTH 5C0TA 2FOGA 1H9HE 2VIQA 1GI1A 1EZQA 3U69H 4OS5A 2HPPH 2RA3A 3L33A 3MTYA 2DE9A 1G32B 3GCNA 5C5OA 2M5TA 1SKYE 1ESBA 3A7YA 3RLWH 1TNKA 1QL9A 1ZTKA 1TGTA 3ATIA 1SI5H 1O3HA 2H9TH 1JRSA 2VIVA 1O2WA 1W14U 3KHVA 3A82A 8ESTE 1BDAA 3M5OA 2K1QA 3FP6E 1KXBA 1ABJH 3RMLH 3SU4A 1TX8A 2O8MA 1LPKB 1P3CA 1GJ9B 1QB1A 4CBOA 1SGFG 2FOFA 4AFQA 2ZU1A 1HFDA 1P2KA 2FIRH 5DP6A 4DVAU 4X8UH 1JBUH 3LKWA 1C5OH 2PFEA 3UFAA 1WQVH 1TYNA 1F0RA 1DLKB 4WH6A 2F9UA 3KYFA 3SORA 3T25A 2R2MB 1ELBA 1QJ7B 5C94A 2ODQA 1A5GH 3GY6A 1P2OA 2FXRA 1GBLA 4YTAA 4LOYH 1D3PB 1RRKA 2O8UA 4OS7A 2PHBA 4WJG2 4NFFA 3S0NA 1ZRBA 5E0JA 2OINA 1EAUA 2QF3A 4FUFA 3M5MA 1EZUC 3SO3A 3SQEE 2FM2A 1QCPA 2C4FH 1P11E 4JYVH 2IJOB 2CN0H 3MNBA 1AB9B 4AX9H 4YLQH 1O5GH 3P17H 5FCKA 3U8OH 1E35B 2J4IA 5CHAB 3V3MA 4FETA 1PQ8A 3HK3B 2BOKA 1YPMH 2HALA 4F55A 2FWWA 1A0HB 1E79D 4ZXXH 2XYAA 4WMFA 1B0FA 1ELCA 4K8YA 1UK3A 2A7JA 1WXRA 5F8XA 1GHAG 4B71A 5C20A 2QYIA 2ZECA 2KCPA 1NPMA 8GCHG 1Z8JB 2WUBA 1TONA 5DKMA 3SJOA 3LGYA 1ZSJA 1Z71A 3U28C 4HZHA 1TMTH 4ISHH 1HNEE 2O9QA 4RKJB 2OC0A 3OTJE 1Y3VA 3GS9A 1CHGA 1B5GH 1YPGH 2Y7ZA 3GCTG 4XFQA 2Y6TA 1C2EA 3GY7A 2RFKC 5C1YA 2XCNA 1OWIA 2CMYA 3SJ8A 4IS5A 3RM0H 1GHVH 1MTWA 4IMQA 3FOAA 4HI3A 4Q2KA 1E36B 1A4WH 3FP8E 4UDWH 2QF5A 1E34B 2F9BH 4UEHH 1YF4A 1ZRKA 3SUFA 3KYGA 2ZDNA 2XC4A 1UVTH 4CREA 2BD3A 1QBNA 4ABHA 4Z0KA 1NN6A 1TQ7B 2GGVB 3D23A 4YOIA 5CMXH 3SW2B 2F9VA 4Q7YA 1FXYA 1SLUB 1OYQA 3SJ9A 1RFNA 3M35A 1ID5H 2RDLA 4WH8A 2JDID 5HGGA 1GG6B 1GMDF 1MKWH 1V2UT 3M61U 1FY5A 4XE4A 5EXMA 2EQNA 2R3UA 2ZGBH 4ABIA 3GDSA 2TGPZ 3RP2A 1GBIA 2OCVB 4YT7H 1EB2A 1BJVA 5K7RA 3QWCH 2B5TB 4ASUD 5KGOA 4BANB 1T4UH 4INHA 1AVGH 3E16B 1GG6C 3UR9A 4BAMB 3E8LA 3H7OA 1C2HA 4JK5A 4X1PU 3SHCH 3QUMP 3UWJH 5EPYA 1ETRH 3GYLB 4X6OA 1FNIA 3P6ZB 1G30B 4RSPA 1H9LB 3VB6A 1TE0A 3M7UA 3ATKA 3FKSD 2BD9A 1YPHE 3L6PA 1KMHB 2LP6A 1V2KT 3SUGA 1H8IH 1KXFA 4F49A 2UWLA 3BTWE 5FBIA 3SJIA 2FOBA 3N7OA 3AVZA 1TB6H 4Y8XA 4DG4A 1FONA 4X2XA 1CE5A 3RXQA 1YPJH 4XBDA 2SGQE 2GDDA 2FODA 2BB4A 2KCOA 2R2WU 3RXPA 2QF0A 3JZ2B 2K0QA 3D65E 2ZTYA 1TLDA 2GV7A 4O3TA 4KTCA 1BHXF 1LVOA 1C1VH 1PPFE 3M5NA 3GDVA 1ANBA 3Q3XA 4FUBA 2HNTE 4INKA 2A7HA 3U1IB 4I8LA 1VCQA 1QZ8A 5C2ZA 1P8VC 2LPRA 8LPRA 1TGSZ 1HV7A 2QE7D 4K3JA 1Y3WA 4ISNA 3RMNH 1NBMD 4MNYA 4NGAH 1V2JT 1W10U 3MO9A 1J17T 1ELAA 2GMTB 3TGJE 3GY2A 2BZ6H 3IITA 3EDXB 1HXFH 1V2WT 3V12A 1HAVA 1GCTB 3BG4C 1QNJA 2I6SA 1P03A 3SYJA 3NKKA 1AUTC 4IN1A 2F3CE 3PTBA 2AEIH 4JK6A 3K6ZA 4ZAEA 2W6JD 1D6RA 1HAXB 3MNCA 1NT1A 1UK4A 1K2I1 1V3XA 5DP7A 3LONA 3RXJA 1O2HA 3BTHE 4X2YA 3VGCB 1T8MA 2BLOA 3UAIC 3ZVDA 3WY8A 5GIBA 2A4RA 4BNRA 1TBZH 3M7TA 4I31A 2JETC 2FI3E 1UTNA 1FLEE 2J98A 3TITA 3RC5A 1MUEB 3SNBA 3UY9A 1O2LA 5JB9S 1H4WA 3ZVCA 1SHHB 2FYRA 3PB1E 1HDTH 3DA9B 1TRNA 1K21H 1SGNE 4Y0ZE 1VR1H 1AU8A 2WPHS 1P2QA 4Y7AA 3MOCA 1ZHMA 1BOQA 3EQ0H 2ZFPH 3DSOA 5L30H 1ETTH 3TLOA 6GCHG 1BB0B 3OX7U 5HXFA 2ZDAH 1V2TT 4YT6H 4ISLA 2AMDA 1VGCC 4A6LA 2P95A 4LK4A 2Y81A 3BG8A 2VWLA 2P94A 2STBE 4ABEA 1QHRB 5DGJA 1DPOA 5FBEA 2ZNKH 1ZZZA 2AH4X 4AYVB 4CHAC 2XTTB 3UTUH 1U6QA 1O30A 3BEIB 3HKJB 1O3CA 1VGCB 5DG6A 3URDA 1BTUA 1BHXB 1XKBC 1WDIA 1AVXA 1Z8RA 1MTSA 3I29A 1NRNH 1KDQB 1JIMA 4YLUA 4D76A 1LVMA 2CHAC 1F7ZA 1SSXA 1V2LT 2W3KA 3A8AA 5EGMA 5ESTE 2ZCLP 4XDEA 1QL8A 2A5IA 2HNTC 2HVXA 4GLYA 1O3JA 1THPB 1NRQH 1AZZA 1HCGA 1GBJA 5EU8A 3BTTE 3TH2H 3BSQA 1E1RD 1C1WH 3R3GB 3Q3KA 5B6OA 4FUEA 1G36A 2J9NA 1C5NH 2J98B 1SGQE 1XXDA 3SNDA 1AFQB 3PRDA 5C3NA 4I8HA 1D4PB 1K1MA 2FO9A 3F9HA 3LPRA 1A1RA 2JIZD 1DT2A 1KXCA 2ZGXH 3UUZA 4X1RU 5HM9A 3QO6A 1QRWA 3NXPA 1T31A 4U2WA 1NU7B 1WTHD 1HAOH 3FO8D 1TABE 2UUJB 4D7GA 3OSYA 2P3TB 2ZFRH 2QY0B 3A7VA 1CGHA 1Z1IA 4X8SH 1BTHH 4Z1MD 1ABIH 4ZH8A 1UHBA 3DUXH 4X0WU 3FZZA 3UOPA 1ZGVA 1ANDA 4YESB 1INCA 3TGKE 2HVYB 5BPEA 2BDGA 3QZQA 2ZCHP 4O9VA 5GDSH 1FDPA 2QCYA 3NUMA 3M3VA 1WV7H 2WV9A 1LMWB 1SLWB 1ZGIA 2ZHWH 3F0OA 4JZDH 4E06H 3MH5A 1P2MA 4B6FA 4XOJA 3EA9A 3VG8A 2WSSD 3KQCA 4WXVA 5FHTA 3TJNA 1SQRA 1W8BH 3N99A 3LH1A 1GJ7B 1KXDA 5GPIB 1GJAB 1SGPE 4CRCA 2VGCB 4FVDA 2D26C 1ZPZA 3RUOA 1FY4A 1FQ3A 2QF4A 2AYWA 1GJDB 5A0CA 1GHYH 3B23B 2B9LA 2IJD1 3MNXA 5FL7D 6CHAC 2OQ5A 4HG6A 3F9FA 2C8ZB 4AOQA 2ZWLH 3NRLA 1EJAA 1UCYK 2GZ7A 3VB3A 5DO4H 7KMEH 1XVMA 1AD8H 2SGDE 1J14A 1NC6A 1NO9H 2A5KA 5EQSA 1W12U 2KFWA 1DSUA 2AMQA 1LHEH 5HIZA 1SQTA 2BD4A 3ZZCA 2D8WA 1LHFH 1ZLRA 3A7TA 3SOSA 3A88A 4BTIB 3HGPA 3TK9A 2ZU2A 1AFQC 3S7HB 4P02A 4NSVA 1GBBA 3MMGA 2J2UA 4J1YA 1UTLM 2VIDA 2B8OH 3O8BA 4FUCA 1P57B 1EB1H 1TBRH 5EXNA 3LGWA 5HKKD 1Z8GA 2BVRH 3RXRA 4WVPE 1O32A 2ZDMA 3HKIB 4DJZB 1O3MA 2STAE 5L6NH 1G3DA 1L1NA 3Q76A 1TX7A 2AERH 2BTCE 2NU0E 2OC8A 1FI8A 1SL3A 3AW0A 1TQ0B 4IBLH 1MKXH 5TCAA 2FOMB 1XUIA 4JZFH 5IYTA 1D3TB 4WY3A 1ZMLA 1CBWB 5J4SA 2FLRH 1QR3E 4H6TA 5T1VA 4QT8C 4Q7XA 4LZ1H 1ZPBA 3RMMH 1SGEE 4X1QU 1C5LH 3GY8A 2ZGCA 3OEHD 1EP5A 1RTKA 3QZRA 3TJUA 1SOZA 3LDXH 1O2PA 1RS0A 4YOGA 1MTUA 4I7YH 2OUAA 3C1KA 5E8EH 1RTLA 3GICB 1P10A 1BRCE 1LHGH 2TIOA 2J94A 1XKAC 2BOHB 1YCPK 4XRNA 1PPHE 1BCUH 3MH6A 2ALPA 8GCHF 1DWBH 3UNRA 2R0LA 4JZ1A 1NBME 3U98H 1WSSH 1RIWC 3SU6A 2ZDLA 1NU9A 3LC3A 3SU0A 4B76A 1BZXE 2ZHFH 2J97A 5DP3A 3PWCA 2V3HH 3ODFA 5FCRA 2GT7A 1OP2A 2Z6BD 3Q3YA 3E3TA 2OK5A 5JBAS 1AZ8A 3MH4A 1EAIA 1CT2E 2KZ4A 1EJNA 1THSH 3EE0B 2Q6GA 2W26A 3W95A 2GZ8A 1HJAB 1W7GH 3PRBA 4P00A 1OYTH 3PMHB 1QBOA 1MU6B 1YP9A 1GHXH 4UFFH 1YCPM 1O2TA 2BLVA 1O0DH 1L4DA 5LPFA 1HUTH 2FI4E 1O2QA 4NFEA 2ZGJA 6ESTA 3VGCC 1SLXB 1O2MA 1QJ6B 1FY3A 1GMCG 2ZTXA 1C5TA 3LIWA 3MYWA 2SGPE 3RXDA 2W6ID 1YBWA 3VB7A 1BBRK 2FS8A 1DY9A 1C1QA 4NCYA 1S6LA 1BTYA 1UTOA 3ATLA 2VIOA 3RXEA 1UTMA 2FX6A 3ZZAA 2VVUA 2AIPA 2YMSB 3KL6A 2Z9GA 1VJ9U 4Y8YA 3A7ZA 3AAUA 4ZKRU 5A8YA 4CRAA 1WQSA 5AF9H 1GBDA 1ELEE 2AS9A 2ZFSA 2GKVE 2ZGHA 1QA7A 2A5AA 1QURH 4I8JA 8KME2 2GCTB 2BQ7B 4AYYB 4BXSA 3BTME 4FOUC 3UNSA 1C5ZB 3LU9B 2P59A 3QTVH 1HIAB 5AHGH 4ZUHA 1BMFD 4RI0A 2GCHF 4K1TA 1ESTA 2H9HA 1AWHB 1JIRA 2Z3CA 5EJLA 3SBKA 1GBTA 2PTCE 2BD2A 3A84A 5FXLA 1BMMH 4ISIH 1FIWA 1O35A 4IGDA 1LPZB 2O8TA 1YYY1 1XUGA 4BAQB 3ENSB 2BD8A 1EASA 1HBTH 2LELA 1OWKA 2Z9KA 3UNQA 1ZPCA 2UUFB 5FPYA 4X1SU 3ZYEA 4MNXA 4FU8A 4O03A 1ZTJA 4ZKOU 4CHAB 1A0LA 3ZVGA 5FPSA 1C4V2 5EXLA 3VB5A 1DWEH 3EAJA 1XUHA 3GY5A 4AGJA 1Z6EA 2K8IA 1DSTA 4MTBA 1CHOG 5ABWA 2G00A 1IQHA 1WTGH 2BD5A 2XRCA 2G5VA 5DPAA 1CVWH 2ANMH 3E6PH 1S0RA 3KIDU 1IQJA 2FOHA 4CBNA 1O2NA 4CH8B 2A4OA 1P01A 3DT0H 4VGCC 2ZTZA 1GJCB 1N1LA 4NZQA 7GCHF 1MQ5A 1UVPA 1YPKH 1IOEA 2VGCC 5EJZA 1AY6H 1ELDE 5T6GA 1Z6JH 5F8TA 4FUDA 3TNSA 1O5DH 4HFPB 3GCHB 2A1DB 4KKDA 3E1XB 3SUDA 3T27A 1L1GA 1TX6A 1TOMH 2V6NA 1F0TA 2VBCA 1FIZA 3M5LA 5EW2H 3RXLA 1C1SA 1IQLA 4JMYA 1TA2A 3ZZ5A 3F2HA 1F0SA 1HGTH 3DFLA 3OU0A 3DD2H 3NZIA 3O8DA 3VPKA 1TALA 2ZZUH 1JWTA 4B74A 1PYTD 2C8YB 1EZSC 4KP0A 1NROH 1A5IA 1C1RA 1TGCA 1MQ6A 1NRRH 1GPZA 1TMBH 3PLPA 3TJVA 1PPZA 1N6YA 3K65B 1TOCB 2EC9H 1THRH 5JB8S 3EYDA 3A7XA 1PFXC 1FY8E 1P05A 1CA0B 4RT0A 1C1MA 3A86A 1HAHH 1NFXA 2BD7A 3QN7A 1PPEE 3M7QA 5EPNA 1XVOA 3A7WA 1FX0B 3NCLA 1MCTA 1V2NT 3A83A 2Z9JA 2YMSD 4GCHF 2XC0A 1YC0A 1O2KA 1DITH 3F6UH 5JPMH 2GJGA 1K22H 1CA0C 3EE7A 1E37B 5T3HA 1CGIE 3BIUH 1TPAE 2F9OA 1PYTC 4ASHA 1O39A 4Y71A 3T28A 1BUIA 1S85A 1UCYE 2QIQA 4OGXA 2W7SA 3T5FH 1K9OE 2OXSA 1OXGA 1S84A 1D9IA 4KGAA 1GHAF 1UHBB 1AVWA 4H42U 1DOJA 1WYKA 1W3CA 2XBXA 1V2RT 3T2NA 4A7IB 4ESTE 4WWYA 1MZDA 2JKHA 1D3QB 2BDAA 5LGOA 3SI4H 3SZNA 1SHYA 1C1OA 1SGYE 1YPEH 1GDUA 2ZPSA 2C8XB 1GBAA 3BTKE 6LPRA 2BHGA 1NFWA 1BJUA 2Y5HA 3H7TA 1KLJH 4UFGH 2FTMA 4R0IA 1S83A 2TGTA 4OS2A 3A80A 1GDNA 1FN6A 2D1JA 4GCHG 4TYDA 1FPCH 2H6MA 1TA6A 2CV3A 1T8OA 1HJ9A 1O2YA 2BX4A 1PPBH 1C4U2 1LKBA 1W2KH 1D3DB 1G3EA 1G9IE 5EJ1A 1IQNA 4YOJA 1QY6A 1LTOA 2BVSH 1XUFA 5EODA 3SU2A 5H4IB 1AO5A 2UUKB 3TGIE 2ALVA 1HAYB 2VWOA 4AFZA 4ACBA 3SN8A 1FMGA 4TY6A 2A2QH 1EATA 2QXGA 1EPTC 3GCTF 2QV1A 4Q80A 3NWUA 1O3IA 1TBQH 2BDBA 1MH0A 1SGRE 4Y0YE 2ANKH 4TY7A
chains in the Genus database with same CATH topology
5LPRA 1DWCH 1P02A 1C4Y2 2VU8E 2ZEBA 1WCZA 4BTUB 3ZV8A 1GMCF 2BLQA 2C93B 2PKAA 3U8RH 1EPTB 1ZJKA 3PMJA 3STIA 1ZMJA 2FZZA 1IQGA 3ATMA 4Y76A 2QGRA 4NZLA 1LHDH 1GBEA 2BM2A 2NU2E 4HGCA 4BOHA 1Z1JA 2GCTC 2EEKA 3SGBE 4Y6DA 4JZIA 1BIOA 2BX3A 1TGBA 2OP9A 1A46H 3FVFB 3S9CA 1TPSA 2ZHEH 2J38A 1ELGA 3PV5A 1LPGB 2OC1A 1ELFA 4YXWD 2ANWA 4U32A 1FN8A 2AMPA 2XC5A 1O2GH 3A85A 3T62A 3RXGA 1NRPH 2G4TA 2FP7B 1GJ4H 3BTDE 2ZC9H 3A8BA 2PLXA 3OY5U 1UO6A 2WYJA 3MO3A 3SNCA 1K1JA 1NTPA 3SUEA 1DWDH 1OP8A 3SI3H 1EP6A 1P9SA 4ABJA 5EOKA 5LH8A 4VGCB 1C5YB 3CP7A 3DCLA 2XCFA 4DT4A 1AE5A 4LXBH 2C3SA 2F9NA 5AFYH 3FAOA 4AFSA 2OBQA 1MTNB 5GNDA 4K1EA 4X8VH 1ARCA 2ZFTA 3O8RA 1XXFA 1ZSKA 2GMTC 5K0HA 3RM2H 3STJA 1O3PB 2BVXH 1B0EA 2V35A 3UWIA 2ZFQH 1QB6A 3ATWA 5A2MH 2FX4A 1EAXA 2P3UB 3TIUA 4WMEA 2BY6X 4X1NU 1MKWK 1DXWA 3SGQE 1Y59T 3K6YA 4KELA 1S82A 1SFQB 2DUCA 1GL0E 7GCHG 3URCA 1VJAU 2ZI2H 2AGEX 4Y10E 3RXTA 1BTZA 2BY7X 2C90B 4AG1A 1Q3XA 1DICA 2GDEH 4BAKB 5CHBA 1SR5C 1T7CA 1ZSLA 4MNVA 3LH3A 2PW8H 3A8CA 2FESH 2XWBI 2ZDKA 3P95A 2PGQB 5DP9A 1KIGH 1TRMA 4Y8ZA 4DOQA 1BT7A 5JBTA 4B2CA 2VNTA 4Q4LA 2RG3A 1IQFA 4DIHH 1O3LA 1C2KA 2Y5FA 3LGTA 1XUKA 1QQUA 2JH5D 3HATH 1YLCA 4RN6A 3GISB 2VIWA 1AHTH 1NFYA 4F4OC 2KAIA 5C0UA 1Y5UT 4B73A 1ARBA 4YM9A 1GVZA 3B8JA 4BAOB 1AQ7A 1P09A 1V2MT 1VITF 4OS4A 2CXVA 4K5ZA 2CHAB 4D7FA 1EOJA 1J9CH 2VINA 4AFUA 2JH6D 1CSOE 1QA0A 1Z7KA 1KYNA 2TGAA 1K1PA 2ZU4A 4U30A 1LKAA 2H9EH 1GBFA 2BY9X 1HAVB 2A7CA 2J95A 3I77A 4R8TB 1UCYH 3OY6U 2JJ1D 3GY4A 4HTCH 1O2RA 3ZZ4A 7LPRA 2WV5A 2OC7A 1EQ9A 1O2IA 1O2XA 2W7UA 1T8NA 3F68H 1GI7B 3PROA 4NG9H 2KM0A 1DXPA 1EKBB 1GI0A 2BQ6B 2FI5E 3MH7A 5DK1A 1P04A 4XD7D 2WUCA 3BEFB 5L2ZH 3F0PA 5F6MA 2QXJA 3WW7A 1SGIB 2RA0A 1W11U 2ZDVH 4GVUA 4YO9A 3ZVFA 1OHHD 1W7XH 4FUHA 2O8WA 1IQMA 1DM4B 1M9UA 3ZZ7A 2KCAA 2OQUA 1WU1A 4XSKU 1KTTB 3O8CA 4X2VA 3ZYDA 3LJOA 2HLCA 2ZHDA 3FZDA 2PKSC 1GHZA 1MMJN 2SNVA 1TIOA 3BIVH 3KF2A 1V6DA 5C5NA 1SQOA 3KGPA 4DW2U 1C2JA 1MAYA 1GVKB 1Y3UA 4AZ2B 1C2MA 4J2YB 3UREA 1A61H 2FLBH 3UIRA 2XBYA 3OTPA 1BMNH 2Y82A 4AG2A 3ZVBA 1C1TA 1DUEA 2G55A 3SJKA 1ZYOA 4OM9A 1A3EH 3P70B 1PJPA 2FMJA 1JRTA 3BTGE 5CDFE 3MHWU 2BY5X 1C1NA 1C2GA 4CR9A 3S9AA 2R3YA 2J5UA 1SPJA 5F53A 3M36A 3WWFA 2G52A 1C5XB 1GI6A 2A45B 2FOEA 2ZPQA 1BQYA 3MFJA 3AW1A 3R0FA 5E0GA 5IK2D 4YZUA 1TWXB 1CGJE 3PMBB 1YCPH 1KLTA 1ANCA 1F92A 3BF6H 3P8GA 1N8OC 3EA7A 1X7AC 2BLWA 4X6MA 2ZCKP 4DGJA 2XOKD 4MDSA 4H6SB 4LZ4B 2GX4A 2Q6FA 5E0HA 3PTNA 2WPMS 2ZIQH 2WZQA 1V2QT 3LOXA 6CHAB 2Z3DA 1MD7A 1AWFH 4FUJA 1V2OT 1IAUA 2FYQA 1RIWB 4JYTA 1DS2E 3LGIA 4TT3D 1P2JA 3CENA 4IMZA 1IHTH 1G3BA 4FVBA 2CGAA 4SGBE 1A3BH 1C2FA 1ORFA 4X8TH 2EI6A 2H1UA 3LT3A 3PO1B 3ITIA 4K69A 2A0QB 3PV4A 2W3IA 1MTVA 1O2JA 2JH0D 1O3OA 3HPTB 1AUJA 1Z8IB 1GMHF 3A87A 1FY1A 2I6QA 1CBWC 1GCTC 3ZVAA 3L3TA 3ODDA 1SG8B 3A8DA 1ESAA 2V0BA 2ULLA 3D49H 3TK5A 3UOUA 5DP5A 1F5RA 3BV9B 9ESTA 4ZHLU 3KQBA 4K60A 1A7SA 1SGTA 5TCCA 4UONA 3ZZ3A 1HJ8A 1MBQA 1CT4E 5I25A 5IDKA 4OS1A 3NK8A 1RGQA 2YMSC 3BEUA 1QB9A 1YKTA 4KTUA 1QBVH 2NU3E 1E38B 4NA9H 1GL1A 2FEQH 1UVUH 2FOAA 3S7KB 4ZROA 1Y3XA 5GXPA 4CRBA 4NA8A 1UVSH 5DSFA 3W94A 3SV6A 1O2VA 2PGBB 3RU4T 3F9GA 1J8AA 3MU0A 1ZMNA 3E0NB 3U8TH 4CRGA 1O5BB 1P3EA 1TMUH 4K2YA 4Y11E 1LDTT 1FAXA 3QTOH 1QRZA 2Z7FE 2PV9B 1VITG 2ZO3H 3H09A 3ELAH 2GVFA 3RXIA 1T32A 1DX5M 5TJXA 1DANH 3LJJA 1NM6A 4E7RG 1XM1A 5E2PA 1IQIA 2HWLB 5GCHG 3IG6B 1K28D 2F83A 2BY8X 1OWJA 1J16A 3JZ1B 2UWOA 1GWAA 1S81A 4FU7A 5EQQA 5A8ZA 2IPHA 5ESBA 1K1IA 1AGJA 3RXFA 2EI8A 1GBCA 3TU7H 2AFQB 4A92A 1GVLA 4AGKA 9LPRA 3F1SB 3TH3H 3Q00A 1V2ST 4NSYA 2H5CA 1W0ZU 2EA3A 3TH4H 1PPCE 2HNTF 2DE8A 2PR3A 4CRDA 3N7EA 5FPTA 1HIAA 1GBHA 3GDUA 3PWBA 2XBWA 3KEEA 4ZKSU 5GWZA 1QFKH 3MU1A 1HXEH 3MU5A 5AVDA 1OWDA 4THNH 3K9XB 1SB1H 3OE7D 1EJMA 1UTKA 5HMAA 4B2BA 2XBVA 1KLIH 4NWKA 1TRYA 3MO6A 1YPHC 4ISOA 3T26A 1MKXK 4K8BA 3UQVA 4GHTA 1COWD 2ZFFH 2KR7A 1Y3YA 2ZU3A 2CF9H 4FUIA 4D8NA 3MNSA 1W0KD 1VZQH 2PSXA 2BDHA 1S0QA 1ACBE 2XXLA 1CT0E 2A2XH 3OYPA 4WXIA 3D62A 5A0BA 1MU8B 3M3TA 4TWWA 4GSOA 1Y5AT 1C5MD 3MI4A 5DP4A 4GPGA 4X6PA 1L0ZA 3KCGH 2PUXB 2OBOA 5L2YH 1DDJA 4UE7H 4TWYA 1GJ8B 1GHBF 2XNIA 2TRMA 4B75A 4O3UA 4DT7B 1DLEA 1O2ZA 4A1XA 1C9TA 1LQDB 1O2SA 1O34A 5EQRA 3SHAH 5C67A 4OS6A 1BMAA 4MLFB 2PTNA 1BA8B 1S6HA 2BYAX 1QRXA 2SGAA 4DURA 2ASUB 2QXHA 1PQAA 1C5SA 1LQEA 1XUJA 2CJIA 1L1JA 3RU4D 3GY3A 1W13U 3FFGA 3ZZ6A 1H8HD 1HRTH 2VVCA 1AKSB 1EX3A 1T8LA 2YNAA 3PLBA 1TPOA 3LC5A 1GJ5H 3V7TA 3SZEA 3S69A 7ESTE 3DSPA 2GV6A 1AMHA 1O3KA 3P8NA 5F8ZA 3AAVA 4XBCA 1NFUA 1MTNC 1ETSH 4ABDA 3QGNB 4A1VA 4RKOB 1TPPA 1FJSA 5AFZH 1O5AB 3AASA 1WAYB 5F03A 4UFEH 1BTXA 1Y5BT 4X2WA 5T6DA 1OPHB 2P8OB 2Z9LA 2R9PA 4UD9H 2F43B 3ZZ9A 2F91A 2GTBA 3E90B 1HAGE 1PQ5A 2B7DH 1D6WA 1KTSB 4E7NA 2ODYB 1UMAH 1TAWA 2G81E 4BAHB 1H8DH 3M37A 1TNHA 3RU4E 1C1UH 1OWEA 2BZAA 4ZMAH 2BDYA 5JYIA 4NA7A 1QJ1B 1ELVA 2LNCA 1HAZB 1NY22 2O8LA 5JDUB 2ESTE 3RXCA 2A32A 3MU8A 2ZU5A 1B7XB 2FPZA 2H2ZA 3FP7E 3VFEA 3TPIZ 4NIWA 4DY7B 2Q6DA 4CH2B 1OOKB 1XX9A 3GOVB 3SGAE 1WUNH 1IQEA 2NWNA 4AORA 3E91A 2FOCA 3RXVA 1GI5A 1GJ6A 2FDAA 4GAWA 2J34A 5GJ4B 1C1PA 1UVOA 3ZVEA 3PLKA 1OP0A 5DJ7A 2BXUH 2SGFE 2H5DA 1O38A 3LGUA 1SQAA 1QGFA 4O97A 1F5LA 5A09A 3VEQB 1K1LA 1SBWA 4PROA 1ZHPA 3G01A 1DE7H 1FZZA 3PMAB 1GI3A 1O36A 1TNJA 2GP9B 3M3SA 4AN7A 1GI4A 1SLVB 3QLPH 2UUYA 2EI7A 3V0XA 1CU1A 3RXUA 3P92A 3TNTA 1TGNA 4WMDA 1ANEA 4Y79A 1O5FH 1YGCH 2WV4A 2SNWA 4IN2A 2VB0A 4MQAA 1CQQA 3QGJA 3SNAA 2BQWB 1AIXH 5E2OA 4ABBA 4FU9A 1EXFA 5PTPA 2GCHG 1EPTA 2OLGA 3BTFE 1NESE 4JYUH 2KAIB 3EGKH 1FAKH 2VH6A 3VB4A 2VIPA 1BRUP 1O3AA 1Q2WA 1ZOMA 4GUXA 1GGDB 1O3GA 2C8WB 1K1NA 2NU1E 3ZIAD 5FAHA 4I8KA 3QX5H 4NIXA 3RXAA 1C5WB 2WPLS 1O33A 1O37A 2VWNA 1BRAA 3B9FH 3GCHC 5I46H 2WYGA 4CRFA 1FPHH 1E1QD 3U9AH 4XBBA 2QXIA 1GGDC 2ZPRA 5EG4A 2A4QA 2Y7XA 4A5TS 2A4GA 1C2DA 5B6LA 4K1SA 1RXPA 1C5RA 3DHKH 4TSFD 2WINI 1OKXA 2ZQ2A 3PM3A 3RC6A 1BTWA 2UWPA 4D9QA 5DN6D 3Q77A 3S9BA 1LVBA 4MNWA 4M9FA 2ODPA 3IWMA 3K2UA 4JZEH 4ZHMU 2PSYA 4UFDH 4AB9A 2ZG0H 1T4VH 1G2MA 2P93A 1O3DA 4MG3A 3UQOA 1F5KU 3VXFH 3RXHA 1LCYA 2CF8H 1L2EA 4ZCNA 5FX6A 3CS0A 1GJBB 1EZXC 3P8OA 1P12E 1NRSH 2ZA5A 3CS7A 1DY8A 1GDQA 4Q7ZA 2GD4B 3UB0A 5ETXA 3ZZDA 4SGAE 3RXMA 1RTFB 2ZHQH 5JBBS 2G4UA 2JETB 5J4QA 2KCYA 1VCWA 3RMOH 4I33A 4B2AA 1GBMA 2L6OA 3RXSA 1SMFE 1BITA 1F0UA 1YLDA 1HPGA 2AHME 1JOUB 1IHSH 1C5PA 4OGYA 1AKSA 3BN9A 1AI8H 1A5HA 2OD3B 2XW9A 1GMDG 3PV2A 2V7QD 5CHAC 1BMLA 5C1XA 1A2CH 3ZZ8A 1GHBG 4MVNA 1A0JA 3QK1A 1N6XA 1O5CB 1QTFA 4INLA 2F4LA 1YPLH 1Q31A 2AIQA 4CR5A 4ABFA 1HB0B 4Z6AH 4GHQA 1DVAH 5BRRE 3RXBA 3SV7A 2W5EA 2ZKSA 3T29A 1TNGA 2ZF0H 3I78A 1AE8H 1SGFA 3KQDA 4I32A 1EAWA 5HM2A 1VCPA 1GI9B 3HK6B 4E05H 2HRVA 3ZV9A 5C1UA 2P3FH 1LO6A 1HAIH 1K1OA 3SU3A 1UTPA 3A81A 1S6FA 4ZHAA 1EUFA 1TNIA 3DFJA 1VITH 4TPYA 2P8OC 1G37A 1MCVA 2TGDA 1NS3A 1SVPA 2AGGX 4MPVA 2CK3D 3ESTA 3SU5A 3BG4B 2G51A 1P2IA 2ANYA 5DP8A 3TVJB 4WF8A 5C17A 4BXWA 1KDQA 2FS9A 3RC4A 2YOLA 1HYLA 3MU4A 3P8FA 1H9IE 1UTQA 3A89A 1CO7E 1G2LA 2IOTA 2QA9E 4ZXYH 1KXAA 1AB9C 2WPIS 3W1EA 1O2OA 1GI8B 1O2UA 5FX5A 2VVVA 1MAXA 2QN5T 1O31A 2B0FA 3NPSA 1PQ7A 4DCDA 3OAAD 1G3CA 2Z3EA 2M2AA 1DUAA 3F2GA 1SOTA 6GCHF 2G8TA 1Y8TA 1AFEH 5T6FA 1OX1A 4ABAA 4B1TA 1J15A 3UPEA 2JJ2D 3F3BA 2VH0A 1OWHA 1UJ1A 1HLTH 1N8OB 3BTQE 2VJ1A 3FANA 1EFRD 1QL7A 1HAPH 1P2NA 3EA8A 1SGDE 2RCEA 4Y7BA 5JBCS 4FXGH 3OFND 2J92A 1GHWH 1ZHRA 1GI2A 3SU1A 2GT8A 4FUGA 5HYOA 1WOFA 2XNDD 1O3EA 1MZAA 1TFXA 2ILNA 2OTVA 3U1JB 1OSSA 2GZ9A 1S5SA 3GYMA 3UR6A 3SV9A 2Y80A 1V2PT 4ZKNU 1GMHG 1C5QA 2P16A 2PKAB 4I8GA 3WWBA 5A8XA 3GCOA 1L4ZA 1P0SH 3ZZBA 4D9RA 3RLYH 1P9UA 2V3OH 1QIXB 1GCDA 3TK6A 1KXEA 1MBMA 3HGNA 2THFB 4MPXA 2QC2A 3OEED 2G5NA 2QAAA 1LVYA 3H5CB 2BDIA 3SNEA 4TPIZ 5EW1H 1ZTLA 2BXTH 1C2LA 4IC5A 4NIVA 1RJXB