1DXPA

Inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
175
structure length
175
Chain Sequence
b'APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE/HELICASE NS3 (P70)
molecule tags Hydrolase
source organism Hepatitis c virus (isolate taiwan)
publication title Inhibition of the Hepatitis C Virus Ns3/4A Protease the Crystal Structures of Two Protease-Inhibitor Complexes
pubmed doi rcsb
total genus 36
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxpA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxpA01
4YLUA 1G30B 3SBKA 3SU0A 4X1SU 1O2SA 3QLPH 4Z6AH 1TQ7B 1MCVA 1TNJA 5EU8A 2JH6D 1MMJN 3URCA 1O37A 1GGDB 2SFAA 1SQAA 1GG6B 1VJAU 1L1JA 1HYLA 4YLQH 1T8MA 4ISOA 2ZI2H 1FLEE 1VZQH 1O3CA 4D8NA 5E0HA 5C5OA 1XX9A 3A7TA 2W26A 1H8DH 2J2UA 3PWBA 3RP2A 3O8DA 5DP9A 1NC6A 3H7TA 3SJ8A 3A88A 3SZNA 3ZZAA 1XKAC 1OWJA 3RXJA 1NTPA 5EQSA 1UK4A 3DD2H 4MTBA 2FIRH 4ABHA 4OS2A 3QZQA 1DE7H 4KTUA 4ISLA 3RXIA 2VNTA 3B9FH 1NFUA 3ZVCA 2CMYA 1TALA 3UQOA 5K7RA 3MFJA 1WQSA 1V2QT 2FS8A 1V3XA 3AK5A 1JMOH 3LGIA 3SV8A 2BVSH 2Z9KA 4D7FA 4DIIH 3DFJA 3GCHC 3TLOA 3F6UH 2FTLE 2BD3A 1A3BH 1KDQA 4BOHA 1TX8A 3CP7A 2FP7B 1AFQC 1BMAA 1Z1JA 1LQEA 1A5IA 1JRSA 5T6GA 2PKSB 5DGJA 3MTYA 3NK8A 3CENA 3E90B 3KCGH 2R3UA 3ODDA 5GCHF 1A5HA 4XBDA 4XFQA 4Y8ZA 1WUNH 1YLDA 1NRQH 2ULLA 2CN0H 1ZJKA 1HAGE 3KQCA 4XBBA 3U98H 3U69H 1KY9A 1SR5C 1XUHA 4Y79A 5L30H 1V2ST 1FY5A 3ZVEA 1O2UA 2PUXB 2ZP0H 1KXFA 4GUXA 1AZZA 2XWBI 1ELDE 1T8OA 2QIQA 4I8KA 1GJ7B 2JETC 1O2YA 1AKSB 2AS9A 3C27B 4GHTA 1HAVB 3SNAA 1BQYA 2R2MB 3RXBA 3PWCA 4X1RU 2PKSC 4MLFB 2QV1A 3RXFA 2VWOA 2FOHA 1DWDH 4GHQA 1O5CB 5DP4A 2ZPQA 2GCHG 1AGJA 3IG6B 1UVSH 4TWWA 5FXLA 2GV7A 4X2XA 3SU5A 2EEKA 2HPPH 1RTFB 2GKVE 1P9UA 2HWLB 3EAJA 4WH8A 1EP5A 2PSYA 1C2FA 4MQAA 5AFZH 4RI0A 3JZ2B 3U1JB 4YTAA 2J9NA 3V13A 4YT6H 2Z3CA 4UEHH 1O2ZA 4F4OC 1SGCA 2PV9B 1SOZA 1P0SH 1JIMA 2ZDNA 2O8LA 1S5SA 2RCEA 1V2PT 1AN1E 1C5QA 5GIBA 5CMXH 5GDSH 1BTWA 2ANWA 2FO9A 1BTHH 1E0FD 4E05H 4MDSA 4Y71A 1EOLA 3TK5A 4X8SH 5DG6A 3SJIA 3RC5A 3BTQE 5FPSA 5HM2A 2XYAA 3PYHA 1JIRA 1GJ8B 1F0TA 3S7KB 3PMJA 3VFEA 3ZZ3A 3KF2A 4A7IB 2G4UA 1HAZB 1TGSZ 3RXEA 1BTZA 1CGHA 2F9BH 1RIWB 1BIOA 1TOCB 1OXGA 3SUFA 2BD7A 1EXFA 2ZIQH 3S9BA 3A85A 2VBCA 2H9EH 1AUTC 4FUDA 2FXRA 1SGFG 4FXGH 1K2I1 4CHAB 1C1MA 1P2IA 2FI4E 5EW2H 1U6QA 2GT7A 1AQ7A 1BJUA 3SUEA 4O3TA 1KXEA 2LPRA 3A7VA 2ZA5A 3TGIE 4TY6A 3BEIB 4R0IA 1TE0A 2HVXA 1C5XB 4CBOA 1YCPK 1HB0B 3BTEE 4Q80A 1IQNA 1ZTLA 3UOUA 1O3LA 2ZTYA 3LU9B 1F2SE 2J34A 3UQVA 2GD4B 1EZXC 4Y8YA 4JK5A 1WV7H 1K9OE 2D26C 2QN5T 4GLYA 2PHBA 2NU0E 1OWDA 3PV4A 1ANDA 3PTNA 3UWIA 1YPLH 1P3CA 1SC8U 3LGTA 4AB9A 3RLYH 3K6YA 3KN2A 2QA9E 1WTGH 3GCNA 1GMHF 1T7CA 1ZPCA 3BG4B 4IC5A 5JBBS 3T2NA 1H8IH 1KXAA 3EA8A 1TABE 1AWHB 1QR3E 3SJ9A 5JDUB 1ELCA 4E7NA 5C20A 1QHRB 2ZU3A 2SNWA 1PPEE 1WSSH 2FWWA 1K1IA 3BF6H 1ZMLA 3W94A 2BDBA 1DXWA 1G9IE 2AMDA 1C5TA 3KHVA 1X7AC 1NN6A 4Y10E 1TX7A 1O3OA 1QJ6B 1WU1A 1C2MA 1P02A 3HKJB 3RMLH 1IAUA 4RN6A 2OCVB 1LMWB 4D7GA 1GMDG 3TH4H 1HDTH 1EAIA 4I7YH 1O5EH 5FPYA 2R0LA 1WTHD 1FV9A 2BM2A 3TJOA 1AVWA 4LXBH 4NSYA 1UVUH 1ARCA 1FY3A 3ZYEA 3A7XA 4YT7H 1KTSB 1YC0A 3P8GA 3RXPA 3VXEH 1OOKB 2M5TA 4LZ4B 7GCHF 2EI7A 1H9HE 2VWMA 2FZZA 1E38B 4IBLH 4X1NU 8LPRA 8KME2 1AIXH 4ZUHA 4FUEA 3RMOH 1MCTA 2GDDA 3VXFH 2QF3A 2P3TB 3OU0A 2Z6BD 3QN7A 4B76A 1LVBA 1UO6A 2HLCA 1HAPH 3K9XB 1BBRK 2BLQA 4XDEA 2BVXH 1L4DA 2TRMA 4AFQA 4O3UA 4SGAE 3MYWA 4SGBE 1DUAA 3LIWA 1SB1H 5FCKA 2HGTH 1C5LH 1BTUA 1CHOF 1DSTA 1GJ6A 1GMHG 3BIUH 4MNXA 1GMCF 3DT0H 1J17T 4BTIB 2QXGA 1SQOA 1MTNC 3QK1A 4O9VA 2ZFQH 2FOFA 1F0SA 1O3PB 1V2VT 3GCHB 4BTUB 2UUKB 4KELA 3TK9A 1P2JA 1IOEA 1ZMJA 1O3NA 3SYJA 1A7SA 4AYVB 3A7WA 4LK4A 1T32A 3LC3A 5AFYH 4AZ2B 3AW1A 1MU6B 4BAOB 1NU9A 1CO7E 2A2QH 1O5FH 2ZTZA 4WY3A 1EJNA 3EGKH 2QXHA 3BSQA 1QL8A 4MG3A 3TGJE 1P2OA 1GHZA 5B6LA 2XC4A 5CHAC 2ZHQH 1Z7KA 2AIQA 3KQEA 1GHWH 3ZZBA 2H9TH 3RXQA 3VB3A 4WMFA 1P06A 1BZXE 2XBYA 1Y3YA 4X6PA 3SGQE 1WXRA 1TBZH 3V3MA 1A4WH 2OC0A 3HATH 1F5KU 1O3JA 3A81A 1KXDA 4RKJB 1V2RT 5HYOA 4GPGA 2DE9A 5EQRA 1UTPA 1VCPA 1Q31A 2A45B 3F9EA 1EOJA 4ABIA 2OD3B 2W7SA 1MKWH 1NY22 2XC0A 3SU6A 4CREA 2FI5E 3FAOA 2QXJA 1AFEH 3C1KA 4RSPA 1E36B 4AFSA 2YNBA 3BTGE 2FPZA 2ZCHP 4DGJA 3SU3A 3SNDA 1O2QA 2GP9B 2VGCC 1GI2A 2P3FH 3K65B 2J94A 3K2UA 4Y0YE 3A8CA 1GDNA 1YCPH 3MH6A 4FU9A 3S7HB 2VIQA 4K60A 1BTXA 1IHTH 2TGAA 5B6OA 1ETTH 4RKOB 2C8XB 4AG2A 1CT0E 1D9IA 1O32A 4Y0ZE 2A7CA 1VITF 1K22H 1AU8A 5SGAE 3RM0H 4YESB 4BTTB 1C1PA 2ZFFH 3T28A 1SG8B 3BTKE 3PLKA 3LJJA 1O2RA 2C90B 2EI8A 2ZQ2A 3TIUA 5GWZA 3E0NB 4DOQA 4QT8C 2HPQH 2UWOA 2O8WA 1D3DB 1S0RA 3PB1E 1MH0A 3NCLA 3KQDA 3STJA 3A86A 4X8VH 1AB9C 1TNLA 1PQ5A 2Z94A 2AMPA 2HALA 1FY8E 1W10U 1Z8IB 4FUIA 3TNTA 5BPEA 4WVPE 1A1RA 3NPSA 8GCHF 4YOJA 3TVJB 4K1TA 5E2OA 1G3EA 1W7XH 4MPWA 1MTWA 3URDA 6GCHF 1W0ZU 3MO3A 4IN2A 1VJ9U 2Z9GA 1Y5BT 1QBOA 2FOGA 4OGXA 1O3EA 1E37B 4A1TA 5A8XA 4NA9H 1H1BA 3ATMA 4WH6A 1E34B 1D4PB 1S6FA 3BG8A 1ZSLA 5EXNA 1HIAA 4HZHA 4ABDA 2AGEX 5E0JA 1PYTD 4AN7A 5TCCA 1N6YA 4VGCB 1SGYE 2WPIS 1QURH 5FX5A 3U8TH 3TJVA 3A82A 4INHA 1MD7A 2ILNA 1ORFA 4IN1A 1C2HA 3MI4A 4B75A 2HNTE 1GMDF 2PKAB 1GHXH 1VCWA 2F9NA 3F9GA 1TPOA 4A92A 1ELTA 2ZU5A 4B2CA 1OKXA 2B9LA 4TWYA 1TRNA 2GCTB 4I33A 2WUBA 3GYMA 4ZKNU 4DY7B 3Q3YA 6CHAB 2ZCKP 1MZDA 3PV2A 2VH6A 2BZAA 3QDZB 1ZGIA 4CH2B 4CRDA 1FAXA 3KL6A 1TQ0B 2R0KA 1C5RA 4BXWA 4JK6A 1UMAH 1EB1H 1C4Y2 4K3JA 1V2WT 2AYWA 2ZCLP 3AVZA 4K1EA 1GBDA 2Y5HA 1BHXB 1BBRH 1YPKH 3RC4A 1O2PA 4U2WA 1TMTH 2BY6X 2FYQA 3LH1A 4X6MA 1O2IA 2XW9A 1BBRE 2Z9JA 1CA8B 1GBTA 1S84A 4AGKA 5HXFA 2OQ5A 2BOKA 1ELFA 3MO6A 2WV4A 1GBHA 1OX1A 1CHOG 1GI7B 5F8TA 4TPYA 3GY2A 2VVCA 2BLVA 3RXCA 3SU1A 3M37A 1C1OA 1QY6A 3EYDA 4WWYA 4K69A 3U8RH 4TPIZ 4B2BA 5HGGA 1J15A 1PPCE 3ZZDA 1SGQE 1P03A 5HMAA 3PLBA 3V12A 2CV3A 2A4GA 3L33A 1SFIA 4A1VA 3N7OA 2A7HA 1P3EA 1QGFA 1RIWC 2BX4A 2CXVA 1C5OH 1HBTH 3U1IB 3L3TA 1ETSH 3LH3A 2W3KA 2GX4A 2BDAA 3LOXA 3H09A 3UWJH 3UR6A 1ESTA 1MTSA 1DWCH 4K5ZA 2STBE 4NG9H 4E06H 2BD4A 1XVMA 2GMTC 4OS6A 3F68H 1RD3B 3FVFB 2C4FH 1EASA 1GJ4H 1KYNA 1SBWA 2PGBB 1HNEE 3SZEA 2ALVA 1F92A 9LPRA 1DANH 2XWAA 1QJ1B 1TMBH 1SI5H 3GDUA 1DITH 5L2ZH 1LHDH 1TPSA 1T8LA 2AGIX 1G36A 2HRVA 1NESE 1GHVH 1CHGA 2FYRA 1O2VA 1P8VC 1CA0C 1O2GH 3RXRA 4B1TA 2BB4A 2IPHA 2UUYA 4Q7ZA 2KAIB 1C2KA 1HAVA 1EX3A 4ZAEA 4NFFA 3SUGA 2A5IA 1LCYA 1D6WA 3SN8A 1GHBG 1E35B 1WOFA 2ANKH 3GICB 2DUCA 3TH2H 4DG4A 1GHYH 4BAQB 2FX4A 1MAXA 3BEUA 2ZGXH 1TMUH 1H4WA 3OY5U 4OS7A 4WXVA 3ZYDA 1TB6H 5DO4H 2ZFSA 3S69A 5AVDA 1C5ZB 3DFLA 2WPMS 4R8TB 1UCYE 4VGCC 4BXSA 3E6PH 2ZPRA 3ATLA 2ZGJA 1C9TA 2CGAA 1UVOA 3MHWU 1LVOA 1ZTKA 4WF8A 1BJVA 2WPHS 3LGYA 4JZDH 1C1VH 1NPMA 3SGAE 1GBBA 2OXSA 1LVYA 4MPVA 4NWKA 2EI6A 2VGCB 1TPPA 3RLWH 2V6NA 1QB1A 2Y7ZA 3JZ1B 1GJCB 3D65E 2HOBA 5DK1A 1ZGVA 1FN6A 4D76A 1MAYA 3GCTF 2A32A 1MTUA 1GI1A 1VITH 2EA3A 4B6FA 3BTME 3W95A 5TCAA 1ZLRA 3PTBA 3M35A 5J4QA 3RM2H 3IITA 4IS5A 2Z9LA 4KTCA 1MKXH 1ELVA 3SI4H 2Z3DA 4ABGA 4DURA 1DS2E 1Q3XA 4MPUA 2A7JA 1TOMH 1QFKH 1SSXA 5EPNA 1O30A 1P2NA 2H9HA 4ZMAH 1Z6EA 3A8BA 4K2YA 3P8OA 2CF8H 3SV7A 2FOMB 5CHAB 3BTWE 4GSOA 3UR9A 3D62A 1OYTH 1B0FA 3RU4T 1C1TA 5G4BA 2THFB 2FLRH 1O2KA 5EODA 4LOYH 1S85A 5DP3A 1BTPA 1HJ9A 3UREA 2FOCA 2ZDKA 1NFYA 2G5NA 2SGEE 1O2WA 4F49A 3GY6A 5JB8S 1THPB 4U30A 3M3TA 1YPMH 3SQHE 1BT7A 4CH8B 1XUJA 2GGVB 3MU5A 5AF9H 4M9FA 1ZHRA 1XUKA 2W5EA 1EKBB 5JBAS 1TNKA 4NIXA 4AGJA 1P01A 2H5DA 1GBMA 1PQ8A 5FCRA 3VEQB 1O3MA 4YM9A 2VWLA 1TA2A 1VR1H 1SGRE 5DPAA 3NZIA 4ZKSU 1ZPBA 5LPFA 2G4TA 1SL3A 1LPZB 1ID5H 1UJ1A 3E16B 2CF9H 3F9HA 4UONA 1OWIA 5FPTA 1FIWA 2VINA 4DVAU 1TFXA 1BMNH 2D2DA 2QY0B 5EOKA 1ZOMA 1C5WB 1ZRKA 2G00A 3QX5H 2ZGHA 4X1QU 2KAIA 1GCDA 4UE7H 1PPZA 1VITG 1S0QA 1HCGA 1YPGH 2BQ6B 3T27A 2I6QA 1P2QA 2J92A 1SLWB 1C9PA 4INKA 3PO1B 1KLIH 2ZGCA 1EAXA 3UPEA 5TJXA 2G55A 4IMZA 1DVAH 1CA0B 1O2TA 1MQ5A 1FI8A 5C1YA 1C2IA 4H6TA 2PUQH 1EZQA 2B8OH 1MKWK 3PLPA 2ZHFH 1HIAB 3DA9B 2BD2A 1V2NT 4NIVA 2F9OA 2R3YA 4OGYA 4KP0A 3BG4C 3D49H 4B74A 2PR3A 5FHTA 3LT3A 1TA6A 1TGTA 1O5AB 1IQHA 3QTOH 5E0GA 2JH0D 1O5GH 3HPTB 1HJ8A 3O8CA 5C1XA 1G2LA 1O3BA 1C2DA 1FUJA 1WBGB 2FDAA 3HK6B 3Q3XA 2TIOA 2B5TB 1GCTB 1EATA 2C8YB 1GBJA 4BAMB 2BD8A 3I77A 4ZROA 5AHGH 1QA0A 1WCZA 2BVRH 5EGMA 1GBAA 4UD9H 1G37A 3AAVA 4ZKOU 1QRXA 1Z8RA 2GV6A 2BHGA 2RG3A 2ZG0H 2P8OC 3LGWA 3ZV8A 2WZQA 1TGCA 3RXMA 1Q2WA 1LHCH 2WV5A 4B73A 1TRYA 1CGJE 1HLTH 3UOPA 3RUOA 3BTTE 1VGCC 2QC2A 1ZYOA 2A31A 1SHHB 2UWLA 1RFNA 1N8OC 1YLCA 1HAIH 2BY9X 5GNDA 3RXDA 1V2TT 1SMFE 1P2KA 3NUMA 1OP2A 5ETXA 1GPZA 1BRAA 2B7DH 1A5GH 1BRUP 1MTVA 3TK6A 2Q1JA 3LDXH 1BCUH 1J9CH 3GCTG 1LPKB 2F9VA 3VPKA 2XXLA 1RGQA 3AASA 5DP5A 2QF0A 3AW0A 4MNVA 4KGAA 2VIPA 3RU4D 3CS7A 1YBWA 2A4QA 4I8LA 1JXPA 1D3TB 1ZRBA 1AVGH 1TNHA 2ZEBA 2P59A 2PTNA 1YCPM 3M7QA 1YPHC 4OM9A 3SNEA 1W3CA 1IQEA 3KGPA 3ZVGA 2OBOA 3ATWA 4AG1A 3P92A 4Y76A 1LDTT 3RXVA 2ZNKH 2UWPA 4A6LA 4CRBA 2GCTC 1B5GH 1SOTA 3WY8A 1GBIA 1NFWA 4Y6DA 1B0EA 4IGDA 2P8OB 4WXIA 4NWLA 5DP7A 2STAE 3BV9B 1C5UA 4X2WA 3F1SB 4UFGH 2IN2A 4CR5A 1IQIA 2ANYA 1CVWH 2FESH 1C5YB 1NU7B 3SUDA 3T29A 1HUTH 5T3HA 1THSH 3FFGA 2ZFRH 1A0JA 3A89A 2RA0A 1O3KA 2BD5A 5EW1H 2C3SA 1GCTC 2AIPA 1O5BB 3K6ZA 1O35A 1GWAA 3S0NA 3PV5A 1P2MA 1AVXA 2WINI 4ISHH 1DWBH 2JETB 3ZZCA 1OP8A 3TJNA 4Y7BA 2FLBH 1D3QB 2OP9A 3MOCA 1OWEA 1YP9A 5LH8A 1ARBA 1V6DA 2P94A 4AFZA 1YPEH 1ZSKA 4CRAA 3MU1A 1O3AA 3B23B 5PTPA 2Y82A 1FIZA 2FOBA 3UNQA 2G51A 1ZMNA 1S83A 3T26A 3PMBB 4DCDA 4MNYA 2GZ9A 1BRCE 2BDHA 1O3HA 4X6NA 4BNRA 5F6MA 4ABAA 1NRSH 1NRNH 2A5KA 2Y6TA 2W7UA 4YOGA 1C1WH 2Y5GA 3HK3B 4I8HA 4D9RA 1GL1A 1AFQB 4XOJA 4DT7B 1JBUH 5JBCS 5DP8A 2J38A 3GY5A 4J1YA 1LTOA 1FXYA 1Z71A 4CRCA 4AB8A 5GCHG 3B8JA 2H1UA 4Q7YA 2FOAA 4CR9A 5L6NH 2AH4X 1K1JA 1T4UH 2NU1E 2F91A 1BITA 1TONA 3QGJA 1O34A 1C5MD 5ESTE 1GHBF 5JPMH 1KTTB 3HKIB 2Z7FE 2HNTF 1FAKH 1RTLA 2VIWA 1C1SA 2VVUA 1YGCH 3E8LA 3PM3A 1SGIB 3A80A 1PJPA 1AE8H 1O5DH 2VIDA 2BD9A 5EQQA 1OPHB 2PFEA 4FUCA 4ZXYH 3GY8A 3M5MA 3ODFA 1J16A 1TBQH 1FQ3A 4IW4E 1DICA 1H9IE 1ZPZA 4LZ1H 1KXBA 4NZLA 1Z8JB 1K1LA 3ESTA 2A2XH 3ATKA 3GY7A 4ISNA 3ZZ4A 4BANB 4ZKRU 1TAWA 1P11E 1EP6A 4JZ1A 2VIVA 3P95A 1KSNA 4Q7XA 4UDWH 1V2UT 1ABIH 1OS8A 2QAAA 1SLXB 2XTTB 1EAWA 1S81A 1DPOA 3OTPA 1O33A 3ENSB 1HV7A 2NU3E 1T31A 2ZU1A 1C5VA 5HM9A 4FVBA 1CBWC 1NZQH 2WPKS 4HFPB 2ZZUH 1JWTA 3ZZ5A 1PFXC 3FANA 1K1PA 1O2NA 4INLA 2P95A 3A84A 1HAHH 3GCOA 4FVDA 1QCPA 4B6EA 3A87A 3SV9A 1HFDA 2J95A 1GL0E 1ZJDA 1KDQB 1ZHMA 2ZC9H 3VB6A 4U32A 1C2JA 2BOHB 4X2YA 5A0AE 1BHXF 1SGEE 5F03A 2TBSA 3P8NA 3ZZ7A 2AFQB 4H42U 3RXGA 1AMHA 2IJOB 3SGBE 1KLJH 1HJAC 2XCFA 4ZHAA 3SV2H 3MH5A 2VU8E 1NS3A 1PQAA 1RRKA 3LGUA 2IOTA 3M5NA 1DLKB 1Y3VA 3SORA 3UNRA 1DOJA 2IJD1 4YOIA 1EQ9A 1D6RA 3UTUH 4HGCA 2Q6DA 1QQUA 3ZZ9A 4XE4A 3FP6E 3RU4E 4MPXA 3ZVDA 1XM1A 1CQQA 3QUMP 1C2GA 4J2YB 1A61H 1AY6H 4JZIA 2VJ1A 1ESAA 1XMNB 2ZHDA 1GGDC 1NT1A 2CHAC 3UIRA 1ZTJA 1W13U 3QWCH 1INCA 5FX6A 1BDAA 2ZU4A 2JKHA 1SGFA 2XRCA 1AI8H 1XUIA 4I32A 4I31A 1QRWA 5C1UA 1KXCA 2Y81A 2ZDMA 1A2CH 4I8JA 1HXFH 3DHKH 3SU4A 3RMMH 1ETRH 2YOLA 3E91A 4OS1A 1SVPA 1S6HA 3UNSA 3SO3A 1KIGH 3OSYA 4JYVH 1BA8B 1ELAA 1QJ7B 1V2JT 3MWIU 8GCHG 2V3OH 1DUEA 4E7RG 5C5NA 5E2PA 1ACBE 2V35A 3RXLA 2AGGX 1LKBA 3Q77A 1BB0B 1XKBC 1K28D 3SNBA 1O2LA 2CJIA 3O8RA 4GAWA 4X2VA 1PYTC 2OQUA 1C4U2 4TY7A 5DKMA 4WMEA 3LGVA 5JB9S 1ANEA 1UTNA 2XC5A 2ASUB 1SGTA 1L4ZA 1W14U 4CRGA 4K8BA 3FP8E 4AYYB 3Q76A 1EB2A 1O31A 1UTJA 5IYTA 1UTQA 2F4LA 1G32B 2ZGBH 1DLEA 4ZHMU 1TLDA 3M7UA 1O2MA 2ZF0H 5C2ZA 3EA9A 3RDZA 4WJG2 1SLUB 5GJ4B 2GVFA 3SV6A 2J4IA 1G3BA 2UUFB 3SOSA 2R9PA 4YO9A 4ZXXH 1DY8A 1AD8H 5I25A 2OC7A 2H5CA 4AORA 1DDJA 4ESTE 1TYNA 1MBMA 4BAHB 1F5RA 4FU7A 3FP7E 2QGRA 2F9UA 1Y3UA 3SQEE 1F7ZA 1AKSA 3VB7A 1V2MT 2D8WA 8ESTE 3ITIA 5DP6A 2G8TA 1BOQA 3AAUA 2C8WB 3VGCC 1SGNE 2OC8A 1MQ6A 2P93A 2ZHEH 3SHCH 1V2LT 2XNIA 2ZWLH 7LPRA 3G01A 4X0WU 1AZ8A 1P04A 2TGPZ 2AEIH 2GMTB 3M61U 2SGQE 3MNSA 3RXUA 4M7GA 5ESBA 1LHEH 1P10A 4WMDA 4AFUA 1YYY1 2H2ZA 1C5SA 3UUZA 2XCNA 2LNCA 4ABJA 6ESTA 1H9LB 4NSVA 3SHAH 4X8UH 1UVTH 4Y7AA 3NKKA 7GCHG 2A5AA 2ZQ1A 4DIHH 4FUHA 1MZAA 2VH0A 2FM2A 3GY3A 1TBRH 2ZDLA 3NWUA 3LONA 1O38A 3LKWA 1DM4B 5T6FA 2FTMA 1C1QA 1F0UA 4ABFA 1HJAB 3TITA 1FONA 1N6XA 3FZZA 1TRMA 4ABBA 4CHAC 1IQLA 2A1DB 3EDXB 4XSKU 4MNWA 3TGKE 1MD8A 3T5FH 3ZVAA 5GXPA 1FMGA 2SNVA 4A1XA 5CE1A 1HGTH 3PMHB 1BMLA 3I29A 2OC1A 2WPJS 5T1VA 1O3GA 1UVPA 2FI3E 3QTVH 1C1RA 4Y8XA 3RC6A 2BYAX 4ZHLU 1FNIA 2ZKSA 5LPRA 3LJOA 1OWHA 1IQKA 1CBWB 1FY1A 1YPHE 1GMCG 2V0BA 2VIOA 3ZZ8A 5J4SA 1GI3A 1TNIA 2Y5FA 1AUJA 9ESTA 3VB5A 1EPTB 1GBLA 2BXTH 3A8AA 3PMAB 1L2EA 1TGBA 3BEFB 4OS4A 3RMNH 3T62A 1UCYH 3VB4A 3V7TA 1O36A 3GDVA 4B2AA 7KMEH 2BDGA 1OP0A 2FODA 1UK2A 1YF4A 4H6SB 3OX7U 1K21H 3H5CB 1M9UA 1AWFH 2XBVA 4TYDA 4NGAH 1W7GH 1ZZZA 3TH3H 1UTKA 1QB9A 3LC5A 1EZUC 2ZECA 3IWMA 3MMGA 3ZZ6A 1HAYB 4NIYA 1RS0A 1CSOE 4Q2KA 2ZFPH 4FUBA 3V0XA 2ODQA 3MH7A 1GVKB 2BLWA 5L2YH 1UTOA 1EJAA 6CHAC 3MO9A 2PKAA 2FEQH 1K1NA 3P8FA 3RXOA 4CRFA 2SGFE 2BDIA 4FUGA 3EE0B 2ZDVH 1AE5A 3UY9A 2A0QB 3M5LA 3HGNA 2TGDA 2SGDE 3ZV9A 2UUJB 3BIVH 1V2OT 2AERH 1GVZA 1SLVB 1XXFA 1GVLA 2PW8H 5EPYA 1W0YH 1QA7A 3MNCA 1SQTA 2JH5D 4KKDA 2PGQB 1L1NA 1TNGA 2ZPSA 1V2KT 1DWEH 3L6PA 4BAKB 5C3NA 1GI4A 1NO9H 2OK5A 2BQWB 2I6SA 3BTHE 1ANCA 2HNTC 1P12E 1J8AA 1QIXB 2AMQA 4DJZB 2BTCE 4U01A 2O9QA 4ABEA 4AOQA 1ZR0A 3OYPA 2ALPA 2XBXA 2Q6FA 4AX9H 2ZO3H 1SHYA 1PQ7A 1LHFH 5K0HA 1Z1IA 2FS9A 3GDSA 1SGDE 4CBNA 2BDYA 2OINA 1Y3XA 5EG4A 3BN9A 1ESBA 2NU4E 2OLGA 2G81E 1TIOA 1Y3WA 1ABJH 1D3PB 2GCHF 2Z3EA 1HAOH 1C5NH 3M7TA 1GJ5H 2PWXA 4DW2U 1CE5A 1G3DA 3D23A 2D1JA 2A4RA 1J14A 1EZSC 5BRRE 4XBCA 2G5VA 1NRPH 1FPHH 1DFPA 2K1QA 3MNXA 5C67A 1EJMA 2PSXA 1G3CA 4KTSA 1AB9B 4D9QA 3MU0A 1FJSA 1WAYB 1GBFA 3BTFE 3OTJE 2QXIA 1XUGA 1MUEB 3GOVB 1CT2E 1BUIA 2VVVA 5EXMA 3E0PB 2BXUH 5F8ZA 2SGAA 3ELAH 4PROA 1GI9B 1FDPA 4FUFA 3KNXA 4YZUA 3TPIZ 1PPGE 4GVUA 4NIWA 3E3TA 1KLTA 3RXHA 6GCHG 4ISIH 2ODPA 1Z6JH 1UCYK 4ASHA 1P09A 3NXPA 4A5TS 2BDCA 3FZDA 1NRRH 1SPJA 2Y7XA 3KEEA 3QZRA 4NA8A 1SGPE 4THNH 2W3IA 1O2XA 3KIDU 4JCNA 1P05A 1BRBE 1P9SA 2VB0A 2ZTXA 4NFEA 5ABWA 1GJBB 1QNJA 1QTFA 3MU8A 1PPBH 5A8ZA 2PTCE 1IHSH 3SI3H 2QYIA 1GI8B 4UFEH 1TX6A 2Q6GA 1AO5A 1RTKA 2P16A 1QBVH 4JMYA 6LPRA 5A0BA 4X6OA 2NWNA 1O2OA 2GDEH 2B0FA 1C1NA 1BMMH 3EQ0H 1GBEA 1C5PA 2GZ8A 5E8EH 3U9AH 5A8YA 4FU8A 1LO6A 1L1GA 1ZSJA 3ZVFA 5T6DA 2ZU2A 2VWNA 1IQJA 3E1XB 3MNBA 2WHXA 2V3HH 2WPLS 1LVMA 1NROH 3R0FA 5JYIA 2BY7X 2BX3A 3Q3KA 1EAUA 1AHTH 2BZ6H 3RXAA 5LGOA 2O8MA 1QL7A 1VCQA 2ZDAH 3RXTA 1XXDA 1MBQA 3QO6A 3ZVBA 1GHAG 2WUCA 4GCHF 1DXPA 3R3GB 3TNSA 2WYGA 1YM0A 4HTCH 1GI0A 1FZZA 1GJDB 1Y5AT 3RXSA 4JZFH 2P3UB 3I78A 3P6ZB 5FAHA 2BMGB 3SJKA 1JRTA 1UTLM 2PLXA 2Y80A 1HXEH 3M3VA 2O8TA 3SNCA 1QRZA 2BY8X 3SU2A 3P70B 1MTNB 1CGIE 1LKAA 5F8XA 3TU7H 1QB6A 2GTBA 1ANBA 1GG6C 1PPFE 1UHBB 3M3SA 5A0CA 1GJ9B 3PROA 2F9PA 3S9CA 3SW2B 1UHBA 1GDUA 1EPTC 3O8BA 1GBKA 3VGCB 3HGPA 2G52A 3T25A 1Y8TA 1LPGB 1P57B 4JYUH 1N1LA 1SFQB 1A3EH 1F5LA 5IDKA 3DUXH 1W12U 1BTYA 1L0ZA 7ESTE 2OTVA 4IC6A 4ZH8A 2TGTA 1YPJH 1N8OB 4K8YA 3GISB 1FPCH 2A4OA 3M5OA 5A09A 1VGCB 1T8NA 1C4V2 1K1OA 5A2MH 3A83A 4Z0KA 2RA3A 3Q00A 1GBCA 2C8ZB 2BY5X 1F0RA 2RDLA 1W11U 3GY4A 1WYKA 2O8UA 3LPRA 1OSSA 5DJ7A 5FBIA 1GJAB 1O3DA 1ELBA 1G2MA 1QL9A 1FY4A 4UFDH 5EXLA 2ZHWH 1MU8B 1TGNA 4B71A 2FX6A 2BLOA 1S82A 4X1PU 1O2JA 1W8BH 1DT2A 1XVOA 2YNAA 2H6MA 4JZEH 2WV9A 1IQMA 1GHAF 1CT4E 4GCHG 1OWKA 4JYTA 2XBWA 2BQ7B 4MVNA 5FBEA 2F3CE 4I8GA 1MKXK 1A46H 3MU4A 4K1SA 3A8DA 1NFXA 1C1UH 1W2KH 4HI3A 2ZFTA 1UK3A 3KQBA 3M36A 1ELGA 1GDQA 2ANMH 2TPIZ 1Z8GA 1FN8A 2GZ7A 4NA7A 1LQDB 1GI5A 4H4FA 5I46H 3SJOA 1HPGA 3OY6U 1QBNA 4Y11E 1ZHPA 2NU2E 1LHGH 3TJUA 1PPHE 2ODYB 2C93B 5GPIB 1UTMA 3ATIA 2F83A 1HAXB 4UFFH 1THRH 2EC9H 3F9FA 1IQFA 1DX5M 1Y5UT 2DE8A 1T4VH 1WQVH 1CU1A 2CHAB 2FMJA 3UFAA 3MH4A 3PO1C 3GYLB 1RJXB 1EUFA 1O3FA 3BTDE 1RXPA 1GI6A 1YKTA 3RXKA 1K1MA 1XUFA 2ESTE 4O03A 1DY9A 1NM6A 3A7YA 1IQGA 1B7XB 1TPAE 4NZQA 1O3IA 4X8TH 1OYQA 4O97A 2OUAA 5JBTA 2QCYA 1O0DH 2Z9IA 3H7OA 3A7ZA 1C2EA 1HRTH 2R2WU 1DSUA 3S9AA 1O2HA 5LPEA 1QQ4A 2FOEA 3U8OH 1ELEE 5H4IB 2WYJA 3QGNB 4IMQA 1TWXB 2GT8A 1A0LA 1O39A 3EA7A 3P17H 4NCYA 3STIA 2SGPE 1Y59T 4OS5A 1A0HB 1EPTA 2OBQA 4FUJA 1C2LA 1JOUB 3CS0A
chains in the Genus database with same CATH superfamily
4YLUA 1G30B 3SBKA 3SU0A 4X1SU 1O2SA 3QLPH 4Z6AH 1TQ7B 1MCVA 1TNJA 5EU8A 2JH6D 1MMJN 3URCA 1O37A 1GGDB 2SFAA 1SQAA 1GG6B 1VJAU 1L1JA 1HYLA 4YLQH 1T8MA 4ISOA 2ZI2H 1FLEE 1VZQH 1O3CA 4D8NA 5E0HA 2KZ4A 5C5OA 1XX9A 3A7TA 2W26A 2WSSD 1H8DH 2J2UA 3PWBA 3RP2A 3O8DA 5DP9A 1NC6A 3H7TA 3SJ8A 3A88A 3SZNA 3ZZAA 1XKAC 1OWJA 3RXJA 1NTPA 5EQSA 1UK4A 2RDEA 4MTBA 2FIRH 4ABHA 3DD2H 4OS2A 3QZQA 1DE7H 4KTUA 4ISLA 3RXIA 2VNTA 3B9FH 1NFUA 3ZVCA 2CMYA 1TALA 3UQOA 5K7RA 3MFJA 1WQSA 2WPDD 1V2QT 2FS8A 1V3XA 3AK5A 1JMOH 3LGIA 3SV8A 2BVSH 2Z9KA 4D7FA 4DIIH 3DFJA 3GCHC 3TLOA 3F6UH 2FTLE 2BD3A 1A3BH 1KDQA 4BOHA 1TX8A 3CP7A 2FP7B 1AFQC 1BMAA 1Z1JA 1LQEA 1A5IA 1JRSA 5T6GA 2PKSB 5DGJA 3MTYA 3NK8A 3CENA 3E90B 3KCGH 2R3UA 2J97A 3ODDA 5GCHF 1A5HA 4XBDA 4XFQA 4Y8ZA 1WUNH 1YLDA 1NRQH 2ULLA 2CN0H 4DT4A 1ZJKA 1HAGE 3KQCA 4XBBA 3U98H 3U69H 1KY9A 1SR5C 1XUHA 4Y79A 5L30H 1V2ST 1FY5A 3ZVEA 1O2UA 2PUXB 2ZP0H 1KXFA 4GUXA 1AZZA 2XWBI 1ELDE 1T8OA 2QIQA 2YMSC 4I8KA 1GJ7B 2JETC 1O2YA 1AKSB 2AS9A 3C27B 4GHTA 1HAVB 3SNAA 1BQYA 2R2MB 3RXBA 3PWCA 4X1RU 2PKSC 4MLFB 2QV1A 3RXFA 2VWOA 2FOHA 1DWDH 4GHQA 1O5CB 5DP4A 2ZPQA 2GCHG 1AGJA 3IG6B 1UVSH 4TWWA 5FXLA 2GV7A 4X2XA 3SU5A 1KMHB 2EEKA 2HPPH 1RTFB 2GKVE 1P9UA 2HWLB 2W6ID 3EAJA 4WH8A 1EP5A 2PSYA 1C2FA 4MQAA 5AFZH 4RI0A 3JZ2B 3U1JB 4YTAA 2J9NA 3V13A 4YT6H 2Z3CA 4UEHH 1O2ZA 4F4OC 1SGCA 2PV9B 1SOZA 2KM0A 1P0SH 1JIMA 2ZDNA 3UAIC 2O8LA 1S5SA 2RCEA 1V2PT 1AN1E 1C5QA 5GIBA 5CMXH 5GDSH 1BTWA 2ANWA 2FO9A 1BTHH 1E0FD 4E05H 4MDSA 4Y71A 1EOLA 3TK5A 4X8SH 5DG6A 3SJIA 3RC5A 3BTQE 3F3BA 5FPSA 5HM2A 1S6LA 2XYAA 3PYHA 1JIRA 1GJ8B 3PRBA 1F0TA 3S7KB 3PMJA 3VFEA 3ZZ3A 3KF2A 4A7IB 2G4UA 1HAZB 1TGSZ 3RXEA 1BTZA 1CGHA 2F9BH 1RIWB 1BIOA 1TOCB 1OXGA 3SUFA 2BD7A 1EXFA 2VBCA 2ZIQH 3A85A 3S9BA 2H9EH 1AUTC 4FUDA 2FXRA 1SGFG 4FXGH 1K2I1 4CHAB 1C1MA 1P2IA 2FI4E 5EW2H 1U6QA 2GT7A 1AQ7A 1BJUA 3SUEA 4O3TA 1KXEA 2LPRA 3A7VA 2ZA5A 3TGIE 4TY6A 3BEIB 2EQNA 4R0IA 1TE0A 2HVXA 1C5XB 4CBOA 1YCPK 1HB0B 3BTEE 4Q80A 1IQNA 1ZTLA 3UOUA 1O3LA 2ZTYA 3LU9B 1F2SE 2J34A 3UQVA 2GD4B 1EZXC 2RFKC 4Y8YA 4JK5A 1WV7H 1K9OE 2D26C 2QN5T 4GLYA 2PHBA 2NU0E 1OWDA 3PV4A 1ANDA 3PTNA 3UWIA 1YPLH 1P3CA 1SC8U 3LGTA 4AB9A 3RLYH 3K6YA 3KN2A 2QA9E 1WTGH 3GCNA 1GMHF 1T7CA 1ZPCA 3BG4B 4IC5A 5JBBS 3T2NA 1H8IH 1KXAA 5HKKD 3EA8A 1TABE 1AWHB 1QR3E 3SJ9A 2V3MA 5JDUB 1ELCA 4E7NA 5C20A 1QHRB 2ZU3A 2SNWA 1PPEE 1WSSH 2FWWA 1K1IA 3BF6H 1ZMLA 3W94A 2BDBA 1DXWA 1G9IE 2AMDA 1C5TA 3KHVA 1X7AC 1NN6A 4Y10E 1TX7A 1O3OA 1QJ6B 1WU1A 1C2MA 1P02A 3HKJB 3RMLH 1IAUA 2F43B 4RN6A 2OCVB 1LMWB 4D7GA 1GMDG 3TH4H 1HDTH 1EAIA 4I7YH 1O5EH 5FPYA 2R0LA 1WTHD 1FV9A 2BM2A 3TJOA 1AVWA 4LXBH 4NSYA 1UVUH 1ARCA 1FY3A 2K8IA 3A7XA 3ZYEA 1KTSB 4YT7H 1YC0A 3P8GA 3RXPA 3VXEH 1OOKB 2M5TA 4LZ4B 7GCHF 2EI7A 1H9HE 2VWMA 2FZZA 1E38B 4IBLH 4X1NU 8LPRA 8KME2 1AIXH 4ZUHA 4FUEA 3RMOH 5CHBA 1MCTA 2GDDA 3VXFH 2QF3A 2P3TB 3OU0A 2Z6BD 3QN7A 4B76A 1LVBA 1UO6A 2HLCA 1HAPH 3K9XB 1BBRK 2BLQA 4XDEA 2BVXH 1L4DA 1FX0B 2TRMA 4AFQA 4O3UA 4SGAE 3MYWA 4SGBE 1DUAA 3LIWA 1SB1H 5FCKA 2HGTH 1C5LH 1BTUA 1CHOF 1DSTA 1GJ6A 3DCLA 1GMHG 3OFND 3BIUH 4ACBA 4MNXA 1GMCF 3DT0H 1J17T 4BTIB 2QXGA 1SQOA 1MTNC 3QK1A 4O9VA 2ZFQH 2FOFA 1F0SA 1O3PB 1V2VT 3GCHB 4BTUB 2UUKB 4KELA 3TK9A 1P2JA 1IOEA 1ZMJA 3KYGA 1O3NA 3SYJA 1A7SA 4AYVB 3A7WA 4LK4A 3W1EA 1T32A 3LC3A 5AFYH 4AZ2B 3AW1A 1MU6B 4BAOB 1NU9A 1CO7E 2A2QH 1O5FH 2ZTZA 4WY3A 1EJNA 3EGKH 2QXHA 3BSQA 1QL8A 4MG3A 5B6LA 1P2OA 1GHZA 3TGJE 2XC4A 5CHAC 2ZHQH 1Z7KA 2CK3D 3KYFA 2AIQA 3KQEA 1GHWH 5EJZA 3ZZBA 2H9TH 3RXQA 3VB3A 4WMFA 1P06A 1BZXE 2XBYA 2KCOA 1K0HA 1Y3YA 4X6PA 3SGQE 1WXRA 1TBZH 3V3MA 1A4WH 2OC0A 3HATH 1F5KU 1O3JA 3A81A 1KXDA 4RKJB 1V2RT 5HYOA 4GPGA 2DE9A 5EQRA 1UTPA 1VCPA 1Q31A 1H8ED 2A45B 3F9EA 1EOJA 4ABIA 2OD3B 2W7SA 1MKWH 1NY22 2XC0A 4ASUD 3SU6A 4CREA 2FI5E 3FAOA 2QXJA 1AFEH 3C1KA 4RSPA 1E36B 4AFSA 2YNBA 3BTGE 2FPZA 2ZCHP 4DGJA 3SU3A 3SNDA 1O2QA 2GP9B 2VGCC 1GI2A 2P3FH 3K65B 2J94A 3K2UA 4Y0YE 3A8CA 1GDNA 1YCPH 3MH6A 4FU9A 3S7HB 2VIQA 4K60A 1BTXA 1IHTH 2TGAA 5B6OA 1ETTH 4RKOB 2C8XB 4AG2A 1CT0E 1D9IA 1O32A 4Y0ZE 2A7CA 1VITF 1K22H 1AU8A 5SGAE 3RM0H 4YESB 4BTTB 1C1PA 2ZFFH 3T28A 1SG8B 3BTKE 3PLKA 3LJJA 1O2RA 3PRDA 2C90B 2EI8A 2ZQ2A 3TIUA 5GWZA 3E0NB 4DOQA 4QT8C 2HPQH 2UWOA 2O8WA 1D3DB 1S0RA 3F0PA 3PB1E 1MH0A 3NCLA 3KQDA 3STJA 3A86A 4X8VH 1AB9C 1TNLA 1PQ5A 2Z94A 2AMPA 3OE7D 3WW7A 5EJ1A 2HALA 1FY8E 1W10U 1Z8IB 4FUIA 3TNTA 5BPEA 4WVPE 1A1RA 3NPSA 8GCHF 5F53A 3TVJB 4YOJA 4K1TA 5E2OA 1G3EA 1W7XH 4MPWA 1MTWA 3URDA 6GCHF 1W0ZU 3MO3A 4IN2A 1VJ9U 2Z9GA 1Y5BT 1QBOA 2FOGA 4OGXA 1O3EA 1E37B 4A1TA 5A8XA 4NA9H 1H1BA 3ATMA 4WH6A 1E34B 1D4PB 1SQRA 3N7EA 1S6FA 3BG8A 1ZSLA 5EXNA 1HIAA 4HZHA 4XD7D 2AGEX 4ABDA 5E0JA 1PYTD 4AN7A 5TCCA 1N6YA 4VGCB 1SGYE 3WWBA 2WPIS 1QURH 5FX5A 3U8TH 3TJVA 1COWD 3A82A 4INHA 1MD7A 2ILNA 1ORFA 4IN1A 1NBMD 1C2HA 3MI4A 4B75A 2HNTE 1GMDF 2PKAB 1GHXH 1VCWA 2F9NA 3F9GA 1TPOA 4A92A 1ELTA 2ZU5A 4B2CA 1OKXA 2B9LA 4TWYA 1TRNA 2GCTB 4I33A 2WUBA 3GYMA 4ZKNU 4DY7B 3Q3YA 6CHAB 2ZCKP 1MZDA 3PV2A 5HIYA 2VH6A 2BZAA 3QDZB 1ZGIA 3FN8A 4CH2B 4CRDA 1FAXA 3KL6A 1TQ0B 2R0KA 1C5RA 4BXWA 4JK6A 1UMAH 1EB1H 1C4Y2 4K3JA 1V2WT 2AYWA 2ZCLP 3AVZA 4K1EA 1GBDA 2Y5HA 1BHXB 1UW7A 1BBRH 1YPKH 3RC4A 1O2PA 4U2WA 1TMTH 2BY6X 2FYQA 3LH1A 4X6MA 1O2IA 5DN6D 2XW9A 1BBRE 2Z9JA 1CA8B 1GBTA 1S84A 4AGKA 5HXFA 2OQ5A 2BOKA 1ELFA 3MO6A 2WV4A 1GBHA 1OX1A 1CHOG 1GI7B 5F8TA 2QE7D 4TPYA 3GY2A 2VVCA 1E79D 2BLVA 3RXCA 3SU1A 3M37A 1C1OA 1QY6A 3EYDA 4WWYA 4K69A 3U8RH 4TPIZ 4ZCNA 4B2BA 2PP6A 5HGGA 4F55A 1J15A 1SKYE 1PPCE 3ZZDA 1SGQE 1P03A 5HMAA 3PLBA 3V12A 4FOUC 2CV3A 2A4GA 3L33A 1SFIA 4A1VA 3N7OA 2A7HA 1P3EA 1QGFA 1RIWC 2BX4A 2CXVA 1C5OH 1HBTH 3U1IB 4ACAA 3L3TA 1ETSH 3LH3A 2W3KA 2GX4A 3F2FA 2BDAA 3LOXA 1YY3A 3H09A 2KCYA 3UWJH 2XNDD 3UR6A 1ESTA 1MTSA 1DWCH 4K5ZA 2STBE 4NG9H 4E06H 2BD4A 1XVMA 2GMTC 4OS6A 3F68H 1RD3B 3FVFB 2C4FH 1EASA 1GJ4H 1KYNA 1SBWA 2PGBB 1HNEE 3SZEA 2ALVA 2KX4A 1F92A 9LPRA 1DANH 2XWAA 1QJ1B 3VG8A 1TMBH 1SI5H 3GDUA 1DITH 5L2ZH 1LHDH 1TPSA 1T8LA 2AGIX 1G36A 2HRVA 1NESE 1GHVH 1CHGA 2FYRA 1O2VA 1P8VC 4Q63A 1CA0C 1O2GH 3RXRA 4B1TA 2BB4A 2IPHA 2UUYA 4Q7ZA 2KAIB 1C2KA 1HAVA 1EX3A 4ZAEA 4NFFA 3SUGA 2A5IA 1LCYA 1D6WA 3SN8A 1GHBG 1E35B 1WOFA 2ANKH 3GICB 2DUCA 3TH2H 4F48B 4DG4A 1GHYH 4BAQB 2FX4A 1MAXA 3BEUA 2ZGXH 1TMUH 1H4WA 3OY5U 4OS7A 4WXVA 3ZYDA 1TB6H 5DO4H 2ZFSA 3S69A 5AVDA 1C5ZB 3DFLA 2WPMS 4R8TB 1UCYE 4VGCC 4BXSA 3E6PH 2ZPRA 3ATLA 2ZGJA 1C9TA 2CGAA 1UVOA 3MHWU 1LVOA 1ZTKA 4WF8A 1BJVA 2WPHS 3LGYA 4JZDH 1C1VH 1NPMA 3SGAE 1E1QD 1GBBA 2OXSA 1LVYA 4MPVA 4NWKA 2EI6A 2VGCB 1TPPA 3RLWH 2V6NA 3F2GA 1QB1A 2Y7ZA 3JZ1B 1GJCB 3D65E 2HOBA 1E1RD 5DK1A 1ZGVA 1FN6A 4D76A 1MAYA 3GCTF 2A32A 1MTUA 1GI1A 1VITH 2EA3A 4B6FA 3BTME 3W95A 5TCAA 1ZLRA 3PTBA 5KECA 3M35A 5J4QA 3RM2H 3IITA 2JJ1D 4IS5A 2Z9LA 4KTCA 1MKXH 1ELVA 3SI4H 2Z3DA 2KR7A 4ABGA 4DURA 1DS2E 4Q4LA 1Q3XA 1MABB 4MPUA 2A7JA 1TOMH 1QFKH 1SSXA 5EPNA 1O30A 1P2NA 2H9HA 4ZMAH 2HLDD 1Z6EA 3A8BA 4K2YA 3P8OA 2CF8H 3SV7A 2FOMB 5CHAB 3BTWE 3KQ5A 4GSOA 3UR9A 3D62A 1OYTH 1B0FA 3RU4T 1C1TA 5G4BA 2THFB 2FLRH 1O2KA 5EODA 4LOYH 1S85A 5DP3A 1BTPA 1HJ9A 3UREA 2FOCA 2HVYB 2ZDKA 1NFYA 2G5NA 2SGEE 1O2WA 4F49A 3GY6A 5JB8S 1THPB 4U30A 4YXWD 3M3TA 1YPMH 3SQHE 1BT7A 4CH8B 1XUJA 2GGVB 3MU5A 2KCAA 5AF9H 4M9FA 1ZHRA 1XUKA 2W5EA 1EKBB 2J98A 5JBAS 1TNKA 4NIXA 4AGJA 1P01A 2H5DA 1GBMA 1PQ8A 5FCRA 3VEQB 1O3MA 4YM9A 2VWLA 1TA2A 1VR1H 1SGRE 4TT3D 5DPAA 4P00A 3NZIA 4ZKSU 1BMFD 1ZPBA 5LPFA 2G4TA 1SL3A 2M2AA 1LPZB 1ID5H 1UJ1A 3E16B 2CF9H 3F9HA 4UONA 1OWIA 3N7DA 5FPTA 1FIWA 2VINA 4DVAU 1H8HD 1TFXA 1BMNH 2D2DA 2QY0B 5EOKA 1ZOMA 1YLNA 1C5WB 1ZRKA 1W0JD 2G00A 3QX5H 2ZGHA 4X1QU 2KAIA 3FKSD 1GCDA 4UE7H 1PPZA 1VITG 1S0QA 1HCGA 1YPGH 2BQ6B 3T27A 2I6QA 1P2QA 2J92A 1SLWB 1C9PA 4INKA 3PO1B 1KLIH 2ZGCA 1EAXA 3UPEA 5TJXA 2G55A 4IMZA 1DVAH 1CA0B 1O2TA 1MQ5A 1FI8A 5C1YA 1C2IA 4H6TA 2PUQH 1EZQA 2B8OH 1MKWK 3PLPA 2ZHFH 1HIAB 3DA9B 2BD2A 1V2NT 4NIVA 2F9OA 2R3YA 4OGYA 4KP0A 3BG4C 3D49H 4B74A 2PR3A 5FHTA 3LT3A 1TA6A 1TGTA 1O5AB 1IQHA 3QTOH 5E0GA 2JH0D 1O5GH 3HPTB 1HJ8A 3O8CA 5C1XA 1G2LA 1O3BA 1C2DA 1FUJA 1WBGB 2FDAA 3HK6B 3Q3XA 5DSFA 2TIOA 2B5TB 1GCTB 1EATA 2C8YB 1GBJA 4BAMB 2BD8A 3I77A 4ZROA 5AHGH 1QA0A 1WCZA 2BVRH 5EGMA 1GBAA 4UD9H 1G37A 3AAVA 4ZKOU 1QRXA 1Z8RA 2GV6A 2BHGA 2RG3A 2ZG0H 2P8OC 3LGWA 3ZV8A 2WZQA 1TGCA 3RXMA 1Q2WA 1LHCH 2WV5A 4B73A 1TRYA 1CGJE 3EE7A 1HLTH 3UOPA 3RUOA 3BTTE 1VGCC 2QC2A 1ZYOA 2A31A 1SHHB 2UWLA 1RFNA 1N8OC 1YLCA 1HAIH 2BY9X 5GNDA 3RXDA 2J5UA 1V2TT 1SMFE 1P2KA 3NUMA 1OP2A 5ETXA 1GPZA 1BRAA 2B7DH 1A5GH 1BRUP 1MTVA 3TK6A 2Q1JA 3LDXH 1BCUH 1J9CH 3GCTG 1LPKB 2F9VA 3VPKA 5C0UA 2XXLA 1RGQA 3AASA 5DP5A 2QF0A 3AW0A 4MNVA 4KGAA 2VIPA 3RU4D 3CS7A 1YBWA 2A4QA 4I8LA 1JXPA 1D3TB 1ZRBA 1AVGH 1TNHA 2ZEBA 2P59A 2PTNA 1YCPM 3M7QA 1YPHC 2J98B 4OM9A 3SNEA 1W3CA 1IQEA 3KGPA 3ZVGA 2OBOA 3ATWA 4AG1A 3P92A 4Y76A 1LDTT 3RXVA 2ZNKH 2UWPA 4A6LA 4CRBA 2GCTC 1B5GH 1SOTA 3WY8A 1GBIA 5FL7D 1NFWA 4Y6DA 2JDID 1B0EA 4IGDA 2P8OB 4WXIA 4NWLA 5DP7A 3MQKC 2STAE 3BV9B 1C5UA 4X2WA 3F1SB 4UFGH 2IN2A 4CR5A 1IQIA 2ANYA 1CVWH 2FESH 1C5YB 1NU7B 3SUDA 3T29A 1HUTH 5T3HA 1THSH 3FFGA 2ZFRH 1A0JA 3A89A 2RA0A 1O3KA 2BD5A 5EW1H 2C3SA 1GCTC 2AIPA 1O5BB 3K6ZA 1O35A 1GWAA 3S0NA 3PV5A 1P2MA 1AVXA 2WINI 4ISHH 1DWBH 4Z1MD 2JETB 3ZZCA 1OP8A 3TJNA 4Y7BA 2FLBH 5EIYA 1D3QB 2OP9A 3MOCA 1OWEA 1YP9A 5LH8A 1ARBA 1V6DA 2P94A 4AFZA 1YPEH 1ZSKA 4CRAA 3MU1A 1O3AA 3B23B 5PTPA 2Y82A 1FIZA 2FOBA 3UNQA 2G51A 1ZMNA 1S83A 3T26A 3PMBB 4DCDA 4MNYA 2GZ9A 1BRCE 2BDHA 1O3HA 4X6NA 4BNRA 5F6MA 4ABAA 1NRSH 1NRNH 2A5KA 2Y6TA 2W7UA 4YOGA 1C1WH 2Y5GA 3HK3B 4I8HA 3NRLA 4D9RA 1GL1A 1AFQB 4XOJA 4DT7B 1JBUH 5JBCS 4HG6A 5DP8A 2J38A 3GY5A 4J1YA 5KEDA 1LTOA 1FXYA 1Z71A 4CRCA 4AB8A 5GCHG 3B8JA 2H1UA 4Q7YA 2FOAA 4CR9A 5L6NH 2AH4X 1K1JA 1T4UH 2NU1E 2F91A 1BITA 1TONA 3QGJA 1O34A 1C5MD 5ESTE 1GHBF 5JPMH 1KTTB 3HKIB 2W6JD 2Z7FE 3UB0A 2HNTF 1FAKH 1RTLA 2VIWA 1C1SA 2VVUA 1YGCH 3E8LA 2YMSB 3PM3A 1SGIB 3A80A 1PJPA 1AE8H 1O5DH 2VIDA 2BD9A 5EQQA 1OPHB 2PFEA 4FUCA 4ZXYH 3GY8A 3M5MA 3ODFA 1J16A 1TBQH 1FQ3A 4IW4E 1DICA 1H9IE 1ZPZA 4LZ1H 1KXBA 2JIZD 4NZLA 1Z8JB 1K1LA 3ESTA 2A2XH 3ATKA 3GY7A 4ISNA 3ZZ4A 4BANB 4ZKRU 1TAWA 1P11E 3F0OA 1EP6A 4JZ1A 2VIVA 3P95A 1KSNA 4Q7XA 4UDWH 1V2UT 1ABIH 1OS8A 2QAAA 1SLXB 2XTTB 1EAWA 1S81A 1DPOA 3OTPA 1O33A 3ENSB 1HV7A 2NU3E 1T31A 2ZU1A 1C5VA 5HM9A 4FVBA 1CBWC 1NZQH 2WPKS 4HFPB 2ZZUH 1JWTA 3ZZ5A 1PFXC 3FANA 1K1PA 1O2NA 1W0KD 4INLA 2P95A 3A84A 1HAHH 3GCOA 4FVDA 1QCPA 4B6EA 3A87A 3SV9A 1HFDA 2J95A 1GL0E 1ZJDA 1KDQB 1ZHMA 2ZC9H 3VB6A 4U32A 1C2JA 2BOHB 4X2YA 5A0AE 1BHXF 1SGEE 5F03A 2TBSA 3P8NA 3ZZ7A 2AFQB 4H42U 3RXGA 1AMHA 2IJOB 3DSGA 3SGBE 1KLJH 1HJAC 2XCFA 4ZHAA 3SV2H 3MH5A 2VU8E 1NS3A 1PQAA 1RRKA 3LGUA 2IOTA 3M5NA 1DLKB 1Y3VA 3SORA 3UNRA 1DOJA 2IJD1 4YOIA 1EQ9A 1D6RA 3UTUH 4HGCA 2Q6DA 1QQUA 3ZZ9A 4XE4A 3FP6E 3RU4E 3F2HA 4MPXA 3ZVDA 1XM1A 1CQQA 3QUMP 1C2GA 4J2YB 1A61H 1AY6H 4JZIA 2VJ1A 1ESAA 1XMNB 2ZHDA 1GGDC 1NT1A 2CHAC 3UIRA 1ZTJA 1W13U 3QWCH 1INCA 5FX6A 1WDIA 1BDAA 2ZU4A 2JKHA 1SGFA 2XRCA 1AI8H 1XUIA 4I32A 4I31A 1QRWA 5C1UA 1KXCA 2Y81A 2ZDMA 1A2CH 4I8JA 1HXFH 3DHKH 3SU4A 3RMMH 1ETRH 2YOLA 3E91A 4OS1A 1SVPA 1S6HA 3UNSA 3SO3A 1KIGH 3OSYA 4JYVH 1BA8B 1ELAA 1QJ7B 1V2JT 3MWIU 8GCHG 2V3OH 1DUEA 4E7RG 5C5NA 5E2PA 1ACBE 5KGOA 2V35A 3RXLA 2AGGX 1LKBA 3Q77A 1BB0B 1XKBC 1K28D 3SNBA 1O2LA 2CJIA 3O8RA 4GAWA 4X2VA 5IK2D 1PYTC 2OQUA 1C4U2 4TY7A 5DKMA 4WMEA 3LGVA 5JB9S 1ANEA 1UTNA 2ASUB 2XC5A 1SGTA 1L4ZA 1W14U 4CRGA 4K8BA 3FP8E 4AYYB 3Q76A 1EB2A 1O31A 1UTJA 2F4LA 1UTQA 5IYTA 1G32B 2ZGBH 1DLEA 4ZHMU 1TLDA 3M7UA 1O2MA 2ZF0H 5C2ZA 3EA9A 3RDZA 4WJG2 1SLUB 5GJ4B 2GVFA 3SV6A 2J4IA 1G3BA 2UUFB 3SOSA 2R9PA 4YO9A 4ZXXH 1DY8A 1AD8H 5I25A 2OC7A 2H5CA 4AORA 1DDJA 4ESTE 1TYNA 1MBMA 4BAHB 1F5RA 4FU7A 3FP7E 2QGRA 2F9UA 1Y3UA 3SQEE 1F7ZA 1AKSA 3VB7A 1V2MT 2D8WA 8ESTE 3ITIA 5DP6A 2G8TA 1BOQA 3AAUA 2C8WB 3VGCC 1SGNE 2OC8A 1MQ6A 2P93A 2ZHEH 3SHCH 1V2LT 2XNIA 2ZWLH 7LPRA 3G01A 1NBME 1AZ8A 1P04A 4X0WU 2TGPZ 2AEIH 2GMTB 3M61U 2SGQE 3MNSA 3RXUA 4M7GA 5ESBA 1LHEH 1P10A 4WMDA 2XOKD 4AFUA 1YYY1 2H2ZA 1C5SA 3UUZA 2XCNA 2LNCA 4ABJA 6ESTA 2QF4A 1H9LB 4NSVA 3SHAH 4X8UH 1UVTH 4Y7AA 3NKKA 7GCHG 2A5AA 2ZQ1A 4DIHH 4FUHA 1MZAA 2VH0A 2FM2A 3GY3A 1TBRH 2ZDLA 3NWUA 3LONA 1O38A 3LKWA 1DM4B 5T6FA 2FTMA 1C1QA 1F0UA 4ABFA 1HJAB 3TITA 1FONA 1N6XA 3FZZA 1TRMA 4ABBA 4CHAC 1IQLA 2A1DB 3EDXB 4XSKU 4MNWA 3TGKE 1MD8A 3T5FH 3ZVAA 5GXPA 1FMGA 2SNVA 4A1XA 5CE1A 1HGTH 3PMHB 1BMLA 2YMSD 3I29A 2OC1A 2WPJS 5T1VA 1O3GA 1UVPA 2FI3E 3QTVH 1C1RA 4Y8XA 3RC6A 2BYAX 4ZHLU 1FNIA 2ZKSA 5LPRA 3LJOA 1OWHA 1IQKA 1CBWB 1FY1A 1YPHE 1GMCG 2V0BA 2VIOA 3ZZ8A 5J4SA 1GI3A 1TNIA 2Y5FA 1AUJA 9ESTA 3VB5A 1EPTB 1GBLA 2BXTH 3A8AA 3PMAB 1L2EA 1TGBA 3BEFB 3OEED 4OS4A 3RMNH 3T62A 1UCYH 2JJ2D 3V7TA 1O36A 3GDVA 3VB4A 4B2AA 7KMEH 2BDGA 5HIZA 1OP0A 2FODA 1UK2A 1YF4A 4H6SB 3OX7U 1K21H 3H5CB 1M9UA 4I86A 1AWFH 2XBVA 4TSFD 4TYDA 4NGAH 1W7GH 1ZZZA 3TH3H 1UTKA 1QB9A 3LC5A 1EZUC 2ZECA 3IWMA 3MMGA 3ZZ6A 1HAYB 4NIYA 2LELA 1RS0A 3OAAD 1CSOE 4Q2KA 2ZFPH 2K0QA 4FUBA 3V0XA 2ODQA 3MH7A 1GVKB 2BLWA 5L2YH 1UTOA 1EJAA 6CHAC 3MO9A 2PKAA 2FEQH 1K1NA 3P8FA 3RXOA 4CRFA 2SGFE 2BDIA 4FUGA 3EE0B 2ZDVH 2V7QD 1AE5A 1VKYA 3UY9A 2A0QB 2L6OA 3M5LA 3HGNA 2TGDA 2SGDE 3ZV9A 2UUJB 3BIVH 1V2OT 2AERH 1GVZA 1SLVB 1XXFA 2L74A 1GVLA 2PW8H 5EPYA 1W0YH 1QA7A 3MNCA 1SQTA 2JH5D 4KKDA 2PGQB 1L1NA 1TNGA 2ZPSA 1V2KT 1DWEH 3L6PA 4BAKB 5C3NA 1GI4A 1NO9H 2OK5A 2BQWB 2I6SA 3BTHE 1ANCA 2HNTC 1P12E 1J8AA 1QIXB 2AMQA 3U28C 4DJZB 2BTCE 4U01A 2O9QA 4ABEA 4AOQA 1ZR0A 3OYPA 2ALPA 2XBXA 2Q6FA 4AX9H 2ZO3H 1SHYA 1PQ7A 1LHFH 5K0HA 1Z1IA 2FS9A 3GDSA 1SGDE 4CBNA 2BDYA 2OINA 1Y3XA 5EG4A 3BN9A 1ESBA 2NU4E 2OLGA 2G81E 1TIOA 1Y3WA 1ABJH 1D3PB 2GCHF 2Z3EA 1HAOH 1C5NH 3M7TA 1GJ5H 2PWXA 4AC9A 1CE5A 1G3DA 3D23A 2D1JA 2A4RA 4DW2U 1J14A 1EZSC 5BRRE 4XBCA 2G5VA 1NRPH 1FPHH 1DFPA 2K1QA 3MNXA 5C67A 1EJMA 2PSXA 1G3CA 4KTSA 3N99A 1AB9B 4D9QA 3MU0A 1FJSA 1WAYB 5C17A 1GBFA 3BTFE 3OTJE 2QXIA 1XUGA 1MUEB 3GOVB 1CT2E 1BUIA 2VVVA 5EXMA 3E0PB 2BXUH 5EJLA 5F8ZA 2SGAA 3ELAH 4PROA 1GI9B 1FDPA 4FUFA 3KNXA 4YZUA 3TPIZ 1PPGE 4GVUA 4NIWA 3E3TA 2KFWA 1KLTA 3RXHA 2LP6A 6GCHG 4ISIH 2ODPA 1Z6JH 1UCYK 4ASHA 1P09A 3NXPA 4A5TS 2BDCA 4RT0A 3FZDA 1NRRH 1SPJA 2Y7XA 3KEEA 3QZRA 4NA8A 1SGPE 4THNH 1QZ8A 2W3IA 1O2XA 3KIDU 3ZIAD 4JCNA 1P05A 1BRBE 1P9SA 2VB0A 2ZTXA 4NFEA 5ABWA 1GJBB 1QNJA 1QTFA 3MU8A 1PPBH 5A8ZA 2PTCE 1IHSH 3SI3H 2QYIA 1GI8B 4UFEH 1TX6A 2Q6GA 1AO5A 1RTKA 2P16A 1QBVH 4JMYA 6LPRA 5A0BA 4X6OA 2NWNA 1O2OA 2GDEH 2B0FA 1C1NA 1BMMH 3EQ0H 1GBEA 1C5PA 2GZ8A 5E8EH 3U9AH 5A8YA 4FU8A 1LO6A 1L1GA 1ZSJA 3ZVFA 5T6DA 2ZU2A 1YWUA 2VWNA 1IQJA 3E1XB 2WHXA 3MNBA 2V3HH 2WPLS 1LVMA 1EFRD 1NROH 3R0FA 2BY7X 2BX3A 5JYIA 3Q3KA 1EAUA 1AHTH 2BZ6H 3RXAA 5LGOA 2O8MA 1QL7A 1VCQA 2ZDAH 3RXTA 1XXDA 3DSOA 1MBQA 3QO6A 3ZVBA 1GHAG 2WUCA 4GCHF 1DXPA 3R3GB 4P02A 3TNSA 2WYGA 1YM0A 3GS9A 4HTCH 1GI0A 1FZZA 1GJDB 1Y5AT 3RXSA 4FETA 4JZFH 2P3UB 3I78A 3P6ZB 5FAHA 2BMGB 3SJKA 1JRTA 1UTLM 2PLXA 2Y80A 3FOAA 1HXEH 3M3VA 2O8TA 3SNCA 1QRZA 2BY8X 3SU2A 3P70B 1MTNB 1CGIE 1LKAA 5F8XA 3TU7H 1QB6A 2GTBA 1ANBA 1GG6C 1PPFE 1UHBB 3M3SA 5A0CA 1GJ9B 3PROA 2F9PA 3S9CA 3SW2B 1UHBA 1GDUA 1EPTC 3O8BA 1GBKA 3VGCB 3HGPA 2G52A 3T25A 1Y8TA 1LPGB 2IPQX 2KCPA 1P57B 4JYUH 1N1LA 1SFQB 1A3EH 1F5LA 5IDKA 3DUXH 1W12U 1BTYA 1L0ZA 7ESTE 2OTVA 4IC6A 4ZH8A 2TGTA 1YPJH 1N8OB 4K8YA 3GISB 1FPCH 2A4OA 3M5OA 5A09A 1VGCB 1T8NA 1C4V2 1K1OA 5A2MH 3A83A 4Z0KA 2RA3A 3Q00A 1GBCA 2C8ZB 2BY5X 1F0RA 2RDLA 4XRNA 1W11U 3GY4A 1WYKA 2O8UA 3LPRA 1OSSA 5DJ7A 5FBIA 1GJAB 1O3DA 1ELBA 1G2MA 5C0TA 1QL9A 1FY4A 4UFDH 5EXLA 2ZHWH 1MU8B 1TGNA 4B71A 2FX6A 2BLOA 1S82A 4X1PU 1O2JA 1W8BH 1DT2A 1XVOA 2WV9A 2H6MA 2YNAA 4JZEH 1IQMA 1GHAF 1CT4E 4GCHG 1OWKA 4JYTA 2XBWA 2BQ7B 4MVNA 5FBEA 1OHHD 2F3CE 4I8GA 1MKXK 1A46H 3MU4A 5CDFE 4K1SA 3A8DA 1NFXA 1C1UH 1W2KH 4HI3A 2ZFTA 1UK3A 3KQBA 3M36A 1ELGA 1GDQA 2ANMH 2TPIZ 1Z8GA 1FN8A 2GZ7A 4NA7A 1LQDB 1GI5A 4H4FA 5I46H 3SJOA 1HPGA 3OY6U 1QBNA 4Y11E 1ZHPA 2NU2E 1LHGH 3TJUA 1PPHE 2ODYB 2C93B 5GPIB 1UTMA 3ATIA 2F83A 1HAXB 4UFFH 1THRH 2EC9H 5C94A 3F9FA 1IQFA 1DX5M 1Y5UT 2DE8A 1T4VH 3WWFA 1WQVH 1CU1A 2CHAB 2FMJA 3UFAA 3MH4A 3PO1C 2EY4C 3GYLB 1RJXB 1EUFA 1O3FA 3BTDE 1RXPA 1GI6A 2GJGA 1YKTA 3RXKA 1K1MA 1XUFA 2ESTE 4O03A 1DY9A 1NM6A 3A7YA 1IQGA 1B7XB 3FO8D 1TPAE 4NZQA 1O3IA 4X8TH 1OYQA 4O97A 2OUAA 5JBTA 2QCYA 1O0DH 2Z9IA 3H7OA 3A7ZA 1C2EA 1HRTH 2R2WU 1DSUA 3OEHD 3S9AA 2QF5A 1O2HA 5LPEA 1QQ4A 2FOEA 3U8OH 1ELEE 5H4IB 2WYJA 3QGNB 4IMQA 1TWXB 2GT8A 1A0LA 1O39A 4RT1A 3EA7A 3P17H 3DSPA 2AHME 4NCYA 3STIA 3CNRA 2SGPE 1Y59T 4OS5A 1A0HB 1EPTA 2OBQA 4FUJA 1C2LA 1JOUB 3CS0A
chains in the Genus database with same CATH topology
4YLUA 1G30B 3SBKA 3SU0A 4X1SU 1O2SA 3QLPH 4Z6AH 1TQ7B 1MCVA 1TNJA 5EU8A 2JH6D 1MMJN 3URCA 1O37A 1GGDB 2SFAA 1SQAA 1GG6B 1VJAU 1L1JA 1HYLA 4YLQH 1T8MA 4ISOA 2ZI2H 1FLEE 1VZQH 1O3CA 4D8NA 5E0HA 5C5OA 2KZ4A 1XX9A 3A7TA 2W26A 2WSSD 1H8DH 2J2UA 3PWBA 3RP2A 3O8DA 5DP9A 1NC6A 3H7TA 3SJ8A 3A88A 3SZNA 3ZZAA 1XKAC 1OWJA 3RXJA 1NTPA 5EQSA 1UK4A 3DD2H 4MTBA 2FIRH 4ABHA 4OS2A 3QZQA 1DE7H 4KTUA 4ISLA 3RXIA 2VNTA 3B9FH 1NFUA 3ZVCA 2CMYA 1TALA 3UQOA 5K7RA 3MFJA 1WQSA 2WPDD 1V2QT 2FS8A 1V3XA 3AK5A 1JMOH 3LGIA 3SV8A 2BVSH 2Z9KA 4D7FA 4DIIH 3DFJA 3GCHC 3TLOA 3F6UH 2FTLE 2BD3A 1A3BH 1KDQA 4BOHA 1TX8A 3CP7A 2FP7B 1AFQC 1BMAA 1Z1JA 1LQEA 1A5IA 1JRSA 5T6GA 2PKSB 5DGJA 3MTYA 3NK8A 3CENA 3E90B 3KCGH 2R3UA 3ODDA 5GCHF 1A5HA 4XBDA 4XFQA 4Y8ZA 1WUNH 1YLDA 1NRQH 2ULLA 2CN0H 4DT4A 1ZJKA 1HAGE 3KQCA 4XBBA 3U98H 3U69H 1KY9A 1SR5C 1XUHA 4Y79A 5L30H 1V2ST 1FY5A 3ZVEA 1O2UA 2PUXB 2ZP0H 1KXFA 4GUXA 1AZZA 2XWBI 1ELDE 1T8OA 2QIQA 2YMSC 4I8KA 1GJ7B 2JETC 1O2YA 1AKSB 2AS9A 3C27B 4GHTA 1HAVB 3SNAA 1BQYA 2R2MB 3RXBA 3PWCA 4X1RU 2PKSC 4MLFB 2QV1A 3RXFA 2VWOA 2FOHA 1DWDH 4GHQA 1O5CB 5DP4A 2ZPQA 2GCHG 1AGJA 3IG6B 1UVSH 4TWWA 5FXLA 2GV7A 4X2XA 3SU5A 1KMHB 2EEKA 2HPPH 1RTFB 2GKVE 1P9UA 2HWLB 2W6ID 3EAJA 4WH8A 1EP5A 2PSYA 1C2FA 4MQAA 5AFZH 4RI0A 3JZ2B 3U1JB 4YTAA 2J9NA 3V13A 4YT6H 2Z3CA 4UEHH 1O2ZA 4F4OC 1SGCA 2PV9B 1SOZA 2KM0A 1P0SH 1JIMA 2ZDNA 2O8LA 1S5SA 2RCEA 1V2PT 1AN1E 1C5QA 5GIBA 5CMXH 5GDSH 1BTWA 2ANWA 2FO9A 1BTHH 1E0FD 4E05H 4MDSA 4Y71A 1EOLA 3TK5A 4X8SH 5DG6A 3SJIA 3RC5A 3BTQE 5FPSA 3F3BA 5HM2A 2XYAA 3PYHA 1S6LA 1JIRA 1GJ8B 3PRBA 1F0TA 3S7KB 3PMJA 3VFEA 3ZZ3A 3KF2A 4A7IB 2G4UA 1HAZB 1TGSZ 3RXEA 1BTZA 1CGHA 2F9BH 1RIWB 1BIOA 1TOCB 1OXGA 3SUFA 2BD7A 1EXFA 2ZIQH 3S9BA 3A85A 2VBCA 2H9EH 1AUTC 4FUDA 2FXRA 1SGFG 4FXGH 1K2I1 4CHAB 1C1MA 1P2IA 2FI4E 5EW2H 1U6QA 2GT7A 1AQ7A 1BJUA 3SUEA 4O3TA 1KXEA 2LPRA 3A7VA 2ZA5A 3TGIE 4TY6A 3BEIB 4R0IA 1TE0A 2HVXA 1C5XB 4CBOA 1YCPK 1HB0B 3BTEE 4Q80A 1IQNA 1ZTLA 3UOUA 1O3LA 2ZTYA 3LU9B 1F2SE 2J34A 3UQVA 2GD4B 1EZXC 4Y8YA 4JK5A 1WV7H 1K9OE 2D26C 2QN5T 4GLYA 2PHBA 2NU0E 1OWDA 3PV4A 1ANDA 3PTNA 3UWIA 1YPLH 1P3CA 1SC8U 3LGTA 4AB9A 3RLYH 3K6YA 3KN2A 2QA9E 1WTGH 3GCNA 1GMHF 1T7CA 1ZPCA 3BG4B 4IC5A 5JBBS 3T2NA 1H8IH 1KXAA 5HKKD 3EA8A 1TABE 1AWHB 1QR3E 3SJ9A 5JDUB 1ELCA 4E7NA 5C20A 1QHRB 2ZU3A 2SNWA 1PPEE 1WSSH 2FWWA 1K1IA 3BF6H 1ZMLA 3W94A 2BDBA 1DXWA 1G9IE 2AMDA 1C5TA 3KHVA 1X7AC 1NN6A 4Y10E 1TX7A 1O3OA 1QJ6B 1WU1A 1C2MA 1P02A 3HKJB 3RMLH 1IAUA 2F43B 4RN6A 2OCVB 1LMWB 4D7GA 1GMDG 3TH4H 1HDTH 1EAIA 4I7YH 1O5EH 5FPYA 2R0LA 1WTHD 1FV9A 2BM2A 3TJOA 1AVWA 4LXBH 4NSYA 1UVUH 1ARCA 1FY3A 3ZYEA 3A7XA 4YT7H 1KTSB 2K8IA 1YC0A 3P8GA 3RXPA 3VXEH 1OOKB 2M5TA 4LZ4B 7GCHF 2EI7A 1H9HE 2VWMA 2FZZA 1E38B 4IBLH 4X1NU 8LPRA 8KME2 1AIXH 4ZUHA 4FUEA 3RMOH 5CHBA 1MCTA 2GDDA 3VXFH 2QF3A 2P3TB 3OU0A 2Z6BD 3QN7A 4B76A 1LVBA 1UO6A 2HLCA 1HAPH 3K9XB 1BBRK 2BLQA 4XDEA 2BVXH 1L4DA 1FX0B 2TRMA 4AFQA 4O3UA 4SGAE 3MYWA 4SGBE 1DUAA 3LIWA 1SB1H 5FCKA 2HGTH 1C5LH 1BTUA 1CHOF 1DSTA 1GJ6A 3DCLA 1GMHG 3OFND 3BIUH 4MNXA 1GMCF 3DT0H 1J17T 4BTIB 2QXGA 1SQOA 1MTNC 3QK1A 4O9VA 2ZFQH 2FOFA 1F0SA 1O3PB 1V2VT 3GCHB 4BTUB 2UUKB 4KELA 3TK9A 1P2JA 1IOEA 1ZMJA 1O3NA 3SYJA 1A7SA 4AYVB 3A7WA 4LK4A 3W1EA 1T32A 3LC3A 5AFYH 4AZ2B 3AW1A 1MU6B 4BAOB 1NU9A 1CO7E 2A2QH 1O5FH 2ZTZA 4WY3A 1EJNA 3EGKH 2QXHA 3BSQA 1QL8A 4MG3A 3TGJE 1P2OA 1GHZA 5B6LA 2XC4A 5CHAC 2ZHQH 1Z7KA 2CK3D 2AIQA 3KQEA 1GHWH 3ZZBA 2H9TH 3RXQA 3VB3A 4WMFA 1P06A 1BZXE 2XBYA 2KCOA 1Y3YA 4X6PA 3SGQE 1WXRA 1TBZH 3V3MA 1A4WH 2OC0A 3HATH 1F5KU 1O3JA 3A81A 1KXDA 4RKJB 1V2RT 5HYOA 4GPGA 2DE9A 5EQRA 1UTPA 1VCPA 1Q31A 2A45B 1H8ED 3F9EA 1EOJA 4ABIA 2OD3B 2W7SA 1MKWH 1NY22 2XC0A 4ASUD 3SU6A 4CREA 2FI5E 3FAOA 2QXJA 1AFEH 3C1KA 4RSPA 1E36B 4AFSA 2YNBA 3BTGE 2FPZA 2ZCHP 4DGJA 3SU3A 3SNDA 1O2QA 2GP9B 2VGCC 1GI2A 2P3FH 3K65B 2J94A 3K2UA 4Y0YE 3A8CA 1GDNA 1YCPH 3MH6A 4FU9A 3S7HB 2VIQA 4K60A 1BTXA 1IHTH 2TGAA 5B6OA 1ETTH 4RKOB 2C8XB 4AG2A 1CT0E 1D9IA 1O32A 4Y0ZE 2A7CA 1VITF 1K22H 1AU8A 5SGAE 3RM0H 4YESB 4BTTB 1C1PA 2ZFFH 3T28A 1SG8B 3BTKE 3PLKA 3LJJA 1O2RA 3PRDA 2C90B 2EI8A 2ZQ2A 3TIUA 5GWZA 3E0NB 4DOQA 4QT8C 2HPQH 2UWOA 2O8WA 1D3DB 1S0RA 3PB1E 3F0PA 1MH0A 3NCLA 3KQDA 3STJA 3A86A 4X8VH 1AB9C 1TNLA 1PQ5A 2Z94A 2AMPA 3OE7D 3WW7A 2HALA 1FY8E 1W10U 1Z8IB 4FUIA 3TNTA 5BPEA 4WVPE 1A1RA 3NPSA 8GCHF 4YOJA 3TVJB 5F53A 4K1TA 5E2OA 1G3EA 1W7XH 4MPWA 1MTWA 3URDA 6GCHF 1W0ZU 3MO3A 4IN2A 1VJ9U 2Z9GA 1Y5BT 1QBOA 2FOGA 4OGXA 1O3EA 1E37B 4A1TA 5A8XA 4NA9H 1H1BA 3ATMA 4WH6A 1E34B 1D4PB 3N7EA 1S6FA 3BG8A 1ZSLA 5EXNA 1HIAA 4HZHA 4ABDA 2AGEX 4XD7D 5E0JA 1PYTD 4AN7A 5TCCA 1N6YA 4VGCB 1SGYE 3WWBA 2WPIS 1QURH 5FX5A 3U8TH 3TJVA 1COWD 3A82A 4INHA 1MD7A 2ILNA 1ORFA 4IN1A 1NBMD 1C2HA 3MI4A 4B75A 2HNTE 1GMDF 2PKAB 1GHXH 1VCWA 2F9NA 3F9GA 1TPOA 4A92A 1ELTA 2ZU5A 4B2CA 1OKXA 2B9LA 4TWYA 1TRNA 2GCTB 4I33A 2WUBA 3GYMA 4ZKNU 4DY7B 3Q3YA 6CHAB 2ZCKP 1MZDA 3PV2A 2VH6A 2BZAA 3QDZB 1ZGIA 3FN8A 4CH2B 4CRDA 1FAXA 3KL6A 1TQ0B 2R0KA 1C5RA 4BXWA 4JK6A 1UMAH 1EB1H 1C4Y2 4K3JA 1V2WT 2AYWA 2ZCLP 3AVZA 4K1EA 1GBDA 2Y5HA 1BHXB 1BBRH 1YPKH 3RC4A 1O2PA 4U2WA 1TMTH 2BY6X 2FYQA 3LH1A 4X6MA 1O2IA 5DN6D 2XW9A 1BBRE 2Z9JA 1CA8B 1GBTA 1S84A 4AGKA 5HXFA 2OQ5A 2BOKA 1ELFA 3MO6A 2WV4A 1GBHA 1OX1A 1CHOG 1GI7B 5F8TA 2QE7D 4TPYA 3GY2A 2VVCA 1E79D 2BLVA 3RXCA 3SU1A 3M37A 1C1OA 1QY6A 3EYDA 4WWYA 4K69A 3U8RH 4TPIZ 4ZCNA 4B2BA 5HGGA 4F55A 1J15A 1SKYE 1PPCE 3ZZDA 1SGQE 1P03A 5HMAA 3PLBA 3V12A 2CV3A 2A4GA 3L33A 1SFIA 4A1VA 3N7OA 2A7HA 1P3EA 1QGFA 1RIWC 2BX4A 2CXVA 1C5OH 1HBTH 3U1IB 3L3TA 1ETSH 3LH3A 2W3KA 2GX4A 3F2FA 2BDAA 3LOXA 3H09A 2KCYA 3UWJH 3UR6A 2XNDD 1ESTA 1MTSA 1DWCH 4K5ZA 2STBE 4NG9H 4E06H 2BD4A 1XVMA 2GMTC 4OS6A 3F68H 1RD3B 3FVFB 2C4FH 1EASA 1GJ4H 1KYNA 1SBWA 2PGBB 1HNEE 3SZEA 2ALVA 1F92A 9LPRA 1DANH 2XWAA 1QJ1B 3VG8A 1TMBH 1SI5H 3GDUA 1DITH 5L2ZH 1LHDH 1TPSA 1T8LA 2AGIX 1G36A 2HRVA 1NESE 1GHVH 1CHGA 2FYRA 1O2VA 1P8VC 4Q63A 1CA0C 1O2GH 3RXRA 4B1TA 2BB4A 2IPHA 2UUYA 4Q7ZA 2KAIB 1C2KA 1HAVA 1EX3A 4ZAEA 4NFFA 3SUGA 2A5IA 1LCYA 1D6WA 3SN8A 1GHBG 1E35B 1WOFA 2ANKH 3GICB 2DUCA 3TH2H 4DG4A 1GHYH 4BAQB 2FX4A 1MAXA 3BEUA 2ZGXH 1TMUH 1H4WA 3OY5U 4OS7A 4WXVA 3ZYDA 1TB6H 5DO4H 2ZFSA 3S69A 5AVDA 1C5ZB 3DFLA 2WPMS 4R8TB 1UCYE 4VGCC 4BXSA 3E6PH 2ZPRA 3ATLA 2ZGJA 1C9TA 2CGAA 1UVOA 3MHWU 1LVOA 1ZTKA 4WF8A 1BJVA 2WPHS 3LGYA 4JZDH 1C1VH 1NPMA 3SGAE 1E1QD 1GBBA 2OXSA 1LVYA 4MPVA 4NWKA 2EI6A 2VGCB 1TPPA 3RLWH 2V6NA 3F2GA 1QB1A 2Y7ZA 3JZ1B 1GJCB 3D65E 2HOBA 1E1RD 5DK1A 1ZGVA 1FN6A 4D76A 1MAYA 3GCTF 2A32A 1MTUA 1GI1A 1VITH 2EA3A 4B6FA 3BTME 3W95A 5TCAA 1ZLRA 3PTBA 3M35A 5J4QA 3RM2H 3IITA 2JJ1D 4IS5A 2Z9LA 4KTCA 1MKXH 1ELVA 3SI4H 2Z3DA 4ABGA 2KR7A 4DURA 1DS2E 4Q4LA 1Q3XA 1MABB 4MPUA 2A7JA 1TOMH 1QFKH 1SSXA 5EPNA 1O30A 1P2NA 2H9HA 4ZMAH 2HLDD 1Z6EA 3A8BA 4K2YA 3P8OA 2CF8H 3SV7A 2FOMB 5CHAB 3BTWE 4GSOA 3UR9A 3D62A 1OYTH 1B0FA 3RU4T 1C1TA 5G4BA 2THFB 2FLRH 1O2KA 5EODA 4LOYH 1S85A 5DP3A 1BTPA 1HJ9A 3UREA 2FOCA 2ZDKA 1NFYA 2G5NA 2SGEE 1O2WA 4F49A 3GY6A 5JB8S 1THPB 4U30A 4YXWD 3M3TA 1YPMH 3SQHE 1BT7A 4CH8B 1XUJA 2GGVB 3MU5A 2KCAA 5AF9H 4M9FA 1ZHRA 1XUKA 2W5EA 1EKBB 5JBAS 1TNKA 4NIXA 4AGJA 1P01A 2H5DA 1GBMA 1PQ8A 5FCRA 3VEQB 1O3MA 4YM9A 2VWLA 1TA2A 1VR1H 1SGRE 5DPAA 4TT3D 3NZIA 4ZKSU 1BMFD 1ZPBA 5LPFA 2G4TA 1SL3A 2M2AA 1LPZB 1ID5H 1UJ1A 3E16B 2CF9H 3F9HA 4UONA 1OWIA 3N7DA 5FPTA 1FIWA 2VINA 4DVAU 1H8HD 1TFXA 1BMNH 2D2DA 2QY0B 5EOKA 1ZOMA 1C5WB 1ZRKA 2G00A 1W0JD 3QX5H 2ZGHA 4X1QU 2KAIA 3FKSD 1GCDA 4UE7H 1PPZA 1VITG 1S0QA 1HCGA 1YPGH 2BQ6B 3T27A 2I6QA 1P2QA 2J92A 1SLWB 1C9PA 4INKA 3PO1B 1KLIH 2ZGCA 1EAXA 3UPEA 5TJXA 2G55A 4IMZA 1DVAH 1CA0B 1O2TA 1MQ5A 1FI8A 5C1YA 1C2IA 4H6TA 2PUQH 1EZQA 2B8OH 1MKWK 3PLPA 2ZHFH