1DY3A

Ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from escherichia coli with atp and a substrate analogue.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSINE-5'-TRIPHOSPHATE
molecule tags Pyrophosphorylase
source organism Escherichia coli
publication title 2.0A X-Ray Structure of the Ternary Complex of 7,8-Dihydro-6-Hydroxymethylpterinpyrophosphokinase from Escherichia Coli with ATP and a Substrate Analogue
pubmed doi rcsb
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1dy3A00
3HSGA 1RAOA 3KUHA 5ETKA 1F9HA 3HCXA 1TMMA 3ILOA 4PZVA 5ETLA 2BMBA 2QX0A 4M5NA 3HSZA 3QBCA 2CG8A 5ETVA 4M5HA 3ILJA 5ETMA 5ETQA 5ETNA 4AD6A 1EQMA 3HD1A 3MCMA 3ILIA 3HD2A 3HT0A 3MCNA 4M5GA 1KBRA 4CRJA 2F63A 1RB0A 1DY3A 3IP0A 5ETSA 4CYUA 5ETRA 1TMJA 5ETTA 3UDEA 4M5KA 1HKAA 1EQ0A 5ETOA 1IM6A 3HSJA 3MCOA 4CYUB 3UDVA 1G4CA 1RTZA 4M5JA 4F7VA 4CWBA 1HQ2A 1Q0NA 3ILLA 2F65A 3HSDA 1CBKA 4M5IA 1RU2A 4M5MA 3UD5A 1RU1A 4M5LA 3KUEA 3KUGA 5ETPA 1EX8A
chains in the Genus database with same CATH superfamily
2BE9B 3VGTA 1NU4A 1KP6A 2R7VA 2FYXA 4B3TF 1YBAA 3M8PA 5KFJA 3DN9A 2X3GA 3O5TB 2VONA 1N52B 1SIZA 3OJUA 2C1EB 2BZ2A 1D09B 4DL7A 2VG7A 2ZC4A 1I94F 3OHAA 1DY3A 2OIHA 2BRLA 3BSOA 2MQLA 3DRYA 3I31A 2M3DA 1HNWF 1S72S 3QSIA 1S76D 3TARA 1NB2A 1REGX 4ANCA 5KFZA 1RAAB 4YY3F 4V19J 2PO4A 2QLFB 1IBLJ 4RW4A 3FCHA 1VGYA 4WP3A 1N5TA 1FRLA 5D77A 3G8TA 3KLEA 4AQYJ 3CW2C 2GW8A 4IRDA 2R7RA 1R8PA 1CJKA 1QUVA 1RU1A 1VFJA 2DJWA 2XNRA 1CSJA 2P5VA 3HVTA 2KTQA 4LIWA 4DSKA 2C2MB 4OYOA 3IAM9 2D9OA 3QSYB 2AP6A 4USTA 2BW7A 1PJ7A 1T02A 2BA9A 2GGPA 3CCTA 3K58A 2XMVA 3HFZB 1SJRA 5KFCA 2HHHF 2NREA 4LFCJ 4ZN3A 4HHJA 2JLFA 2WB1D 4A8YA 3J80U 1QVGR 4K0KF 2CJ9A 4Z2XA 4AQYF 1XR6A 2CPZA 2GGPB 2RQMA 3BPDA 4IRCA 2JLGA 2CAJA 2E5IA 4I7FB 2MZRA 3HZGA 2B5JA 4Y2AA 4CDIA 2Y8WA 5L1LA 4ZIWA 1UW9A 5L1JA 1VQ7S 2MPUA 2VKZG 3POTB 4ECTA 4E0DA 3OTEA 3R5JB 3N4WA 2UXCF 3CCES 1HFEL 1UTAA 3GU0A 3FVYA 3L95X 3TX0A 5D4OA 2UVWA 1KVIA 1BC6A 3HVTB 1WKLA 5C25A 4NLDA 2ZOMA 2QLJB 2WW4A 1GK8A 1K9MT 1BUXA 5KFVA 1VISA 1X8DA 2PI5A 2QC3A 2A6OA 1JLFB 4IH5A 3CJSA 4GO7X 5DETA 3PR4A 2BM0A 2YXLA 1KSPA 4DFPA 2VPWB 3V5RA 1UVMA 3W8GA 2H51B 3GYNA 1NK7A 2XHCA 1K47A 4WIIA 4BWMA 4ZN1A 3ZTQA 1O51A 1MLAA 1X5SA 4KHMA 4BBYA 2AJFE 1LK5A 2V94A 5D0RA 1CS4A 1SJ1A 2B51A 1DHMA 4WPAA 2AZ3A 2E29A 4F0MA 5J2PB 4GKKJ 4RWXA 2DR8A 3GFZA 3OTOJ 3J81U 1SJ4P 3HM9A 4MKBA 2MQOA 2E5LF 3ZZPA 2CQBA 4MYTA 4N56A 5DDPC 1JXVA 1PGZA 4BC7A 2LVWA 2K3IA 4GRSA 4QQBA 4RW8A 2HS0A 5DO2A 4DPWA 4F04B 1S9GA 1NSAA 3RRKA 3O3LA 5JUMA 4I2PB 4F2RA 1JLGB 2PE8A 3GSDA 5KFTA 3MUVP 2KFZA 4AT1B 3QRPA 3KK2A 2C2NA 1V5IB 3TJ8A 3DKDA 4LQ9A 5B09A 4YR2A 3PR5B 1R8CA 1M1GA 5CA5A 2PD1A 1AZSA 2WONA 1RBAA 3TAMB 1NHVA 1KLMB 2W9BB 2BKPA 2QYGA 1BQXA 3R7BB 1MROA 1HI1A 2J9DA 2DXFA 3GIIA 4UY8T 2V8DA 3J7Z5 3MWBA 2J8AA 3MTJA 3TR5A 2OKQA 3Q86A 4LRBA 5A8KB 2AMCB 3OFFA 5HROB 2ZM6F 1AFJA 1S6OA 5GVQA 2QLBB 6FDRA 1O5JA 1NDPA 3IO1A 4X84A 1U1OA 1FESA 2J7UA 2WVBA 3HX9A 1FX4A 1FVQA 3RGIA 1YJ9S 2J9DE 1XMQF 1L3SA 4WK1A 1U02A 3QBCA 1ZAXA 3RZAA 5LSRA 2XI2A 3NMAA 1T94A 3BO3A 1X9MA 4QPTA 5L9NA 4Y65A 2DNQA 4C4WA 3ISNC 2WBMA 1MMNA 4FN5A 2BQ3A 4U7UD 4I2PA 2DHSA 1XMOF 1TMJA 2IIHA 1FJGF 3EDRB 1P6TA 3PO4A 1S0MA 3W8PA 2G0CA 1KKHA 4U7UK 5DGBA 3P45B 3MR5A 2MQMA 3J80Y 1N54B 2Q3PA 3GLJA 3GG1A 1BQNB 2FPHX 2AF6A 1XMQJ 1IVZA 1TVRB 3CB4A 1OYEA 2RMLA 5K9FA 3W2WA 3K17A 2XY6A 2HVEA 3JTPA 1YJTA 1C1BA 4KGMA 3BB5A 4HACB 3RG6A 2XSJB 1VK8A 2QEXS 3LALA 5B0FA 1KVKA 4DR5F 2B7CB 1D8YA 1RT3B 3Q8SB 1EJ7L 1TTHB 2VC1A 4FNIA 1HNVA 2WVCA 4AE5A 2RF2B 3IGNA 3D1HA 4C11A 5E41A 2XSJA 4P72A 2VODA 2CJXB 3WX8A 2HZAA 3OPKA 3PO5A 2MGZB 3OT9A 4F7VA 1FF2A 2HK2A 1RXOB 4J9RA 1A7GE 3QGHA 2L3MA 1WI8A 2XMKA 4ZJOA 4N41A 4EGLA 3W64A 1HW9A 5GAHU 4WCEQ 3QT5A 4IQXA 1BQNA 3CJ3A 4C8MA 3EJMA 2W25A 3T5KA 4R5PA 4DX5A 5DGAA 2LEPA 3NRBA 1Q8LA 4ZVTB 4ZVEA 4YR3A 2X1GA 4RO0A 1C1CA 1JKHA 4RNFA 3K57A 4A8KA 1Q82T 4TU8A 3G86A 3RRHA 2HGLA 2NUUG 2PI4A 1ITPA 3HVAA 4EYIB 1RHRB 1HNXJ 3JSRA 3C6UB 1EQMA 2ZBQA 3D7SB 1WACA 4J9QA 1UVIA 2ZZNA 4G65A 2F9JA 1WI6A 2MZQA 2DHAA 3JS9A 4IFVA 4Y2IA 5KFYA 3VZIA 3GR0A 1ZYQA 2G13A 5A0YA 1UJ5A 1PKUA 5D0HA 2NR0A 2CJQA 1RAIB 2UVUA 1TL5A 4ZLNA 3MM6B 2YKOA 2CPDA 5KFAA 4F4YA 4IDKB 3UCGA 1E6YA 1VJWA 3KMSA 2G0JA 1HNZJ 1IKWA 5F8JA 4K4SA 3WBZA 4CNZA 3AJ1A 1WF2A 2O66A 2D3ZA 2ACMA 4KGKA 5IS2A 2CQ1A 2AT1B 3FK4A 5EN1A 1RTHA 2ZOFA 5ETLA 2DO0A 3MFHA 2HMIB 1VQNS 5CZVA 4IUFA 3NG8A 1CC8A 5HLFB 2HZCA 2VFTA 2RRBA 4ES3A 1C1CB 1TV6A 2IBOA 1RTJA 4YR0A 2HNYB 4ZCMA 5H9EK 1LWEA 2AZ1A 4KE5A 4C7QA 5HMYA 2NYIA 3BH6B 4CYUA 4CT8A 1DLOB 2D74B 5KT7A 1HHQA 5KFDA 1PBAA 3I0RA 2VDIA 1HKAA 1ZPVA 3AD9C 4KRWA 1A6LA 1EZZB 1WC1A 5CYJA 2ZH4A 3UN3A 1V3SA 3CMAS 1WKJA 2AU0A 3R7NB 5KT4A 1J5OB 4CCHA 3CC7S 1TELA 4USJC 3M8RA 4Z7CA 2W7OA 4OX6A 4PQUB 3M1VB 3R9LA 5KG4A 3KLFB 5CXTA 2CQ4A 2RU9A 3AFGA 4O44A 1RWUA 2C2ZB 2V2VA 4B9LA 2GZOA 4F4AA 2IAJA 4W90B 3TZXA 4PZVA 2E1MC 2RS8A 2JHEA 3MM7A 1CVJA 4JI5J 3G4SS 3NL0A 1GMUA 4G6VB 1MW7A 1FRMA 2ASDA 5K5MA 4KPCA 3ILJA 3FRZA 2E1RA 4ZPTR 3FNNA 4QZVB 3RAQA 3R6LB 3KK1B 2QSFA 2FHJA 1I5OB 2X1BA 1L3TA 1WEZA 4Q44A 1N6QB 3HD2A 4U8VA 4N8OA 3FZBA 1TV6B 3NS5A 1NLKL 2YQ0A 1XR5A 1VMBA 3NGTA 3NWGA 4KFBB 3QRRA 2HIYA 3SZ2A 4DQQA 1NXIA 3MM8B 2MKIA 3KLIA 2RE1A 4ZJLA 4CQ1A 2MB0B 4ZVFA 2HS4A 3HHKA 1FXDA 1M5PC 2CPEA 2VV5A 3F56A 4NL5A 1JIHA 4C0BA 1S1VA 2IDLA 4HH1A 1FD8A 3DDKA 1AROP 4RUBA 5CABA 1SL0A 2IM1A 2EK1A 5F8GA 5B08A 2G1HA 2AJ2A 2E5JA 3IAS9 1C4CA 1NO8A 4FYYB 4WE1B 1NDLA 2IJRA 2KRBA 2MLYA 2R7OA 2PMWA 2DR6A 3ELHA 4KV8A 4WXWA 4OZ5A 5EDWA 2HFNA 2AIRB 1S1VB 3QT7A 1NUEA 1CJKB 1U1NA 2XB2D 1R0AB 1LW2A 3TRGA 1FJGJ 2GNKA 2B4OA 4LIRA 2MKKA 5KFMA 4WE1A 3KMQA 2ZDPA 1UETA 1W2BR 2HRUA 3OL7A 2RDIA 3RYLA 1YRXA 5HANA 4EWTA 1WELA 1PO6A 4GKKF 2HHXA 4LFBF 3GFXA 3H2UB 3JYTA 2R2RA 3FRYA 3UVJA 2KM8C 4EBDA 1U4BA 4O4GA 3W61A 1LEOA 2DEIA 4I2QB 4QR2A 2DR9A 1KVJA 1Y5LB 5C5JA 3B4MA 2EFPA 3CWJA 2ZITA 3D3BJ 5LSOA 4NZ6A 3TJ9A 2CQGA 1U26A 4LRCA 2IM0A 3R5AA 5GAEU 4JV1A 5DM6Q 4WFAQ 4KHPJ 2IYGA 9RUBA 1YITS 4B3RF 4ID5A 4DR7J 4I67A 3E01A 5ETMA 4DSEA 4LF8J 3VGSA 5ETQA 3ZZUA 3H40A 2UUBJ 4KGXB 3DOKA 3AT1B 1B99A 4LF4J 1LQ9A 4PXDA 2UXBF 2XMUA 4QWEA 5BJRA 3V2UC 2NXJA 3Q0AA 2H5IB 4ERDA 1RB0A 1JLCB 5C7PA 4W92B 3P8BB 2IHR1 4OYAA 5HI7A 3DDIA 5F0WA 1HBUA 1UWBA 2ZWOA 2Q79A 4IQMA 2LYVA 3CJKA 1OSDA 4NA3A 5HAOA 2JFDA 4F4WA 1Q16B 3KK3B 3HHLC 3DMJA 5MAOA 1LWFA 2B9YA 3N9UC 4OZJA 3HO1A 4KSEB 1FDBA 1G7CB 4LF8F 3C66A 3A8JA 4R0EA 1RISA 2ZE2B 3NS7B 3DOMA 3KHGA 2HHQA 1SUQB 2KG0A 1FRHA 1VQPS 2AYMA 3FFIB 5HMZA 2GX8A 3OL6A 1RTIB 2KZMA 5K8PA 1JWWA 3F0NA 4C0OC 3KOAA 3B82A 1B0TA 2HWHA 2E1PA 2JNJA 2BANB 1UEKA 3I5BA 5H9EJ 4ZCIA 1T9WA 4Q2LA 4BS2A 1GH8A 1QAIA 3IP0A 1VOMA 1NBEB 4LF7F 1ZA1B 2C3YA 1EQ0A 3MAQA 3MAHA 1VRTB 1YJRA 3M6WA 2KT3A 2GVZA 2FC9A 2XBPA 2DNMA 5DZ6A 2FJWA 1LV5A 1DTQA 1NNDA 4NLOA 3M8PB 5DZ7A 4TY8B 2U1AA 3CCRS 2BQUA 1RYRA 4PWWA 1SC1B 2SXLA 3PFOA 2R9LA 4K4VA 1UPMB 2GV1A 4WFNQ 3DLKB 2KI2A 2BVZA 2DO4A 1WSVA 2GVZB 4L3NA 1VBYA 4QR0A 5KT5A 2MSTA 2W1BA 3P3DA 3M9MB 3PW7A 1C0UB 3ZO7A 2UU9F 4ZPCA 1MMDA 2CNOB 2GHPA 3KKFA 5DJBA 1R8BA 3U02A 3W63A 5L1KA 4LF7J 3CC2S 3D6TB 4PQAA 1WEYA 2FLOA 2FVRA 2RT3A 3MCMA 1P8GA 2FZCB 3UD4P 4DG1B 3RRGA 1AUDA 3CJ8A 1ZBTA 5I3QA 3EWGA 4AYBD 3WC2A 4CYUB 4B3SF 3IR6B 2CQPA 2YKMA 1G4CA 5C42A 4PG8A 3W5ZA 3MEEA 2AX0A 2R2TA 2V63A 4NX9A 3HULA 1RA7A 4UOGA 5KTQA 4L73A 4DPYA 3L09A 2E1AA 4R8UB 3C15A 3DGPA 3HFKA 3OR1B 1F5AA 1YBUA 1JKHB 2GVDA 1EARA 2DCLA 1MNEA 2HNZA 4RW4B 5ETVA 3PKMA 2V68A 4QJVA 4U67Q 3TZWA 3OL9A 1TQLA 1NHKL 1NPKA 1YBTA 3M2RA 3VCDA 4ZVOB 2QFJA 4ZVUB 4AUKA 3HD1A 3KJVA 5HVFA 2C2KB 3JQMA 4X65J 3CCWA 2DB1A 4NYPA 3VAMA 2OEMA 3D6MB 3IRXB 4TYAA 4OI1A 2ALZA 2FGCA 1NHUA 3HXMA 1PILA 1TL7A 4DUYF 4QR1A 4DFJA 5LXYA 1SXLA 2W2MP 4PWUA 1JLEB 1OPZA 2W01A 4YDDB 3CDBA 3HP6A 4ED1A 1AB8A 4DV6F 1OY6A 2YPYA 2ATLA 2YKNB 3CMQA 3JXOA 3KLEB 3V6DB 2KHCA 3MMAB 1HWIA 3AHPA 2FJVA 4DCOB 1LW0B 3VHQA 2MQQA 3KLHB 3DGPB 3OR1A 2FLNA 2AEMA 3UCZP 2NXCA 1QVFR 1S4FA 4ZP6A 4ZPAA 4KT0C 4WFXA 1ZTTA 2C2RA 2OMLA 1S9FA 3MZIA 1S9EA 4R5PB 5J2PA 2HRYA 2XGQA 4MFBB 2JVRA 4ZPDA 5LXRA 3W7BA 3PJWA 3OFEA 1VBKA 1PJ5A 2Y3YA 1S1XB 2KB2A 1RT7A 2E44A 1HQEB 3Q8RB 4DV6J 3OTOF 3NCRA 2RRNA 4M5DA 5D4LA 1FDAA 4DXLA 3TOQA 4LF4F 1R6VA 3K89A 1QE1B 4KY3A 4ATNA 1RHUB 2Q43A 3EXCX 4J5OA 1S77D 4QCLA 3HJFA 3OJSA 2CDRB 2RUGA 3IFEA 4LVNP 2CVEA 3PFEA 1PYSB 4DR2J 2OGUA 2WSCC 1G2EA 4DLGA 4C3KA 4IDKA 3DDNA 1Y0HA 2QX0A 2X1AA 3GYXB 2L08A 5G4DA 1SQEA 4DMZA 4DV7F 2PGCA 3E3XA 3BQ2A 1QSLA 3ETMA 1VIOA 2IVFB 4NXMF 3BF4A 1Y11A 3IM8A 3N0VA 5A8RA 3SEOA 2QMWA 3TA0A 3PCOB 2CZVC 1HMVA 2HIQA 2PMHA 2H48B 5HQLA 5KFBA 1JJ4A 5HL7Q 4QW9A 2PDAA 2KRRA 1U7LA 2O01C 5AXLA 3RBEA 3KXDA 2DGTA 3ZZOA 3NOCA 2HQCA 2BRKA 1SH3A 3BYPA 1Y7PA 3GV7B 2C22A 1SL2A 2V4JA 1QSSA 1JNZB 3TVZA 2W9CB 3T1HF 2FVQA 3MXHP 3I4HX 4YN3B 1FNXH 4C48A 5J1PA 3T3FA 3LP1B 1RZMA 2ZZMA 4DL0C 5J2QA 4ECQA 2Q1LA 3MUMP 2B3TB 3CO9A 3M4XA 3I4PA 3MPVA 1HPZA 2HBYB 3QO9B 1P1LA 3SSQA 1JNRB 4E8UA 2CG8A 2XS2A 4OX8A 3MEGA 1R0AA 2FJXA 4K7QA 4B9UA 3TAQA 1WC6A 2I5JB 5J2MA 5E0OA 4OJ1A 1ZPWX 3C19A 1RT5A 1Q95G 3LGHA 2GJ2A 4X4OA 5J1EA 3VAHA 3PZPA 1TK0A 3MM7B 3Q23A 3ZTSA 5KFPA 4DX7A 3IMQJ 3KK2B 1FJEB 5B0CA 1HARA 4I2QA 2YX4A 1HYSB 1QLNA 2XYHB 3CDEA 2BXJA 4ID8A 2ZBCA 2FD2A 4PXCA 3DRRB 2DGSA 4C98A 2V4JB 2ROGA 1SQFA 4K5SA 3ZZZA 3RJMB 4CT9A 1RWXB 3T41A 3M05A 3SFGA 2H5EA 3Q8PB 4DFKA 3RBZA 1X4EA 4HHUA 3SBMA 1NH7A 5JVGQ 5J2QB 2IMWP 5BYSA 2ZJRQ 2NSCA 1WHXA 2R3VA 4QU7A 3MAAB 4NCGB 3SCLE 4LBHA 3T19A 1NCLA 4YHHJ 1TUVA 3H4BA 3KWMA 5HJXA 3PX6A 4FXVA 4TVAB 4DL3A 2VBYA 1N8RT 1AA1B 2CNKB 2ZUGA 4YUDA 1Q5YA 3G6YA 4B3TJ 1GMWD 3HLUA 3JQKA 1HBOA 4KH0B 1WF1A 2B4PA 2YX7A 3GIJA 4WYWA 1TUGB 3MR7A 3TYTA 2RAQA 3ET6A 5H9FJ 2XY7A 2O3DA 1ZZNA 1Q79A 5I3PA 2A3JA 2CJYB 2CPJA 1MSWD 1ULRA 3PW2A 5D4NA 3W66A 1ZM9A 1HQUA 1WHWA 3JSMA 4KJIA 2DNRA 2C2OB 4KO0A 1IBLF 1Q1KA 1YK9A 2YKAA 4A8WA 2HVIA 1JLQA 3M9OB 1Q86T 3OW2R 1GAOA 1KFDA 3IWLA 4KKOB 3ZFVA 4DZDA 4HACA 4QWAA 1JXLA 4LF5J 3NS6A 2LP4A 4S0MA 2HURA 5EUHA 1X60A 1N36J 1QTMA 4FBTA 1IWAA 4AXIA 2H3EB 3PACA 4ILRA 2KT2A 5LM7E 1S6PA 3BGUA 4YHHF 4ECUA 2HHHJ 2G2ZA 1WSRA 2EI5A 4LR7A 1YHQS 3TI0A 4IKAA 1B7YB 5ETOA 4IG0A 2B4VA 5M2UA 2IRYA 4BHQA 2HWTA 2O67A 3NGDA 1Q78A 1WNEA 4M5JA 1H6KX 4H4MA 5EGYA 3N5FA 1Y3JA 5D0EA 4JI1F 2NS1B 4RBUA 1X0FA 2JWNA 4YFUA 2Z2MA 4R25A 4F3QA 4B9VA 1S1UB 4DWIA 1QUPA 3M6UA 4CNYA 2VFUA 4N76A 1YKWA 5IT9U 4DV7J 2AWZA 2R8JA 4JP8A 4AL5A 1EP4A 8RUCA 3W1YC 3MMAA 3W9IA 3M8QB 4TKTA 3Q8UA 4DLEA 5IT9Y 2GMHA 5E3PA 1YG0A 2FJEB 4OYBA 2FJBB 2CZ9A 4OQJA 3L7OA 2IPOB 3FSIA 2E7WA 2RQCA 1U0HA 2QYCA 4OJHA 2Y1JA 3DXSX 1BQMA 3CCZA 3EE3A 3G96A 2QFIA 3M6VA 3UFCX 3AODA 5AJ3F 3MCOA 4WWSA 3VAIA 2ERRA 2JEJA 2FHKA 5K14B 3TVYA 4JI0J 2YQ3A 1R31A 4CWBA 4C6AA 5GADU 4I69A 2HNYA 1VBZA 1RT7B 2BANA 3BV8A 3N5BA 1UEUA 4MT1A 4NLGA 1F60B 3FKBA 4J9MA 1FWPA 1KC8T 5I42B 2PN6A 3QNWB 3TO8A 3CCVS 3CXCR 1IBKF 3FBEA 5KT3A 5T7LA 2VPZB 4WFYA 2YWGA 2VU5A 3R2DJ 1HIYA 3THTA 2QMUB 1TKXB 2IC3B 2AGQA 3HSZA 4X65F 4DR1F 1S97A 2XO6A 2MHNA 2UXBJ 1K44A 2R8HA 3J81j 2JEFA 1RKJA 1VQ4S 4Y2MA 3R5GA 4X64F 3AJDA 1GTHA 4FDFA 2CADA 3MGJA 3NCQA 4RBTA 1FCAA 1V3RA 2OSRA 3MUTP 2BKOA 2DNZA 1Y5IB 3EM1A 2VICA 1XN9A 2LQ8A 3H90A 1HHTP 1GT8A 4HI1A 1DAXA 3UD3P 4P2FA 1X5TA 1SKSA 1D9DA 1IM6A 2BABA 4WYLA 1X4CA 4KH1B 4OJ3A 2M8HA 4MJKA 2DPJA 4GKJF 2PC6A 3NGUA 1VIXA 4ELVA 1MU2A 1Q7YT 4U96A 2FVPA 5KFOA 4UOHA 3CNQP 4LBPA 1PIEA 4USVA 1FWKA 4AL6A 3NNCA 3EVMA 1REVA 1IQZA 1U47A 4B3OB 2OPPB 4HH0A 2JX2A 1B4SA 3P49B 5I42A 1ROFA 4ED7A 5KFEA 3HDSA 3D6HB 2V4RA 5D3GB 2VA2A 1TL1A 1GNKA 1CJUB 5CYMB 2N82B 3N6LA 2ZH6A 2NUHA 3FUYA 5U47A 1FJCA 4J9OA 3HKZD 2VQFJ 5E7OB 5CAAA 5L1IA 1YJ7A 1Y10A 1YI2S 1N5SA 1ACMB 3EGNA 2ZUAA 5A6WA 2UU9J 3DC2A 4U95A 2LLZA 1F5CA 1VS3A 4RW9B 5CYMA 3A8KA 3E2EA 1RTZA 5I4MA 4JUZA 1Y3KA 1HL6A 2OELA 2VASA 3VR1A 1LW2B 5AXKA 4QPXA 3M8YA 4IOCQ 2M8DB 4A48A 4EFAC 2DNYA 2D3UA 1U45A 2FHOB 2W4PA 3GIRA 5IXUA 3JAMU 3J7A1 2CQIA 1CQMA 3Q2SC 4GC6A 4EBCA 3KTQA 2NSBA 4I7FA 2M7SA 2NXUA 2XMJA 2ZNZA 1QAYA 2R7QA 4QYZJ 3A4TA 4LF6F 1QAJA 2VOOA 1T95A 4CIOA 4C8NA 2CRLA 2KVIA 3CJKB 2Z2LA 2H1YA 5KG2A 2QZ8A 4OZ1A 4W98A 1PC4A 2DNPA 4CRJA 3OFGA 2ZHAA 3VALA 3I9V9 1RKIA 4TLQA 5G0RA 1VRUB 2WVEA 4XTTA 2Z8QA 4CO1A 2ZE2A 3OHBA 5HROA 2NXEA 2UXDF 3SSRA 2ZHOA 1RLDA 1NK0A 2V2KA 4YOEA 4KC5A 3W60A 5DDOC 1HNWJ 3CD5A 3CGIA 7FDRA 4XDCA 3TUZC 3A12A 4M5IA 4O4GB 4M5MA 4EU0A 1R89A 1ZZFA 3QO9A 4JV0A 2UUCF 4DX8H 2EKYA 4ZITA 1GTEA 1HBUB 1UWBB 2GS8A 4Q5VA 4M5DB 2LXFA 2MMYA 4USHA 2ZKTA 4WTOB 1T9UA 1OIAA 1EETB 4K8RA 3EPIA 1Z2ZA 3M32B 2HHVA 1RSCA 4EUVA 5BR8J 3UWTA 5FLXY 2XMAA 4ZVHA 4ZPVR 1H0HB 2HFUA 3M8SA 4NRTA 1URNA 1S48A 3WIUA 4M5GA 3SV3A 4ED3A 1SUQA 1HNIA 1RI7A 4ES1A 4PUOB 3CIZA 4Y6IA 2HNDA 2K1RB 3PNIA 4PXBA 5FD1A 1J27A 4J90A 4P74A 1O8BA 3TZZA 4ECXA 5G0RB 4FBUA 3FDSA 2V0NA 5KFSA 3THPA 1JJ2R 2OD4A 4TLRA 3BO4A 4DBQA 4DX6A 1WG4A 1SJ3P 4F3OA 1T0TV 1WDDA 2A2CA 5HQ8A 5E3AA 4NLRA 5FJ4A 3H5UA 2JLEA 2DKOB 5RUBA 3JSBA 4P7VA 4EO8A 4ED4A 4C0HA 2IFXA 3MTKA 3DNCA 4CM0A 3TNVA 2AW0A 1YJWS 1R7IA 1SJFA 3FSYA 2E1CA 5CCLA 1M5OC 2B43A 2HEKA 1U8WA 4PRFA 3UN5A 5L46A 5IT0A 3OL8A 2C42A 3NNHA 1HPZB 3AOAA 2B0GA 4TNOA 4EEYA 3SIPB 3KNAA 4I0WA 2KYZA 3G87A 5J2MB 1S5ZA 3GCWP 3GJQB 3PM9A 1Z1ZA 4HTIA 3G9CA 4JV5F 2XWYA 2OFHX 2HAFA 3BBBA 1GMWA 3JTOA 4LRFA 4OMFG 1XNQF 3D28A 3CD0A 4LT6A 1KN6A 2F3JA 2UVRA 3IBFB 1NJXA 3E51A 3C14A 4CLKA 1K73T 2ZH7A 3BN4A 4OX9F 3VWSA 1UAWA 1SBRA 2HFVA 2OPSB 5C2CA 4P2SA 3GJTB 3IC1A 4FKXA 3W2WB 2RHQB 4G1PA 1MN7A 4CLZA 1G3OA 3MCNA 4UOCA 4QWDA 2L41A 1YRUA 4Y28C 2W8KA 1RUSA 1LW0A 3QATA 1H2UX 1M5VC 1UVJA 4ECVA 1T05B 3M8WA 1HQ2A 2N7YA 2OPRB 2PEHA 1QY7A 1S1UA 1VCTA 4KB7A 1UVKA 4G1QB 1SV5B 6AT1B 3W3SA 3HHLB 3H4DA 5LMUJ 2AJ1A 4MFBA 3C15B 4ALZA 2K2PA 1KOOA 3M7VA 5A0YB 2OJ3A 2XHWA 3I0SA 1DQAA 1GFWB 4C9DA 3A3NB 4I56A 4K4XA 2CWXA 2XCAA 4J9VA 3NXZA 2R8KA 4KO0B 1TFYA 3HVRA 2PT0A 3MHYA 4HLBA 1M90T 2VFVA 1KS2A 4DPUA 3ZZRA 4KKOA 2KJWA 4OFZA 1R0BG 3SYZA 1ELOA 3TAPA 3FGVA 3KLFA 2I6WA 4G1IA 2YWWA 1Q81T 4UOFA 2LDIA 1NRKA 5IOLA 1TL7B 2XZDB 3SV4A 3AD7C 4D3GA 1S1XA 3ENWA 3M8ZA 4ZOSA 1N48A 5A8RB 3MM6A 2OSQA 4GMKA 4LREA 4C3LA 5BR8F 4B9MA 1G6BA 2XSFA 2ADCA 5LJ3Y 5F8NA 2FJAB 2W9BA 1RA6A 2CWKA 3I9ZA 1OYDA 3IA0A 2NYHA 3WQPA 2C3MA 5KFWA 4YQWA 3RW7A 2HW3A 4NEYA 1YDLA 1S57A 1RT4A 2YKQA 2YQ1A 3D66A 1UMJA 3GSIA 4IG3B 4DCJB 2DNOA 3OV7A 3BPSP 3IS9B 4FNHA 3PEJA 3DLGA 2CXEA 3FEZA 2ZBRA 2DNHA 4U9RA 5KG3A 3TUIC 4TQSA 3V4MA 3HT3A 3RU0A 3CPWR 4DV3J 5AE1A 2VOPA 2AQ4A 2HHUA 3P6YC 1PYOB 2FQQB 2EWHA 2JJ4D 2JL9A 2R42A 1IJEB 2ROPA 4B02A 3QZ8A 2LKZA 3G6ES 5E33A 4D3HA 4X62J 4A46A 1HBNB 3Q24A 5M2PA 2VA3A 4JI7F 3MPDA 3TQ1A 2RDDA 3PVXA 1RP5A 3MEDA 4ANEA 2RB7A 1YRTA 3BBCA 3NEKA 4NI2A 2DNGA 2HQIA 2BOAA 2HLUA 4F50A 3UCUP 2MQ8A 2LQ9A 2D3O1 4F3MA 4DDFA 3HJVA 5AXNA 4P52A 2ACYA 4ER8A 1MWZA 1MN9A 2LEAA 1FTCA 4ZIVA 3T5JA 2DRBA 2Z57B 3CT9A 2FTRA 3SDEA 4DV0J 1XC9A 3MEKA 4IYQA 2QL9B 2GAGC 3PW4A 1YZ7A 2W2NP 5GAGU 5EX0A 2HNDB 2K1RA 3FZ2A 1QAXA 1U6ZA 2JOQA 2V9WA 2B4UA 4CLFA 2GO9A 1S7HA 3EGVA 3R3TA 4DV3F 5J1EB 3DYAB 1RT2A 3D9BA 3G8SA 2MDAA 5A8KA 4DQPA 3HI9A 2HGMA 4QYRA 2KKHA 3IXQA 2XS5A 2MY7A 2RJZA 2MQNA 3MM5A 4URQU 4ZVSB 4O3SA 1K0TA 3V6KA 1TL3A 2IY5B 4QOTA 3HHEA 4MIAA 3LP0A 2HSEB 1CJTB 3DRRA 2C2DA 1KDNA 2W24A 3EDQB 5JVHQ 1F9FA 3MPYA 1H38A 3LTOA 2OPPA 7FD1A 3BSCA 3N79A 3DRSB 4FZVA 3A13A 4WTYA 4DV5F 2D1CA 2OEKA 3P4UB 4WZMA 5HMXA 2VQEJ 1TL1B 3EVOA 1FTRA 2W8LA 5H9FK 1CJTA 4WIQA 5HJYA 1VLOA 1DFDA 1D8ZA 3FJ2A 1T8EA 1UVNA 4LMZA 2J0XA 1WOPA 1FWLA 2DRDA 2JRSA 2LQ5A 3DGVA 3ILLA 4B08A 5KG7A 5GAHI 3CCJS 1DQ8A 2WK4A 4PG5A 2D41A 2OD6A 1X0PA 2G9OA 3C6UA 2LCWA 3DOMB 2HBZB 5DDQC 1N32J 3OXFA 4U8YA 1T9XA 5FIIA 3DOLA 3FC9A 3MOZA 4DPOA 4N77A 1H3DA 2OO4A 4LUBA 5J2NA 3MFIA 1X4FA 2OEJA 2OPSA 1N0VC 1RWPB 2CPIA 1GX6A 1CG2A 3W2VA 1E6VA 2R7XA 2GO8A 1RTDB 1YJUA 4CLTA 2VH7A 3IG1B 1WG1A 3UR0A 4Y3CA 2AEFA 2NCKL 4R0JA 3HSJA 3AA9A 4ED8A 2CYYA 4NWBA 4LF9F 4ZVRB 1DURA 1U48A 3PYEA 5CD4H 2RQKA 5CYQA 2XZTB 2YPZA 1PBUA 2BKNA 1BWVA 2HG4A 2HRTA 2DGOA 2LQJA 4FYWB 1OY8A 3OTCA 3TUPA 4QIEA 2EFQA 3QJJA 3CJRA 1N5QA 3H2VE 3QGIA 4NA2A 1UW4A 2MKJA 3UE2A 1P1TA 4MIWA 5A6PA 4GC7A 2I2YA 4DG1A 4C3MA 4Q45A 1NSKL 3LPEA 5J2NB 1YWXA 3MDFA 3C16A 1HWLA 2FDNA 1VBXA 3ZC4A 4ZS6A 2N7CA 2E7XA 1FVSA 1DTTB 2APOA 4LR9A 3SCKE 2DBBA 1VQKS 3IG1A 1RK8A 4J91A 1Y4ZB 2RKIA 3D5MA 2MSSA 3OR2B 3U1LA 2UUAJ 4WFZA 1S7IA 4MKVA 5F0UA 5KFUA 3U1NA 4PG7A 2ZD1B 5H1SV 5CCMA 4A8SA 5IV3A 4F02A 1JLAB 3G82B 4J9LA 4A47A 3CCQS 1WHVA 3L7PA 2OTLS 4LF6J 4LFAF 2DIUA 2AGOA 2YNIA 4J9NA 3IWXA 1NJIT 2LFVA 1SKUB 2R7WA 4B17A 2DIVA 4OYMA 4HYKA 4Q2MA 1NKCA 4DV0F 2AD9A 4XPEA 4K4UA 4NCBA 1F5BA 1X4AA 4OV1A 2O1PA 1ZM2A 4DSLA 1T9TA 4P2XA 1VQMS 1LXNA 1RHKB 2V67A 4DJBA 4KBIA 4NOHA 2GVDB 3DLBA 4M95A 2BR0A 2LECA 2OAUA 3CJ0A 3UR3C 3MOJB 1Q8KA 1WJ9A 2ZH1A 3TUJC 1WOOA 2LDYA 1APSA 3CD7A 1DARA 2B9EA 2V2QA 4UY85 1RHJB 2PA8D 4DR4F 1UCNA 2J0SD 2CPHA 3G82A 1M5KC 2QGFB 3PX0A 1QTNB 2VZ9A 4O3QA 3DXBA 5KFKA 3WHIA 2F4VF 1G1XA 4YB6A 4H54A 3NBPB 4DEZA 2MXYA 4A8MP 4K4ZA 1HWKA 2B5JB 2DVIA 2FHMA 2J0QD 1QSYA 4JI6F 4FF4A 4EMDA 2R2UA 2J9EA 2DK2A 1B0VA 3PG9A 3PHEA 3VVTA 5EWFA 4J9SA 1UA1A 1TP7A 2P8IA 2Z30B 4USWA 1DBDA 2VF3A 4TU7A 1QJHA 4L75A 2I8EA 1JJCB 3DHXA 4QIWD 2UP1A 1XNRF 5ITHA 1S10A 1CS4B 4DR4J 1ZM4A 3CE8A 3CTRA 2UV8A 3GPAA 1GEHA 1NZAA 2GMJA 2BE2B 3L7UA 3HMJG 4RUCA 1VQ9S 2UZAA 5B0DA 2AGPA 2XM3A 2AYGA 2EW9A 3ZXWA 4AL7A 4HT7A 3KUEA 2YVSA 1M1KT 4Y2CA 3T1YF 4DS5A 4WP8A 2Q6BA 4RKUC 4K4TA 3U1MA 3H0PA 4PKDB 4E2FB 3VGVA 1FFGB 1S6QB 2B6AB 2CZ4A 2F5GA 7AT1B 1RT4B 3PEHA 1KTQA 1B70B 1JQGA 4G1QA 2QG9B 1I94J 2DR5A 5D3GA 3RTVA 3LP0B 3KDOA 3PJXA 2H65B 3K5PA 1ZM3A 3M6XA 1NSPA 2L9WA 1MMLA 4O0NA 1I3OB 4I1TA 2JC1A 3VV2B 4RW6B 4X4QA 1MROB 1U25A 1EHWA 1X4BA 4MAKA 5ETRA 4DL6A 1FHTA 2KHDA 3I0SB 1HNXF 3N01A 6FD1A 4V19X 3UN2A 3M1VA 3P5TL 3W5YA 1X9WA 3K8WA 3O44A 4JYAJ 3GYGA 2DHGA 4JI2F 3FQKA 4TN2A 3R2CJ 3AQPA 4WFBQ 1YX2A 3IGVA 2BE2A 3L4BC 1K8AT 3PIOQ 4A8XA 3R5CA 3MMCA 3TX8A 3NGKA 2GC8A 2HFSA 2RD5C 4IH6A 1Q5VA 1AXQA 1FEHA 2G2YA 4HDGA 3IRWP 3T1YJ 2XWXA 1T9VA 1Q7LB 2N3OA 3H42A 3D0GE 1N34F 2I1RA 4EO6A 2CNNB 1RAJA 3KLGA 1FDNA 1RWMB 2GQ2A 2K8GA 2MKYA 3B78A 3ILIA 4PABA 5KFXA 1JLFA 1MWYA 1PAEX 1K1QA 3LGMA 5DG7A 1XTZA 4PXEA 4JI2J 1XJWB 2EC2A 1HYSA 3DLKA 5B0GA 2J0WA 1IBMJ 3MD3A 4LF2A 4WXOA 2XLIA 4IR1A 2VBZA 2GIRA 2DR7A 3Q83A 4ILLA 1YGYA 4J37A 1N0UA 4Q8FA 3M30B 1Q0NA 4RW7A 3OLAA 5I3UA 2XY5A 2F65A 2K3KA 2NPIA 3BYRA 3FSXA 3T5LA 3H25A 2AYEA 2GA7A 3CCUS 4JYAF 1RCOB 2W7AA 3AJ2A 4X4SA 1UEVA 3HPOA 4CI0B 2R8IA 1EIYB 3VAFA 1IKVA 2QTWA 1F2HA 1EAYC 2KZZA 2XC9A 1IXKA 5GADI 3TVKA 2YKMB 4F4KA 2LEBA 2OI2A 4OLOA 3B6BA 3B54A 2H4WB 3MEEB 4ICLA 4DN9A 2DRAA 2E9RX 4RU2A 4JI5F 4RW8B 4F25A 3KHRA 4WKRA 1N34J 3RAXA 3KHHA 3KLGB 3OSPA 4B3MF 4YMEA 1CULB 1SCJB 2BV3A 2M2BA 3UW1A 1C2PA 4OZLA 2DGVA 2E7VA 3AXKA 4PUOA 1PYTA 3F41A 2L9NA 4I6WA 1N32F 4M63A 5BYRA 1C0TB 2D7SA 5AJ3J 4DR6F 3EUNA 1FK9A 3DRXA 1RU2A 4URSA 4UUWA 4RW7B 5L8RC 3LUYA 4DUYJ 4ID5B 3CJ4A 4RUHA 3QT6A 2RF2A 2HPUA 5K8OA 4USUA 3F73A 3TP2A 3BDPA 3PY8A 1ZS6A 4QU6A 1X7VA 3I87A 2DHHA 2IYIA 3DLHA 2HKEA 3IRXA 5L9XA 1S4EA 2EEYA 1IQTA 3PDNA 1HD0A 1FJ7A 1RT2B 4H4KC 4IFVB 2A10A 2M5YA 2YTCA 3NLCA 2YX1A 2PSZA 3P96A 3R27A 4LR8A 5L38A 3LWLA 4LF9J 4LFCF 4HL9A 1SV5A 3RB4A 1VLYA 3L9ZA 3HHLD 3LPYA 4HT5A 4ZPBA 5B0EA 2AJQA 4K5RA 4M5KA 4X64J 4MMOA 1OY9A 3QIPA 1FE4A 3CDWA 4X62F 1IKYB 3IBCB 3PRVA 1FXLA 5A2QY 4XDDA 4LQ3A 1L3UA 1RLCL 2B9XA 2XGPA 1L3VA 3D3CJ 4FS1A 2BOPA 1TFWA 3BSAA 1X4HA 3KUGA 4F26A 2VFSA 3AOCA 1FFSB 3RUBL 3MD1A 4X4UA 4G3IA 3U27A 4R8UA 2JZ5A 2MGZA 2LQBA 2VG6A 3BKUA 5SUHA 4ZHRB 3IR7B 5HBMA 5LMNJ 2ADBA 3A3OB 1SL1A 1J5EF 3FCVA 4C8LA 1LWEB 1RADB 5F8LA 3I56S 2CFXA 2MZTA 1DTTA 1WC4A 1IKWB 3M2RB 3OTDA 1ZOTA 2K7JA 2KXHA 2F40A 2IM2A 3QPIA 4HI2A 1SJQA 3A1YG 4RR5A 1SIWB 1J5OA 2AYBA 1YQHA 1FI4A 2E9ZA 3B4DA 4PPZA 4C11B 2WCXA 1EKRA 2Y1RI 3EZUA 5KG1A 2KYXA 4I68A 4C8YA 2LU2A 3G71S 4O23A 3V6HA 1V9OA 1N33F 2A6MA 2Z2YB 2DNNA 2WSFC 2WSEC 5F3ZA 5LSLA 4OX7A 1M0SA 1HMVB 2BMBA 3WC0A 4C2MA 3J7YI 2VQFF 1BQMB 2RDJA 1VQ6S 3GTYX 3OD2A 1GXLA 4B9TA 1HD1A 4JI8J 4RWWA 4K4WA 1U1MA 2KL8A 3NWRA 2ZVSA 5D4PA 4UT4A 1VR6A 3OLBA 4ED0A 2DXEA 2EFVA 1T7PA 2R7SA 1HBMB 1SH0A 2WW8A 3TA2A 1IBCB 1I1GA 2QLXA 3PW0A 2K06A 2JH3A 3DU5A 1IKXB 3IWNC 3MM9B 2E66A 4P75A 4UW2A 3C16B 3HSDA 1NPRA 1HBMA 1XEZA 3KFWX 1KLNA 2HS3A 1UZHA 2KU7A 1FKPA 1BXNA 4KGVB 4PR6A 4QWCA 2NXNA 1XERA 4RBVA 1I6JA 3GG0A 2A1BA 3DLJA 2FGOA 2HBQB 1JJHA 1N33J 3SDEB 5B7WA 4ZLJA 1PC5A 3ZTRA 1H72C 3DM2B 1ZTWA 3KJVB 3R7SB 1BMQB 4C8KA 2DNLA 1LOUA 2WOMA 3DI6A 4DN0A 1VQYA 2X51A 5HLFA 3FEXB 4B3MJ 4L74A 4ELUA 3CJTA 4C8ZA 5EWEA 2HFZA 4HKQA 4RW9A 1R8AA 1BGXT 1S0VA 3TZYA 1YVFA 1REVB 1XR7A 1QDUB 5GMEA 4EI2A 5L39A 1KQKA 4XPCA 4ED6A 1X31C 1S99A 1H7WA 2J7WA 1WORA 3AH6A 3CC4S 2COLA 1C4AA 2J8SA 5HN0A 1KHVA 3DI6B 5HP1A 4DR6J 1U6FA 1TK8A 3D1OA 2WB4A 4DR3J 1CJUA 4KQZA 5IQQA 5KFLA 2YWKA 1NSQA 3UDCA 2ZH5A 2QA4S 5K20B 3DRPB 2GJIA 2J7KA 4QIVA 2PMZD 1W7WA 4KR0B 3JTNA 4OHXA 2DH9A 3T6JA 4BLGA 5DG9A 2H9ZA 4ECZA 4ELTA 3NMRA 2HHTA 1HBOB 3I82A 4M5NA 2P6SA 3M2VB 5BXIA 3EPGA 5KT6A 2KDOA 3AY0A 1YJNS 2VJUA 3PV8A 2CA9A 4DHVA 2EKNA 1WC0A 2BE7D 3SFUA 1TL3B 4MH8A 4O4RA 5ADZA 1GXUA 5DQHA 2D69A 2I0XA 2QJ3A 4NMXA 5DM7Q 1Q4RA 3BGLA 3BM7A 1B7FA 5CH7B 3R6GB 3H2LA 3GWCA 3OSNA 4ETZA 1WC3A 3DOLB 2IVMA 3KLIB 2KXFA 3A8IA 1UJ4A 4FXWA 5KFQA 3ENQA 2QN6B 3R1HA 3DOKB 5M2RA 1UKUA 3EGZA 1NK4A 5LMNF 2DHXA 4CH7A 4JV5J 3PYDA 4UQGA 1S0OA 4K4YA 4JI1J 1UZDA 4UF4A 2OPQB 1VQ8S 4UZBA 3JAMY 3HFVA 4M5HA 5IC4B 3VGUA 4ZLLA 1NEEA 1N4LA 2BJ8A 3DLLQ 4CP5A 3RR7A 5ETNA 3TQEA 3MI7X 2C2EA 4QYZK 4JI3F 2BJ9A 1IBMF 4ZLPA 4I6YA 2DPIA 2MZ1A 2FZGB 5LOQA 3HT0A 1X5PA 2XLKA 3GP9A 1KLMA 1Y00A 1VC0A 1UFLA 5KOWA 3OQ2A 5C25B 2J5AA 3NGRA 3NKYA 1PSDA 2KM8B 4ECYA 3AAWB 2C28A 2DNKA 4ANDA 1F3FA 5HK4A 2AEJA 4B3SJ 2BQRA 1ZETA 1T11A 3D0IE 2L48A 1M5HA 2BJDA 3N6NA 3OXLA 2YNGB 2XMMA 3DCAA 3VQTA 5JJBA 1YIJS 3L3CA 1BE4A 2VL1A 2W9AA 2EFGA 1P9QC 4UQTA 4OV6A 4X4RA 4NLXA 1S59A 3UI3A 2IBKA 2MZSA 1DRZA 3K8VA 3E01B 1U1PA 4KGZB 4I4BA 2IJNA 1JMTA 2HK3A 2IMOA 4FKYA 2F4FA 5DQIA 5IZHA 4M8LA 4FXDA 4L3KA 2MJUA 2XO7A 5DLFA 3S7RA 1U1RA 5T7LB 1S6PB 4USKA 1OSCA 2UUTA 4NXMJ 3GQCA 4KTQA 1FK9B 4AXJA 4RZRA 2Y8YA 1XBWA 4HVZA 5EX3A 1JXEA 3AD8C 1IUJA 3MR6A 5F3TA 9ATCB 2Q6CA 3THVA 1AZSB 1N5YB 4X4VA 2HQ3A 3QT8A 4GVBB 3GIKA 2VHGA 3CDAA 3N6MA 4NASA 2ZKUA 3S1TA 4ZJQA 1O6XA 2AKWB 2ZD1A 5GMKa 4FYDA 4MYUA 4Y0FA 3Q2TC 1DQ9A 2V50A 2EPIA 3LW5C 1FFWB 5E3QA 1H2VZ 3KG0A 5C42B 1KFSA 2FLLA 4OI4A 4MK7A 3ZZTA 5K8NA 1S79A 2IM3A 3PTWA 3QQCD 5IWAJ 4LSNA 3ET6B 3CJ5A 2WZ1A 3MF5A 3QIPB 4NZ0A 2IA0A 4Q43A 1T03B 1UL3A 2RILA 2CQCA 3ISND 1M1HA 1X4GA 4WU3A 4NZ7A 3TEHB 2PA3A 2VBWA 1VRQC 3FMWA 3FQLA 3ITHA 3CCSS 3I0RB 4IOAQ 2U2FA 4ICLB 3VZHA 4CH1A 4OI6A 2RU3A 2VG7B 1NM2A 3NBPA 5DRKA 2JSXA 1RGVA 4FF3A 1RDRA 4DSFA 1KQSR 1RWNB 3SCIE 3J7ZT 1NJYA 1RAFB 2ZVIA 3DFEA 1ZA2B 3FBCA 1NDCA 3HSGA 3TA1A 1X4DA 1PJ6A 3G6XA 3MPWA 3RB3A 3QJPA 1U09A 1TKZB 2BJ3A 4OHVA 5GAEI 5AE2A 1N5YA 2RHSB 4RJVA 2X1FA 2BBEA 3TJAA 3J7YU 2FVCA 3LF0A 3GV5B 4DUZF 3VAGA 2YWHA 3SMZA 1TR0A 2XLJA 2UUWA 2VD3A 1GX5A 1NDKA 4GVLA 5HO4A 4DR1J 2VB6A 4BCAA 4HHHA 4ED5A 3BN7A 1NJWA 2YWFA 5HATA 1FRXA 2HAIA 1E6YB 3GONA 5EHHA 1SKWA 4OYXA 4XIUA 4NXNJ 2HHSA 3MR3A 2V4QA 1IN0A 4DV1J 2F1FA 2OFGX 3P5BP 4FS2A 1RYSA 1KD1T 2DD8S 3PYFA 1F2GA 3GJRB 2ZJPQ 1IWGA 1OO0B 1SVDA 1KR4A 1RWWB 3ILOA 2H5JB 4GKJJ 1F3VA 3D6FB 2YH1A 2EVZA 3NAIA 1S1TB 4JB8B 3I32A 2KXNB 2MKCA 4EYHB 5CHCB 1PAUB 2OPRA 1RE1B 3LA0A 1SKRA 2BW2A 4JI3J 3NOGA 1WEXA 1WF0A 4ZVPB 4N7TA 3D54A 5C24A 4CO4A 3OUYA 2UUCJ 5T14A 3ZZYA 3MURP 5B0BA 2H4YB 1U2CA 4TQRA 1IR2A 3VVUA 3BEGB 2PEBA 4K59A 1TZ0A 2MHEA 3C8YA 2KJVA 4NMLA 3D68A 1AW0A 5K14A 4DV4J 4CLSA 2F8MA 5ETTA 3K5MA 1YZ6A 1HWUA 3JSYA 1RBOB 2NZCA 2DGUA 2ZH8A 1LNQA 2A18A 2M70A 3UDVA 4NLTA 3TEGA 2FIUA 2R7UA 1HBNA 1W25A 2RNEA 3PW5A 1FE0A 3M32A 3ZNJ1 1KHWA 4KAIA 4TY9A 2E5HA 1ZH5A 1Q8BA 1RAGB 1F9EB 1I51B 2YWEA 2DH7A 3QAUA 4M5LA 3GMGA 1JLGA 3B8HA 4NLSA 5MLCV 1HQEA 5CZXA 3T9ZA 1Q8IA 2ZWPA 2RUSA 4OZ0A 1X9SA 2Z4PA 5KFHA 3IS9A 5AXMA 3K59A 2WONB 3TAMA 1RT5B 4RNHA 2FHJD 1VC5A 2AX1A 4P73A 3CCMS 5JXSA 2VQEF 2IJFA 4DU7A 2MKHA 2V8GA 4MK9A 2VFRA 4WU2A 3E8OA 4N47A 3UQSA 5I3UB 3TW0A 1YLXA 1RTHB 2HMIA 1HNZF 5D15A 2FY1A 4OIXA 4P10A 3KJFB 1NAQA 3CJ2A 2CPFA 4RW6A 3VAJA 4CLWA 4X4TA 1JLCA 3I5AA 1RTJB 4K0KJ 3PX4A 2CG4A 4DQRA 3DRPA 4RU9A 4Q7AA 1J2VA 4ZPWR 2CQHA 3MPUB 2MZJA 5DQGA 3F44A 1NPPA 3C46A 1BLUA 2ABYA 1JX4A 3DMJB 2HVZA 3M2VA 2O5DA 3NY0A 2H54B 2QA1A 3PRDA 4LF1A 3MMBA 1FNMA 5ETKA 1XNQJ 1FRIA 2YNHB 2ZZTA 3FCWA 3QAEA 1PCAA 3MECB 3QLHB 3QGGA 4J9UE 1JB0C 3ZTOA 2AV5A 4BC9A 1EETA 1OQ6A 3OBIA 1LK7A 3A8EA 1O0PA 1WD6A 5IM0A 3I55S 3V6JA 3BJYA 2QT7A 3LANA 2J76E 1CQNA 1UP1A 2CQ0A 2YBVA 2YNHA 3SQOP 4RNOA 3UVJB 2EG2A 4B9NA 4Q0BB 1TL4A 1SQGA 2DGWA 2W4DA 3U7JA 2YH0A 2UXCJ 4OZNA 3GILA 2P9EA 3KG4A 3IBWA 4WKYA 3RR8A 4JBCA 3OXGA 1WG5A 4YB7A 4DU8A 2B8PA 4DSJA 5GMDA 3BR9A 3BO2A 4F2SA 3ENVA 4B3RJ 1S49A 3SI8A 1K0VA 3VQSA 4ES2A 2P9CA 1UVLA 3CULA 4PWDB 2DGXA 1KQFB 2JEIA 2CJAA 2D9PA 3RBXA 3QGPA 2A2DA 5IWAF 2EFOA 3DYAA 3BQ1A 2X3DA 3V4IB 4WZQA 4U7CA 1C0UA 1VK3A 2AHOB 5KFGA 3C6TA 4LSLB 1NKBA 4OYPA 4IG0B 4PWDA 1FRJA 1S12A 4QIFA 5HQMA 2VUGA 4ZCKA 5AT1B 2VIHA 2HZVA 1ZAWA 1WDTA 2BYCA 5LT5A 2WTFA 4LJMA 2KH9A 4ILMA 5IQ6A 2MLZA 3MMJA 5CYQB 1KEKA 4DL2A 5KFRA 2V6AA 3T6BA 1TAUA 3AB2B 2DYAA 2XYGB 1LWXA 8AT1B 4YP3A 3ZTPA 3V81B 2GJFA 3BREA 2R4FA 4DFMA 1TK5A 1FA0A 4DF8A 2E5GA 2P6TA 1TMMA 2Y0BB 3JYTB 3ETOA 1SB6A 1SH2A 1UWAA 2VBXA 1RAHB 5T41A 4N5SA 2V8HA 3PKYA 1Q53A 1HQUB 2DITA 1ZAVA 2HNZB 2L9DA 2WVDA 1YTYA 1JLBB 3QWPA 4H4OB 2OH2A 4OX9J 3V81A 4OL8A 1OS5A 2NLWA 3RB6A 3FMBA 3MAAA 4OI2A 1RT6A 4P71A 1FERA 3NAHA 1VRTA 5DLGA 4C8OA 2IVYA 2JVOA 4FPRA 2RKIB 5ETSA 4CO2A 2BDPA 2PFFB 3D1QA 1RWKB 1OQ3A 2OHDA 3UDEA 2A0FB 4ECRA 1VQOS 2EFNA 2JC0A 1S1WB 2YNFB 2BEFA 1JLAA 1HLWA 3KDNA 3LAMA 5D0GA 4F67A 1SC3B 5KFFA 1RTDA 3CF5Q 1IKYA 2VG5B 4MKYA 3EX7B 5D78A 3QMQA 3SQGA 3CCLS 4BDPA 2M9KA 2NQPA 1F1BB 2YKPA 1UJ6A 4Y2KA 1S1WA 2YNFA 3D4JA 4A8QA 3W5XA 4TU9A 2OLWA 3TANA 3WIVA 4NLWA 3DLGB 1A9NB 3KG1A 2IA6A 5D8HB 1XMOJ 2XS7A 4WF9Q 3O8WA 2VG5A 3GB0A 4LSNB 2YNGA 1IKXA 1SC6A 4NLVA 3DLEB 4MTPA 4OHZA 4UZCA 2EBGA 2NPFA 1JLBA 4PYDA 1AUSL 4H4OA 3OUYB 1NK8A 1EP4B 1WHYA 2DH8A 3EMTA 2FVSA 1R27B 3X1LB 5KG5A 2XMWA 1WTBA 3AQOA 5EWGA 1RABB 1NJZA 2B7BB 3QRQA 5E5NA 2FJDB 4PYAA 3DM2A 2BJ7A 4ZCLA 4B3OA 2ASJA 4DUTA 3KK1A 2F8HA 1HA1A 1QM9A 2HHWA 4OYWA 4NYZA 5F8IA 4KHRA 1TKZA 3T1HJ 1U1LA 2DT9A 3OTBA 4ZDNA 3G2XA 2NZ4A 2LA6A 3SQGB 3H5XA 2GFFA 3GV8B 1H2TZ 3MM9A 1DZ5A 4KPYA 4Y34A 1DJ0A 1F6TA 3J81Y 4F4ZA 4ED2A 2V9KA 3S6EA 4O44B 5GAGI 3M8QA 5AE3A 2AJ0A 2ZNYA 3NP5A 4OHYA 1NMEB 2CIMA 3ZNUA 1LFWA 2ZFHA 1HW8A 2QA4G 1URRA 2P9GA 4F8RA 2OMOA 1VQ5S 4X4NA 3WDOA 2JEGA 4O3OA 2GAHC 2MKSA 2N4DA 1D1UA 4OZ3A 3HF5A 3HHNB 5E2QA 4RLEA 1U8SA 4OLPA 2GQCA 5IT4A 2G0IA 5KAKA 5F8HA 3AXMA 3HHLA 3W9JA 1WWHA 3H7HB 2MJNA 3PIPQ 1HR0F 2C3UA 5BYQA 4KFBA 4AD6A 2W9CA 3JB9k 2PFDA 4IFYB 1D3WA 3H5YA 2EBEA 1S6QA 2B6AA 2MEWA 4Z37A 1IM4A 2GMLA 4X4PA 3I5CA 5F8MA 3PJ9A 2WRMA 3MEDB 2QLWA 2CQ2A 5A76A 1S9EB 1TKXA 2IC3A 4DV4F 1LKZA 3OVBA 2G2OA 4HR2A 3R5BA 3EZOA 2FUG9 1RBLA 3BS9A 5F41A 4RUAA 3W9HA 3PXGa 4PAAA 2GQQA 3Q22A 2KVQE 1CC7A 1ICEB 3ISZA 1IR1A 4OYZA 4IR9A 3FBFA 3CD6S 3RW6A 4YS2A 3UNGC 4DI6A 2YY3A 3CIMA 3KYLA 4A4JA 1FD2A 3Q8VA 5DS7A 1KTVA 4IH7A 1NK9A 5A8WB 2ZH9A 1LXJA 4LVOP 4WJBA 1RAOA 4I6AA 4CTAB 1TKDA 5KOXA 3PRBA 1GXTA 3BGFA 4K2XA 4FPIA 4W4MA 4L6V3 2BJ1A 4DPXA 3T5HA 4LSZB 4F0HA 2Z0GA 4EK2A 4IG3A 1WTFA 2CQDA 2F8EX 3GFHA 1W2IA 3R1LA 2HGNA 3NCPA 4DQSA 2Z58B 2QA2A 2XZWA 3D67A 3KK3A 1UA0A 4LFBJ 2FZKB 1N36F 2I38A 2CQ3A 2OPQA 2RQ4A 4MK8A 4O3PA 3MMCB 3DRSA 4OJGA 4DZ6A 4DV2F 1KWMA 3CO0P 2D3OR 1NK6A 1CJVB 3GCXP 5KFIA 3K5LA 1SPBP 4O3RA 2RIJA 5C2GA 3UPFA 4HEA9 4YDXA 3BDEA 2QO3A 4C97A 1FKOA 1RT1B 1S9GB 2K7KA 2Y1IA 4CLUA 2QMXA 3KLVA 1AT1B 2N4CA 4OHWA 2RS2A 3EZ5A 1U2FA 3MECA 3QLHA 3MEGB 4ZP9A 4X66J 4NE9C 4JI4J 1B64A 2R2SA 4LBIA 1R3NA 2XI3A 4CTAA 2XG8A 1S0NA 1K1SA 1LWFB 4FF1A 4LFAJ 4DV2J 1FKAF 4F36A 4JI0F 1R6YA 3T9NA 4DSIA 1CULA 1SC4B 1J5EJ 3Q89A 1BWEA 3D0HE 3EVWA 1TUWA 4DV1F 3BSNA 2J6UA 1E6VB 4P7TA 3RBDA 5A2QU 3QZ7A 2DISA 1X5OA 3CUNA 5LL6d 4DR2F 3KJQB 3PYGA 2Q66A 2XNQA 1U2RA 1N5VA 1P27B 2VJVA 2HHPA 4I64A 1HNIB 4OI3A 3UD5A 5B0AA 2JDJA 1KONA 4J9PA 3WX4A 1AYEA 1D9AA 2E9TA 2IRXA 2GIFA 3JQJA 4K50A 5D6GA 1FDDA 4NCGA 3I96A 1GQEA 1RT3A 2PIIA 2RH3A 4QIGA 4USIA 4OZ2A 5KG6A 1FXRA 3C6TB 4TY8A 5LMUF 4JI7J 1HNVB 1Y9OA 1B0PA 2LXUA 2CJKA 4A8FA 2HVHA 4ETXA 1C0TA 2R7TA 1M5SA 5J1NA 2Y1LB 3IR5B 3MMBB 4ENOA 3D2WA 2QRRA 2ZHBA 3N28A 1V5VA 1N56A 4FF2A 1MG7A 3HVWA 4NLQA 1RHQB 4JI6J 1C1BB 1BD6A 1H98A 3ADAC 3HHDA 2P2CB 1EB0A 3GR1A 3BH7B 1H74A 5IM0B 3BBFA 1V3ZA 3BGOP 3OR2A 4ZMMA 3KHLA 4DR7F 2WAQD 1U6BA 4CO5A 1AFIA 1U0SA 4PPDA 4ZP7A 5DG8A 2R8GA 3K0JA 2QV6A 4RPFA 3H59A 2Y0SD 4WK3A 2LU1A 1YSJA 4KIAA 5HBMB 5K8MA 2ZH2A 4DUZJ 3HZEA 2KT5A 1U1KA 2EG1A 2BX6A 3NGSA 5CD4A 2G1DA 1WOSA 1TVRA 2CDQA 4J9KA 4DV5J 4P6QA 1VQLS 4DS4A 4EZ6A 1XQIA 1NZ8A 2ZOGA 2GHWA 2OP5A 3PHTA 3QFWA 2X7IA 3AB4B 3GFYA 4MIBA 4N8NA 5E3RA 2WVFA 1JLEA 3G8QA 1MWQA 4FP9A 4NLPA 5IC6B 4O0IA 2V5HG 3I6PA 4URGA 2YKNA 3V6DA 1D9FA 1Z2LA 4HTJA 1IR0A 2J9CA 4XAKA 3BGRA 1JK9B 2VC0A 3A3PB 2DGQA 3ZZ0A 1T03A 2VG6B 4ZHRA 1H73A 4IRKA 1GMVA 2M52A 2V2ZA 3ENAA 4JOUA 1HR0J 2ASYA 2ZEJA 4PEOA 4J7CA 1XMBA 5C24B 2ZH3A 5SZTA 3MR2A 2HVDA 1QD1A 4JV2A 1MU2B 1UFWA 4E98A 1CEZA 1EX8A 1H7XA 3FBBA 4ZVQB 3BGRB 1FRKA 4QW8A 4L76A 5E3CA 2HFOA 1PG5B 3EYZA 3VAKA 3GIMA 2HQDA 4EZ9A 1RAEB 4NLYA 3DLEA 2DY9A 4ZKAA 1VDHA 5KG0A 1R43A 1FT8A 3LOUA 3OFHA 4M94A 1BHNA 2Z56B 4YEAA 1HHSA 2BUNA 2V34A 3J7AN 1IJFB 1LWCA 4CH0S 4CO0A 2J6TA 3CEDA 4IO9Q 1RJJA 3CJQA 2LXIA 5THWA 3G6VA 1IBKJ 4U6PA 2F9DA 4NYOA 1WC5A 3CVKA 1RT6B 1RWOB 5F9NA 3QIDA 2RVJA 2F4VJ 2IDEA 1KQGB 2CJBA 3POTA 1LWCB 2ZBPA 4MKAA 4WBFA 2BACA 4O3NA 2V69A 3UDLA 4DL4A 2GIQA 4FVMA 4NLUA 4Q8EA 2DEJA 2J6SA 1S1TA 1WKKA 1OWXA 2HQFA 1SI9A 2XMTA 4F0KA 2GHVC 2ILZA 8ATCB 3KLHA 5IV4A 4ECWA 1NKEA 1N6QA 4PCQA 2CUYA 3AA8A 4Y00A 1OMSA 1U24A 3M30A 2VDHA 5DDRC 3QFHA 4PQUA 3BKTA 2VPYB 1TKTB 3IM9A 2ZBIA 3QYYA 4NEZA 5KT2A 4K2JA 3S01A 3ULHA 1U1QA 2UV8G 2HWIA 5HP1B 1CPZA 3QWUA 1VI7A 4UTGA 2IAJB 2HYIB 1IKVB 4FYXB 1UFKA 1L5UA 3LQVA 4OYIA 4IOBA 2F7VA 2BM1A 2W2OP 3EXYA 2CPXA 2ZC3A 3K5OA 4NI2B 4NPOA 5HVGA 4QWBA 2XTJP 4PG4A 2FC8A 4LRDA 2FY8A 4IFYA 2I5JA 1U0HB 4YY3J 1QE1A 4B9SA 4GO5X 3IN5A 2WOMB 2KFNA 4M1KA 2QL7B 4TXSA 5ETPA 3QJLA 3KNGA 3X3UA 4DR3F 5IFMA 1NB7A 3R97A 4DPTA 2XYPB 4ZK7M 1FX2A 2UVVA 1XK8A 1F0XA 2KN4A 4KYZA 1T9YA 4ZA1A 5HSPA 3R8YA 3SSSA 3SXLA 1FNOA 1V6HA 3LP1A 3M2UA 4ITSA 2RRAA 3C2PA 1FKPB 1Y5NB 2LA4A 1BY9A 4FVCA 4L72B 2KG1A 2V8VA 4ECSA 4TYBA 4V1Ak 2B8QA 4CLPA 1KNZA 2DXDA 3H5SA 2IRUA 2F63A 2HBRB 3CDUA 4WP9A 2ATCB 1VYAA 1FO1A 1TKTA 3K7RA 2BJEA 2EC0A 4XO0A 3M2UB 3W62A 4YB1P 3LP2B 2W2QP 4H4KA 4KV8B 2MQPA 3WZ0A 1EKSA 2ASLA 2W2PP 1TU0B 4PG6A 3BQ0A 2ZJQQ 3ONQA 3GZ7A 3H98A 3DHWC 1RWVB 3MM8A 2JFKA 2DY1A 1F9HA 4CZCA 1WUUA 2MYFA 1KOHA 4HDHA 3MCSA 3H8YA 1OPIA 5HMWA 1L3KA 4RNNA 2XCPA 5F9LA 3SCJE 1R0CB 3KJNB 3OVAA 2HLTA 2POKA 4RL1A 4NCAA 1XNRJ 3MM5B 3FEYB 2XEXA 1VRUA 2CPYA 3T1AA 1HI0P 3JSMB 2UXDJ 3K2YA 4CO3A 2DTJA 4JI8F 1CJVA 1CLFA 3UO0A 1U49A 1FEEA 2LMIA 2KFYA 4XK8C 1S6UA 4USMA 1JLQB 2WHOA 3LH2S 4DL5A 4Q0BA 4A8OA 2OTJS 1RT1A 4LSLA 4X66F 2QSWA 3LWMA 2FLPA 4JI4F 3S8SA 4NA1A 2ROEA 4IO1A 2UUAF 3LP2A 1VJQA 1T3OA 2AJ4A 4CLLA 1NH8A 3O6QA 3W2VB 1N88A 2RSQA 1OJ4A 1R8HA 1RTIA 3EGWB 3O2IA 3HCXA 3HKWA 4RX6A 5JMNA 2ILYA 5FLXU 1UPPA 2XULA 2E5LJ 3C14B 1P9YA 4AFFA 2ALYB 4DOZA 1HI8A 4H4MB 5A8WA 3O1LA 3V4IA 4KHPF 2CKWA 3DU6A 1A0OB 4CLYA 5HVHA 2OUGA 1VQSA 1KBRA 2GCFA 4FYVB 3UNYA 3VTIA 4DR5J 3Q8YA 1W26A 4YB5A 2UUBF 3CMES 3CSKA 1YJVA 3LO3A 2N3LA 2ZDOA 3R5DA 1VHIA 1TAQA 4Z7YA 5KFNA 2HQGA 4X2BA 4P2MA 4P9SA 4BWJA 2MLXA 1RCXB 3BKFA 5FDLA 1CBKA 1T05A 4DQIA 4NXNF 4NRUA 4F4XA 4ZP8A 4LF5F 1RQ0A 2EXUA 2CVIA 3KUHA 4ZVGA 3US5A 1DLOA 2I9SA 2MY8A 3BZQA 3H20A 1VC6A 2Y9HA 1KRPA 2B9WA 2EK6A 4UUXA 3LAKA 1B3TA 3HK2A 3VF0B 5FDLB 3NNAA 1Z4UA 2VPXB 3Q8QB 1FKOB 3GE9A 2G4BA 2M4MA 2FB0A 2W4CA 2QE5A 1DTQB 1VHFA 1XIQA 2DCUB 2B56A 2C3OA 2C3PA 3EICA 4DCPB 3AOBA 2XQCA 4EBEA 1XWLA 3GJSB 3RB0A 4CM2A 2M0GB 5LJ5Y 3ICLA 3FFIA 3ITHB 3BR8A 3LGNA 4LRAA 3M9NB 1RHMB 4RNMA 1T3NA 1D0EA 1LFPA 3C3LA 4OI0A 3RAMA 2V8PA 1RACB 2MTLA 4GVBA 4DF4A 2YNIB 2W7PA 4QBUA 3K5NA 2KO1A 2M88A 2QIFA 2WBRA 3OVSA 3TWZA 5CQGA 2QL5B 2CNLB 1HWJA 2Z2ZA 3W65A 1NK5A 2ZM6J 2VKRA
chains in the Genus database with same CATH topology
3HSGA 1RAOA 3KUHA 5ETKA 1F9HA 3HCXA 1TMMA 3ILOA 4PZVA 5ETLA 2BMBA 2QX0A 4M5NA 3HSZA 3QBCA 2CG8A 5ETVA 4M5HA 3ILJA 5ETMA 5ETQA 5ETNA 4AD6A 1EQMA 3HD1A 3MCMA 3ILIA 3HD2A 3HT0A 3MCNA 4M5GA 1KBRA 4CRJA 2F63A 1RB0A 1DY3A 3IP0A 5ETSA 4CYUA 5ETRA 1TMJA 5ETTA 3UDEA 4M5KA 1HKAA 1EQ0A 5ETOA 1IM6A 3HSJA 3MCOA 4CYUB 3UDVA 1G4CA 1RTZA 4M5JA 4F7VA 4CWBA 1HQ2A 1Q0NA 3ILLA 2F65A 3HSDA 1CBKA 4M5IA 1RU2A 4M5MA 3UD5A 1RU1A 4M5LA 3KUEA 3KUGA 5ETPA 1EX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSG A;  1RAO A;  3KUH A;  5ETK A;  1F9H A;  3HCX A;  1TMM A;  3ILO A;  4PZV A;  5ETL A;  2BMB A;  2QX0 A;  4M5N A;  3HSZ A;  3QBC A;  2CG8 A;  5ETV A;  4M5H A;  3ILJ A;  5ETM A;  5ETQ A;  5ETN A;  4AD6 A;  1EQM A;  3HD1 A;  3MCM A;  3ILI A;  3HD2 A;  3HT0 A;  3MCN A;  4M5G A;  1KBR A;  4CRJ A;  2F63 A;  1RB0 A;  1DY3 A;  3IP0 A;  5ETS A;  4CYU A;  5ETR A;  1TMJ A;  5ETT A;  3UDE A;  4M5K A;  1HKA A;  1EQ0 A;  5ETO A;  1IM6 A;  3HSJ A;  3MCO A;  4CYU B;  3UDV A;  1G4C A;  1RTZ A;  4M5J A;  4F7V A;  4CWB A;  1HQ2 A;  1Q0N A;  3ILL A;  2F65 A;  3HSD A;  1CBK A;  4M5I A;  1RU2 A;  4M5M A;  3UD5 A;  1RU1 A;  4M5L A;  3KUE A;  3KUG A;  5ETP A;  1EX8 A; 
#chains in the Genus database with same CATH topology
 2BE9 B;  3VGT A;  1NU4 A;  1KP6 A;  2R7V A;  2FYX A;  4B3T F;  1YBA A;  3M8P A;  5KFJ A;  3DN9 A;  2X3G A;  3O5T B;  2VON A;  1N52 B;  1SIZ A;  3OJU A;  2C1E B;  2BZ2 A;  1D09 B;  4DL7 A;  2VG7 A;  2ZC4 A;  1I94 F;  3OHA A;  1DY3 A;  2OIH A;  2BRL A;  3BSO A;  2MQL A;  3DRY A;  3I31 A;  2M3D A;  1HNW F;  1S72 S;  3QSI A;  1S76 D;  3TAR A;  1NB2 A;  1REG X;  4ANC A;  5KFZ A;  1RAA B;  4YY3 F;  4V19 J;  2PO4 A;  2QLF B;  1IBL J;  4RW4 A;  3FCH A;  1VGY A;  4WP3 A;  1N5T A;  1FRL A;  5D77 A;  3G8T A;  3KLE A;  4AQY J;  3CW2 C;  2GW8 A;  4IRD A;  2R7R A;  1R8P A;  1CJK A;  1QUV A;  1RU1 A;  1VFJ A;  2DJW A;  2XNR A;  1CSJ A;  2P5V A;  3HVT A;  2KTQ A;  4LIW A;  4DSK A;  2C2M B;  4OYO A;  3IAM 9;  2D9O A;  3QSY B;  2AP6 A;  4UST A;  2BW7 A;  1PJ7 A;  1T02 A;  2BA9 A;  2GGP A;  3CCT A;  3K58 A;  2XMV A;  3HFZ B;  1SJR A;  5KFC A;  2HHH F;  2NRE A;  4LFC J;  4ZN3 A;  4HHJ A;  2JLF A;  2WB1 D;  4A8Y A;  3J80 U;  1QVG R;  4K0K F;  2CJ9 A;  4Z2X A;  4AQY F;  1XR6 A;  2CPZ A;  2GGP B;  2RQM A;  3BPD A;  4IRC A;  2JLG A;  2CAJ A;  2E5I A;  4I7F B;  2MZR A;  3HZG A;  2B5J A;  4Y2A A;  4CDI A;  2Y8W A;  5L1L A;  4ZIW A;  1UW9 A;  5L1J A;  1VQ7 S;  2MPU A;  2VKZ G;  3POT B;  4ECT A;  4E0D A;  3OTE A;  3R5J B;  3N4W A;  2UXC F;  3CCE S;  1HFE L;  1UTA A;  3GU0 A;  3FVY A;  3L95 X;  3TX0 A;  5D4O A;  2UVW A;  1KVI A;  1BC6 A;  3HVT B;  1WKL A;  5C25 A;  4NLD A;  2ZOM A;  2QLJ B;  2WW4 A;  1GK8 A;  1K9M T;  1BUX A;  5KFV A;  1VIS A;  1X8D A;  2PI5 A;  2QC3 A;  2A6O A;  1JLF B;  4IH5 A;  3CJS A;  4GO7 X;  5DET A;  3PR4 A;  2BM0 A;  2YXL A;  1KSP A;  4DFP A;  2VPW B;  3V5R A;  1UVM A;  3W8G A;  2H51 B;  3GYN A;  1NK7 A;  2XHC A;  1K47 A;  4WII A;  4BWM A;  4ZN1 A;  3ZTQ A;  1O51 A;  1MLA A;  1X5S A;  4KHM A;  4BBY A;  2AJF E;  1LK5 A;  2V94 A;  5D0R A;  1CS4 A;  1SJ1 A;  2B51 A;  1DHM A;  4WPA A;  2AZ3 A;  2E29 A;  4F0M A;  5J2P B;  4GKK J;  4RWX A;  2DR8 A;  3GFZ A;  3OTO J;  3J81 U;  1SJ4 P;  3HM9 A;  4MKB A;  2MQO A;  2E5L F;  3ZZP A;  2CQB A;  4MYT A;  4N56 A;  5DDP C;  1JXV A;  1PGZ A;  4BC7 A;  2LVW A;  2K3I A;  4GRS A;  4QQB A;  4RW8 A;  2HS0 A;  5DO2 A;  4DPW A;  4F04 B;  1S9G A;  1NSA A;  3RRK A;  3O3L A;  5JUM A;  4I2P B;  4F2R A;  1JLG B;  2PE8 A;  3GSD A;  5KFT A;  3MUV P;  2KFZ A;  4AT1 B;  3QRP A;  3KK2 A;  2C2N A;  1V5I B;  3TJ8 A;  3DKD A;  4LQ9 A;  5B09 A;  4YR2 A;  3PR5 B;  1R8C A;  1M1G A;  5CA5 A;  2PD1 A;  1AZS A;  2WON A;  1RBA A;  3TAM B;  1NHV A;  1KLM B;  2W9B B;  2BKP A;  2QYG A;  1BQX A;  3R7B B;  1MRO A;  1HI1 A;  2J9D A;  2DXF A;  3GII A;  4UY8 T;  2V8D A;  3J7Z 5;  3MWB A;  2J8A A;  3MTJ A;  3TR5 A;  2OKQ A;  3Q86 A;  4LRB A;  5A8K B;  2AMC B;  3OFF A;  5HRO B;  2ZM6 F;  1AFJ A;  1S6O A;  5GVQ A;  2QLB B;  6FDR A;  1O5J A;  1NDP A;  3IO1 A;  4X84 A;  1U1O A;  1FES A;  2J7U A;  2WVB A;  3HX9 A;  1FX4 A;  1FVQ A;  3RGI A;  1YJ9 S;  2J9D E;  1XMQ F;  1L3S A;  4WK1 A;  1U02 A;  3QBC A;  1ZAX A;  3RZA A;  5LSR A;  2XI2 A;  3NMA A;  1T94 A;  3BO3 A;  1X9M A;  4QPT A;  5L9N A;  4Y65 A;  2DNQ A;  4C4W A;  3ISN C;  2WBM A;  1MMN A;  4FN5 A;  2BQ3 A;  4U7U D;  4I2P A;  2DHS A;  1XMO F;  1TMJ A;  2IIH A;  1FJG F;  3EDR B;  1P6T A;  3PO4 A;  1S0M A;  3W8P A;  2G0C A;  1KKH A;  4U7U K;  5DGB A;  3P45 B;  3MR5 A;  2MQM A;  3J80 Y;  1N54 B;  2Q3P A;  3GLJ A;  3GG1 A;  1BQN B;  2FPH X;  2AF6 A;  1XMQ J;  1IVZ A;  1TVR B;  3CB4 A;  1OYE A;  2RML A;  5K9F A;  3W2W A;  3K17 A;  2XY6 A;  2HVE A;  3JTP A;  1YJT A;  1C1B A;  4KGM A;  3BB5 A;  4HAC B;  3RG6 A;  2XSJ B;  1VK8 A;  2QEX S;  3LAL A;  5B0F A;  1KVK A;  4DR5 F;  2B7C B;  1D8Y A;  1RT3 B;  3Q8S B;  1EJ7 L;  1TTH B;  2VC1 A;  4FNI A;  1HNV A;  2WVC A;  4AE5 A;  2RF2 B;  3IGN A;  3D1H A;  4C11 A;  5E41 A;  2XSJ A;  4P72 A;  2VOD A;  2CJX B;  3WX8 A;  2HZA A;  3OPK A;  3PO5 A;  2MGZ B;  3OT9 A;  4F7V A;  1FF2 A;  2HK2 A;  1RXO B;  4J9R A;  1A7G E;  3QGH A;  2L3M A;  1WI8 A;  2XMK A;  4ZJO A;  4N41 A;  4EGL A;  3W64 A;  1HW9 A;  5GAH U;  4WCE Q;  3QT5 A;  4IQX A;  1BQN A;  3CJ3 A;  4C8M A;  3EJM A;  2W25 A;  3T5K A;  4R5P A;  4DX5 A;  5DGA A;  2LEP A;  3NRB A;  1Q8L A;  4ZVT B;  4ZVE A;  4YR3 A;  2X1G A;  4RO0 A;  1C1C A;  1JKH A;  4RNF A;  3K57 A;  4A8K A;  1Q82 T;  4TU8 A;  3G86 A;  3RRH A;  2HGL A;  2NUU G;  2PI4 A;  1ITP A;  3HVA A;  4EYI B;  1RHR B;  1HNX J;  3JSR A;  3C6U B;  1EQM A;  2ZBQ A;  3D7S B;  1WAC A;  4J9Q A;  1UVI A;  2ZZN A;  4G65 A;  2F9J A;  1WI6 A;  2MZQ A;  2DHA A;  3JS9 A;  4IFV A;  4Y2I A;  5KFY A;  3VZI A;  3GR0 A;  1ZYQ A;  2G13 A;  5A0Y A;  1UJ5 A;  1PKU A;  5D0H A;  2NR0 A;  2CJQ A;  1RAI B;  2UVU A;  1TL5 A;  4ZLN A;  3MM6 B;  2YKO A;  2CPD A;  5KFA A;  4F4Y A;  4IDK B;  3UCG A;  1E6Y A;  1VJW A;  3KMS A;  2G0J A;  1HNZ J;  1IKW A;  5F8J A;  4K4S A;  3WBZ A;  4CNZ A;  3AJ1 A;  1WF2 A;  2O66 A;  2D3Z A;  2ACM A;  4KGK A;  5IS2 A;  2CQ1 A;  2AT1 B;  3FK4 A;  5EN1 A;  1RTH A;  2ZOF A;  5ETL A;  2DO0 A;  3MFH A;  2HMI B;  1VQN S;  5CZV A;  4IUF A;  3NG8 A;  1CC8 A;  5HLF B;  2HZC A;  2VFT A;  2RRB A;  4ES3 A;  1C1C B;  1TV6 A;  2IBO A;  1RTJ A;  4YR0 A;  2HNY B;  4ZCM A;  5H9E K;  1LWE A;  2AZ1 A;  4KE5 A;  4C7Q A;  5HMY A;  2NYI A;  3BH6 B;  4CYU A;  4CT8 A;  1DLO B;  2D74 B;  5KT7 A;  1HHQ A;  5KFD A;  1PBA A;  3I0R A;  2VDI A;  1HKA A;  1ZPV A;  3AD9 C;  4KRW A;  1A6L A;  1EZZ B;  1WC1 A;  5CYJ A;  2ZH4 A;  3UN3 A;  1V3S A;  3CMA S;  1WKJ A;  2AU0 A;  3R7N B;  5KT4 A;  1J5O B;  4CCH A;  3CC7 S;  1TEL A;  4USJ C;  3M8R A;  4Z7C A;  2W7O A;  4OX6 A;  4PQU B;  3M1V B;  3R9L A;  5KG4 A;  3KLF B;  5CXT A;  2CQ4 A;  2RU9 A;  3AFG A;  4O44 A;  1RWU A;  2C2Z B;  2V2V A;  4B9L A;  2GZO A;  4F4A A;  2IAJ A;  4W90 B;  3TZX A;  4PZV A;  2E1M C;  2RS8 A;  2JHE A;  3MM7 A;  1CVJ A;  4JI5 J;  3G4S S;  3NL0 A;  1GMU A;  4G6V B;  1MW7 A;  1FRM A;  2ASD A;  5K5M A;  4KPC A;  3ILJ A;  3FRZ A;  2E1R A;  4ZPT R;  3FNN A;  4QZV B;  3RAQ A;  3R6L B;  3KK1 B;  2QSF A;  2FHJ A;  1I5O B;  2X1B A;  1L3T A;  1WEZ A;  4Q44 A;  1N6Q B;  3HD2 A;  4U8V A;  4N8O A;  3FZB A;  1TV6 B;  3NS5 A;  1NLK L;  2YQ0 A;  1XR5 A;  1VMB A;  3NGT A;  3NWG A;  4KFB B;  3QRR A;  2HIY A;  3SZ2 A;  4DQQ A;  1NXI A;  3MM8 B;  2MKI A;  3KLI A;  2RE1 A;  4ZJL A;  4CQ1 A;  2MB0 B;  4ZVF A;  2HS4 A;  3HHK A;  1FXD A;  1M5P C;  2CPE A;  2VV5 A;  3F56 A;  4NL5 A;  1JIH A;  4C0B A;  1S1V A;  2IDL A;  4HH1 A;  1FD8 A;  3DDK A;  1ARO P;  4RUB A;  5CAB A;  1SL0 A;  2IM1 A;  2EK1 A;  5F8G A;  5B08 A;  2G1H A;  2AJ2 A;  2E5J A;  3IAS 9;  1C4C A;  1NO8 A;  4FYY B;  4WE1 B;  1NDL A;  2IJR A;  2KRB A;  2MLY A;  2R7O A;  2PMW A;  2DR6 A;  3ELH A;  4KV8 A;  4WXW A;  4OZ5 A;  5EDW A;  2HFN A;  2AIR B;  1S1V B;  3QT7 A;  1NUE A;  1CJK B;  1U1N A;  2XB2 D;  1R0A B;  1LW2 A;  3TRG A;  1FJG J;  2GNK A;  2B4O A;  4LIR A;  2MKK A;  5KFM A;  4WE1 A;  3KMQ A;  2ZDP A;  1UET A;  1W2B R;  2HRU A;  3OL7 A;  2RDI A;  3RYL A;  1YRX A;  5HAN A;  4EWT A;  1WEL A;  1PO6 A;  4GKK F;  2HHX A;  4LFB F;  3GFX A;  3H2U B;  3JYT A;  2R2R A;  3FRY A;  3UVJ A;  2KM8 C;  4EBD A;  1U4B A;  4O4G A;  3W61 A;  1LEO A;  2DEI A;  4I2Q B;  4QR2 A;  2DR9 A;  1KVJ A;  1Y5L B;  5C5J A;  3B4M A;  2EFP A;  3CWJ A;  2ZIT A;  3D3B J;  5LSO A;  4NZ6 A;  3TJ9 A;  2CQG A;  1U26 A;  4LRC A;  2IM0 A;  3R5A A;  5GAE U;  4JV1 A;  5DM6 Q;  4WFA Q;  4KHP J;  2IYG A;  9RUB A;  1YIT S;  4B3R F;  4ID5 A;  4DR7 J;  4I67 A;  3E01 A;  5ETM A;  4DSE A;  4LF8 J;  3VGS A;  5ETQ A;  3ZZU A;  3H40 A;  2UUB J;  4KGX B;  3DOK A;  3AT1 B;  1B99 A;  4LF4 J;  1LQ9 A;  4PXD A;  2UXB F;  2XMU A;  4QWE A;  5BJR A;  3V2U C;  2NXJ A;  3Q0A A;  2H5I B;  4ERD A;  1RB0 A;  1JLC B;  5C7P A;  4W92 B;  3P8B B;  2IHR 1;  4OYA A;  5HI7 A;  3DDI A;  5F0W A;  1HBU A;  1UWB A;  2ZWO A;  2Q79 A;  4IQM A;  2LYV A;  3CJK A;  1OSD A;  4NA3 A;  5HAO A;  2JFD A;  4F4W A;  1Q16 B;  3KK3 B;  3HHL C;  3DMJ A;  5MAO A;  1LWF A;  2B9Y A;  3N9U C;  4OZJ A;  3HO1 A;  4KSE B;  1FDB A;  1G7C B;  4LF8 F;  3C66 A;  3A8J A;  4R0E A;  1RIS A;  2ZE2 B;  3NS7 B;  3DOM A;  3KHG A;  2HHQ A;  1SUQ B;  2KG0 A;  1FRH A;  1VQP S;  2AYM A;  3FFI B;  5HMZ A;  2GX8 A;  3OL6 A;  1RTI B;  2KZM A;  5K8P A;  1JWW A;  3F0N A;  4C0O C;  3KOA A;  3B82 A;  1B0T A;  2HWH A;  2E1P A;  2JNJ A;  2BAN B;  1UEK A;  3I5B A;  5H9E J;  4ZCI A;  1T9W A;  4Q2L A;  4BS2 A;  1GH8 A;  1QAI A;  3IP0 A;  1VOM A;  1NBE B;  4LF7 F;  1ZA1 B;  2C3Y A;  1EQ0 A;  3MAQ A;  3MAH A;  1VRT B;  1YJR A;  3M6W A;  2KT3 A;  2GVZ A;  2FC9 A;  2XBP A;  2DNM A;  5DZ6 A;  2FJW A;  1LV5 A;  1DTQ A;  1NND A;  4NLO A;  3M8P B;  5DZ7 A;  4TY8 B;  2U1A A;  3CCR S;  2BQU A;  1RYR A;  4PWW A;  1SC1 B;  2SXL A;  3PFO A;  2R9L A;  4K4V A;  1UPM B;  2GV1 A;  4WFN Q;  3DLK B;  2KI2 A;  2BVZ A;  2DO4 A;  1WSV A;  2GVZ B;  4L3N A;  1VBY A;  4QR0 A;  5KT5 A;  2MST A;  2W1B A;  3P3D A;  3M9M B;  3PW7 A;  1C0U B;  3ZO7 A;  2UU9 F;  4ZPC A;  1MMD A;  2CNO B;  2GHP A;  3KKF A;  5DJB A;  1R8B A;  3U02 A;  3W63 A;  5L1K A;  4LF7 J;  3CC2 S;  3D6T B;  4PQA A;  1WEY A;  2FLO A;  2FVR A;  2RT3 A;  3MCM A;  1P8G A;  2FZC B;  3UD4 P;  4DG1 B;  3RRG A;  1AUD A;  3CJ8 A;  1ZBT A;  5I3Q A;  3EWG A;  4AYB D;  3WC2 A;  4CYU B;  4B3S F;  3IR6 B;  2CQP A;  2YKM A;  1G4C A;  5C42 A;  4PG8 A;  3W5Z A;  3MEE A;  2AX0 A;  2R2T A;  2V63 A;  4NX9 A;  3HUL A;  1RA7 A;  4UOG A;  5KTQ A;  4L73 A;  4DPY A;  3L09 A;  2E1A A;  4R8U B;  3C15 A;  3DGP A;  3HFK A;  3OR1 B;  1F5A A;  1YBU A;  1JKH B;  2GVD A;  1EAR A;  2DCL A;  1MNE A;  2HNZ A;  4RW4 B;  5ETV A;  3PKM A;  2V68 A;  4QJV A;  4U67 Q;  3TZW A;  3OL9 A;  1TQL A;  1NHK L;  1NPK A;  1YBT A;  3M2R A;  3VCD A;  4ZVO B;  2QFJ A;  4ZVU B;  4AUK A;  3HD1 A;  3KJV A;  5HVF A;  2C2K B;  3JQM A;  4X65 J;  3CCW A;  2DB1 A;  4NYP A;  3VAM A;  2OEM A;  3D6M B;  3IRX B;  4TYA A;  4OI1 A;  2ALZ A;  2FGC A;  1NHU A;  3HXM A;  1PIL A;  1TL7 A;  4DUY F;  4QR1 A;  4DFJ A;  5LXY A;  1SXL A;  2W2M P;  4PWU A;  1JLE B;  1OPZ A;  2W01 A;  4YDD B;  3CDB A;  3HP6 A;  4ED1 A;  1AB8 A;  4DV6 F;  1OY6 A;  2YPY A;  2ATL A;  2YKN B;  3CMQ A;  3JXO A;  3KLE B;  3V6D B;  2KHC A;  3MMA B;  1HWI A;  3AHP A;  2FJV A;  4DCO B;  1LW0 B;  3VHQ A;  2MQQ A;  3KLH B;  3DGP B;  3OR1 A;  2FLN A;  2AEM A;  3UCZ P;  2NXC A;  1QVF R;  1S4F A;  4ZP6 A;  4ZPA A;  4KT0 C;  4WFX A;  1ZTT A;  2C2R A;  2OML A;  1S9F A;  3MZI A;  1S9E A;  4R5P B;  5J2P A;  2HRY A;  2XGQ A;  4MFB B;  2JVR A;  4ZPD A;  5LXR A;  3W7B A;  3PJW A;  3OFE A;  1VBK A;  1PJ5 A;  2Y3Y A;  1S1X B;  2KB2 A;  1RT7 A;  2E44 A;  1HQE B;  3Q8R B;  4DV6 J;  3OTO F;  3NCR A;  2RRN A;  4M5D A;  5D4L A;  1FDA A;  4DXL A;  3TOQ A;  4LF4 F;  1R6V A;  3K89 A;  1QE1 B;  4KY3 A;  4ATN A;  1RHU B;  2Q43 A;  3EXC X;  4J5O A;  1S77 D;  4QCL A;  3HJF A;  3OJS A;  2CDR B;  2RUG A;  3IFE A;  4LVN P;  2CVE A;  3PFE A;  1PYS B;  4DR2 J;  2OGU A;  2WSC C;  1G2E A;  4DLG A;  4C3K A;  4IDK A;  3DDN A;  1Y0H A;  2QX0 A;  2X1A A;  3GYX B;  2L08 A;  5G4D A;  1SQE A;  4DMZ A;  4DV7 F;  2PGC A;  3E3X A;  3BQ2 A;  1QSL A;  3ETM A;  1VIO A;  2IVF B;  4NXM F;  3BF4 A;  1Y11 A;  3IM8 A;  3N0V A;  5A8R A;  3SEO A;  2QMW A;  3TA0 A;  3PCO B;  2CZV C;  1HMV A;  2HIQ A;  2PMH A;  2H48 B;  5HQL A;  5KFB A;  1JJ4 A;  5HL7 Q;  4QW9 A;  2PDA A;  2KRR A;  1U7L A;  2O01 C;  5AXL A;  3RBE A;  3KXD A;  2DGT A;  3ZZO A;  3NOC A;  2HQC A;  2BRK A;  1SH3 A;  3BYP A;  1Y7P A;  3GV7 B;  2C22 A;  1SL2 A;  2V4J A;  1QSS A;  1JNZ B;  3TVZ A;  2W9C B;  3T1H F;  2FVQ A;  3MXH P;  3I4H X;  4YN3 B;  1FNX H;  4C48 A;  5J1P A;  3T3F A;  3LP1 B;  1RZM A;  2ZZM A;  4DL0 C;  5J2Q A;  4ECQ A;  2Q1L A;  3MUM P;  2B3T B;  3CO9 A;  3M4X A;  3I4P A;  3MPV A;  1HPZ A;  2HBY B;  3QO9 B;  1P1L A;  3SSQ A;  1JNR B;  4E8U A;  2CG8 A;  2XS2 A;  4OX8 A;  3MEG A;  1R0A A;  2FJX A;  4K7Q A;  4B9U A;  3TAQ A;  1WC6 A;  2I5J B;  5J2M A;  5E0O A;  4OJ1 A;  1ZPW X;  3C19 A;  1RT5 A;  1Q95 G;  3LGH A;  2GJ2 A;  4X4O A;  5J1E A;  3VAH A;  3PZP A;  1TK0 A;  3MM7 B;  3Q23 A;  3ZTS A;  5KFP A;  4DX7 A;  3IMQ J;  3KK2 B;  1FJE B;  5B0C A;  1HAR A;  4I2Q A;  2YX4 A;  1HYS B;  1QLN A;  2XYH B;  3CDE A;  2BXJ A;  4ID8 A;  2ZBC A;  2FD2 A;  4PXC A;  3DRR B;  2DGS A;  4C98 A;  2V4J B;  2ROG A;  1SQF A;  4K5S A;  3ZZZ A;  3RJM B;  4CT9 A;  1RWX B;  3T41 A;  3M05 A;  3SFG A;  2H5E A;  3Q8P B;  4DFK A;  3RBZ A;  1X4E A;  4HHU A;  3SBM A;  1NH7 A;  5JVG Q;  5J2Q B;  2IMW P;  5BYS A;  2ZJR Q;  2NSC A;  1WHX A;  2R3V A;  4QU7 A;  3MAA B;  4NCG B;  3SCL E;  4LBH A;  3T19 A;  1NCL A;  4YHH J;  1TUV A;  3H4B A;  3KWM A;  5HJX A;  3PX6 A;  4FXV A;  4TVA B;  4DL3 A;  2VBY A;  1N8R T;  1AA1 B;  2CNK B;  2ZUG A;  4YUD A;  1Q5Y A;  3G6Y A;  4B3T J;  1GMW D;  3HLU A;  3JQK A;  1HBO A;  4KH0 B;  1WF1 A;  2B4P A;  2YX7 A;  3GIJ A;  4WYW A;  1TUG B;  3MR7 A;  3TYT A;  2RAQ A;  3ET6 A;  5H9F J;  2XY7 A;  2O3D A;  1ZZN A;  1Q79 A;  5I3P A;  2A3J A;  2CJY B;  2CPJ A;  1MSW D;  1ULR A;  3PW2 A;  5D4N A;  3W66 A;  1ZM9 A;  1HQU A;  1WHW A;  3JSM A;  4KJI A;  2DNR A;  2C2O B;  4KO0 A;  1IBL F;  1Q1K A;  1YK9 A;  2YKA A;  4A8W A;  2HVI A;  1JLQ A;  3M9O B;  1Q86 T;  3OW2 R;  1GAO A;  1KFD A;  3IWL A;  4KKO B;  3ZFV A;  4DZD A;  4HAC A;  4QWA A;  1JXL A;  4LF5 J;  3NS6 A;  2LP4 A;  4S0M A;  2HUR A;  5EUH A;  1X60 A;  1N36 J;  1QTM A;  4FBT A;  1IWA A;  4AXI A;  2H3E B;  3PAC A;  4ILR A;  2KT2 A;  5LM7 E;  1S6P A;  3BGU A;  4YHH F;  4ECU A;  2HHH J;  2G2Z A;  1WSR A;  2EI5 A;  4LR7 A;  1YHQ S;  3TI0 A;  4IKA A;  1B7Y B;  5ETO A;  4IG0 A;  2B4V A;  5M2U A;  2IRY A;  4BHQ A;  2HWT A;  2O67 A;  3NGD A;  1Q78 A;  1WNE A;  4M5J A;  1H6K X;  4H4M A;  5EGY A;  3N5F A;  1Y3J A;  5D0E A;  4JI1 F;  2NS1 B;  4RBU A;  1X0F A;  2JWN A;  4YFU A;  2Z2M A;  4R25 A;  4F3Q A;  4B9V A;  1S1U B;  4DWI A;  1QUP A;  3M6U A;  4CNY A;  2VFU A;  4N76 A;  1YKW A;  5IT9 U;  4DV7 J;  2AWZ A;  2R8J A;  4JP8 A;  4AL5 A;  1EP4 A;  8RUC A;  3W1Y C;  3MMA A;  3W9I A;  3M8Q B;  4TKT A;  3Q8U A;  4DLE A;  5IT9 Y;  2GMH A;  5E3P A;  1YG0 A;  2FJE B;  4OYB A;  2FJB B;  2CZ9 A;  4OQJ A;  3L7O A;  2IPO B;  3FSI A;  2E7W A;  2RQC A;  1U0H A;  2QYC A;  4OJH A;  2Y1J A;  3DXS X;  1BQM A;  3CCZ A;  3EE3 A;  3G96 A;  2QFI A;  3M6V A;  3UFC X;  3AOD A;  5AJ3 F;  3MCO A;  4WWS A;  3VAI A;  2ERR A;  2JEJ A;  2FHK A;  5K14 B;  3TVY A;  4JI0 J;  2YQ3 A;  1R31 A;  4CWB A;  4C6A A;  5GAD U;  4I69 A;  2HNY A;  1VBZ A;  1RT7 B;  2BAN A;  3BV8 A;  3N5B A;  1UEU A;  4MT1 A;  4NLG A;  1F60 B;  3FKB A;  4J9M A;  1FWP A;  1KC8 T;  5I42 B;  2PN6 A;  3QNW B;  3TO8 A;  3CCV S;  3CXC R;  1IBK F;  3FBE A;  5KT3 A;  5T7L A;  2VPZ B;  4WFY A;  2YWG A;  2VU5 A;  3R2D J;  1HIY A;  3THT A;  2QMU B;  1TKX B;  2IC3 B;  2AGQ A;  3HSZ A;  4X65 F;  4DR1 F;  1S97 A;  2XO6 A;  2MHN A;  2UXB J;  1K44 A;  2R8H A;  3J81 j;  2JEF A;  1RKJ A;  1VQ4 S;  4Y2M A;  3R5G A;  4X64 F;  3AJD A;  1GTH A;  4FDF A;  2CAD A;  3MGJ A;  3NCQ A;  4RBT A;  1FCA A;  1V3R A;  2OSR A;  3MUT P;  2BKO A;  2DNZ A;  1Y5I B;  3EM1 A;  2VIC A;  1XN9 A;  2LQ8 A;  3H90 A;  1HHT P;  1GT8 A;  4HI1 A;  1DAX A;  3UD3 P;  4P2F A;  1X5T A;  1SKS A;  1D9D A;  1IM6 A;  2BAB A;  4WYL A;  1X4C A;  4KH1 B;  4OJ3 A;  2M8H A;  4MJK A;  2DPJ A;  4GKJ F;  2PC6 A;  3NGU A;  1VIX A;  4ELV A;  1MU2 A;  1Q7Y T;  4U96 A;  2FVP A;  5KFO A;  4UOH A;  3CNQ P;  4LBP A;  1PIE A;  4USV A;  1FWK A;  4AL6 A;  3NNC A;  3EVM A;  1REV A;  1IQZ A;  1U47 A;  4B3O B;  2OPP B;  4HH0 A;  2JX2 A;  1B4S A;  3P49 B;  5I42 A;  1ROF A;  4ED7 A;  5KFE A;  3HDS A;  3D6H B;  2V4R A;  5D3G B;  2VA2 A;  1TL1 A;  1GNK A;  1CJU B;  5CYM B;  2N82 B;  3N6L A;  2ZH6 A;  2NUH A;  3FUY A;  5U47 A;  1FJC A;  4J9O A;  3HKZ D;  2VQF J;  5E7O B;  5CAA A;  5L1I A;  1YJ7 A;  1Y10 A;  1YI2 S;  1N5S A;  1ACM B;  3EGN A;  2ZUA A;  5A6W A;  2UU9 J;  3DC2 A;  4U95 A;  2LLZ A;  1F5C A;  1VS3 A;  4RW9 B;  5CYM A;  3A8K A;  3E2E A;  1RTZ A;  5I4M A;  4JUZ A;  1Y3K A;  1HL6 A;  2OEL A;  2VAS A;  3VR1 A;  1LW2 B;  5AXK A;  4QPX A;  3M8Y A;  4IOC Q;  2M8D B;  4A48 A;  4EFA C;  2DNY A;  2D3U A;  1U45 A;  2FHO B;  2W4P A;  3GIR A;  5IXU A;  3JAM U;  3J7A 1;  2CQI A;  1CQM A;  3Q2S C;  4GC6 A;  4EBC A;  3KTQ A;  2NSB A;  4I7F A;  2M7S A;  2NXU A;  2XMJ A;  2ZNZ A;  1QAY A;  2R7Q A;  4QYZ J;  3A4T A;  4LF6 F;  1QAJ A;  2VOO A;  1T95 A;  4CIO A;  4C8N A;  2CRL A;  2KVI A;  3CJK B;  2Z2L A;  2H1Y A;  5KG2 A;  2QZ8 A;  4OZ1 A;  4W98 A;  1PC4 A;  2DNP A;  4CRJ A;  3OFG A;  2ZHA A;  3VAL A;  3I9V 9;  1RKI A;  4TLQ A;  5G0R A;  1VRU B;  2WVE A;  4XTT A;  2Z8Q A;  4CO1 A;  2ZE2 A;  3OHB A;  5HRO A;  2NXE A;  2UXD F;  3SSR A;  2ZHO A;  1RLD A;  1NK0 A;  2V2K A;  4YOE A;  4KC5 A;  3W60 A;  5DDO C;  1HNW J;  3CD5 A;  3CGI A;  7FDR A;  4XDC A;  3TUZ C;  3A12 A;  4M5I A;  4O4G B;  4M5M A;  4EU0 A;  1R89 A;  1ZZF A;  3QO9 A;  4JV0 A;  2UUC F;  4DX8 H;  2EKY A;  4ZIT A;  1GTE A;  1HBU B;  1UWB B;  2GS8 A;  4Q5V A;  4M5D B;  2LXF A;  2MMY A;  4USH A;  2ZKT A;  4WTO B;  1T9U A;  1OIA A;  1EET B;  4K8R A;  3EPI A;  1Z2Z A;  3M32 B;  2HHV A;  1RSC A;  4EUV A;  5BR8 J;  3UWT A;  5FLX Y;  2XMA A;  4ZVH A;  4ZPV R;  1H0H B;  2HFU A;  3M8S A;  4NRT A;  1URN A;  1S48 A;  3WIU A;  4M5G A;  3SV3 A;  4ED3 A;  1SUQ A;  1HNI A;  1RI7 A;  4ES1 A;  4PUO B;  3CIZ A;  4Y6I A;  2HND A;  2K1R B;  3PNI A;  4PXB A;  5FD1 A;  1J27 A;  4J90 A;  4P74 A;  1O8B A;  3TZZ A;  4ECX A;  5G0R B;  4FBU A;  3FDS A;  2V0N A;  5KFS A;  3THP A;  1JJ2 R;  2OD4 A;  4TLR A;  3BO4 A;  4DBQ A;  4DX6 A;  1WG4 A;  1SJ3 P;  4F3O A;  1T0T V;  1WDD A;  2A2C A;  5HQ8 A;  5E3A A;  4NLR A;  5FJ4 A;  3H5U A;  2JLE A;  2DKO B;  5RUB A;  3JSB A;  4P7V A;  4EO8 A;  4ED4 A;  4C0H A;  2IFX A;  3MTK A;  3DNC A;  4CM0 A;  3TNV A;  2AW0 A;  1YJW S;  1R7I A;  1SJF A;  3FSY A;  2E1C A;  5CCL A;  1M5O C;  2B43 A;  2HEK A;  1U8W A;  4PRF A;  3UN5 A;  5L46 A;  5IT0 A;  3OL8 A;  2C42 A;  3NNH A;  1HPZ B;  3AOA A;  2B0G A;  4TNO A;  4EEY A;  3SIP B;  3KNA A;  4I0W A;  2KYZ A;  3G87 A;  5J2M B;  1S5Z A;  3GCW P;  3GJQ B;  3PM9 A;  1Z1Z A;  4HTI A;  3G9C A;  4JV5 F;  2XWY A;  2OFH X;  2HAF A;  3BBB A;  1GMW A;  3JTO A;  4LRF A;  4OMF G;  1XNQ F;  3D28 A;  3CD0 A;  4LT6 A;  1KN6 A;  2F3J A;  2UVR A;  3IBF B;  1NJX A;  3E51 A;  3C14 A;  4CLK A;  1K73 T;  2ZH7 A;  3BN4 A;  4OX9 F;  3VWS A;  1UAW A;  1SBR A;  2HFV A;  2OPS B;  5C2C A;  4P2S A;  3GJT B;  3IC1 A;  4FKX A;  3W2W B;  2RHQ B;  4G1P A;  1MN7 A;  4CLZ A;  1G3O A;  3MCN A;  4UOC A;  4QWD A;  2L41 A;  1YRU A;  4Y28 C;  2W8K A;  1RUS A;  1LW0 A;  3QAT A;  1H2U X;  1M5V C;  1UVJ A;  4ECV A;  1T05 B;  3M8W A;  1HQ2 A;  2N7Y A;  2OPR B;  2PEH A;  1QY7 A;  1S1U A;  1VCT A;  4KB7 A;  1UVK A;  4G1Q B;  1SV5 B;  6AT1 B;  3W3S A;  3HHL B;  3H4D A;  5LMU J;  2AJ1 A;  4MFB A;  3C15 B;  4ALZ A;  2K2P A;  1KOO A;  3M7V A;  5A0Y B;  2OJ3 A;  2XHW A;  3I0S A;  1DQA A;  1GFW B;  4C9D A;  3A3N B;  4I56 A;  4K4X A;  2CWX A;  2XCA A;  4J9V A;  3NXZ A;  2R8K A;  4KO0 B;  1TFY A;  3HVR A;  2PT0 A;  3MHY A;  4HLB A;  1M90 T;  2VFV A;  1KS2 A;  4DPU A;  3ZZR A;  4KKO A;  2KJW A;  4OFZ A;  1R0B G;  3SYZ A;  1ELO A;  3TAP A;  3FGV A;  3KLF A;  2I6W A;  4G1I A;  2YWW A;  1Q81 T;  4UOF A;  2LDI A;  1NRK A;  5IOL A;  1TL7 B;  2XZD B;  3SV4 A;  3AD7 C;  4D3G A;  1S1X A;  3ENW A;  3M8Z A;  4ZOS A;  1N48 A;  5A8R B;  3MM6 A;  2OSQ A;  4GMK A;  4LRE A;  4C3L A;  5BR8 F;  4B9M A;  1G6B A;  2XSF A;  2ADC A;  5LJ3 Y;  5F8N A;  2FJA B;  2W9B A;  1RA6 A;  2CWK A;  3I9Z A;  1OYD A;  3IA0 A;  2NYH A;  3WQP A;  2C3M A;  5KFW A;  4YQW A;  3RW7 A;  2HW3 A;  4NEY A;  1YDL A;  1S57 A;  1RT4 A;  2YKQ A;  2YQ1 A;  3D66 A;  1UMJ A;  3GSI A;  4IG3 B;  4DCJ B;  2DNO A;  3OV7 A;  3BPS P;  3IS9 B;  4FNH A;  3PEJ A;  3DLG A;  2CXE A;  3FEZ A;  2ZBR A;  2DNH A;  4U9R A;  5KG3 A;  3TUI C;  4TQS A;  3V4M A;  3HT3 A;  3RU0 A;  3CPW R;  4DV3 J;  5AE1 A;  2VOP A;  2AQ4 A;  2HHU A;  3P6Y C;  1PYO B;  2FQQ B;  2EWH A;  2JJ4 D;  2JL9 A;  2R42 A;  1IJE B;  2ROP A;  4B02 A;  3QZ8 A;  2LKZ A;  3G6E S;  5E33 A;  4D3H A;  4X62 J;  4A46 A;  1HBN B;  3Q24 A;  5M2P A;  2VA3 A;  4JI7 F;  3MPD A;  3TQ1 A;  2RDD A;  3PVX A;  1RP5 A;  3MED A;  4ANE A;  2RB7 A;  1YRT A;  3BBC A;  3NEK A;  4NI2 A;  2DNG A;  2HQI A;  2BOA A;  2HLU A;  4F50 A;  3UCU P;  2MQ8 A;  2LQ9 A;  2D3O 1;  4F3M A;  4DDF A;  3HJV A;  5AXN A;  4P52 A;  2ACY A;  4ER8 A;  1MWZ A;  1MN9 A;  2LEA A;  1FTC A;  4ZIV A;  3T5J A;  2DRB A;  2Z57 B;  3CT9 A;  2FTR A;  3SDE A;  4DV0 J;  1XC9 A;  3MEK A;  4IYQ A;  2QL9 B;  2GAG C;  3PW4 A;  1YZ7 A;  2W2N P;  5GAG U;  5EX0 A;  2HND B;  2K1R A;  3FZ2 A;  1QAX A;  1U6Z A;  2JOQ A;  2V9W A;  2B4U A;  4CLF A;  2GO9 A;  1S7H A;  3EGV A;  3R3T A;  4DV3 F;  5J1E B;  3DYA B;  1RT2 A;  3D9B A;  3G8S A;  2MDA A;  5A8K A;  4DQP A;  3HI9 A;  2HGM A;  4QYR A;  2KKH A;  3IXQ A;  2XS5 A;  2MY7 A;  2RJZ A;  2MQN A;  3MM5 A;  4URQ U;  4ZVS B;  4O3S A;  1K0T A;  3V6K A;  1TL3 A;  2IY5 B;  4QOT A;  3HHE A;  4MIA A;  3LP0 A;  2HSE B;  1CJT B;  3DRR A;  2C2D A;  1KDN A;  2W24 A;  3EDQ B;  5JVH Q;  1F9F A;  3MPY A;  1H38 A;  3LTO A;  2OPP A;  7FD1 A;  3BSC A;  3N79 A;  3DRS B;  4FZV A;  3A13 A;  4WTY A;  4DV5 F;  2D1C A;  2OEK A;  3P4U B;  4WZM A;  5HMX A;  2VQE J;  1TL1 B;  3EVO A;  1FTR A;  2W8L A;  5H9F K;  1CJT A;  4WIQ A;  5HJY A;  1VLO A;  1DFD A;  1D8Z A;  3FJ2 A;  1T8E A;  1UVN A;  4LMZ A;  2J0X A;  1WOP A;  1FWL A;  2DRD A;  2JRS A;  2LQ5 A;  3DGV A;  3ILL A;  4B08 A;  5KG7 A;  5GAH I;  3CCJ S;  1DQ8 A;  2WK4 A;  4PG5 A;  2D41 A;  2OD6 A;  1X0P A;  2G9O A;  3C6U A;  2LCW A;  3DOM B;  2HBZ B;  5DDQ C;  1N32 J;  3OXF A;  4U8Y A;  1T9X A;  5FII A;  3DOL A;  3FC9 A;  3MOZ A;  4DPO A;  4N77 A;  1H3D A;  2OO4 A;  4LUB A;  5J2N A;  3MFI A;  1X4F A;  2OEJ A;  2OPS A;  1N0V C;  1RWP B;  2CPI A;  1GX6 A;  1CG2 A;  3W2V A;  1E6V A;  2R7X A;  2GO8 A;  1RTD B;  1YJU A;  4CLT A;  2VH7 A;  3IG1 B;  1WG1 A;  3UR0 A;  4Y3C A;  2AEF A;  2NCK L;  4R0J A;  3HSJ A;  3AA9 A;  4ED8 A;  2CYY A;  4NWB A;  4LF9 F;  4ZVR B;  1DUR A;  1U48 A;  3PYE A;  5CD4 H;  2RQK A;  5CYQ A;  2XZT B;  2YPZ A;  1PBU A;  2BKN A;  1BWV A;  2HG4 A;  2HRT A;  2DGO A;  2LQJ A;  4FYW B;  1OY8 A;  3OTC A;  3TUP A;  4QIE A;  2EFQ A;  3QJJ A;  3CJR A;  1N5Q A;  3H2V E;  3QGI A;  4NA2 A;  1UW4 A;  2MKJ A;  3UE2 A;  1P1T A;  4MIW A;  5A6P A;  4GC7 A;  2I2Y A;  4DG1 A;  4C3M A;  4Q45 A;  1NSK L;  3LPE A;  5J2N B;  1YWX A;  3MDF A;  3C16 A;  1HWL A;  2FDN A;  1VBX A;  3ZC4 A;  4ZS6 A;  2N7C A;  2E7X A;  1FVS A;  1DTT B;  2APO A;  4LR9 A;  3SCK E;  2DBB A;  1VQK S;  3IG1 A;  1RK8 A;  4J91 A;  1Y4Z B;  2RKI A;  3D5M A;  2MSS A;  3OR2 B;  3U1L A;  2UUA J;  4WFZ A;  1S7I A;  4MKV A;  5F0U A;  5KFU A;  3U1N A;  4PG7 A;  2ZD1 B;  5H1S V;  5CCM A;  4A8S A;  5IV3 A;  4F02 A;  1JLA B;  3G82 B;  4J9L A;  4A47 A;  3CCQ S;  1WHV A;  3L7P A;  2OTL S;  4LF6 J;  4LFA F;  2DIU A;  2AGO A;  2YNI A;  4J9N A;  3IWX A;  1NJI T;  2LFV A;  1SKU B;  2R7W A;  4B17 A;  2DIV A;  4OYM A;  4HYK A;  4Q2M A;  1NKC A;  4DV0 F;  2AD9 A;  4XPE A;  4K4U A;  4NCB A;  1F5B A;  1X4A A;  4OV1 A;  2O1P A;  1ZM2 A;  4DSL A;  1T9T A;  4P2X A;  1VQM S;  1LXN A;  1RHK B;  2V67 A;  4DJB A;  4KBI A;  4NOH A;  2GVD B;  3DLB A;  4M95 A;  2BR0 A;  2LEC A;  2OAU A;  3CJ0 A;  3UR3 C;  3MOJ B;  1Q8K A;  1WJ9 A;  2ZH1 A;  3TUJ C;  1WOO A;  2LDY A;  1APS A;  3CD7 A;  1DAR A;  2B9E A;  2V2Q A;  4UY8 5;  1RHJ B;  2PA8 D;  4DR4 F;  1UCN A;  2J0S D;  2CPH A;  3G82 A;  1M5K C;  2QGF B;  3PX0 A;  1QTN B;  2VZ9 A;  4O3Q A;  3DXB A;  5KFK A;  3WHI A;  2F4V F;  1G1X A;  4YB6 A;  4H54 A;  3NBP B;  4DEZ A;  2MXY A;  4A8M P;  4K4Z A;  1HWK A;  2B5J B;  2DVI A;  2FHM A;  2J0Q D;  1QSY A;  4JI6 F;  4FF4 A;  4EMD A;  2R2U A;  2J9E A;  2DK2 A;  1B0V A;  3PG9 A;  3PHE A;  3VVT A;  5EWF A;  4J9S A;  1UA1 A;  1TP7 A;  2P8I A;  2Z30 B;  4USW A;  1DBD A;  2VF3 A;  4TU7 A;  1QJH A;  4L75 A;  2I8E A;  1JJC B;  3DHX A;  4QIW D;  2UP1 A;  1XNR F;  5ITH A;  1S10 A;  1CS4 B;  4DR4 J;  1ZM4 A;  3CE8 A;  3CTR A;  2UV8 A;  3GPA A;  1GEH A;  1NZA A;  2GMJ A;  2BE2 B;  3L7U A;  3HMJ G;  4RUC A;  1VQ9 S;  2UZA A;  5B0D A;  2AGP A;  2XM3 A;  2AYG A;  2EW9 A;  3ZXW A;  4AL7 A;  4HT7 A;  3KUE A;  2YVS A;  1M1K T;  4Y2C A;  3T1Y F;  4DS5 A;  4WP8 A;  2Q6B A;  4RKU C;  4K4T A;  3U1M A;  3H0P A;  4PKD B;  4E2F B;  3VGV A;  1FFG B;  1S6Q B;  2B6A B;  2CZ4 A;  2F5G A;  7AT1 B;  1RT4 B;  3PEH A;  1KTQ A;  1B70 B;  1JQG A;  4G1Q A;  2QG9 B;  1I94 J;  2DR5 A;  5D3G A;  3RTV A;  3LP0 B;  3KDO A;  3PJX A;  2H65 B;  3K5P A;  1ZM3 A;  3M6X A;  1NSP A;  2L9W A;  1MML A;  4O0N A;  1I3O B;  4I1T A;  2JC1 A;  3VV2 B;  4RW6 B;  4X4Q A;  1MRO B;  1U25 A;  1EHW A;  1X4B A;  4MAK A;  5ETR A;  4DL6 A;  1FHT A;  2KHD A;  3I0S B;  1HNX F;  3N01 A;  6FD1 A;  4V19 X;  3UN2 A;  3M1V A;  3P5T L;  3W5Y A;  1X9W A;  3K8W A;  3O44 A;  4JYA J;  3GYG A;  2DHG A;  4JI2 F;  3FQK A;  4TN2 A;  3R2C J;  3AQP A;  4WFB Q;  1YX2 A;  3IGV A;  2BE2 A;  3L4B C;  1K8A T;  3PIO Q;  4A8X A;  3R5C A;  3MMC A;  3TX8 A;  3NGK A;  2GC8 A;  2HFS A;  2RD5 C;  4IH6 A;  1Q5V A;  1AXQ A;  1FEH A;  2G2Y A;  4HDG A;  3IRW P;  3T1Y J;  2XWX A;  1T9V A;  1Q7L B;  2N3O A;  3H42 A;  3D0G E;  1N34 F;  2I1R A;  4EO6 A;  2CNN B;  1RAJ A;  3KLG A;  1FDN A;  1RWM B;  2GQ2 A;  2K8G A;  2MKY A;  3B78 A;  3ILI A;  4PAB A;  5KFX A;  1JLF A;  1MWY A;  1PAE X;  1K1Q A;  3LGM A;  5DG7 A;  1XTZ A;  4PXE A;  4JI2 J;  1XJW B;  2EC2 A;  1HYS A;  3DLK A;  5B0G A;  2J0W A;  1IBM J;  3MD3 A;  4LF2 A;  4WXO A;  2XLI A;  4IR1 A;  2VBZ A;  2GIR A;  2DR7 A;  3Q83 A;  4ILL A;  1YGY A;  4J37 A;  1N0U A;  4Q8F A;  3M30 B;  1Q0N A;  4RW7 A;  3OLA A;  5I3U A;  2XY5 A;  2F65 A;  2K3K A;  2NPI A;  3BYR A;  3FSX A;  3T5L A;  3H25 A;  2AYE A;  2GA7 A;  3CCU S;  4JYA F;  1RCO B;  2W7A A;  3AJ2 A;  4X4S A;  1UEV A;  3HPO A;  4CI0 B;  2R8I A;  1EIY B;  3VAF A;  1IKV A;  2QTW A;  1F2H A;  1EAY C;  2KZZ A;  2XC9 A;  1IXK A;  5GAD I;  3TVK A;  2YKM B;  4F4K A;  2LEB A;  2OI2 A;  4OLO A;  3B6B A;  3B54 A;  2H4W B;  3MEE B;  4ICL A;  4DN9 A;  2DRA A;  2E9R X;  4RU2 A;  4JI5 F;  4RW8 B;  4F25 A;  3KHR A;  4WKR A;  1N34 J;  3RAX A;  3KHH A;  3KLG B;  3OSP A;  4B3M F;  4YME A;  1CUL B;  1SCJ B;  2BV3 A;  2M2B A;  3UW1 A;  1C2P A;  4OZL A;  2DGV A;  2E7V A;  3AXK A;  4PUO A;  1PYT A;  3F41 A;  2L9N A;  4I6W A;  1N32 F;  4M63 A;  5BYR A;  1C0T B;  2D7S A;  5AJ3 J;  4DR6 F;  3EUN A;  1FK9 A;  3DRX A;  1RU2 A;  4URS A;  4UUW A;  4RW7 B;  5L8R C;  3LUY A;  4DUY J;  4ID5 B;  3CJ4 A;  4RUH A;  3QT6 A;  2RF2 A;  2HPU A;  5K8O A;  4USU A;  3F73 A;  3TP2 A;  3BDP A;  3PY8 A;  1ZS6 A;  4QU6 A;  1X7V A;  3I87 A;  2DHH A;  2IYI A;  3DLH A;  2HKE A;  3IRX A;  5L9X A;  1S4E A;  2EEY A;  1IQT A;  3PDN A;  1HD0 A;  1FJ7 A;  1RT2 B;  4H4K C;  4IFV B;  2A10 A;  2M5Y A;  2YTC A;  3NLC A;  2YX1 A;  2PSZ A;  3P96 A;  3R27 A;  4LR8 A;  5L38 A;  3LWL A;  4LF9 J;  4LFC F;  4HL9 A;  1SV5 A;  3RB4 A;  1VLY A;  3L9Z A;  3HHL D;  3LPY A;  4HT5 A;  4ZPB A;  5B0E A;  2AJQ A;  4K5R A;  4M5K A;  4X64 J;  4MMO A;  1OY9 A;  3QIP A;  1FE4 A;  3CDW A;  4X62 F;  1IKY B;  3IBC B;  3PRV A;  1FXL A;  5A2Q Y;  4XDD A;  4LQ3 A;  1L3U A;  1RLC L;  2B9X A;  2XGP A;  1L3V A;  3D3C J;  4FS1 A;  2BOP A;  1TFW A;  3BSA A;  1X4H A;  3KUG A;  4F26 A;  2VFS A;  3AOC A;  1FFS B;  3RUB L;  3MD1 A;  4X4U A;  4G3I A;  3U27 A;  4R8U A;  2JZ5 A;  2MGZ A;  2LQB A;  2VG6 A;  3BKU A;  5SUH A;  4ZHR B;  3IR7 B;  5HBM A;  5LMN J;  2ADB A;  3A3O B;  1SL1 A;  1J5E F;  3FCV A;  4C8L A;  1LWE B;  1RAD B;  5F8L A;  3I56 S;  2CFX A;  2MZT A;  1DTT A;  1WC4 A;  1IKW B;  3M2R B;  3OTD A;  1ZOT A;  2K7J A;  2KXH A;  2F40 A;  2IM2 A;  3QPI A;  4HI2 A;  1SJQ A;  3A1Y G;  4RR5 A;  1SIW B;  1J5O A;  2AYB A;  1YQH A;  1FI4 A;  2E9Z A;  3B4D A;  4PPZ A;  4C11 B;  2WCX A;  1EKR A;  2Y1R I;  3EZU A;  5KG1 A;  2KYX A;  4I68 A;  4C8Y A;  2LU2 A;  3G71 S;  4O23 A;  3V6H A;  1V9O A;  1N33 F;  2A6M A;  2Z2Y B;  2DNN A;  2WSF C;  2WSE C;  5F3Z A;  5LSL A;  4OX7 A;  1M0S A;  1HMV B;  2BMB A;  3WC0 A;  4C2M A;  3J7Y I;  2VQF F;  1BQM B;  2RDJ A;  1VQ6 S;  3GTY X;  3OD2 A;  1GXL A;  4B9T A;  1HD1 A;  4JI8 J;  4RWW A;  4K4W A;  1U1M A;  2KL8 A;  3NWR A;  2ZVS A;  5D4P A;  4UT4 A;  1VR6 A;  3OLB A;  4ED0 A;  2DXE A;  2EFV A;  1T7P A;  2R7S A;  1HBM B;  1SH0 A;  2WW8 A;  3TA2 A;  1IBC B;  1I1G A;  2QLX A;  3PW0 A;  2K06 A;  2JH3 A;  3DU5 A;  1IKX B;  3IWN C;  3MM9 B;  2E66 A;  4P75 A;  4UW2 A;  3C16 B;  3HSD A;  1NPR A;  1HBM A;  1XEZ A;  3KFW X;  1KLN A;  2HS3 A;  1UZH A;  2KU7 A;  1FKP A;  1BXN A;  4KGV B;  4PR6 A;  4QWC A;  2NXN A;  1XER A;  4RBV A;  1I6J A;  3GG0 A;  2A1B A;  3DLJ A;  2FGO A;  2HBQ B;  1JJH A;  1N33 J;  3SDE B;  5B7W A;  4ZLJ A;  1PC5 A;  3ZTR A;  1H72 C;  3DM2 B;  1ZTW A;  3KJV B;  3R7S B;  1BMQ B;  4C8K A;  2DNL A;  1LOU A;  2WOM A;  3DI6 A;  4DN0 A;  1VQY A;  2X51 A;  5HLF A;  3FEX B;  4B3M J;  4L74 A;  4ELU A;  3CJT A;  4C8Z A;  5EWE A;  2HFZ A;  4HKQ A;  4RW9 A;  1R8A A;  1BGX T;  1S0V A;  3TZY A;  1YVF A;  1REV B;  1XR7 A;  1QDU B;  5GME A;  4EI2 A;  5L39 A;  1KQK A;  4XPC A;  4ED6 A;  1X31 C;  1S99 A;  1H7W A;  2J7W A;  1WOR A;  3AH6 A;  3CC4 S;  2COL A;  1C4A A;  2J8S A;  5HN0 A;  1KHV A;  3DI6 B;  5HP1 A;  4DR6 J;  1U6F A;  1TK8 A;  3D1O A;  2WB4 A;  4DR3 J;  1CJU A;  4KQZ A;  5IQQ A;  5KFL A;  2YWK A;  1NSQ A;  3UDC A;  2ZH5 A;  2QA4 S;  5K20 B;  3DRP B;  2GJI A;  2J7K A;  4QIV A;  2PMZ D;  1W7W A;  4KR0 B;  3JTN A;  4OHX A;  2DH9 A;  3T6J A;  4BLG A;  5DG9 A;  2H9Z A;  4ECZ A;  4ELT A;  3NMR A;  2HHT A;  1HBO B;  3I82 A;  4M5N A;  2P6S A;  3M2V B;  5BXI A;  3EPG A;  5KT6 A;  2KDO A;  3AY0 A;  1YJN S;  2VJU A;  3PV8 A;  2CA9 A;  4DHV A;  2EKN A;  1WC0 A;  2BE7 D;  3SFU A;  1TL3 B;  4MH8 A;  4O4R A;  5ADZ A;  1GXU A;  5DQH A;  2D69 A;  2I0X A;  2QJ3 A;  4NMX A;  5DM7 Q;  1Q4R A;  3BGL A;  3BM7 A;  1B7F A;  5CH7 B;  3R6G B;  3H2L A;  3GWC A;  3OSN A;  4ETZ A;  1WC3 A;  3DOL B;  2IVM A;  3KLI B;  2KXF A;  3A8I A;  1UJ4 A;  4FXW A;  5KFQ A;  3ENQ A;  2QN6 B;  3R1H A;  3DOK B;  5M2R A;  1UKU A;  3EGZ A;  1NK4 A;  5LMN F;  2DHX A;  4CH7 A;  4JV5 J;  3PYD A;  4UQG A;  1S0O A;  4K4Y A;  4JI1 J;  1UZD A;  4UF4 A;  2OPQ B;  1VQ8 S;  4UZB A;  3JAM Y;  3HFV A;  4M5H A;  5IC4 B;  3VGU A;  4ZLL A;  1NEE A;  1N4L A;  2BJ8 A;  3DLL Q;  4CP5 A;  3RR7 A;  5ETN A;  3TQE A;  3MI7 X;  2C2E A;  4QYZ K;  4JI3 F;  2BJ9 A;  1IBM F;  4ZLP A;  4I6Y A;  2DPI A;  2MZ1 A;  2FZG B;  5LOQ A;  3HT0 A;  1X5P A;  2XLK A;  3GP9 A;  1KLM A;  1Y00 A;  1VC0 A;  1UFL A;  5KOW A;  3OQ2 A;  5C25 B;  2J5A A;  3NGR A;  3NKY A;  1PSD A;  2KM8 B;  4ECY A;  3AAW B;  2C28 A;  2DNK A;  4AND A;  1F3F A;  5HK4 A;  2AEJ A;  4B3S J;  2BQR A;  1ZET A;  1T11 A;  3D0I E;  2L48 A;  1M5H A;  2BJD A;  3N6N A;  3OXL A;  2YNG B;  2XMM A;  3DCA A;  3VQT A;  5JJB A;  1YIJ S;  3L3C A;  1BE4 A;  2VL1 A;  2W9A A;  2EFG A;  1P9Q C;  4UQT A;  4OV6 A;  4X4R A;  4NLX A;  1S59 A;  3UI3 A;  2IBK A;  2MZS A;  1DRZ A;  3K8V A;  3E01 B;  1U1P A;  4KGZ B;  4I4B A;  2IJN A;  1JMT A;  2HK3 A;  2IMO A;  4FKY A;  2F4F A;  5DQI A;  5IZH A;  4M8L A;  4FXD A;  4L3K A;  2MJU A;  2XO7 A;  5DLF A;  3S7R A;  1U1R A;  5T7L B;  1S6P B;  4USK A;  1OSC A;  2UUT A;  4NXM J;  3GQC A;  4KTQ A;  1FK9 B;  4AXJ A;  4RZR A;  2Y8Y A;  1XBW A;  4HVZ A;  5EX3 A;  1JXE A;  3AD8 C;  1IUJ A;  3MR6 A;  5F3T A;  9ATC B;  2Q6C A;  3THV A;  1AZS B;  1N5Y B;  4X4V A;  2HQ3 A;  3QT8 A;  4GVB B;  3GIK A;  2VHG A;  3CDA A;  3N6M A;  4NAS A;  2ZKU A;  3S1T A;  4ZJQ A;  1O6X A;  2AKW B;  2ZD1 A;  5GMK a;  4FYD A;  4MYU A;  4Y0F A;  3Q2T C;  1DQ9 A;  2V50 A;  2EPI A;  3LW5 C;  1FFW B;  5E3Q A;  1H2V Z;  3KG0 A;  5C42 B;  1KFS A;  2FLL A;  4OI4 A;  4MK7 A;  3ZZT A;  5K8N A;  1S79 A;  2IM3 A;  3PTW A;  3QQC D;  5IWA J;  4LSN A;  3ET6 B;  3CJ5 A;  2WZ1 A;  3MF5 A;  3QIP B;  4NZ0 A;  2IA0 A;  4Q43 A;  1T03 B;  1UL3 A;  2RIL A;  2CQC A;  3ISN D;  1M1H A;  1X4G A;  4WU3 A;  4NZ7 A;  3TEH B;  2PA3 A;  2VBW A;  1VRQ C;  3FMW A;  3FQL A;  3ITH A;  3CCS S;  3I0R B;  4IOA Q;  2U2F A;  4ICL B;  3VZH A;  4CH1 A;  4OI6 A;  2RU3 A;  2VG7 B;  1NM2 A;  3NBP A;  5DRK A;  2JSX A;  1RGV A;  4FF3 A;  1RDR A;  4DSF A;  1KQS R;  1RWN B;  3SCI E;  3J7Z T;  1NJY A;  1RAF B;  2ZVI A;  3DFE A;  1ZA2 B;  3FBC A;  1NDC A;  3HSG A;  3TA1 A;  1X4D A;  1PJ6 A;  3G6X A;  3MPW A;  3RB3 A;  3QJP A;  1U09 A;  1TKZ B;  2BJ3 A;  4OHV A;  5GAE I;  5AE2 A;  1N5Y A;  2RHS B;  4RJV A;  2X1F A;  2BBE A;  3TJA A;  3J7Y U;  2FVC A;  3LF0 A;  3GV5 B;  4DUZ F;  3VAG A;  2YWH A;  3SMZ A;  1TR0 A;  2XLJ A;  2UUW A;  2VD3 A;  1GX5 A;  1NDK A;  4GVL A;  5HO4 A;  4DR1 J;  2VB6 A;  4BCA A;  4HHH A;  4ED5 A;  3BN7 A;  1NJW A;  2YWF A;  5HAT A;  1FRX A;  2HAI A;  1E6Y B;  3GON A;  5EHH A;  1SKW A;  4OYX A;  4XIU A;  4NXN J;  2HHS A;  3MR3 A;  2V4Q A;  1IN0 A;  4DV1 J;  2F1F A;  2OFG X;  3P5B P;  4FS2 A;  1RYS A;  1KD1 T;  2DD8 S;  3PYF A;  1F2G A;  3GJR B;  2ZJP Q;  1IWG A;  1OO0 B;  1SVD A;  1KR4 A;  1RWW B;  3ILO A;  2H5J B;  4GKJ J;  1F3V A;  3D6F B;  2YH1 A;  2EVZ A;  3NAI A;  1S1T B;  4JB8 B;  3I32 A;  2KXN B;  2MKC A;  4EYH B;  5CHC B;  1PAU B;  2OPR A;  1RE1 B;  3LA0 A;  1SKR A;  2BW2 A;  4JI3 J;  3NOG A;  1WEX A;  1WF0 A;  4ZVP B;  4N7T A;  3D54 A;  5C24 A;  4CO4 A;  3OUY A;  2UUC J;  5T14 A;  3ZZY A;  3MUR P;  5B0B A;  2H4Y B;  1U2C A;  4TQR A;  1IR2 A;  3VVU A;  3BEG B;  2PEB A;  4K59 A;  1TZ0 A;  2MHE A;  3C8Y A;  2KJV A;  4NML A;  3D68 A;  1AW0 A;  5K14 A;  4DV4 J;  4CLS A;  2F8M A;  5ETT A;  3K5M A;  1YZ6 A;  1HWU A;  3JSY A;  1RBO B;  2NZC A;  2DGU A;  2ZH8 A;  1LNQ A;  2A18 A;  2M70 A;  3UDV A;  4NLT A;  3TEG A;  2FIU A;  2R7U A;  1HBN A;  1W25 A;  2RNE A;  3PW5 A;  1FE0 A;  3M32 A;  3ZNJ 1;  1KHW A;  4KAI A;  4TY9 A;  2E5H A;  1ZH5 A;  1Q8B A;  1RAG B;  1F9E B;  1I51 B;  2YWE A;  2DH7 A;  3QAU A;  4M5L A;  3GMG A;  1JLG A;  3B8H A;  4NLS A;  5MLC V;  1HQE A;  5CZX A;  3T9Z A;  1Q8I A;  2ZWP A;  2RUS A;  4OZ0 A;  1X9S A;  2Z4P A;  5KFH A;  3IS9 A;  5AXM A;  3K59 A;  2WON B;  3TAM A;  1RT5 B;  4RNH A;  2FHJ D;  1VC5 A;  2AX1 A;  4P73 A;  3CCM S;  5JXS A;  2VQE F;  2IJF A;  4DU7 A;  2MKH A;  2V8G A;  4MK9 A;  2VFR A;  4WU2 A;  3E8O A;  4N47 A;  3UQS A;  5I3U B;  3TW0 A;  1YLX A;  1RTH B;  2HMI A;  1HNZ F;  5D15 A;  2FY1 A;  4OIX A;  4P10 A;  3KJF B;  1NAQ A;  3CJ2 A;  2CPF A;  4RW6 A;  3VAJ A;  4CLW A;  4X4T A;  1JLC A;  3I5A A;  1RTJ B;  4K0K J;  3PX4 A;  2CG4 A;  4DQR A;  3DRP A;  4RU9 A;  4Q7A A;  1J2V A;  4ZPW R;  2CQH A;  3MPU B;  2MZJ A;  5DQG A;  3F44 A;  1NPP A;  3C46 A;  1BLU A;  2ABY A;  1JX4 A;  3DMJ B;  2HVZ A;  3M2V A;  2O5D A;  3NY0 A;  2H54 B;  2QA1 A;  3PRD A;  4LF1 A;  3MMB A;  1FNM A;  5ETK A;  1XNQ J;  1FRI A;  2YNH B;  2ZZT A;  3FCW A;  3QAE A;  1PCA A;  3MEC B;  3QLH B;  3QGG A;  4J9U E;  1JB0 C;  3ZTO A;  2AV5 A;  4BC9 A;  1EET A;  1OQ6 A;  3OBI A;  1LK7 A;  3A8E A;  1O0P A;  1WD6 A;  5IM0 A;  3I55 S;  3V6J A;  3BJY A;  2QT7 A;  3LAN A;  2J76 E;  1CQN A;  1UP1 A;  2CQ0 A;  2YBV A;  2YNH A;  3SQO P;  4RNO A;  3UVJ B;  2EG2 A;  4B9N A;  4Q0B B;  1TL4 A;  1SQG A;  2DGW A;  2W4D A;  3U7J A;  2YH0 A;  2UXC J;  4OZN A;  3GIL A;  2P9E A;  3KG4 A;  3IBW A;  4WKY A;  3RR8 A;  4JBC A;  3OXG A;  1WG5 A;  4YB7 A;  4DU8 A;  2B8P A;  4DSJ A;  5GMD A;  3BR9 A;  3BO2 A;  4F2S A;  3ENV A;  4B3R J;  1S49 A;  3SI8 A;  1K0V A;  3VQS A;  4ES2 A;  2P9C A;  1UVL A;  3CUL A;  4PWD B;  2DGX A;  1KQF B;  2JEI A;  2CJA A;  2D9P A;  3RBX A;  3QGP A;  2A2D A;  5IWA F;  2EFO A;  3DYA A;  3BQ1 A;  2X3D A;  3V4I B;  4WZQ A;  4U7C A;  1C0U A;  1VK3 A;  2AHO B;  5KFG A;  3C6T A;  4LSL B;  1NKB A;  4OYP A;  4IG0 B;  4PWD A;  1FRJ A;  1S12 A;  4QIF A;  5HQM A;  2VUG A;  4ZCK A;  5AT1 B;  2VIH A;  2HZV A;  1ZAW A;  1WDT A;  2BYC A;  5LT5 A;  2WTF A;  4LJM A;  2KH9 A;  4ILM A;  5IQ6 A;  2MLZ A;  3MMJ A;  5CYQ B;  1KEK A;  4DL2 A;  5KFR A;  2V6A A;  3T6B A;  1TAU A;  3AB2 B;  2DYA A;  2XYG B;  1LWX A;  8AT1 B;  4YP3 A;  3ZTP A;  3V81 B;  2GJF A;  3BRE A;  2R4F A;  4DFM A;  1TK5 A;  1FA0 A;  4DF8 A;  2E5G A;  2P6T A;  1TMM A;  2Y0B B;  3JYT B;  3ETO A;  1SB6 A;  1SH2 A;  1UWA A;  2VBX A;  1RAH B;  5T41 A;  4N5S A;  2V8H A;  3PKY A;  1Q53 A;  1HQU B;  2DIT A;  1ZAV A;  2HNZ B;  2L9D A;  2WVD A;  1YTY A;  1JLB B;  3QWP A;  4H4O B;  2OH2 A;  4OX9 J;  3V81 A;  4OL8 A;  1OS5 A;  2NLW A;  3RB6 A;  3FMB A;  3MAA A;  4OI2 A;  1RT6 A;  4P71 A;  1FER A;  3NAH A;  1VRT A;  5DLG A;  4C8O A;  2IVY A;  2JVO A;  4FPR A;  2RKI B;  5ETS A;  4CO2 A;  2BDP A;  2PFF B;  3D1Q A;  1RWK B;  1OQ3 A;  2OHD A;  3UDE A;  2A0F B;  4ECR A;  1VQO S;  2EFN A;  2JC0 A;  1S1W B;  2YNF B;  2BEF A;  1JLA A;  1HLW A;  3KDN A;  3LAM A;  5D0G A;  4F67 A;  1SC3 B;  5KFF A;  1RTD A;  3CF5 Q;  1IKY A;  2VG5 B;  4MKY A;  3EX7 B;  5D78 A;  3QMQ A;  3SQG A;  3CCL S;  4BDP A;  2M9K A;  2NQP A;  1F1B B;  2YKP A;  1UJ6 A;  4Y2K A;  1S1W A;  2YNF A;  3D4J A;  4A8Q A;  3W5X A;  4TU9 A;  2OLW A;  3TAN A;  3WIV A;  4NLW A;  3DLG B;  1A9N B;  3KG1 A;  2IA6 A;  5D8H B;  1XMO J;  2XS7 A;  4WF9 Q;  3O8W A;  2VG5 A;  3GB0 A;  4LSN B;  2YNG A;  1IKX A;  1SC6 A;  4NLV A;  3DLE B;  4MTP A;  4OHZ A;  4UZC A;  2EBG A;  2NPF A;  1JLB A;  4PYD A;  1AUS L;  4H4O A;  3OUY B;  1NK8 A;  1EP4 B;  1WHY A;  2DH8 A;  3EMT A;  2FVS A;  1R27 B;  3X1L B;  5KG5 A;  2XMW A;  1WTB A;  3AQO A;  5EWG A;  1RAB B;  1NJZ A;  2B7B B;  3QRQ A;  5E5N A;  2FJD B;  4PYA A;  3DM2 A;  2BJ7 A;  4ZCL A;  4B3O A;  2ASJ A;  4DUT A;  3KK1 A;  2F8H A;  1HA1 A;  1QM9 A;  2HHW A;  4OYW A;  4NYZ A;  5F8I A;  4KHR A;  1TKZ A;  3T1H J;  1U1L A;  2DT9 A;  3OTB A;  4ZDN A;  3G2X A;  2NZ4 A;  2LA6 A;  3SQG B;  3H5X A;  2GFF A;  3GV8 B;  1H2T Z;  3MM9 A;  1DZ5 A;  4KPY A;  4Y34 A;  1DJ0 A;  1F6T A;  3J81 Y;  4F4Z A;  4ED2 A;  2V9K A;  3S6E A;  4O44 B;  5GAG I;  3M8Q A;  5AE3 A;  2AJ0 A;  2ZNY A;  3NP5 A;  4OHY A;  1NME B;  2CIM A;  3ZNU A;  1LFW A;  2ZFH A;  1HW8 A;  2QA4 G;  1URR A;  2P9G A;  4F8R A;  2OMO A;  1VQ5 S;  4X4N A;  3WDO A;  2JEG A;  4O3O A;  2GAH C;  2MKS A;  2N4D A;  1D1U A;  4OZ3 A;  3HF5 A;  3HHN B;  5E2Q A;  4RLE A;  1U8S A;  4OLP A;  2GQC A;  5IT4 A;  2G0I A;  5KAK A;  5F8H A;  3AXM A;  3HHL A;  3W9J A;  1WWH A;  3H7H B;  2MJN A;  3PIP Q;  1HR0 F;  2C3U A;  5BYQ A;  4KFB A;  4AD6 A;  2W9C A;  3JB9 k;  2PFD A;  4IFY B;  1D3W A;  3H5Y A;  2EBE A;  1S6Q A;  2B6A A;  2MEW A;  4Z37 A;  1IM4 A;  2GML A;  4X4P A;  3I5C A;  5F8M A;  3PJ9 A;  2WRM A;  3MED B;  2QLW A;  2CQ2 A;  5A76 A;  1S9E B;  1TKX A;  2IC3 A;  4DV4 F;  1LKZ A;  3OVB A;  2G2O A;  4HR2 A;  3R5B A;  3EZO A;  2FUG 9;  1RBL A;  3BS9 A;  5F41 A;  4RUA A;  3W9H A;  3PXG a;  4PAA A;  2GQQ A;  3Q22 A;  2KVQ E;  1CC7 A;  1ICE B;  3ISZ A;  1IR1 A;  4OYZ A;  4IR9 A;  3FBF A;  3CD6 S;  3RW6 A;  4YS2 A;  3UNG C;  4DI6 A;  2YY3 A;  3CIM A;  3KYL A;  4A4J A;  1FD2 A;  3Q8V A;  5DS7 A;  1KTV A;  4IH7 A;  1NK9 A;  5A8W B;  2ZH9 A;  1LXJ A;  4LVO P;  4WJB A;  1RAO A;  4I6A A;  4CTA B;  1TKD A;  5KOX A;  3PRB A;  1GXT A;  3BGF A;  4K2X A;  4FPI A;  4W4M A;  4L6V 3;  2BJ1 A;  4DPX A;  3T5H A;  4LSZ B;  4F0H A;  2Z0G A;  4EK2 A;  4IG3 A;  1WTF A;  2CQD A;  2F8E X;  3GFH A;  1W2I A;  3R1L A;  2HGN A;  3NCP A;  4DQS A;  2Z58 B;  2QA2 A;  2XZW A;  3D67 A;  3KK3 A;  1UA0 A;  4LFB J;  2FZK B;  1N36 F;  2I38 A;  2CQ3 A;  2OPQ A;  2RQ4 A;  4MK8 A;  4O3P A;  3MMC B;  3DRS A;  4OJG A;  4DZ6 A;  4DV2 F;  1KWM A;  3CO0 P;  2D3O R;  1NK6 A;  1CJV B;  3GCX P;  5KFI A;  3K5L A;  1SPB P;  4O3R A;  2RIJ A;  5C2G A;  3UPF A;  4HEA 9;  4YDX A;  3BDE A;  2QO3 A;  4C97 A;  1FKO A;  1RT1 B;  1S9G B;  2K7K A;  2Y1I A;  4CLU A;  2QMX A;  3KLV A;  1AT1 B;  2N4C A;  4OHW A;  2RS2 A;  3EZ5 A;  1U2F A;  3MEC A;  3QLH A;  3MEG B;  4ZP9 A;  4X66 J;  4NE9 C;  4JI4 J;  1B64 A;  2R2S A;  4LBI A;  1R3N A;  2XI3 A;  4CTA A;  2XG8 A;  1S0N A;  1K1S A;  1LWF B;  4FF1 A;  4LFA J;  4DV2 J;  1FKA F;  4F36 A;  4JI0 F;  1R6Y A;  3T9N A;  4DSI A;  1CUL A;  1SC4 B;  1J5E J;  3Q89 A;  1BWE A;  3D0H E;  3EVW A;  1TUW A;  4DV1 F;  3BSN A;  2J6U A;  1E6V B;  4P7T A;  3RBD A;  5A2Q U;  3QZ7 A;  2DIS A;  1X5O A;  3CUN A;  5LL6 d;  4DR2 F;  3KJQ B;  3PYG A;  2Q66 A;  2XNQ A;  1U2R A;  1N5V A;  1P27 B;  2VJV A;  2HHP A;  4I64 A;  1HNI B;  4OI3 A;  3UD5 A;  5B0A A;  2JDJ A;  1KON A;  4J9P A;  3WX4 A;  1AYE A;  1D9A A;  2E9T A;  2IRX A;  2GIF A;  3JQJ A;  4K50 A;  5D6G A;  1FDD A;  4NCG A;  3I96 A;  1GQE A;  1RT3 A;  2PII A;  2RH3 A;  4QIG A;  4USI A;  4OZ2 A;  5KG6 A;  1FXR A;  3C6T B;  4TY8 A;  5LMU F;  4JI7 J;  1HNV B;  1Y9O A;  1B0P A;  2LXU A;  2CJK A;  4A8F A;  2HVH A;  4ETX A;  1C0T A;  2R7T A;  1M5S A;  5J1N A;  2Y1L B;  3IR5 B;  3MMB B;  4ENO A;  3D2W A;  2QRR A;  2ZHB A;  3N28 A;  1V5V A;  1N56 A;  4FF2 A;  1MG7 A;  3HVW A;  4NLQ A;  1RHQ B;  4JI6 J;  1C1B B;  1BD6 A;  1H98 A;  3ADA C;  3HHD A;  2P2C B;  1EB0 A;  3GR1 A;  3BH7 B;  1H74 A;  5IM0 B;  3BBF A;  1V3Z A;  3BGO P;  3OR2 A;  4ZMM A;  3KHL A;  4DR7 F;  2WAQ D;  1U6B A;  4CO5 A;  1AFI A;  1U0S A;  4PPD A;  4ZP7 A;  5DG8 A;  2R8G A;  3K0J A;  2QV6 A;  4RPF A;  3H59 A;  2Y0S D;  4WK3 A;  2LU1 A;  1YSJ A;  4KIA A;  5HBM B;  5K8M A;  2ZH2 A;  4DUZ J;  3HZE A;  2KT5 A;  1U1K A;  2EG1 A;  2BX6 A;  3NGS A;  5CD4 A;  2G1D A;  1WOS A;  1TVR A;  2CDQ A;  4J9K A;  4DV5 J;  4P6Q A;  1VQL S;  4DS4 A;  4EZ6 A;  1XQI A;  1NZ8 A;  2ZOG A;  2GHW A;  2OP5 A;  3PHT A;  3QFW A;  2X7I A;  3AB4 B;  3GFY A;  4MIB A;  4N8N A;  5E3R A;  2WVF A;  1JLE A;  3G8Q A;  1MWQ A;  4FP9 A;  4NLP A;  5IC6 B;  4O0I A;  2V5H G;  3I6P A;  4URG A;  2YKN A;  3V6D A;  1D9F A;  1Z2L A;  4HTJ A;  1IR0 A;  2J9C A;  4XAK A;  3BGR A;  1JK9 B;  2VC0 A;  3A3P B;  2DGQ A;  3ZZ0 A;  1T03 A;  2VG6 B;  4ZHR A;  1H73 A;  4IRK A;  1GMV A;  2M52 A;  2V2Z A;  3ENA A;  4JOU A;  1HR0 J;  2ASY A;  2ZEJ A;  4PEO A;  4J7C A;  1XMB A;  5C24 B;  2ZH3 A;  5SZT A;  3MR2 A;  2HVD A;  1QD1 A;  4JV2 A;  1MU2 B;  1UFW A;  4E98 A;  1CEZ A;  1EX8 A;  1H7X A;  3FBB A;  4ZVQ B;  3BGR B;  1FRK A;  4QW8 A;  4L76 A;  5E3C A;  2HFO A;  1PG5 B;  3EYZ A;  3VAK A;  3GIM A;  2HQD A;  4EZ9 A;  1RAE B;  4NLY A;  3DLE A;  2DY9 A;  4ZKA A;  1VDH A;  5KG0 A;  1R43 A;  1FT8 A;  3LOU A;  3OFH A;  4M94 A;  1BHN A;  2Z56 B;  4YEA A;  1HHS A;  2BUN A;  2V34 A;  3J7A N;  1IJF B;  1LWC A;  4CH0 S;  4CO0 A;  2J6T A;  3CED A;  4IO9 Q;  1RJJ A;  3CJQ A;  2LXI A;  5THW A;  3G6V A;  1IBK J;  4U6P A;  2F9D A;  4NYO A;  1WC5 A;  3CVK A;  1RT6 B;  1RWO B;  5F9N A;  3QID A;  2RVJ A;  2F4V J;  2IDE A;  1KQG B;  2CJB A;  3POT A;  1LWC B;  2ZBP A;  4MKA A;  4WBF A;  2BAC A;  4O3N A;  2V69 A;  3UDL A;  4DL4 A;  2GIQ A;  4FVM A;  4NLU A;  4Q8E A;  2DEJ A;  2J6S A;  1S1T A;  1WKK A;  1OWX A;  2HQF A;  1SI9 A;  2XMT A;  4F0K A;  2GHV C;  2ILZ A;  8ATC B;  3KLH A;  5IV4 A;  4ECW A;  1NKE A;  1N6Q A;  4PCQ A;  2CUY A;  3AA8 A;  4Y00 A;  1OMS A;  1U24 A;  3M30 A;  2VDH A;  5DDR C;  3QFH A;  4PQU A;  3BKT A;  2VPY B;  1TKT B;  3IM9 A;  2ZBI A;  3QYY A;  4NEZ A;  5KT2 A;  4K2J A;  3S01 A;  3ULH A;  1U1Q A;  2UV8 G;  2HWI A;  5HP1 B;  1CPZ A;  3QWU A;  1VI7 A;  4UTG A;  2IAJ B;  2HYI B;  1IKV B;  4FYX B;  1UFK A;  1L5U A;  3LQV A;  4OYI A;  4IOB A;  2F7V A;  2BM1 A;  2W2O P;  3EXY A;  2CPX A;  2ZC3 A;  3K5O A;  4NI2 B;  4NPO A;  5HVG A;  4QWB A;  2XTJ P;  4PG4 A;  2FC8 A;  4LRD A;  2FY8 A;  4IFY A;  2I5J A;  1U0H B;  4YY3 J;  1QE1 A;  4B9S A;  4GO5 X;  3IN5 A;  2WOM B;  2KFN A;  4M1K A;  2QL7 B;  4TXS A;  5ETP A;  3QJL A;  3KNG A;  3X3U A;  4DR3 F;  5IFM A;  1NB7 A;  3R97 A;  4DPT A;  2XYP B;  4ZK7 M;  1FX2 A;  2UVV A;  1XK8 A;  1F0X A;  2KN4 A;  4KYZ A;  1T9Y A;  4ZA1 A;  5HSP A;  3R8Y A;  3SSS A;  3SXL A;  1FNO A;  1V6H A;  3LP1 A;  3M2U A;  4ITS A;  2RRA A;  3C2P A;  1FKP B;  1Y5N B;  2LA4 A;  1BY9 A;  4FVC A;  4L72 B;  2KG1 A;  2V8V A;  4ECS A;  4TYB A;  4V1A k;  2B8Q A;  4CLP A;  1KNZ A;  2DXD A;  3H5S A;  2IRU A;  2F63 A;  2HBR B;  3CDU A;  4WP9 A;  2ATC B;  1VYA A;  1FO1 A;  1TKT A;  3K7R A;  2BJE A;  2EC0 A;  4XO0 A;  3M2U B;  3W62 A;  4YB1 P;  3LP2 B;  2W2Q P;  4H4K A;  4KV8 B;  2MQP A;  3WZ0 A;  1EKS A;  2ASL A;  2W2P P;  1TU0 B;  4PG6 A;  3BQ0 A;  2ZJQ Q;  3ONQ A;  3GZ7 A;  3H98 A;  3DHW C;  1RWV B;  3MM8 A;  2JFK A;  2DY1 A;  1F9H A;  4CZC A;  1WUU A;  2MYF A;  1KOH A;  4HDH A;  3MCS A;  3H8Y A;  1OPI A;  5HMW A;  1L3K A;  4RNN A;  2XCP A;  5F9L A;  3SCJ E;  1R0C B;  3KJN B;  3OVA A;  2HLT A;  2POK A;  4RL1 A;  4NCA A;  1XNR J;  3MM5 B;  3FEY B;  2XEX A;  1VRU A;  2CPY A;  3T1A A;  1HI0 P;  3JSM B;  2UXD J;  3K2Y A;  4CO3 A;  2DTJ A;  4JI8 F;  1CJV A;  1CLF A;  3UO0 A;  1U49 A;  1FEE A;  2LMI A;  2KFY A;  4XK8 C;  1S6U A;  4USM A;  1JLQ B;  2WHO A;  3LH2 S;  4DL5 A;  4Q0B A;  4A8O A;  2OTJ S;  1RT1 A;  4LSL A;  4X66 F;  2QSW A;  3LWM A;  2FLP A;  4JI4 F;  3S8S A;  4NA1 A;  2ROE A;  4IO1 A;  2UUA F;  3LP2 A;  1VJQ A;  1T3O A;  2AJ4 A;  4CLL A;  1NH8 A;  3O6Q A;  3W2V B;  1N88 A;  2RSQ A;  1OJ4 A;  1R8H A;  1RTI A;  3EGW B;  3O2I A;  3HCX A;  3HKW A;  4RX6 A;  5JMN A;  2ILY A;  5FLX U;  1UPP A;  2XUL A;  2E5L J;  3C14 B;  1P9Y A;  4AFF A;  2ALY B;  4DOZ A;  1HI8 A;  4H4M B;  5A8W A;  3O1L A;  3V4I A;  4KHP F;  2CKW A;  3DU6 A;  1A0O B;  4CLY A;  5HVH A;  2OUG A;  1VQS A;  1KBR A;  2GCF A;  4FYV B;  3UNY A;  3VTI A;  4DR5 J;  3Q8Y A;  1W26 A;  4YB5 A;  2UUB F;  3CME S;  3CSK A;  1YJV A;  3LO3 A;  2N3L A;  2ZDO A;  3R5D A;  1VHI A;  1TAQ A;  4Z7Y A;  5KFN A;  2HQG A;  4X2B A;  4P2M A;  4P9S A;  4BWJ A;  2MLX A;  1RCX B;  3BKF A;  5FDL A;  1CBK A;  1T05 A;  4DQI A;  4NXN F;  4NRU A;  4F4X A;  4ZP8 A;  4LF5 F;  1RQ0 A;  2EXU A;  2CVI A;  3KUH A;  4ZVG A;  3US5 A;  1DLO A;  2I9S A;  2MY8 A;  3BZQ A;  3H20 A;  1VC6 A;  2Y9H A;  1KRP A;  2B9W A;  2EK6 A;  4UUX A;  3LAK A;  1B3T A;  3HK2 A;  3VF0 B;  5FDL B;  3NNA A;  1Z4U A;  2VPX B;  3Q8Q B;  1FKO B;  3GE9 A;  2G4B A;  2M4M A;  2FB0 A;  2W4C A;  2QE5 A;  1DTQ B;  1VHF A;  1XIQ A;  2DCU B;  2B56 A;  2C3O A;  2C3P A;  3EIC A;  4DCP B;  3AOB A;  2XQC A;  4EBE A;  1XWL A;  3GJS B;  3RB0 A;  4CM2 A;  2M0G B;  5LJ5 Y;  3ICL A;  3FFI A;  3ITH B;  3BR8 A;  3LGN A;  4LRA A;  3M9N B;  1RHM B;  4RNM A;  1T3N A;  1D0E A;  1LFP A;  3C3L A;  4OI0 A;  3RAM A;  2V8P A;  1RAC B;  2MTL A;  4GVB A;  4DF4 A;  2YNI B;  2W7P A;  4QBU A;  3K5N A;  2KO1 A;  2M88 A;  2QIF A;  2WBR A;  3OVS A;  3TWZ A;  5CQG A;  2QL5 B;  2CNL B;  1HWJ A;  2Z2Z A;  3W65 A;  1NK5 A;  2ZM6 J;  2VKR A; 
#chains in the Genus database with same CATH homology
 3HSG A;  1RAO A;  3KUH A;  5ETK A;  1F9H A;  3HCX A;  1TMM A;  3ILO A;  4PZV A;  5ETL A;  2BMB A;  2QX0 A;  4M5N A;  3HSZ A;  3QBC A;  2CG8 A;  5ETV A;  4M5H A;  3ILJ A;  5ETM A;  5ETQ A;  5ETN A;  4AD6 A;  1EQM A;  3HD1 A;  3MCM A;  3ILI A;  3HD2 A;  3HT0 A;  3MCN A;  4M5G A;  1KBR A;  4CRJ A;  2F63 A;  1RB0 A;  1DY3 A;  3IP0 A;  5ETS A;  4CYU A;  5ETR A;  1TMJ A;  5ETT A;  3UDE A;  4M5K A;  1HKA A;  1EQ0 A;  5ETO A;  1IM6 A;  3HSJ A;  3MCO A;  4CYU B;  3UDV A;  1G4C A;  1RTZ A;  4M5J A;  4F7V A;  4CWB A;  1HQ2 A;  1Q0N A;  3ILL A;  2F65 A;  3HSD A;  1CBK A;  4M5I A;  1RU2 A;  4M5M A;  3UD5 A;  1RU1 A;  4M5L A;  3KUE A;  3KUG A;  5ETP A;  1EX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...