1DXPA

Inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE/HELICASE NS3 (P70)
publication title Inhibition of the Hepatitis C Virus Ns3/4A Protease the Crystal Structures of Two Protease-Inhibitor Complexes
pubmed doi rcsb
source organism Hepatitis c virus (isolate taiwan)
molecule tags Hydrolase
total genus 36
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxpA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxpA01
2FOGA 1O3CA 4JYTA 1O3NA 3SUFA 2BD3A 2ESTE 5DP4A 3DHKH 5F6MA 2IOTA 2ZFSA 4O97A 1TNIA 1V2MT 1CHOF 2FO9A 2I6QA 4MPVA 1NM6A 2GCHG 3UPEA 2QAAA 1SC8U 3F9EA 3UR9A 1TPOA 1H9IE 3K6YA 1HAIH 2VWMA 1MTWA 3ZZBA 3MWIU 2R0KA 3TJNA 1W10U 1C4U2 3RM0H 5A0CA 1O5FH 2HALA 2ZDVH 1C5MD 5C67A 4MPWA 2FYRA 2IJOB 3ZVGA 4TY7A 1DWBH 1PPFE 4XDEA 3RXLA 1HAHH 4X2VA 2CN0H 3TITA 2XWBI 4U32A 4JYUH 1A5IA 1THPB 3BTHE 3M3TA 2XBYA 1VGCB 4VGCB 4NGAH 2ZHEH 4YM9A 1WQVH 2TBSA 3BN9A 2FOHA 1EB2A 2AYWA 2J94A 2BMGB 3KCGH 3PROA 1V3XA 1S83A 2FDAA 2QA9E 1BMLA 1YP9A 2IJD1 1HGTH 4AFZA 1SLWB 1F5RA 1S6HA 4JZFH 3SI4H 3TK5A 3GY2A 1GBJA 1S6FA 3MNSA 3SQEE 1WOFA 2FODA 3EE0B 5DJ7A 4Q7XA 1N8OB 3TPIZ 5A0AE 2ZEBA 2D2DA 1SVPA 1YYY1 2WUBA 3P8NA 3GY7A 1OP8A 1INCA 1EPTB 2FPZA 2ZQ1A 1ACBE 2IPHA 4A92A 1XUJA 3SJ8A 1J16A 5LPEA 1TGCA 3UWIA 4AYVB 2A7HA 1BTPA 2F4LA 2WINI 1O32A 4K8YA 4R0IA 3FZZA 1GCDA 1GJDB 4RN6A 2ZECA 1HLTH 3MU5A 3G01A 5HGGA 1DICA 3U8OH 1T4VH 5ESTE 4MNYA 1L1JA 3E6PH 4CHAB 4A1XA 2FYQA 2ZGJA 4K60A 2A5IA 2VBCA 1BITA 2FIRH 3QZQA 1AE5A 2XC4A 1YCPK 4X1PU 4AFQA 2ALPA 3ESTA 1AUTC 1SFIA 2PSYA 1FN6A 1XVMA 1HXEH 2Y6TA 1Z1IA 2TIOA 1SBWA 1BBRH 2Z3DA 4MQAA 4YO9A 1A0HB 1MCTA 1QHRB 2OK5A 2XC5A 3TH4H 2H2ZA 1DSUA 3TGJE 1C4Y2 1AY6H 1B0FA 5HM9A 1O3DA 3U98H 1DVAH 1PYTD 3T29A 3UR6A 3ZZ4A 2XNIA 1UCYH 3M5LA 1GCTC 3DFLA 1A5GH 1DS2E 2HNTF 1CVWH 1HPGA 2O9QA 2YOLA 1TQ7B 3TK9A 1ELCA 2QGRA 2Z6BD 1C1RA 4UFGH 4LOYH 1YC0A 2ANKH 2RA0A 4I32A 1GHAG 1H8DH 3PV4A 3RDZA 4I8GA 3RXVA 3AAUA 1PPCE 3K6ZA 1ZRKA 3QK1A 4YTAA 1HAZB 1K1NA 2FX6A 1CGIE 3SJKA 3RXAA 4ASHA 1EJNA 1DFPA 4INLA 2VNTA 1TPAE 3E8LA 4NFEA 3RXBA 1BTHH 2F9PA 3HATH 3ODDA 3ZVEA 1Y5BT 1AB9B 1MTUA 3ZZAA 3ZZDA 1ARCA 1P02A 3MH6A 2QF3A 1YPHE 1MQ5A 3I78A 3GCHB 4AORA 4AYYB 4YOIA 1P9UA 1TRMA 1MKWH 1VITH 1RD3B 3ZVAA 1V2PT 4D8NA 1W0ZU 3KGPA 3GY5A 1C5VA 2B5TB 4CH8B 3T27A 1HAXB 1EUFA 1QRXA 3Q3YA 1GMHF 2HWLB 5F8TA 3M5MA 4HZHA 4WF8A 4B71A 1RTFB 5EPYA 3KIDU 1RS0A 5A2MH 4Q7YA 4WH6A 1O2GH 2P94A 2HGTH 3FANA 5EODA 3QGJA 1KLIH 1GL0E 4I8LA 5FX6A 1ZJKA 4HI3A 1FI8A 1KXBA 1W11U 1GG6B 1J14A 1T32A 5CE1A 4ZKNU 1ZMLA 9LPRA 4B73A 2SGFE 1QURH 4ABFA 1KLJH 1O5GH 2TGPZ 1P2OA 1T7CA 1OWEA 5CHAC 1FV9A 1GDNA 2A45B 3BG4B 1UMAH 1YPLH 3W94A 1K1JA 3URCA 1AWHB 1HAYB 1ZMNA 4F49A 3MOCA 1SOZA 2J34A 1Z6EA 1J9CH 1V2OT 1GBMA 1QBVH 1PQ8A 1VCPA 3PTBA 1GJCB 3M7TA 1GHXH 2XYAA 2ZI2H 1SR5C 1G3EA 5HYOA 1RIWB 2BLVA 5E0HA 1UVTH 4ABGA 4I31A 5C20A 4NIXA 4UFFH 1Z71A 2BY6X 4NG9H 3VXEH 3VFEA 2EI8A 3M3SA 1D3QB 1H1BA 3OTPA 2UUKB 2FOCA 2OC8A 1HFDA 3JZ2B 1ETTH 1HYLA 1XVOA 2BDHA 2IN2A 4HTCH 3UFAA 1VCQA 2QIQA 1SLVB 1LMWB 1SB1H 2PFEA 2SGQE 1KXCA 5CMXH 1SGPE 4Y8YA 2FX4A 3ZV8A 4WXIA 2BY9X 4SGAE 1GHYH 1OX1A 1PPHE 4ZHLU 4BNRA 2VB0A 3ZZ9A 1G3BA 2G5NA 1QJ7B 3RXGA 4GLYA 1HV7A 1F92A 3TJOA 1YPHC 1O5CB 1DUAA 4DY7B 1V2TT 1V2QT 1EZUC 1C5WB 3RXSA 1P2JA 1TA2A 4ISIH 4AB9A 3SU3A 2XBXA 2FI5E 3BV9B 4ISOA 3IWMA 3TVJB 3RU4D 1F5LA 3MH5A 1J15A 1L1NA 3D65E 4DGJA 5TJXA 1HXFH 5J4SA 1A3BH 3SGQE 2O8UA 4INKA 1UTLM 2SFAA 8KME2 1NROH 1AFQC 2W3IA 1ZSKA 2HLCA 2BD4A 4NIYA 1TOMH 1AI8H 2ZFQH 4BAOB 4WMEA 1G2LA 2FZZA 1CA8B 3DUXH 3OYPA 1O3MA 5DO4H 1E36B 1FPHH 1TGNA 1TRYA 4UD9H 2ODQA 1MU8B 1NFUA 1P04A 2FEQH 1V2NT 2VIDA 3L6PA 1NO9H 2BTCE 5DP7A 2ZU1A 2A7JA 3ZVFA 1PQ7A 2ZU5A 1DOJA 1E38B 1ESAA 1EAXA 1K1MA 2BDBA 4BAKB 1CBWB 2CV3A 1ORFA 1GL1A 1UTJA 3PWBA 5EOKA 1KXFA 2G55A 1O35A 1UHBA 1GHBF 4MPUA 1C2HA 4CR9A 2ODPA 4X2YA 1SGTA 4BXWA 1CA0B 4DW2U 1P0SH 2Y81A 4THNH 3A85A 1V6DA 3M7UA 1P11E 4NWKA 4FUDA 1LVYA 1NRPH 1TYNA 4IMZA 4IMQA 1MD7A 1OWDA 4IN1A 2A5AA 4YOGA 1WXRA 3OX7U 4XSKU 1MMJN 2R9PA 5JBTA 2QXHA 1FY3A 4FUFA 4Y71A 3RLWH 2UWLA 3MTYA 4WY3A 3QUMP 1Y8TA 1O3KA 4LK4A 1BQYA 1K1PA 5F03A 1O31A 4IN2A 1FY4A 1NS3A 1V2UT 1O2HA 4CREA 3D62A 3QLPH 1OPHB 1LHFH 4CBOA 2JH5D 1GBDA 3UOUA 1BTZA 2HOBA 2A5KA 2BY8X 1YCPH 2R2MB 2XWAA 1SGDE 3MH4A 3S9CA 1L4ZA 2ASUB 4E05H 5DP6A 4INHA 1NU7B 1NESE 3KNXA 3SV9A 3EYDA 2GDDA 4FUEA 3ZVDA 3ZZ7A 2BX3A 1WSSH 3MO3A 3NUMA 4ZHMU 2VWLA 2J92A 1W12U 1SGYE 1QBOA 1O2NA 2WPMS 1D9IA 3BIUH 1C5UA 1CE5A 3FVFB 1V2JT 2AEIH 1O36A 1HJ8A 4ZROA 1SQAA 1DANH 5AFZH 4BOHA 4K3JA 3Q3XA 5EXMA 1SGFG 3KF2A 5TCCA 1QR3E 2CMYA 2Q6DA 4KP0A 1GBLA 3BTTE 2GP9B 2A2QH 2BY7X 3WY8A 1MCVA 1OWHA 3CS0A 3S7HB 1K9OE 1W13U 1TA6A 4FVDA 1ZTKA 4ZH8A 4MNXA 1FNIA 2OP9A 1P10A 2VIPA 4YT6H 1MTVA 1QTFA 1SGIB 1P06A 3HKJB 4DVAU 1K22H 1GI1A 1TBQH 1C5LH 2STBE 3ATMA 2AH4X 7KMEH 2ZGBH 1VZQH 1OP0A 1TALA 2XW9A 1GJ5H 2OC1A 3A7ZA 2ZCLP 4YOJA 3EA8A 2VINA 1W14U 2WV5A 2PW8H 1PPEE 2H5CA 3A80A 1T8LA 2WZQA 2XBVA 1EASA 4X8TH 1C5TA 2D8WA 1EZQA 3SU6A 4NA7A 4CH2B 3E16B 4DURA 3ZYDA 1BTUA 1C9PA 1DY9A 1JRSA 2F91A 5DP3A 2ZHWH 1GI2A 2ZDKA 4UE7H 5IDKA 3A87A 2GT8A 5GIBA 1G32B 3RXHA 2C90B 4K5ZA 3ZVCA 1AZ8A 2GCHF 3RLYH 4FXGH 4HGCA 4I8KA 1W0YH 5LPRA 2TGDA 3ATWA 1EAWA 1ZRBA 3M61U 3LC3A 1GMCG 1O3GA 4JK5A 4Y7BA 5FAHA 3RXMA 1EX3A 5GWZA 3NXPA 1UHBB 1XUIA 1G30B 3LDXH 5AVDA 2WPHS 5EW2H 1S82A 3E90B 3H7TA 3PMJA 1NU9A 3MNXA 1BZXE 4BANB 1C1PA 3TNSA 3BTGE 3ZYEA 3SQHE 2AGEX 1OYTH 3GY8A 4X8VH 3PV5A 2CHAB 2NU2E 1Z1JA 4F4OC 4H42U 5E0GA 2Y5HA 5DPAA 2W5EA 3KQDA 2ZZUH 1O5EH 1DUEA 3A83A 2AIPA 2B0FA 2OUAA 4OGXA 2PV9B 1C2FA 1GDQA 1TBRH 2C8YB 1BRUP 1XXFA 3TGIE 5BPEA 2PTNA 4Y8ZA 1LQDB 3BTEE 3F6UH 1C1VH 2VIOA 2GD4B 1BMAA 1WUNH 1MTNB 1O5DH 1O3JA 1P3EA 1MD8A 1Q2WA 1GPZA 2ZA5A 3PWCA 4Y76A 1AVWA 1BTXA 1UTQA 1YPJH 4Z6AH 1O30A 1BIOA 2FOBA 2ZKSA 1GMDF 1HAGE 3UNRA 5FXLA 1O2LA 5DG6A 1HJAC 1Z6JH 1GI4A 1A3EH 3A7YA 3P95A 4B2CA 3EQ0H 5FBEA 2ALVA 2BD7A 3AW1A 1D4PB 2Z9LA 6CHAB 2PGBB 3EAJA 2HPQH 1DDJA 1O3LA 2CXVA 2QV1A 3SV7A 1AE8H 2ZGXH 1ELTA 1IQMA 1YKTA 3STIA 1ANCA 3OTJE 5JB8S 1ZPBA 2VIVA 1Y5UT 1RTKA 4MPXA 5GCHG 2F9UA 5ETXA 2Y5GA 3QWCH 1H9LB 1GGDC 3LGTA 1WYKA 4U30A 2A2XH 2BD9A 1T31A 2V6NA 4GUXA 3SV2H 2P3UB 3SBKA 3SW2B 2JKHA 1SI5H 2AMDA 4MLFB 1JWTA 2AFQB 3Q76A 1PQAA 2VU8E 1ZLRA 4AN7A 1C1SA 1E0FD 2BDGA 4M7GA 3RXDA 1IQHA 1VJAU 1CGJE 1MZAA 2VVCA 1ETSH 2J9NA 1HCGA 1SOTA 2GCTB 4JZEH 3ATKA 3PM3A 4NCYA 3MMGA 3LGVA 4UEHH 1Y3YA 1Z8JB 5A8YA 1AQ7A 1P01A 3ZZ6A 3BTWE 5DKMA 3SI3H 2VJ1A 2V3HH 1GHAF 4CRAA 4K69A 1DX5M 3DFJA 3MNCA 2G52A 6LPRA 4ISNA 4IBLH 1K1LA 3F9GA 1FJSA 2BQ6B 5FBIA 3RXKA 4PROA 3T25A 4E06H 1HIAA 1BRBE 1FAKH 4AGKA 1GJ7B 2JETC 5GJ4B 3SOSA 5EQRA 2ZPRA 2ZPQA 1C2DA 4D9RA 4DCDA 1N6XA 1DSTA 1NFYA 4IW4E 3LH1A 3HGNA 1NRQH 2QXGA 3FZDA 4K1EA 1AD8H 3RXEA 3N7OA 1BTYA 3A7XA 4AX9H 3GISB 2G4UA 3QO6A 3SU2A 1C4V2 3A88A 1P03A 1P12E 1GI9B 1P2MA 1TFXA 2VGCC 1CGHA 1IQJA 1JXPA 1BUIA 4ZKRU 1A0JA 3MO9A 4TWYA 4A1VA 2GMTB 1MAYA 1AVXA 4B2BA 3FFGA 1XKAC 3EDXB 1QIXB 2ZFRH 1LDTT 2GZ9A 1ELDE 1O3AA 1TBZH 1QJ1B 2FP7B 1FAXA 5FPYA 3OY6U 3V7TA 2PTCE 1YPEH 1XMNB 1HAOH 3RXFA 2XBWA 3NK8A 1HUTH 5EU8A 3GYMA 3LGUA 2PKSB 1C1TA 2P95A 4UONA 2J4IA 2ZHDA 1H8IH 3FP6E 4O3TA 2FXRA 1C2MA 5JBBS 2ILNA 4I8HA 3PO1C 1OOKB 3P92A 3BG8A 1K28D 1D3PB 1YLDA 1TGTA 4ABAA 4OS2A 1C1OA 2GTBA 2YNAA 1FZZA 3D23A 4NFFA 4NZQA 3SJIA 5C1UA 2OXSA 2AMQA 5FHTA 3Q3KA 4YLQH 2BD5A 6GCHF 3P8GA 1YGCH 4ZAEA 1F5KU 4GCHF 3LOXA 4JZ1A 3TIUA 2GX4A 3GYLB 2P3FH 1LHGH 1EAUA 1PPBH 3ODFA 4TPYA 4IS5A 4FUGA 1IQGA 4NWLA 1C1UH 1GDUA 1FXYA 1S0RA 2B8OH 1Y3UA 1O37A 1FY1A 2G00A 3I29A 1PQ5A 1TPPA 1HB0B 4WXVA 5JB9S 1C5QA 4KTCA 3SHAH 3SUGA 2ZC9H 3LGYA 4FUCA 2ZTYA 3RMLH 1ELGA 1Y5AT 4UFDH 2A4QA 4AGJA 2BLWA 4NSYA 3U9AH 4FU8A 5GDSH 1F0RA 3QN7A 4BAHB 1BMMH 1AGJA 2Z9JA 1IOEA 1N6YA 3E0PB 3R3GB 1CT0E 1Z8GA 2GKVE 1TMUH 3AVZA 2SNWA 3ZZCA 2SNVA 4Y6DA 1GHVH 1A61H 2Z94A 4TYDA 1BDAA 4K1TA 3BTME 2R3YA 1W7GH 3KHVA 5C3NA 1AIXH 3S7KB 1BBRE 1HIAB 2THFB 3K9XB 1U6QA 1IAUA 2ZCHP 1L1GA 1JRTA 2BXTH 1WAYB 5L6NH 2OBQA 1ZSLA 3F9FA 1VGCC 4VGCC 2OTVA 2XC0A 1ZOMA 1UCYE 1GVLA 2BHGA 3QX5H 3RMOH 1S0QA 3A8CA 1O3PB 3ZZ3A 4RKJB 1K21H 1ESTA 1ZSJA 4XFQA 3TNTA 3P8FA 3MU4A 4A7IB 1HDTH 4O03A 4I7YH 1FN8A 2ZU2A 1FY5A 2GV6A 1A7SA 1LTOA 1DWDH 4Q7ZA 3NKKA 3ATIA 2P8OC 1AN1E 3LIWA 2Y7XA 1WU1A 3LPRA 4GVUA 1C2JA 1AU8A 1EPTC 4DOQA 5T3HA 3K2UA 1V2VT 1Y3VA 7GCHF 3UTUH 1ABIH 2QXJA 2NU3E 2VIQA 1GMHG 4M9FA 4ABJA 2GZ7A 4IC6A 1WV7H 4CHAC 1K2I1 1W3CA 2JH0D 1F0TA 1NRNH 3BSQA 1DT2A 4ISLA 1A2CH 4B6FA 1CQQA 2ZHFH 1EOJA 4X6NA 3RC4A 1P2IA 3PMBB 4MVNA 1NTPA 3QZRA 5FPTA 3EA7A 3M7QA 5EXLA 4RSPA 1SLXB 5A8ZA 3B8JA 2ZG0H 5DP9A 2QC2A 4LZ1H 1SG8B 1C1WH 2Z9KA 2G81E 2QY0B 1O0DH 3URDA 3P70B 3RXUA 2C8WB 1O2YA 2FOFA 3EA9A 1AKSB 3UNSA 1QQ4A 1Z7KA 3EGKH 4ZKSU 1NRRH 2FS9A 3LGIA 3DD2H 3NCLA 2G8TA 2ZDMA 2GV7A 2ZTZA 4CRBA 3LKWA 1N1LA 3M37A 1AZZA 3BTQE 4B6EA 4E7RG 2P93A 3A8AA 2BOKA 4ABHA 3E0NB 2M5TA 4I8JA 1YPGH 4MNWA 1J17T 4DIIH 1GBAA 1O38A 2FM2A 1OS8A 5JBCS 5LGOA 3CS7A 3RUOA 1AWFH 3SU1A 1ZJDA 5EW1H 1OYQA 2J95A 2G5VA 4FUHA 1GJ6A 1GWAA 4XOJA 1EAIA 3A7VA 3GDSA 1MBMA 4ABIA 1EKBB 7ESTE 3RM2H 5E0JA 1FPCH 1FIZA 3A7WA 3OU0A 1GVZA 2EA3A 1CU1A 1P3CA 2VIWA 1RXPA 4O9VA 3L3TA 4GAWA 1QB1A 5F8ZA 1C5YB 3UWJH 4U01A 1ZMJA 3QGNB 4B1TA 2C4FH 3GCHC 1ARBA 1O2TA 2A7CA 3C27B 1WTHD 4ZXYH 5A09A 1BB0B 5BRRE 1NZQH 1A5HA 1TNLA 2FOAA 3T62A 3BTKE 3R0FA 2KAIA 2BB4A 1C9TA 2OINA 4BTUB 1XKBC 1O2ZA 1MKXK 1UK4A 2EEKA 4NA8A 3UUZA 4DG4A 1BHXF 1F2SE 1KDQA 1BJVA 4NIVA 5J4QA 3MYWA 4SGBE 1XUHA 1O2QA 3RMMH 3VXFH 1TPSA 4KGAA 3RXCA 4AOQA 4WMFA 1CSOE 1KTSB 2SGEE 1THSH 5JPMH 3IITA 1UJ1A 3HK3B 3SUEA 1MTSA 1SFQB 2ZU4A 3AASA 2ODYB 3GCTF 2PSXA 1E37B 1ZHMA 3PMAB 1GG6C 8GCHF 2WPLS 1OWJA 1SGQE 4FUJA 1UTNA 1GBEA 1O2VA 2GZ8A 3U1IB 1ELFA 1XX9A 2Q1JA 3UQOA 3BG4C 3LJJA 1GHBG 1KXDA 4FU7A 1P09A 1TRNA 4MNVA 1WQSA 2Z7FE 2BDCA 2ULLA 1JOUB 1MH0A 1CT4E 1TNGA 4K1SA 1V2ST 4B2AA 1RJXB 1Y3XA 2XRCA 2TPIZ 2H5DA 3SZNA 4A6LA 1MZDA 1F7ZA 4X1QU 3JZ1B 5AF9H 1PFXC 4OS6A 1V2RT 1P2KA 1LVMA 1RIWC 1TX7A 2RDLA 1BJUA 1TNKA 1LCYA 2OCVB 1EJMA 1MU6B 1FQ3A 1S84A 1S85A 2ZGCA 1OSSA 1C2EA 2VGCB 3RXJA 1LO6A 1MUEB 5E2PA 1ZGIA 2WYJA 3M35A 1G37A 1T4UH 3H7OA 3MH7A 3P17H 1KY9A 1VJ9U 2Z3CA 5FPSA 1DITH 3PLBA 1QGFA 1GCTB 1O34A 1SHYA 2C3SA 4X6MA 4XBDA 2P59A 2A4RA 2Q6FA 1GBCA 4JZDH 1ZZZA 1LPGB 1SGRE 1Y59T 2BZAA 1G36A 4MG3A 1ELEE 2OC0A 3CP7A 3CENA 2SGAA 1O2XA 4YLUA 1FLEE 1LVBA 1GJ4H 3FP8E 1IQNA 1GI7B 2R0LA 2ZHQH 3VB5A 2CGAA 1DWEH 2ZDNA 4KTSA 3OSYA 3RP2A 1LPKB 1SLUB 1ELAA 1YPKH 1UTKA 1C5NH 3NPSA 3SU0A 3VEQB 1NN6A 4GPGA 4OGYA 1NFWA 3VGCC 3SN8A 2AGIX 1FDPA 1UK2A 3UREA 2ANYA 1HAVA 4FVBA 1FONA 4OS1A 1ZR0A 2HNTE 1QRZA 2Z9IA 5FX5A 3RC5A 1PYTC 1SL3A 4X8UH 1AUJA 3O8RA 2A1DB 1TB6H 3SV6A 3L33A 1QY6A 3QTVH 2ZPSA 1IQEA 1EATA 4TY6A 2KAIB 3FAOA 2TGTA 1ZHRA 4U2WA 2GDEH 2C93B 1VITG 1GJBB 2FESH 5PTPA 1YBWA 2BVXH 5L2YH 2W7SA 1ZGVA 2SGDE 1D6WA 1O3FA 1KDQB 2FS8A 2YNBA 5ESBA 1Q31A 4WWYA 4BTIB 2QYIA 1D3TB 2ZWLH 1CBWC 1ETRH 1QB9A 5DP8A 1GBKA 1S5SA 3P8OA 2FOEA 2C8ZB 3GDVA 1GBHA 3K65B 3TH2H 1EJAA 2ZU3A 3A89A 3A7TA 1CA0C 4X1RU 2DE9A 1EOLA 3A8BA 4IGDA 2BQWB 4Y7AA 1HJ9A 3SORA 1SGNE 3SHCH 5K7RA 1ZPZA 5IYTA 1P57B 3T26A 5GPIB 3RXQA 1XUKA 2WYGA 1TABE 1J8AA 4BXSA 5DP5A 1Q3XA 1ID5H 3KQCA 1DXPA 1K1OA 2F9VA 2Z3EA 3F68H 5T6DA 4BAQB 1FUJA 1UTOA 4NIWA 1TGSZ 1O3OA 3LC5A 4D9QA 1GI6A 3RU4T 4JYVH 1GJAB 3PLKA 1ZYOA 3O8CA 2ZF0H 2LNCA 5CHAB 1UK3A 2BDIA 1C1MA 3PB1E 2VVUA 1GHWH 2VVVA 2NU1E 1OKXA 2EI6A 3RU4E 2R3UA 1AHTH 4XBBA 5HXFA 4NA9H 1O2IA 3M36A 1C5RA 2PKAA 3RMNH 1L4DA 3AK5A 1PJPA 1P2QA 1OP2A 4D7FA 2ZFPH 1OWKA 2FI4E 2V0BA 3A84A 3ZZ8A 1O3EA 4A1TA 4ZXXH 2OBOA 2ZQ2A 4AFSA 3SGBE 1LKBA 2OQUA 2VH6A 2QF0A 3V0XA 2P8OB 3NWUA 3TJVA 1YCPM 3U8RH 4D76A 5AHGH 3A81A 1C5XB 1XUFA 1GI0A 3F1SB 1CHOG 1FMGA 1GMDG 2HNTC 2VH0A 1ZPCA 1C5PA 2H6MA 2ZDAH 4ESTE 3GDUA 4NZLA 5JYIA 1LHEH 3KQEA 1TMBH 5DGJA 4E7NA 2BOHB 4XBCA 1NRSH 2D26C 1LPZB 2Y7ZA 2BD8A 2WPIS 2BLQA 1P8VC 3BIVH 2W26A 5EPNA 1GBIA 2WV4A 3BF6H 5JDUB 1BTWA 3A82A 1BRCE 3M5OA 1HAVB 2ZFTA 3VB6A 2ZFFH 5FCRA 4AG1A 2VWOA 2ANWA 2OD3B 1E34B 2Z9GA 2BDAA 4D7GA 5FCKA 1SPJA 3ELAH 4YESB 3LGWA 1O3BA 1KIGH 1AFQB 1DLKB 2DE8A 2UUYA 2BXUH 2Y5FA 3BTDE 3MU1A 2XCFA 1BOQA 3AAVA 2PGQB 3SGAE 5HMAA 3LU9B 1ABJH 5T6GA 3DA9B 1C2LA 1O5AB 3P6ZB 1F0SA 4DT7B 3UOPA 1EP6A 3F9HA 1YLCA 1EXFA 4Z0KA 1LHDH 1XXDA 1TNHA 3MI4A 1A4WH 1TE0A 3SU4A 2G4TA 1BT7A 1KXAA 2RA3A 4OS4A 2ZNKH 2F9OA 2Y80A 1UVPA 2FLRH 4B75A 1O2SA 1S81A 4FU9A 5A0BA 3QDZB 1MKXH 1W7XH 1V2LT 1UVOA 1O5BB 2O8WA 1BHXB 5EG4A 3HKIB 2CHAC 3SUDA 2P3TB 3RXOA 1KTTB 4OM9A 1CT2E 3SJOA 3STJA 1NPMA 4RKOB 2XTTB 4Y0YE 1ZHPA 4J2YB 1TX8A 1A1RA 1VCWA 2NWNA 4X6OA 4J1YA 1ELVA 3S0NA 4KTUA 1KXEA 1AKSA 2PUQH 2WUCA 4B76A 3O8DA 1P05A 3T5FH 1DE7H 1G3DA 1W2KH 2F83A 2ZP0H 1EP5A 5EQQA 2AGGX 3D49H 3SJ9A 1ZTJA 1ANEA 5GNDA 3PLPA 4Y79A 2XCNA 4CBNA 1AMHA 1GBFA 1YM0A 3PMHB 1MTNC 2PKAB 4DIHH 2FTMA 3SNCA 5ABWA 1A46H 4CRGA 1GVKB 1MBQA 2CF9H 2R2WU 2C8XB 4FUIA 1TX6A 3BEUA 3AW0A 3VPKA 1RTLA 3GY3A 2DUCA 4ABDA 1Z8RA 1LKAA 6CHAC 3LONA 4H4FA 2V35A 3T28A 2FMJA 1O2MA 2Y82A 2TRMA 5HM2A 3UQVA 1OWIA 1QNJA 1C1QA 2WPJS 4GSOA 3TJUA 4A5TS 1QA7A 2BM2A 4ISHH 1TONA 1QL9A 4WH8A 3IG6B 1B7XB 1GI8B 1WTGH 1T8NA 2H9TH 3C1KA 4WJG2 4UFEH 1NT1A 1QJ6B 1B5GH 2ZGHA 3GY4A 1H9HE 1FY8E 2K1QA 1WBGB 2WV9A 1GJ9B 6GCHG 1H4WA 4B74A 4JCNA 4GCHG 1O2RA 1HNEE 1DWCH 5E8EH 3T2NA 1QCPA 1QQUA 2ZDLA 1N8OC 3GICB 2BD2A 4ZMAH 2GCTC 1W8BH 3U8TH 4XE4A 2JH6D 1QA0A 5F8XA 3VB3A 5L30H 3LJOA 1P9SA 4JK6A 4WVPE 5JBAS 1L0ZA 1E35B 1NY22 2QXIA 1TQ0B 1TMTH 1PPGE 2J2UA 5K0HA 1LQEA 4GHTA 2AERH 5EGMA 3PTNA 3SZEA 5EXNA 3ATLA 1EZXC 1F0UA 2RG3A 3RXRA 3B23B 9ESTA 4AZ2B 1HAPH 2FI3E 3FP7E 4OS5A 2F3CE 1JMOH 4JMYA 2W3KA 2BX4A 3E1XB 3MU0A 3H09A 3H5CB 2ZIQH 4YT7H 1SQTA 2BDYA 3TK6A 4ABBA 4ZHAA 1QL8A 2EI7A 2AS9A 1NFXA 3GY6A 5TCAA 3SNDA 1QFKH 8ESTE 1A0LA 1O2JA 1C2IA 3DT0H 3V12A 1OXGA 2ZCKP 3GCOA 4IC5A 4CRDA 2FOMB 2W7UA 1YPMH 1WCZA 2GMTC 3OY5U 4RI0A 1CHGA 3VB4A 1QRWA 3ITIA 1TGBA 1L2EA 2CF8H 1ZTLA 3KL6A 2CJIA 3VGCB 4ZKOU 3TLOA 3NZIA 1IQIA 1IQFA 3U1JB 1AO5A 1V2KT 2B9LA 5LPFA 1BA8B 4ZUHA 1QBNA 1RFNA 2PUXB 3GOVB 1O3IA 2STAE 2LPRA 3M3VA 2VWNA 3S9BA 3HK6B 2PKSC 4H6TA 3UNQA 2Q6GA 2FLBH 2O8MA 2NU0E 2AIQA 1O2WA 3UY9A 5I46H 1SMFE 1GBTA 2ZTXA 5L2ZH 3RC6A 2UUJB 1RRKA 1EZSC 4Y11E 4AG2A 1HJAB 1MAXA 5C5OA 3B9FH 1UO6A 7LPRA 3ZZ5A 3TU7H 7GCHG 3QTOH 1BBRK 2XXLA 1TNJA 3BEIB 1TAWA 1C2GA 1O2KA 2BY5X 1DXWA 3TGKE 1T8MA 5C5NA 1AB9C 2GGVB 4MTBA 3MFJA 2GVFA 6ESTA 3SNAA 1CO7E 1K1IA 1JBUH 3M5NA 4CRFA 1O2UA 2UWOA 3RXPA 1GGDB 5LH8A 5EQSA 1UCYK 3HGPA 2HRVA 3MO6A 3ZV9A 1SGCA 1SGEE 2A4OA 3HPTB 4CRCA 2UUFB 2PLXA 2SGPE 3ENSB 4NSVA 4TPIZ 2UWPA 3U69H 3A8DA 5E2OA 4K2YA 3MHWU 2EC9H 2H9HA 4X1SU 2QCYA 4KKDA 3LH3A 4Y8XA 4TWWA 1O39A 1ELBA 3UIRA 1UTPA 1O2PA 1TIOA 3LT3A 4Y10E 1GMCF 1X7AC 1AVGH 4Q80A 3O8BA 3E91A 1GI3A 2F9BH 1D6RA 1TWXB 3E3TA 5B6LA 2OC7A 2D1JA 2QN5T 2AMPA 4Q2KA 1TLDA 4DJZB 4X2WA 1DY8A 4YZUA 1MQ6A 1UVSH 3MNBA 3SYJA 1JIRA 2G51A 3TH3H 1HRTH 2FWWA 2A32A 1SSXA 1PPZA 1THRH 2O8TA 1XM1A 1BMNH 2FTLE 3S69A 2WPKS 1MKWK 2JETB 5C2ZA 2PHBA 1IQKA 1O2OA 1DM4B 8LPRA 1T8OA 3I77A 5C1XA 1UTMA 4QT8C 4AB8A 1C5OH 5G4BA 1IQLA 4WMDA 4FUBA 5T1VA 4AFUA 5SGAE 2A0QB 3W95A 3SNBA 1KSNA 1YF4A 2RCEA 5I25A 1G9IE 4X6PA 5AFYH 3SU5A 1C5ZB 1VR1H 2J38A 5A8XA 1G3CA 1M9UA 2NU4E 2WHXA 1VITF 4I33A 1C2KA 4ABEA 1SQOA 4H6SB 1GHZA 1ANDA 1KYNA 3V3MA 1C1NA 2ANMH 3SV8A 3SNEA 1G2MA 1BRAA 2OLGA 1Z8IB 2GT7A 1XUGA 2BQ7B 3KN2A 4X8SH 4LZ4B 4O3UA 2P16A 2BVSH 2A4GA 1BCUH 3RXTA 5DK1A 1EPTA 2PWXA 1RGQA 2TGAA 2BVRH 1QB6A 1NC6A 2F9NA 1DPOA 2B7DH 3GCNA 5H4IB 5GCHF 1ESBA 3KQBA 1UVUH 1IHSH 4JZIA 1HBTH 4R8TB 1GI5A 3PO1B 2I6SA 4Y0ZE 3MU8A 4X0WU 1D3DB 1FIWA 2HVXA 1EQ9A 2H1UA 4KELA 3GCTG 3KEEA 4X1NU 5GXPA 1AFEH 1GBBA 1SGFA 1ANBA 1TOCB 1JIMA 5C1YA 8GCHG 4X2XA 4BTTB 1EB1H 1KLTA 3BEFB 2V3OH 3RXIA 3PV2A 2BLOA 4CR5A 4MDSA 2OQ5A 2H9EH 1O3HA 1P2NA 4HFPB 3V13A 1V2WT 4K8BA 2HPPH 5T6FA 3A86A 2O8LA 4LXBH 5B6OA 1O33A 2BYAX 2PR3A 3S9AA 1DLEA 4UDWH 2ZO3H 3PYHA 3SO3A 3ZVBA 1QL7A 1B0EA 2A31A 4OS7A 1GJ8B 4BAMB 1Y3WA 3Q00A 3BTFE 1IHTH 1C5SA 3Q77A 3VB7A 2BZ6H 1LHCH 1LVOA 1SHHB 4GHQA
chains in the Genus database with same CATH superfamily
2FOGA 1O3CA 4JYTA 1O3NA 3SUFA 2BD3A 2ESTE 5DP4A 3DHKH 5F6MA 2IOTA 2ZFSA 4O97A 1TNIA 1V2MT 1CHOF 2FO9A 2I6QA 4MPVA 1NM6A 2GCHG 3UPEA 2QAAA 1SC8U 3F9EA 3UR9A 1TPOA 1H9IE 3K6YA 1HAIH 2VWMA 1MTWA 3ZZBA 3MWIU 2R0KA 3OEHD 3TJNA 1W10U 1C4U2 3RM0H 5A0CA 1O5FH 2HALA 2ZDVH 1C5MD 5C67A 4MPWA 2FYRA 2IJOB 3ZVGA 4TY7A 1DWBH 1PPFE 4XDEA 3RXLA 5DN6D 1HAHH 3DSGA 4X2VA 2CN0H 3TITA 2XWBI 4U32A 4JYUH 1A5IA 1THPB 3BTHE 3M3TA 2XBYA 1VGCB 4VGCB 4NGAH 2ZHEH 4YM9A 1WQVH 2TBSA 3BN9A 2FOHA 1EB2A 2AYWA 2J94A 2BMGB 3KCGH 3PROA 1V3XA 1S83A 2FDAA 2QA9E 1BMLA 1COWD 1YP9A 2IJD1 1HGTH 4AFZA 1SLWB 1F5RA 1E1RD 1S6HA 4JZFH 3SI4H 3TK5A 3GY2A 1GBJA 1S6FA 3MNSA 3SQEE 1BMFD 1WOFA 2FODA 3EE0B 5DJ7A 4Q7XA 1N8OB 3TPIZ 5A0AE 2ZEBA 2D2DA 1SVPA 1YYY1 2WUBA 2QF4A 3P8NA 3GY7A 1OP8A 1INCA 1EPTB 2FPZA 2ZQ1A 1ACBE 2IPHA 3OFND 4A92A 1XUJA 3SJ8A 1J16A 5LPEA 1TGCA 3UWIA 1NBME 4AYVB 2A7HA 1BTPA 2F4LA 2WINI 3FN8A 1O32A 4K8YA 4R0IA 3FZZA 1GCDA 1GJDB 4RN6A 2ZECA 1HLTH 3MU5A 3G01A 5HGGA 1DICA 3U8OH 1T4VH 5ESTE 4MNYA 1L1JA 3E6PH 4CHAB 4A1XA 2FYQA 2ZGJA 4K60A 2A5IA 2VBCA 1BITA 2FIRH 3QZQA 1AE5A 2XC4A 1YCPK 4X1PU 4AFQA 2ALPA 3ESTA 1AUTC 1SFIA 2PSYA 1FN6A 1XVMA 1HXEH 2Y6TA 1Z1IA 2TIOA 1SBWA 1BBRH 2Z3DA 4MQAA 4YO9A 1A0HB 1MCTA 1QHRB 2OK5A 2XC5A 3TH4H 2H2ZA 1DSUA 3TGJE 1C4Y2 4XRNA 1AY6H 1B0FA 5HM9A 1O3DA 3U98H 1DVAH 1PYTD 3T29A 3UR6A 3ZZ4A 2KX4A 4Q63A 2XNIA 1UCYH 3M5LA 1GCTC 2CK3D 3DFLA 1A5GH 1DS2E 2HNTF 1CVWH 1HPGA 2O9QA 2YOLA 1TQ7B 3TK9A 1ELCA 2QGRA 2Z6BD 1C1RA 4UFGH 4LOYH 1YC0A 2ANKH 2RA0A 4I32A 1GHAG 1H8DH 3PV4A 3RDZA 4I8GA 3RXVA 3AAUA 1PPCE 3K6ZA 1ZRKA 2LP6A 3QK1A 4YTAA 1HAZB 1K1NA 2FX6A 1CGIE 3SJKA 3RXAA 1E79D 4ASHA 1EJNA 1DFPA 4INLA 2VNTA 1TPAE 3E8LA 4NFEA 3RXBA 1BTHH 2F9PA 3HATH 3ODDA 3ZVEA 1Y5BT 1AB9B 1MTUA 3ZZAA 3ZZDA 1ARCA 1P02A 3MH6A 2QF3A 1YPHE 1MQ5A 3I78A 3GCHB 4AORA 4AYYB 4YOIA 1P9UA 1TRMA 1MKWH 1VITH 1RD3B 3ZVAA 1V2PT 4D8NA 1W0ZU 3KGPA 3GY5A 1C5VA 2B5TB 3UAIC 4CH8B 3T27A 1HAXB 1EUFA 1QRXA 3Q3YA 1GMHF 2HWLB 5F8TA 3M5MA 4HZHA 4WF8A 4B71A 1RTFB 5EPYA 3KIDU 1RS0A 5A2MH 4Q7YA 4WH6A 1O2GH 2P94A 2HGTH 3FANA 5EODA 3QGJA 1KLIH 1GL0E 4I8LA 5FX6A 2EQNA 1ZJKA 4HI3A 1FI8A 1KXBA 1W11U 1GG6B 1J14A 1T32A 5CE1A 4ZKNU 1ZMLA 9LPRA 4B73A 4Z1MD 2SGFE 1QURH 4ABFA 1KLJH 1O5GH 2TGPZ 1P2OA 1T7CA 1OWEA 5CHAC 1FV9A 1GDNA 2A45B 3BG4B 2JJ2D 1UMAH 1YPLH 3W94A 1K1JA 3URCA 1AWHB 1HAYB 1ZMNA 3WWFA 4F49A 3MOCA 1SOZA 2J34A 1Z6EA 2HLDD 1J9CH 1V2OT 1GBMA 1QBVH 1PQ8A 1VCPA 3PTBA 1GJCB 3M7TA 1GHXH 2XYAA 2ZI2H 1SR5C 1G3EA 5HYOA 1RIWB 2BLVA 5E0HA 1UVTH 4ABGA 4I31A 5C20A 4NIXA 4UFFH 3VG8A 1Z71A 2BY6X 4NG9H 3VXEH 3VFEA 2EI8A 3M3SA 1D3QB 1H1BA 2M2AA 3OTPA 2UUKB 2FOCA 2OC8A 1HFDA 3JZ2B 1ETTH 1HYLA 1XVOA 2BDHA 2IN2A 4HTCH 3UFAA 1VCQA 2QIQA 1SLVB 1LMWB 1SB1H 2PFEA 2SGQE 1KXCA 5CMXH 1SGPE 4Y8YA 2FX4A 3ZV8A 4WXIA 2BY9X 4SGAE 1GHYH 1OX1A 1PPHE 4ZHLU 4BNRA 2VB0A 3ZZ9A 1G3BA 2G5NA 1QJ7B 4Q4LA 3RXGA 4GLYA 1HV7A 1F92A 3TJOA 1YPHC 1O5CB 1DUAA 4DY7B 1V2TT 1V2QT 1EZUC 1C5WB 3RXSA 1P2JA 1TA2A 2J97A 4ISIH 4AB9A 3SU3A 2XBXA 2FI5E 3BV9B 4ISOA 3IWMA 3TVJB 3RU4D 1F5LA 3MH5A 3PRDA 1J15A 1L1NA 3D65E 4DGJA 5TJXA 1HXFH 5J4SA 1A3BH 3SGQE 2O8UA 4INKA 1UTLM 2SFAA 8KME2 1NROH 1AFQC 2W3IA 1ZSKA 2HLCA 2BD4A 4NIYA 1TOMH 1AI8H 2ZFQH 4BAOB 4WMEA 1G2LA 2FZZA 1CA8B 3DUXH 3OYPA 1O3MA 2KCPA 5DO4H 1E36B 1FPHH 1TGNA 1TRYA 4UD9H 2ODQA 1MU8B 1NFUA 1P04A 2FEQH 1V2NT 2VIDA 3L6PA 1NO9H 2BTCE 5DP7A 2ZU1A 2A7JA 3ZVFA 1PQ7A 2ZU5A 1DOJA 1E38B 1ESAA 1EAXA 1K1MA 2BDBA 4BAKB 1CBWB 2CV3A 1ORFA 1GL1A 1UTJA 3F0PA 3PWBA 5EOKA 1KXFA 2G55A 1O35A 1UHBA 1GHBF 4MPUA 1C2HA 4CR9A 2ODPA 4X2YA 1SGTA 4HG6A 4BXWA 1CA0B 1UW7A 4DW2U 1P0SH 2Y81A 4THNH 3A85A 1V6DA 3M7UA 1P11E 4NWKA 4FUDA 1LVYA 1NRPH 5F53A 1TYNA 3EE7A 4IMZA 4IMQA 1MD7A 1OWDA 4IN1A 2A5AA 4YOGA 1WXRA 3OX7U 3U28C 4XSKU 1MMJN 2R9PA 5JBTA 2QXHA 1FY3A 4FUFA 4Y71A 3RLWH 2UWLA 3MTYA 4WY3A 3QUMP 1Y8TA 1O3KA 4LK4A 1BQYA 1K1PA 5F03A 1O31A 4IN2A 1FY4A 1NS3A 1V2UT 1O2HA 4CREA 3D62A 3QLPH 1OPHB 1LHFH 4FETA 4CBOA 2JH5D 1GBDA 3UOUA 1BTZA 2HOBA 2BY8X 2A5KA 1YCPH 2R2MB 2XWAA 1SGDE 3MH4A 3S9CA 1L4ZA 2ASUB 4E05H 5DP6A 4INHA 1NU7B 1NESE 3KNXA 1W0JD 3SV9A 3EYDA 2GDDA 4FUEA 3ZVDA 3ZZ7A 2BX3A 1WSSH 3MO3A 3NUMA 4ZHMU 2VWLA 2J92A 1W12U 1SGYE 1QBOA 1O2NA 2WPMS 1D9IA 3BIUH 1C5UA 1CE5A 3FVFB 1V2JT 2AEIH 1O36A 1HJ8A 4ZROA 1SQAA 1DANH 5AFZH 4BOHA 4K3JA 3Q3XA 5EXMA 1SGFG 3KF2A 5TCCA 1QR3E 2CMYA 2Q6DA 4KP0A 1GBLA 3BTTE 3UB0A 2GP9B 2A2QH 2BY7X 3WY8A 1MCVA 1OWHA 3CS0A 3S7HB 1K9OE 1W13U 1TA6A 4FVDA 1ZTKA 4ZH8A 4MNXA 1FNIA 5C0TA 2OP9A 1P10A 4ACBA 2VIPA 4YT6H 1MTVA 1QTFA 1SGIB 1P06A 3HKJB 4DVAU 1K22H 1GI1A 1TBQH 1C5LH 2STBE 3ATMA 2AH4X 7KMEH 2ZGBH 1VZQH 1OP0A 1TALA 2XW9A 1GJ5H 2OC1A 3A7ZA 2ZCLP 4YOJA 3EA8A 2VINA 1W14U 2WV5A 2PW8H 1PPEE 2H5CA 3A80A 1T8LA 1H8ED 2WZQA 2XBVA 1EASA 4X8TH 1C5TA 2D8WA 1EZQA 3SU6A 4NA7A 4CH2B 3E16B 4DURA 3ZYDA 1BTUA 1C9PA 1DY9A 1JRSA 2F91A 5DP3A 2ZHWH 1GI2A 2ZDKA 4UE7H 5IDKA 3A87A 2GT8A 5GIBA 1G32B 3RXHA 2C90B 4K5ZA 3ZVCA 1AZ8A 2GCHF 3RLYH 2PP6A 4FXGH 4HGCA 4I8KA 1W0YH 5LPRA 2TGDA 3ATWA 1EAWA 1ZRBA 2J5UA 3OEED 3M61U 3LC3A 1GMCG 1O3GA 4JK5A 4Y7BA 5FAHA 3RXMA 1EX3A 5GWZA 3NXPA 1UHBB 1XUIA 1G30B 3LDXH 5AVDA 2WPHS 5EW2H 1S82A 3E90B 3H7TA 3PMJA 1NU9A 3MNXA 1BZXE 4BANB 1C1PA 3TNSA 3BTGE 3ZYEA 3SQHE 2AGEX 1OYTH 3GY8A 4X8VH 3PV5A 2CHAB 2NU2E 1Z1JA 4F4OC 4H42U 5E0GA 2Y5HA 5DPAA 2W5EA 3KQDA 2ZZUH 1O5EH 1YY3A 1DUEA 3A83A 2AIPA 3CNRA 2B0FA 2OUAA 4OGXA 2PV9B 1C2FA 1GDQA 1TBRH 2C8YB 1BRUP 1XXFA 3TGIE 5BPEA 2PTNA 4Y8ZA 4AC9A 1LQDB 3BTEE 3F6UH 1C1VH 2VIOA 2GD4B 1BMAA 1WUNH 1MTNB 1O5DH 1O3JA 1P3EA 1MD8A 1Q2WA 1GPZA 2ZA5A 3PWCA 4Y76A 1AVWA 1BTXA 1UTQA 1YPJH 4Z6AH 1O30A 1BIOA 2FOBA 2ZKSA 1GMDF 1HAGE 4F48B 3UNRA 5FXLA 1O2LA 5DG6A 1HJAC 1Z6JH 1GI4A 1A3EH 3A7YA 3P95A 4B2CA 2WSSD 3EQ0H 5FBEA 2ALVA 2BD7A 3AW1A 1D4PB 2Z9LA 6CHAB 2PGBB 3EAJA 2HPQH 1DDJA 1O3LA 2CXVA 2QV1A 3SV7A 1AE8H 2ZGXH 1ELTA 1IQMA 1YKTA 3STIA 1ANCA 3OTJE 5JB8S 1ZPBA 2VIVA 1Y5UT 2KM0A 1RTKA 4MPXA 5GCHG 2F9UA 5ETXA 2Y5GA 3QWCH 1H9LB 1GGDC 3LGTA 1WYKA 4U30A 2A2XH 2BD9A 1T31A 1W0KD 2V6NA 4GUXA 3SV2H 2P3UB 3SBKA 3SW2B 2JKHA 1SI5H 2AMDA 4MLFB 1JWTA 2AFQB 3Q76A 1PQAA 2VU8E 1ZLRA 4AN7A 1C1SA 1E0FD 2BDGA 4M7GA 3RXDA 1IQHA 1VJAU 1CGJE 1MZAA 2VVCA 1ETSH 2J9NA 3F2GA 1HCGA 1SOTA 2GCTB 4JZEH 3ATKA 3PM3A 4NCYA 3MMGA 3LGVA 4UEHH 1Y3YA 1Z8JB 5A8YA 1AQ7A 1P01A 3ZZ6A 3BTWE 5DKMA 3SI3H 2YMSC 2VJ1A 2V3HH 5HKKD 1GHAF 4CRAA 4K69A 1DX5M 3DFJA 3MNCA 2G52A 6LPRA 4ISNA 4IBLH 1K1LA 3F9GA 2J98B 1FJSA 2BQ6B 5FBIA 3RXKA 4PROA 3T25A 4E06H 1HIAA 1BRBE 1FAKH 4P00A 4AGKA 1GJ7B 2JETC 5GJ4B 3SOSA 5EQRA 2ZPRA 2ZPQA 1C2DA 4D9RA 4DCDA 1N6XA 1DSTA 1NFYA 4IW4E 3LH1A 3HGNA 1NRQH 2QXGA 3FZDA 4K1EA 5EIYA 1AD8H 3RXEA 3N7OA 5C94A 1BTYA 3A7XA 4AX9H 3GISB 2G4UA 3QO6A 3SU2A 1C4V2 3A88A 1YWUA 1P03A 1P12E 1GI9B 1P2MA 1TFXA 2VGCC 1CGHA 1IQJA 1JXPA 1BUIA 4ZKRU 1A0JA 1VKYA 3MO9A 4TWYA 4A1VA 2GMTB 1MAYA 1AVXA 4B2BA 3FFGA 1XKAC 3EDXB 1QIXB 2ZFRH 1LDTT 2GZ9A 3DSOA 1ELDE 1O3AA 3WW7A 1TBZH 1QJ1B 2FP7B 1FAXA 5FPYA 3OY6U 3V7TA 2PTCE 1YPEH 1XMNB 1HAOH 3RXFA 2XBWA 3NK8A 1HUTH 5EU8A 3GYMA 3LGUA 2PKSB 1C1TA 2P95A 4UONA 2J4IA 2ZHDA 1H8IH 3FP6E 4O3TA 2EY4C 1C2MA 2FXRA 5JBBS 2ILNA 4I8HA 3PO1C 1OOKB 3P92A 3BG8A 1K28D 1D3PB 1YLDA 1TGTA 4ABAA 4OS2A 1C1OA 2GTBA 2YNAA 1FZZA 3D23A 4NFFA 4NZQA 3SJIA 5C1UA 2OXSA 2AMQA 5FHTA 3Q3KA 4YLQH 2BD5A 6GCHF 2KCAA 3P8GA 1YGCH 4ZAEA 1F5KU 4GCHF 3LOXA 4JZ1A 3TIUA 2GX4A 3GYLB 2P3FH 1LHGH 4YXWD 1EAUA 1PPBH 3ODFA 4TPYA 5HIZA 4IS5A 4FUGA 1IQGA 4NWLA 1C1UH 1GDUA 1FXYA 1S0RA 1OHHD 2RDEA 2B8OH 1Y3UA 1O37A 1FY1A 2G00A 3I29A 1PQ5A 1TPPA 5EJZA 1HB0B 4WXVA 5JB9S 1C5QA 4KTCA 3SHAH 3SUGA 2ZC9H 3LGYA 4FUCA 2ZTYA 3RMLH 1ELGA 1Y5AT 4UFDH 1QZ8A 2A4QA 4AGJA 2BLWA 4NSYA 3U9AH 4FU8A 3WWBA 5GDSH 1F0RA 3QN7A 4BAHB 1BMMH 1AGJA 2Z9JA 1IOEA 1N6YA 3E0PB 5KEDA 3R3GB 1CT0E 1Z8GA 2GKVE 1TMUH 3AVZA 2V3MA 2SNWA 3ZZCA 2SNVA 4Y6DA 1GHVH 1A61H 2Z94A 4TYDA 1BDAA 4K1TA 3BTME 2R3YA 1W7GH 3KHVA 5C3NA 1AIXH 3S7KB 1BBRE 1HIAB 2THFB 3K9XB 1U6QA 1IAUA 2ZCHP 1L1GA 3KYGA 1JRTA 2BXTH 1WAYB 5L6NH 2OBQA 1ZSLA 3F9FA 1VGCC 4VGCC 2OTVA 2XC0A 1ZOMA 1UCYE 1GVLA 2BHGA 3QX5H 3RMOH 1S0QA 3A8CA 1O3PB 3ZZ3A 4RKJB 1K21H 1ESTA 1ZSJA 4XFQA 3TNTA 3P8FA 3MU4A 4A7IB 1HDTH 4O03A 4I7YH 1FN8A 2ZU2A 1FY5A 2GV6A 1A7SA 1LTOA 1DWDH 4Q7ZA 3NKKA 3ATIA 2P8OC 1AN1E 3LIWA 2Y7XA 1WU1A 3LPRA 4GVUA 1C2JA 1AU8A 1EPTC 4DOQA 5CDFE 5T3HA 3K2UA 1V2VT 1Y3VA 7GCHF 3UTUH 1ABIH 2QXJA 2NU3E 2VIQA 1GMHG 4M9FA 4ABJA 2GZ7A 4IC6A 1WV7H 4CHAC 1K2I1 5KECA 1W3CA 2JH0D 1F0TA 1NRNH 3BSQA 1DT2A 4ISLA 1A2CH 4B6FA 4TT3D 1CQQA 2ZHFH 1EOJA 4X6NA 3RC4A 1P2IA 3PMBB 2L74A 4MVNA 1NTPA 3QZRA 5FPTA 3EA7A 4ASUD 3M7QA 5EXLA 4RSPA 1SLXB 5A8ZA 3B8JA 2ZG0H 5DP9A 2QC2A 4LZ1H 1SG8B 1C1WH 2Z9KA 2G81E 2QY0B 1O0DH 3URDA 3P70B 3RXUA 2C8WB 1O2YA 2FOFA 3GS9A 3EA9A 1AKSB 3UNSA 1QQ4A 1Z7KA 3EGKH 4ZKSU 1NRRH 2FS9A 3LGIA 3DD2H 3NCLA 2G8TA 2ZDMA 2GV7A 2ZTZA 4CRBA 3LKWA 1N1LA 3M37A 1AZZA 5EJ1A 3BTQE 4B6EA 5C0UA 4E7RG 2P93A 1NBMD 3A8AA 2BOKA 4ABHA 3E0NB 2M5TA 1S6LA 4ZCNA 4I8JA 1YPGH 4MNWA 1J17T 4DIIH 1GBAA 1O38A 2FM2A 1OS8A 5JBCS 5LGOA 3CS7A 3RUOA 1AWFH 3SU1A 1ZJDA 5EW1H 1OYQA 2J95A 2G5VA 4FUHA 1GJ6A 1GWAA 4XOJA 1EAIA 3A7VA 3GDSA 1MBMA 4ABIA 1EKBB 7ESTE 3RM2H 5E0JA 1FPCH 1FIZA 3A7WA 3OU0A 1GVZA 2EA3A 1CU1A 1P3CA 2VIWA 1RXPA 4O9VA 3L3TA 4GAWA 1QB1A 5F8ZA 1C5YB 1SQRA 3UWJH 4U01A 1ZMJA 3QGNB 4B1TA 2C4FH 3GCHC 1ARBA 1O2TA 2A7CA 3C27B 1WTHD 4ZXYH 5A09A 1BB0B 5BRRE 1NZQH 1A5HA 1TNLA 2FOAA 2GJGA 3T62A 3BTKE 3R0FA 2KAIA 2BB4A 2QF5A 1C9TA 2OINA 4BTUB 1XKBC 1O2ZA 1MKXK 1UK4A 2EEKA 4NA8A 3UUZA 4DG4A 5CHBA 1BHXF 1F2SE 1KDQA 1BJVA 4NIVA 5J4QA 3MYWA 4SGBE 1XUHA 1O2QA 3RMMH 3VXFH 1TPSA 4KGAA 3RXCA 4AOQA 4WMFA 1CSOE 1KTSB 2SGEE 2KCYA 1THSH 5JPMH 3IITA 1UJ1A 3HK3B 3SUEA 1MTSA 1SFQB 2ZU4A 3AASA 2ODYB 3GCTF 3PRBA 2PSXA 1E37B 1ZHMA 3PMAB 1GG6C 8GCHF 2WPLS 1OWJA 1SGQE 4FUJA 1UTNA 1GBEA 1O2VA 2GZ8A 3U1IB 1ELFA 1XX9A 2Q1JA 3UQOA 3BG4C 3LJJA 1GHBG 1KXDA 4FU7A 5HIYA 1P09A 1TRNA 4MNVA 1WQSA 2Z7FE 2BDCA 2ULLA 1JOUB 1MH0A 1K0HA 1CT4E 1TNGA 4K1SA 1V2ST 4B2AA 1RJXB 1Y3XA 2XRCA 2TPIZ 2H5DA 3SZNA 4A6LA 1MZDA 1F7ZA 4X1QU 3JZ1B 5AF9H 1PFXC 4OS6A 1V2RT 1P2KA 1LVMA 1RIWC 1TX7A 2RDLA 1BJUA 1TNKA 1LCYA 2OCVB 1EJMA 1MU6B 1FQ3A 1S84A 1S85A 2ZGCA 1OSSA 1C2EA 2VGCB 3RXJA 1LO6A 1MUEB 5E2PA 1ZGIA 2AHME 2WYJA 3M35A 1G37A 1T4UH 3H7OA 3MH7A 3P17H 1KY9A 1VJ9U 2Z3CA 5FPSA 1DITH 3PLBA 1QGFA 1GCTB 1O34A 1SHYA 2C3SA 4X6MA 4XBDA 5C17A 2P59A 2A4RA 2Q6FA 2J98A 1GBCA 4JZDH 1ZZZA 1LPGB 1SGRE 1Y59T 2BZAA 1G36A 4MG3A 1ELEE 2OC0A 3CP7A 3CENA 2SGAA 1O2XA 4YLUA 1FLEE 1LVBA 1GJ4H 3FP8E 1IQNA 1GI7B 2R0LA 2ZHQH 3VB5A 2CGAA 1DWEH 2ZDNA 4KTSA 3OSYA 3RP2A 1LPKB 1SLUB 1ELAA 1YPKH 1UTKA 1C5NH 3NPSA 3SU0A 3VEQB 1NN6A 4GPGA 4OGYA 1NFWA 3VGCC 3SN8A 2AGIX 1FDPA 1UK2A 3UREA 2ANYA 1HAVA 4FVBA 1FONA 4OS1A 1ZR0A 2HNTE 1QRZA 2Z9IA 3FOAA 5FX5A 3RC5A 1PYTC 1SL3A 4X8UH 1AUJA 3O8RA 2A1DB 1TB6H 3SV6A 3L33A 1QY6A 3QTVH 2ZPSA 1IQEA 1EATA 2RFKC 4TY6A 2KAIB 3FAOA 2TGTA 1ZHRA 4U2WA 2GDEH 2C93B 1VITG 1GJBB 2FESH 5PTPA 1YBWA 2BVXH 5L2YH 2W7SA 1ZGVA 2SGDE 1D6WA 1O3FA 1KDQB 2FS8A 2YNBA 5ESBA 1Q31A 4WWYA 4BTIB 2QYIA 1D3TB 2ZWLH 1CBWC 1ETRH 1QB9A 5DP8A 1GBKA 1S5SA 3P8OA 2FOEA 2C8ZB 3GDVA 1GBHA 3K65B 3TH2H 1EJAA 2ZU3A 3A89A 3A7TA 1CA0C 4X1RU 2DE9A 1EOLA 3A8BA 4IGDA 2BQWB 4Y7AA 1HJ9A 3SORA 1SGNE 3SHCH 5K7RA 1ZPZA 5IYTA 1P57B 3DSPA 3T26A 5GPIB 3RXQA 1XUKA 2WYGA 2JDID 1TABE 1J8AA 2XNDD 4BXSA 5DP5A 1Q3XA 1ID5H 3KQCA 1DXPA 1K1OA 2F9VA 2Z3EA 3F68H 5T6DA 4BAQB 1FUJA 1UTOA 4NIWA 1TGSZ 1WDIA 1O3OA 3LC5A 4D9QA 1GI6A 3RU4T 4JYVH 1GJAB 3DCLA 3PLKA 1ZYOA 3O8CA 2ZF0H 2LNCA 5CHAB 1UK3A 2BDIA 1C1MA 3PB1E 2VVUA 1GHWH 2VVVA 2NU1E 1OKXA 2EI6A 3RU4E 2R3UA 1AHTH 4XBBA 5HXFA 2HVYB 4NA9H 1O2IA 3M36A 1C5RA 2PKAA 3RMNH 1L4DA 3AK5A 1PJPA 1P2QA 1OP2A 4D7FA 2ZFPH 1OWKA 2FI4E 2V0BA 3A84A 1E1QD 3ZZ8A 1O3EA 4A1TA 4ZXXH 2OBOA 2ZQ2A 4AFSA 3SGBE 1LKBA 2OQUA 2VH6A 2QF0A 3V0XA 2P8OB 3NWUA 3TJVA 1YCPM 3U8RH 4D76A 5AHGH 3A81A 1C5XB 1XUFA 1GI0A 3F1SB 1CHOG 1FMGA 1GMDG 2HNTC 2VH0A 1ZPCA 1C5PA 2H6MA 2IPQX 2ZDAH 1EFRD 4ESTE 3GDUA 4NZLA 5JYIA 1LHEH 3KQEA 1TMBH 5DGJA 4E7NA 2BOHB 4XBCA 1NRSH 2D26C 1LPZB 2Y7ZA 2BD8A 2WPIS 2BLQA 1P8VC 3BIVH 2W26A 5EPNA 1GBIA 2WV4A 3BF6H 5JDUB 1BTWA 3A82A 1BRCE 3M5OA 1HAVB 2ZFTA 3VB6A 2ZFFH 5FCRA 4AG1A 2VWOA 2ANWA 2OD3B 1E34B 2Z9GA 2XOKD 2BDAA 4D7GA 5FCKA 1SPJA 3ELAH 3F3BA 4YESB 3LGWA 1O3BA 1KIGH 1AFQB 1DLKB 2DE8A 3ZIAD 2UUYA 2BXUH 2Y5FA 3BTDE 3MU1A 2XCFA 1BOQA 3AAVA 2PGQB 3SGAE 3F2FA 5HMAA 3LU9B 1ABJH 5T6GA 2JJ1D 3DA9B 1C2LA 1O5AB 3P6ZB 1F0SA 5FL7D 4DT7B 3UOPA 1EP6A 3F9HA 1YLCA 1EXFA 2KCOA 4Z0KA 1LHDH 1XXDA 1TNHA 3MI4A 1A4WH 1TE0A 3SU4A 2G4TA 1BT7A 1KXAA 2RA3A 4OS4A 2ZNKH 2F9OA 2Y80A 1UVPA 2FLRH 4B75A 1O2SA 1S81A 4FU9A 5A0BA 3QDZB 1MKXH 1W7XH 1V2LT 1UVOA 1O5BB 2O8WA 1BHXB 5EG4A 3HKIB 1YLNA 2CHAC 3SUDA 2KZ4A 2P3TB 3RXOA 1KTTB 4TSFD 4OM9A 1CT2E 3SJOA 3STJA 1NPMA 4RKOB 2XTTB 4Y0YE 1MABB 1ZHPA 4J2YB 1TX8A 1A1RA 1VCWA 2NWNA 4X6OA 4J1YA 1ELVA 3S0NA 4KTUA 1KXEA 1AKSA 2PUQH 2WUCA 4B76A 3O8DA 1P05A 3T5FH 1DE7H 1G3DA 1W2KH 2F83A 2ZP0H 1EP5A 5EQQA 2AGGX 3D49H 3SJ9A 1ZTJA 1ANEA 5GNDA 3PLPA 4Y79A 2XCNA 4CBNA 1AMHA 1GBFA 1YM0A 3PMHB 1MTNC 2PKAB 4DIHH 2FTMA 3SNCA 5ABWA 1A46H 4CRGA 1GVKB 1MBQA 2CF9H 2R2WU 2C8XB 4FUIA 1TX6A 3BEUA 3AW0A 3VPKA 1RTLA 3GY3A 2DUCA 3FKSD 4ABDA 1Z8RA 1LKAA 6CHAC 3LONA 4H4FA 2V35A 3T28A 4ACAA 2FMJA 1O2MA 2Y82A 2TRMA 3W1EA 5HM2A 2YMSD 3UQVA 1OWIA 1QNJA 1C1QA 2WPJS 4GSOA 3TJUA 4A5TS 1QA7A 2BM2A 4ISHH 1TONA 1QL9A 4WH8A 3IG6B 1B7XB 1GI8B 1WTGH 1T8NA 2H9TH 3C1KA 4WJG2 4UFEH 1NT1A 1QJ6B 1B5GH 2ZGHA 3GY4A 1H9HE 1FY8E 2K1QA 1WBGB 2WV9A 1GJ9B 6GCHG 1H4WA 2QE7D 4B74A 1KMHB 4JCNA 4GCHG 2JIZD 1O2RA 4RT1A 1HNEE 1DWCH 5E8EH 3T2NA 1QCPA 3KYFA 1QQUA 2ZDLA 1N8OC 3GICB 3KQ5A 2BD2A 4ZMAH 2GCTC 1W8BH 3U8TH 4XE4A 2JH6D 1QA0A 5F8XA 3VB3A 5L30H 3LJOA 2W6ID 1P9SA 4P02A 4JK6A 4WVPE 5JBAS 1L0ZA 1E35B 1NY22 2QXIA 1TQ0B 1TMTH 1PPGE 2J2UA 5K0HA 1LQEA 4GHTA 2AERH 5EGMA 3PTNA 3SZEA 3F0OA 5EXNA 3ATLA 1EZXC 1F0UA 2RG3A 3RXRA 3B23B 9ESTA 4AZ2B 1HAPH 2FI3E 3FP7E 4OS5A 2F3CE 1JMOH 3MQKC 4JMYA 2W3KA 2BX4A 3E1XB 3MU0A 3H09A 3H5CB 4DT4A 2ZIQH 4YT7H 3OE7D 1SQTA 2BDYA 3TK6A 4ABBA 4ZHAA 1QL8A 2EI7A 2AS9A 1NFXA 3GY6A 5TCAA 1H8HD 3SNDA 1QFKH 8ESTE 1A0LA 1O2JA 1C2IA 3DT0H 3V12A 1FX0B 1OXGA 2ZCKP 3GCOA 4IC5A 4CRDA 2FOMB 2W7UA 2L6OA 1YPMH 1WCZA 2GMTC 3OY5U 4RI0A 1CHGA 3VB4A 1QRWA 3ITIA 1TGBA 1L2EA 2CF8H 1ZTLA 2K8IA 3KL6A 2CJIA 3VGCB 4ZKOU 3TLOA 3NZIA 1IQIA 1IQFA 3U1JB 1AO5A 1V2KT 2B9LA 5LPFA 1BA8B 2F43B 3N7DA 4ZUHA 1QBNA 5EJLA 1RFNA 2PUXB 3GOVB 1O3IA 2STAE 2LPRA 3M3VA 2VWNA 4XD7D 3S9BA 3HK6B 2PKSC 4H6TA 3UNQA 2Q6GA 2FLBH 2O8MA 2NU0E 2AIQA 1O2WA 3UY9A 5I46H 1SMFE 1GBTA 2ZTXA 5KGOA 5L2ZH 3RC6A 2UUJB 1RRKA 1EZSC 4Y11E 4AG2A 1HJAB 1MAXA 5C5OA 3B9FH 1UO6A 7LPRA 3ZZ5A 3TU7H 7GCHG 3QTOH 1BBRK 2XXLA 1TNJA 3BEIB 1TAWA 1C2GA 1O2KA 2BY5X 1DXWA 3TGKE 1T8MA 5C5NA 1AB9C 2GGVB 4MTBA 3MFJA 2GVFA 6ESTA 3SNAA 1CO7E 1K1IA 1JBUH 3M5NA 4CRFA 1O2UA 2UWOA 3RXPA 1GGDB 5LH8A 5EQSA 1UCYK 3HGPA 2HRVA 3MO6A 3ZV9A 1SGCA 1SGEE 2A4OA 3HPTB 4CRCA 2UUFB 2PLXA 2SGPE 3ENSB 4NSVA 4TPIZ 2UWPA 3U69H 3A8DA 5E2OA 4K2YA 3MHWU 2EC9H 2H9HA 2KR7A 4X1SU 2QCYA 4KKDA 3LH3A 4Y8XA 4TWWA 1O39A 1ELBA 3OAAD 3UIRA 1UTPA 1O2PA 1TIOA 3LT3A 4Y10E 1GMCF 1X7AC 1AVGH 4Q80A 3O8BA 3E91A 1GI3A 5IK2D 2F9BH 1D6RA 1TWXB 3E3TA 5B6LA 2KFWA 2OC7A 2D1JA 2QN5T 2AMPA 4Q2KA 1TLDA 4DJZB 4FOUC 4X2WA 1DY8A 2YMSB 4YZUA 1MQ6A 2W6JD 1UVSH 3MNBA 3SYJA 1JIRA 2G51A 3FO8D 3TH3H 1HRTH 2FWWA 5DSFA 2A32A 1SSXA 3F2HA 1PPZA 2WPDD 1THRH 2O8TA 1XM1A 1BMNH 2FTLE 3S69A 2WPKS 2V7QD 1MKWK 2JETB 5C2ZA 1IQKA 2PHBA 1O2OA 2LELA 1DM4B 8LPRA 1T8OA 3I77A 5C1XA 1UTMA 4QT8C 4AB8A 3N7EA 1C5OH 5G4BA 1IQLA 4WMDA 4FUBA 5T1VA 4AFUA 5SGAE 2A0QB 3W95A 3SNBA 1KSNA 1YF4A 2RCEA 5I25A 1G9IE 4X6PA 5AFYH 3SU5A 1C5ZB 1VR1H 2J38A 5A8XA 1G3CA 4I86A 1M9UA 2NU4E 2WHXA 1VITF 4I33A 1C2KA 4ABEA 1SQOA 4H6SB 1GHZA 1ANDA 1KYNA 3V3MA 1C1NA 2ANMH 3SV8A 3SNEA 1G2MA 1BRAA 2OLGA 1Z8IB 2GT7A 1XUGA 2BQ7B 3KN2A 4X8SH 4LZ4B 4O3UA 2P16A 2BVSH 2A4GA 1BCUH 3RXTA 5DK1A 1EPTA 2PWXA 1RGQA 2TGAA 2BVRH 1QB6A 4F55A 1NC6A 2F9NA 1DPOA 2B7DH 3GCNA 5H4IB 5GCHF 1ESBA 3KQBA 1UVUH 1IHSH 4JZIA 1HBTH 4R8TB 1GI5A 3PO1B 2I6SA 4Y0ZE 3MU8A 4X0WU 1D3DB 1FIWA 2HVXA 1EQ9A 2H1UA 4KELA 3GCTG 3KEEA 4X1NU 5GXPA 1AFEH 1GBBA 1SGFA 1ANBA 1TOCB 1JIMA 5C1YA 8GCHG 4X2XA 4BTTB 1EB1H 1KLTA 3BEFB 2V3OH 3RXIA 3PV2A 2BLOA 4CR5A 4MDSA 2OQ5A 2H9EH 1O3HA 1P2NA 3NRLA 4HFPB 3N99A 3V13A 1V2WT 4K8BA 2HPPH 5T6FA 3A86A 2O8LA 4LXBH 5B6OA 1O33A 2BYAX 2PR3A 4RT0A 3S9AA 1DLEA 2K0QA 4UDWH 2ZO3H 3PYHA 3SO3A 3ZVBA 1QL7A 1SKYE 1B0EA 2A31A 4OS7A 1GJ8B 4BAMB 1Y3WA 3Q00A 3BTFE 1IHTH 1C5SA 3Q77A 3VB7A 2BZ6H 1LHCH 1LVOA 1SHHB 4GHQA
chains in the Genus database with same CATH topology
2FOGA 1O3CA 4JYTA 1O3NA 3SUFA 2BD3A 2ESTE 5DP4A 3DHKH 5F6MA 2IOTA 2ZFSA 4O97A 1TNIA 1V2MT 1CHOF 2FO9A 2I6QA 4MPVA 1NM6A 2GCHG 3UPEA 2QAAA 1SC8U 3F9EA 3UR9A 1TPOA 1H9IE 3K6YA 1HAIH 2VWMA 1MTWA 3ZZBA 3MWIU 2R0KA 3OEHD 3TJNA 1W10U 1C4U2 3RM0H 5A0CA 1O5FH 2HALA 2ZDVH 1C5MD 5C67A 4MPWA 2FYRA 2IJOB 3ZVGA 4TY7A 1DWBH 1PPFE 4XDEA 3RXLA 5DN6D 1HAHH 4X2VA 2CN0H 3TITA 2XWBI 4U32A 4JYUH 1A5IA 1THPB 3BTHE 3M3TA 2XBYA 1VGCB 4VGCB 4NGAH 2ZHEH 4YM9A 1WQVH 2TBSA 3BN9A 2FOHA 1EB2A 2AYWA 2J94A 2BMGB 3KCGH 3PROA 1V3XA 1S83A 2FDAA 2QA9E 1BMLA 1COWD 1YP9A 2IJD1 1HGTH 4AFZA 1SLWB 1F5RA 1E1RD 1S6HA 4JZFH 3SI4H 3TK5A 3GY2A 1GBJA 1S6FA 3MNSA 3SQEE 1BMFD 1WOFA 2FODA 3EE0B 5DJ7A 4Q7XA 1N8OB 3TPIZ 5A0AE 2ZEBA 2D2DA 1SVPA 1YYY1 2WUBA 3P8NA 2QF4A 3GY7A 1OP8A 1INCA 1EPTB 2FPZA 2ZQ1A 1ACBE 2IPHA 3OFND 4A92A 1XUJA 3SJ8A 1J16A 5LPEA 1TGCA 3UWIA 1NBME 4AYVB 2A7HA 1BTPA 2F4LA 2WINI 3FN8A 1O32A 4K8YA 4R0IA 3FZZA 1GCDA 1GJDB 4RN6A 2ZECA 1HLTH 3MU5A 3G01A 5HGGA 1DICA 3U8OH 1T4VH 5ESTE 4MNYA 1L1JA 3E6PH 4CHAB 4A1XA 2FYQA 2ZGJA 4K60A 2A5IA 2VBCA 1BITA 2FIRH 3QZQA 1AE5A 2XC4A 1YCPK 4X1PU 4AFQA 2ALPA 3ESTA 1AUTC 1SFIA 2PSYA 1FN6A 1XVMA 1HXEH 2Y6TA 1Z1IA 2TIOA 1SBWA 1BBRH 2Z3DA 4MQAA 4YO9A 1A0HB 1MCTA 1QHRB 2OK5A 2XC5A 3TH4H 2H2ZA 1DSUA 3TGJE 1C4Y2 1AY6H 1B0FA 5HM9A 1O3DA 3U98H 1DVAH 1PYTD 3T29A 3UR6A 3ZZ4A 4Q63A 2XNIA 1UCYH 3M5LA 1GCTC 2CK3D 3DFLA 1A5GH 1DS2E 2HNTF 1CVWH 1HPGA 2O9QA 2YOLA 1TQ7B 3TK9A 1ELCA 2QGRA 2Z6BD 1C1RA 4UFGH 4LOYH 1YC0A 2ANKH 2RA0A 4I32A 1GHAG 1H8DH 3PV4A 3RDZA 4I8GA 3RXVA 3AAUA 1PPCE 3K6ZA 1ZRKA 3QK1A 4YTAA 1HAZB 1K1NA 2FX6A 1CGIE 3SJKA 3RXAA 1E79D 4ASHA 1EJNA 1DFPA 4INLA 2VNTA 1TPAE 3E8LA 4NFEA 3RXBA 1BTHH 2F9PA 3HATH 3ODDA 3ZVEA 1Y5BT 1AB9B 1MTUA 3ZZAA 3ZZDA 1ARCA 1P02A 3MH6A 2QF3A 1YPHE 1MQ5A 3I78A 3GCHB 4AORA 4AYYB 4YOIA 1P9UA 1TRMA 1MKWH 1VITH 1RD3B 3ZVAA 1V2PT 4D8NA 1W0ZU 3KGPA 3GY5A 1C5VA 2B5TB 4CH8B 3T27A 1HAXB 1EUFA 1QRXA 3Q3YA 1GMHF 2HWLB 5F8TA 3M5MA 4HZHA 4WF8A 4B71A 1RTFB 5EPYA 3KIDU 1RS0A 5A2MH 4Q7YA 4WH6A 1O2GH 2P94A 2HGTH 3FANA 5EODA 3QGJA 1KLIH 1GL0E 4I8LA 5FX6A 1ZJKA 4HI3A 1FI8A 1KXBA 1W11U 1GG6B 1J14A 1T32A 5CE1A 4ZKNU 1ZMLA 9LPRA 4B73A 4Z1MD 2SGFE 1QURH 4ABFA 1KLJH 1O5GH 2TGPZ 1P2OA 1T7CA 1OWEA 5CHAC 1FV9A 1GDNA 2A45B 3BG4B 2JJ2D 1UMAH 1YPLH 3W94A 1K1JA 3URCA 1AWHB 1HAYB 1ZMNA 3WWFA 4F49A 3MOCA 1SOZA 2J34A 1Z6EA 2HLDD 1J9CH 1V2OT 1GBMA 1QBVH 1PQ8A 1VCPA 3PTBA 1GJCB 3M7TA 1GHXH 2XYAA 2ZI2H 1SR5C 1G3EA 5HYOA 1RIWB 2BLVA 5E0HA 1UVTH 4ABGA 4I31A 5C20A 4NIXA 4UFFH 3VG8A 1Z71A 2BY6X 4NG9H 3VXEH 3VFEA 2EI8A 3M3SA 1D3QB 1H1BA 2M2AA 3OTPA 2UUKB 2FOCA 2OC8A 1HFDA 3JZ2B 1ETTH 1HYLA 1XVOA 2BDHA 2IN2A 4HTCH 3UFAA 1VCQA 2QIQA 1SLVB 1LMWB 1SB1H 2PFEA 2SGQE 1KXCA 5CMXH 1SGPE 4Y8YA 2FX4A 3ZV8A 4WXIA 2BY9X 4SGAE 1GHYH 1OX1A 1PPHE 4ZHLU 4BNRA 2VB0A 3ZZ9A 1G3BA 2G5NA 1QJ7B 3RXGA 4Q4LA 4GLYA 1HV7A 1F92A 3TJOA 1YPHC 1O5CB 1DUAA 4DY7B 1V2TT 1V2QT 1EZUC 1C5WB 3RXSA 1P2JA 1TA2A 4ISIH 4AB9A 3SU3A 2XBXA 2FI5E 3BV9B 4ISOA 3IWMA 3TVJB 3RU4D 1F5LA 3MH5A 3PRDA 1J15A 1L1NA 3D65E 4DGJA 5TJXA 1HXFH 5J4SA 1A3BH 3SGQE 2O8UA 4INKA 1UTLM 2SFAA 8KME2 1NROH 1AFQC 2W3IA 1ZSKA 2HLCA 2BD4A 4NIYA 1TOMH 1AI8H 2ZFQH 4BAOB 4WMEA 1G2LA 2FZZA 1CA8B 3DUXH 3OYPA 1O3MA 2KCPA 5DO4H 1E36B 1FPHH 1TGNA 1TRYA 4UD9H 2ODQA 1MU8B 1NFUA 1P04A 2FEQH 1V2NT 2VIDA 3L6PA 1NO9H 2BTCE 5DP7A 2ZU1A 2A7JA 3ZVFA 1PQ7A 2ZU5A 1DOJA 1E38B 1ESAA 1EAXA 1K1MA 2BDBA 4BAKB 1CBWB 2CV3A 1ORFA 1GL1A 1UTJA 3F0PA 3PWBA 5EOKA 1KXFA 2G55A 1O35A 1UHBA 1GHBF 4MPUA 1C2HA 4CR9A 2ODPA 4X2YA 1SGTA 4BXWA 1CA0B 4DW2U 1P0SH 2Y81A 4THNH 3A85A 1V6DA 3M7UA 1P11E 4NWKA 4FUDA 1LVYA 1NRPH 5F53A 1TYNA 4IMZA 4IMQA 1MD7A 1OWDA 4IN1A 2A5AA 4YOGA 1WXRA 3OX7U 4XSKU 1MMJN 2R9PA 5JBTA 2QXHA 1FY3A 4FUFA 4Y71A 3RLWH 2UWLA 3MTYA 4WY3A 3QUMP 1Y8TA 1O3KA 4LK4A 1BQYA 1K1PA 5F03A 1O31A 4IN2A 1FY4A 1NS3A 1V2UT 1O2HA 4CREA 3D62A 3QLPH 1OPHB 1LHFH 4FETA 4CBOA 2JH5D 1GBDA 3UOUA 1BTZA 2HOBA 2A5KA 2BY8X 1YCPH 2R2MB 2XWAA 1SGDE 3MH4A 3S9CA 1L4ZA 2ASUB 4E05H 5DP6A 4INHA 1NU7B 1NESE 3KNXA 1W0JD 3SV9A 3EYDA 2GDDA 4FUEA 3ZVDA 3ZZ7A 2BX3A 1WSSH 3MO3A 3NUMA 4ZHMU 2VWLA 2J92A 1W12U 1SGYE 1QBOA 1O2NA 2WPMS 1D9IA 3BIUH 1C5UA 1CE5A 3FVFB 1V2JT 2AEIH 1O36A 1HJ8A 4ZROA 1SQAA 1DANH 5AFZH 4BOHA 4K3JA 3Q3XA 5EXMA 1SGFG 3KF2A 5TCCA 1QR3E 2CMYA 2Q6DA 4KP0A 1GBLA 3BTTE 3UB0A 2GP9B 2A2QH 2BY7X 3WY8A 1MCVA 1OWHA 3CS0A 3S7HB 1K9OE 1W13U 1TA6A 4FVDA 1ZTKA 4ZH8A 4MNXA 1FNIA 5C0TA 2OP9A 1P10A 2VIPA 4YT6H 1MTVA 1QTFA 1SGIB 1P06A 3HKJB 4DVAU 1K22H 1GI1A 1TBQH 1C5LH 2STBE 3ATMA 2AH4X 7KMEH 2ZGBH 1VZQH 1OP0A 1TALA 2XW9A 1GJ5H 2OC1A 3A7ZA 2ZCLP 4YOJA 3EA8A 2VINA 1W14U 2WV5A 2PW8H 1PPEE 2H5CA 3A80A 1T8LA 1H8ED 2WZQA 2XBVA 1EASA 4X8TH 1C5TA 2D8WA 1EZQA 3SU6A 4NA7A 4CH2B 3E16B 4DURA 3ZYDA 1BTUA 1C9PA 1DY9A 1JRSA 2F91A 5DP3A 2ZHWH 1GI2A 2ZDKA 4UE7H 5IDKA 3A87A 2GT8A 5GIBA 1G32B 3RXHA 2C90B 4K5ZA 3ZVCA 1AZ8A 2GCHF 3RLYH 4FXGH 4HGCA 4I8KA 1W0YH 5LPRA 2TGDA 3ATWA 1EAWA 1ZRBA 2J5UA 3OEED 3M61U 3LC3A 1GMCG 1O3GA 4JK5A 4Y7BA 5FAHA 3RXMA 1EX3A 5GWZA 3NXPA 1UHBB 1XUIA 1G30B 3LDXH 5AVDA 2WPHS 5EW2H 1S82A 3E90B 3H7TA 3PMJA 1NU9A 3MNXA 1BZXE 4BANB 1C1PA 3TNSA 3BTGE 3ZYEA 3SQHE 2AGEX 1OYTH 3GY8A 4X8VH 3PV5A 2CHAB 2NU2E 1Z1JA 4F4OC 4H42U 5E0GA 2Y5HA 5DPAA 2W5EA 3KQDA 2ZZUH 1O5EH 1DUEA 3A83A 2AIPA 2B0FA 2OUAA 4OGXA 2PV9B 1C2FA 1GDQA 1TBRH 2C8YB 1BRUP 1XXFA 3TGIE 5BPEA 2PTNA 4Y8ZA 1LQDB 3BTEE 3F6UH 1C1VH 2VIOA 2GD4B 1BMAA 1WUNH 1MTNB 1O5DH 1O3JA 1P3EA 1MD8A 1Q2WA 1GPZA 2ZA5A 3PWCA 4Y76A 1AVWA 1BTXA 1UTQA 1YPJH 4Z6AH 1O30A 1BIOA 2FOBA 2ZKSA 1GMDF 1HAGE 3UNRA 5FXLA 1O2LA 5DG6A 1HJAC 1Z6JH 1GI4A 1A3EH 3A7YA 3P95A 4B2CA 2WSSD 3EQ0H 5FBEA 2ALVA 2BD7A 3AW1A 1D4PB 2Z9LA 6CHAB 2PGBB 3EAJA 2HPQH 1DDJA 1O3LA 2CXVA 2QV1A 3SV7A 1AE8H 2ZGXH 1ELTA 1IQMA 1YKTA 3STIA 1ANCA 3OTJE 5JB8S 1ZPBA 2VIVA 1Y5UT 2KM0A 1RTKA 4MPXA 5GCHG 2F9UA 5ETXA 2Y5GA 3QWCH 1H9LB 1GGDC 3LGTA 1WYKA 4U30A 2A2XH 2BD9A 1T31A 1W0KD 2V6NA 4GUXA 3SV2H 2P3UB 3SBKA 3SW2B 2JKHA 1SI5H 2AMDA 4MLFB 1JWTA 2AFQB 3Q76A 1PQAA 2VU8E 1ZLRA 4AN7A 1C1SA 1E0FD 2BDGA 4M7GA 3RXDA 1IQHA 1VJAU 1CGJE 1MZAA 2VVCA 1ETSH 2J9NA 3F2GA 1HCGA 1SOTA 2GCTB 4JZEH 3ATKA 3PM3A 4NCYA 3MMGA 3LGVA 4UEHH 1Y3YA 1Z8JB 5A8YA 1AQ7A 1P01A 3ZZ6A 3BTWE 5DKMA 3SI3H 2YMSC 2VJ1A 2V3HH 5HKKD 1GHAF 4CRAA 4K69A 1DX5M 3DFJA 3MNCA 2G52A 6LPRA 4ISNA 4IBLH 1K1LA 3F9GA 1FJSA 2BQ6B 5FBIA 3RXKA 4PROA 3T25A 4E06H 1HIAA 1BRBE 1FAKH 4AGKA 1GJ7B 2JETC 5GJ4B 3SOSA 5EQRA 2ZPRA 2ZPQA 1C2DA 4D9RA 4DCDA 1N6XA 1DSTA 1NFYA 4IW4E 3LH1A 3HGNA 1NRQH 2QXGA 3FZDA 4K1EA 1AD8H 3RXEA 3N7OA 1BTYA 3A7XA 4AX9H 3GISB 2G4UA 3QO6A 3SU2A 1C4V2 3A88A 1P03A 1P12E 1GI9B 1P2MA 1TFXA 2VGCC 1CGHA 1IQJA 1JXPA 1BUIA 4ZKRU 1A0JA 3MO9A 4TWYA 4A1VA 2GMTB 1MAYA 1AVXA 4B2BA 3FFGA 1XKAC 3EDXB 1QIXB 2ZFRH 1LDTT 2GZ9A 3DSOA 1ELDE 1O3AA 3WW7A 1TBZH 1QJ1B 2FP7B 1FAXA 5FPYA 3OY6U 3V7TA 2PTCE 1YPEH 1XMNB 1HAOH 3RXFA 2XBWA 3NK8A 1HUTH 5EU8A 3GYMA 3LGUA 2PKSB 1C1TA 2P95A 4UONA 2J4IA 2ZHDA 1H8IH 3FP6E 4O3TA 2FXRA 1C2MA 5JBBS 2ILNA 4I8HA 3PO1C 1OOKB 3P92A 3BG8A 1K28D 1D3PB 1YLDA 1TGTA 4ABAA 4OS2A 1C1OA 2GTBA 2YNAA 1FZZA 3D23A 4NFFA 4NZQA 3SJIA 5C1UA 2OXSA 2AMQA 5FHTA 3Q3KA 4YLQH 2BD5A 6GCHF 2KCAA 3P8GA 1YGCH 4ZAEA 1F5KU 4GCHF 3LOXA 4JZ1A 3TIUA 2GX4A 3GYLB 2P3FH 1LHGH 4YXWD 1EAUA 1PPBH 3ODFA 4TPYA 4IS5A 4FUGA 1IQGA 4NWLA 1C1UH 1GDUA 1FXYA 1S0RA 1OHHD 2B8OH 1Y3UA 1O37A 1FY1A 2G00A 3I29A 1PQ5A 1TPPA 1HB0B 4WXVA 5JB9S 1C5QA 4KTCA 3SHAH 3SUGA 2ZC9H 3LGYA 4FUCA 2ZTYA 3RMLH 1ELGA 1Y5AT 4UFDH 2A4QA 4AGJA 2BLWA 4NSYA 3U9AH 4FU8A 3WWBA 5GDSH 1F0RA 3QN7A 4BAHB 1BMMH 1AGJA 2Z9JA 1IOEA 1N6YA 3E0PB 3R3GB 1CT0E 1Z8GA 2GKVE 1TMUH 3AVZA 2SNWA 3ZZCA 2SNVA 4Y6DA 1GHVH 1A61H 2Z94A 4TYDA 1BDAA 4K1TA 3BTME 2R3YA 1W7GH 3KHVA 5C3NA 1AIXH