1DY6A

Structure of the imipenem-hydrolyzing beta-lactamase sme-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
267
Chain Sequence
NKSDAAAKQIKKLEEDFDGRIGVFAIDTGSGNTFGYRSDERFPLCSSFKGFLAAAVLERVQQKKLDINQKVKYESRDLEYHSPITTKYKGSGMTLGDMASAALQYSDNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWELELNTAIPGDKRDTSTPKAVANSLNKLALGNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIWPKNRAPLIVSIYTTRKSKDDKHSDKTIAEASRIAIQAID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
publication title Structure of the Imipenem-Hydrolyzing Class a Beta-Lactamase Sme-1 from Serratia Marcescens.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 98
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1dy6A00
1E3UD 3BEBA 1PI5A 4WZ5A 2R9WA 5J8XA 1L0DA 4DDYA 1KE0A 4C6YA 3ZG9B 4PM9A 2ZMAA 5BOHA 2G2UA 1PWGA 1LI0A 4RX2A 5CRFA 1NXYA 1ALQA 2HPBA 2Y2LA 4KZAA 5L2FA 2EXBA 1KGFA 1JWZA 3WS0A 1ZC2A 5F82A 1DJCA 5JYOA 1MWSA 3ZVTA 4GNUA 3MKEA 4NETA 4PM6A 4FSFA 4Z9QA 1IYQA 4KQRA 2HP6A 3IH8A 3PBTA 1HVBA 1W8YA 4QD4A 3UDXA 4LCLA 4Y0OA 5FATA 3AGDA 3Q7ZA 1AXBA 1FSYA 3IF6B 1M6KA 3MFDA 3W4OA 5CECA 2OLUA 4E6XA 4JXGA 4B4ZA 3MZEA 2XDMA 2ZC6B 1ESIA 1W5DA 2A49A 3IHAA 1SKFA 3PAEA 2EX2A 3TOIA 1ESUA 2JC7A 4QY5A 1JWPA 1KE3A 4ID4A 4BL3A 2E8IA 5FSRA 5FI6A 1E4DA 1YM1A 4BD0A 3IXDA 4GOGA 4B88A 2XEPA 2J9OA 4S2JA 5DTKA 3TG9A 3NY4A 1PWDA 4IBXA 5GHYA 3RJUA 1SDEA 1XGJA 1CEFA 4Y7PA 5FI7A 4LV2A 3ITBA 5GLDA 3MBZA 2ZQCA 3WS5A 1TDLA 5FQJA 2XQZA 2ZLYA 2HDSA 1IKIA 3BYDA 1SDNA 5TFQA 4P85A 1HZOA 5FASA 4S2MA 1KDWA 4UA6A 4OOYA 4BL2A 3V5MA 3W4QA 4IVIA 3IT9A 4PM7A 1XP4A 3GR2A 3ISGA 4R0QA 1K57C 1I2SA 5HW3A 4EBNA 5GLBA 1I5QA 2P9VB 4EUZA 1JTGA 3M2KA 3BLSA 4GDNA 3WS1A 4DE2A 5EVID 1CEGA 2H5SA 1CI9A 2BLSA 3G2YA 4NK3A 4FD8A 1IYOA 4OQIA 4IEDA 1FCOA 2ZD8A 5D3OA 3RXXA 3IF5A 3HLFA 4MBKA 1Q2QA 3HUOA 4LENA 3DW0A 4OPYA 4WBGA 5EUAA 3BFGA 5HAQA 2CC1A 4Y0TA 3OPPA 5IHVA 5E2EA 1LHYA 1L0FA 1LL5A 2HP5A 3NC8A 1NYMA 4E3KA 5FDHA 1XA7A 2FFYA 1XA1A 2Y2MA 3UN7A 3JYIA 3Q07A 2WGVA 2WAFA 4WYYA 4MLLA 1PYYA 5KSHA 1MKIA 4N1HA 4ZTKA 1YMSA 1CI8A 2H0YA 4KG2A 3A3DA 2XFSA 3UNWA 5FI2A 3WS4A 3HLGA 1KVLA 2Z2MB 3V3RA 4KZ7A 1NZOA 3IQAA 1EWZA 3WRTA 1KGEA 2PBYA 2XD1A 4KENB 4QHCA 2B5RA 2P74A 3E2LA 4E3JA 5CEDA 1K6RA 2Y55A 3C5AA 4R4SA 4KZBA 4KZ3A 3MXRA 2ZC7A 2V20A 1ONHA 2IWCA 1MPLA 1KDSA 4A5RA 5GHXA 3ZCZA 4DE1A 1C3BA 3VOZA 2ZC3B 3PAGA 2PU2A 4YFMA 1GCEA 4JXVA 3S4XA 1K55A 3CMZA 4PMAA 4EQIA 4BD1A 4OP8A 4XUXA 3UPOA 2OLVA 3G34A 3BLMA 1OMEA 3HL9A 1ERQA 3ZGAB 3ZFZA 1EROA 4WZ5C 1H5XA 3A3JA 1MBLA 5M19A 3BFEA 1I2WA 3IF6A 4D2OA 3PBOA 3VFFA 4OQ0A 4KZ5A 3SS5A 4JF6A 4C3QA 1MXOA 3HLDA 1K38A 4S2PA 5G18A 5KSCA 1ES2A 1NY0A 2Z2LB 2WADA 4HBUA 3AGEA 4UAAA 4PM5A 3V39A 2XLNA 1PI4A 1SHVA 3PTEA 1U60A 1PIOA 4S2OA 4KQQA 5E2FA 4GDBA 1GA0A 3N8SA 1BULA 3W4PA 5F83A 2Y4AA 3C4PA 3ZNYA 3OZHA 1H8YA 3EQUA 4KZ9A 2QMIA 1NRFA 1MWTA 3IWOA 4HBTA 2WYXA 1VM1A 3P09A 2EFXA 5GLCA 2HDQA 1ZG6A 3HVFA 2DCFA 4FH2A 3VSKA 1ES5A 1ERMA 3S22A 3GQZA 1BSGA 4X68A 4XXRA 3ZG7B 4OQHA 2Y2JA 3Q1FA 5TGFA 4JF4A 5F1FA 3TSGA 1O07A 2OSUA 3ZHHA 3UPPA 3ZG5A 4DKIA 1DJAA 2P9VA 3HBRA 4R23A 4R3JA 3UO9A 2Y91A 3VP1A 1K56A 2XK1A 4LV0A 2C6WB 1PW1A 5CHMA 1TVFA 2ZQ8A 4DE3A 4K0XA 3M2JA 1ES4A 1BLHA 3N8LA 4S2NC 4Q8IA 4OLDA 5GL9A 3N4IA 5M18A 1JVJA 3IWIA 5EVIC 1XKZA 2WGWB 4BENA 3UE1A 4JPMA 1IYPA 5U47A 4WM9A 3NDGA 3BM6A 3N6IA 3PBRA 3ZG8B 4E3OA 3GSGA 1QMEA 5HAIA 1N4OA 2H0TA 3G2ZA 5JYPA 4BJPA 3B3XA 4KZ4A 1LL9A 3OCLA 4WEKA 3SOIA 4DDSA 5GHZA 5FQ9A 3MKFA 1FQGA 4M3KA 2Q9MA 3SH9A 1RCJA 4S2IA 3IWQA 4EV4A 4KQOA 4ZJ2A 3GMWA 3IXBA 3M6BA 2PU4A 1BT5A 4OVDA 3C7VA 3RXWA 4X6TA 2J8YA 4IBRA 4WEJA 5HX9A 1FCMA 4FH4A 2XH9A 5CERA 1L2SA 4OP5A 3ZG0A 5DF7A 1M40A 3M6HA 1YLJA 3MXSA 4HESA 4RA7A 4RYEA 4R3BA 4CJNA 4QY6A 1ES3A 1XXMA 4WZ4A 4FCFA 2J7VA 1S0WA 1K57A 1PW8A 1Z6FA 4KG6A 5GLAA 4DXBA 1ZKJA 5DVAA 2ZQ9A 1YT4A 5CHUA 1LLBA 3PBNA 3DTMA 3FYZA 5HL1A 5F1GA 1Q2PA 3NDEA 3O3VA 3UDFA 5A92A 2V1ZA 3QNBA 1TEMA 4GZBA 2Y2GA 4O7DA 4N92A 3HLEA 3V3SA 3NIAA 3G35A 1K4FA 3MZDA 4N1XA 4RX3A 1JWVA 3AGFA 1BTLA 4U0XA 1CK3A 2ZQ7A 5EVLA 3S1YA 1KE4A 1HTZA 1S6RA 4K0WA 1QMFA 4X55A 4GKUA 5EVIB 1BLSA 1YLPA 3BECA 2OV5A 3HLWA 4B4XA 3WRZA 1WYBA 4MBHA 5EPHA 2EX6A 1DY6A 4JF5A 4ZAMA 1K54C 3GRJA 1N9BA 2WZXA 4OKPA 4DXCA 2WUQA 4JKTA 5CHJA 1K25A 4HEFA 4LV1A 1ONGA 2Q9NA 2J9PA 1KGGA 4JXWA 4OOMA 5FAPA 1FCNA 1XPBA 4N9KA 2RL3A 3BFFA 3HREA 3OPLA 4E3IA 3GVBA 3N7WA 4OOLA 1BZAA 3FZCA 1L0GA 3FV7A 4F94A 4E3NA 1XX2A 1MWRA 1YMXA 5DF9A 5DTTA 2X01A 1RP5A 3G4PA 4MEZA 1J9MA 2Y59A 1E3UA 5CXWA 2BG1A 1G6AA 1YLYA 2I72A 2IWDA 5A91A 3WWXA 1SCWA 5CTMA 1RGZA 4QB8A 3LY4A 4L0LA 5A93A 4DE0A 2XGNA 4KZ8A 2G2WA 3VP2A 1IEMA 5EOOA 3UE3A 3ZVWA 2HDUA 1PZOA 2ZJ9A 4MNRA 2WKEA 4S2KA 2WK0A 1MY8A 4N9LA 4ZJ3A 4X69A 2Y2KA 4WELA 5TR7A 5CGXA 2EXAA 3LY3A 3Q7VB 1PWCA 4OH0A 2WKIA 3VSLA 1NYYA 2WGWA 3OPRA 3I7JA 2EX9A 2ZQAA 3E2KA 3FKVA 3C7UA 3PBQA 5CGSA 3D4FA 3DWZA 1IELA 4UA9A 3SH8A 1IKGA 3P98A 1L0EA 4PM8A 2IWBA 4C75A 4KG5A 2Y2OA 4X56A 3UY6A 4BQMA 5CGWA 1GHIA 1Y54A 1FOFA 2H10A 2HDRA 4QJGA 3BFDA 3WS2A 3LCEA 5AQ7A 5FQKA 2X02A 2JBFA 2V2FF 3Q81A 1FR6A 4OQGA 4BLMA 2GDNA 5E2GA 3HUNA 3LO7A 3VMAA 4LCMA 3BRMA 1W8QA 3GTCA 3G32A 4K91A 5E2HA 2Y2IA 2VGJA 1YLTA 1O7EA 3NI9A 3W8KA 2DNSA 4EBLA 5EECA 2Y2NA 1K56D 3PBSA 2JCHA 3VOYA 4E3MA 1HD8A 2WZZA 1MWUA 3CZDA 3MZFA 1KVMA 2ZM2A 3CJMA 4GD8A 4OPQA 2UWXA 1NJ4A 3QNCA 3SH7A 5EOEA 3OC2A 2QPNA 1LI9A 2FFFB 3UE0A 1XGIA 3IH9A 3OPHA 3GV9A 1G68A 1JTDA 3C4OA 4CPKA 5KZHA 1H8ZA 3G31A 4ZDXA 2Y2QA 5EE8A 2XF3A 3VP4A 5A90A 4X53A 1E25A 1YQSA 3N8RA 4ZBEA 2WKHA 4UA7A 4S2NA 2R9XA 3O87A 5DTSA 2A3UA 5EVIA 4JLFA 1FR1A 1EI5A 2ZQDA 5FAOA 2XD5A 3SS3A 5HAPA 5FQQA 3EQVA 3ITAA 2Y2HA 4E6WA 2EFUA 3DWKA 4XUZA 4P0MA 3HLBA 4P6BA 1PZPA 4YINA 3QHYA 4WMCA 2RCXA 2XR0A 3FKWA 5FQMA 3ZNTA 4PPRA 1BLCA 1RGYA 5AQ9A 1TDGA 3OCNA 3VP0A 2Y2PA 1BLPA 4OONA 5AQBA 5HFOA 2HP9A 4U3TA 4OPZA 5DF8A 4UHUA 5KMWA 2EX8A 3NBLA 4R1GA 4WMCD 3A3IA 4OPRA 4JXSA 4OLGA 2ZM8A 2JE5A 2WGIA 3LEZA 1K6SA 3FWLA 4GN2A 1W7FA 3SS4A 3VP3A 1WYCA 2VGKA 1W79A 5I94A 2X71A 1K55C 4H8RA 3NCKA 4DRTA 1BUEA 1WE4A 2C5WB 3HLCA 1NZUA 4MBFA 4GD6A 1GHPA 2ZM0A 4GB7A 4P87A 3UPNA 5HARA 3VFHA 3O88A 3HUMA 3IXGA 4R4RA 1FSWA 1GA9A 1IYSA 3IXHA 4KZ6A 3A3FA 4IVKA 3IF6C 4S2LA 3ZDJA 1GHMA 3UDIA 4RVAA 4QU3A 3BFCA 4E3LA 4U0TA 3Q7VA 5E43A 5FAQA 1VQQA 2ZC4B 2QZ6A 4Y0UA 1YLZA 4JBFA 1DJBA 4EWFA 4DF6A 2WAEA 2XFTA 3G30A 5M1AA 5FA7A 1YLWA 5CEBA 3A3EA 3IHBA 1ZG4A 4EBPA 1K54A 5CTNA 4ZJ1A 1K4EA 3O86A 5AQAA 5FQIA 3CG5A 3V50A 2ZC5B 4LV3A 3Q82A 2DRWA
chains in the Genus database with same CATH superfamily
3IS2B 2BASA 1H0MA 1E3UD 1SKOA 2R9WA 5J8XA 3ZG9B 4PM9A 5BOHA 2G2UA 4RX2A 1LI0A 2HPBA 5L2FA 2QWSA 3LIBA 1MWSA 3ZVTA 4NETA 4PM6A 4Z9QA 1T1BA 2O99A 2HP6A 5FATA 1AXBA 5CECA 1T18A 2INWA 2XDMA 2PDRA 2ZC6B 4KUOA 3IHAA 1ZHHB 2EX2A 2VGLM 3TOIA 3DTKA 4ID4A 1YM1A 1EW0A 5MC7A 3UB6A 1OTEA 4YWZA 2XROA 4XT2B 4IBXA 5GHYA 1SDEA 4WF0A 4Y7PA 5L07A 1XFQA 2HDSA 1IKIA 4P85A 1AWIA 4UA6A 4CLCB 3IT9A 4PM7A 1XP4A 3ISGA 1K57C 5GLBA 4BMWA 4O0PA 4EUZA 2IA2A 3BLSA 3M2KA 2VEAA 5EVID 1CEGA 2H5SA 2BLSA 2Z6DA 2ZD8A 3IF5A 3IBRA 1VHMA 4II7A 2K7SA 3LR5A 1XA7A 1XA1A 2Y2MA 2WGVA 2WAFA 4WYYA 5EM0A 4MLLA 1PYYA 1Y28A 1MKIA 5A8BA 3WS4A 5FI2A 3IS2A 2B95A 4KZ7A 3WRTA 2XD1A 5F5YA 2YKHA 1HLUP 3T50A 1K6RA 4DN0A 4BBUA 1OTAA 1ONHA 5AVEA 4A5RA 1MPLA 3VOZA 2ZC3B 3PAGA 2PU2A 1GCEA 3S4XA 1K55A 4PMAA 2ZL1B 3P01A 2VV7A 4OP8A 2OLVA 3LI8A 3G34A 3BLMA 3OLOA 1H5XA 5M19A 4D2OA 2VK3A 3VFFA 3SS5A 1K38A 2Z2LB 3AGEA 3DAVA 1PIOA 5E2FA 1H8YA 3EQUA 4XT2A 1NRFA 4HP9A 3P09A 4MN5A 1MKMA 1W63M 1ZG6A 3HVFA 2DCFA 1ERMA 3S22A 4CLCA 2FZ0A 5TGFA 4JF4A 5F1FA 2HV1A 3ZG5A 4DKIA 3HBRA 2W3EA 4LV0A 3JPUA 2C6WB 5CHMA 3UB8A 1JVJA 2V0WA 1XKZA 2WGWB 4BENA 3BM6A 3N6IA 4E3OA 1QMEA 2H0TA 3G2ZA 4E04A 1XJ3A 5JYPA 3GDIA 4ARZB 3OCLA 5FQ9A 3GMWA 3IXBA 3C8CA 4OVDA 3ZQ5A 5HWWA 4PAUA 4OP5A 3M6HA 4R3BA 4FCFA 2J7VA 1S0WA 2W3HA 4DXBA 2ZL1A 4GLQA 3FYZA 3O3VA 5A92A 3QNBA 4GZBA 4Y2FA 4R70A 1UGUA 3MZDA 4N1XA 4U0XA 3NJAA 2J80A 2ZQ7A 1HTZA 1K0KA 1D1JA 3T1XA 3U4LP 3PR6A 2WKQA 2EX6A 4Z1WA 3S7OA 4DXCA 3V67A 5HD5A 4Y5FA 4HEFA 1N9LA 3S7PA 1ONGA 1KGGA 5DKKA 4E3IA 3GVBA 5IS1A 1L0GA 4UQIS 1XX2A 1MWRA 3C2WA 3KX0X 3LIDA 2BG1A 1YLYA 3TJZC 3KSGA 5A93A 1IEMA 3KYZA 2HDUA 1LL8A 4N9LA 4ZJ3A 3LY3A 3Q7VB 3VSLA 1NYYA 2WGWA 3OPRA 5J3WA 3I7JA 3EGDC 3T1SA 3FKVA 1OJ5A 3MJQA 2QJ5A 3EOIA 1IELA 3P98A 2UV0E 4PM8A 4X56A 4ARZA 1GHIA 2H10A 2HDRA 3E4PA 4BWIA 2JBFA 1FR6A 4OQGA 3LO7A 4LCMA 5HD3A 2Y2IA 3W8KA 2HJ9C 5EECA 4JGRA 2JCHA 4E3MA 3NOTC 2ZM2A 4GD8A 4OPQA 2XRNA 3VV4A 1NJ4A 1LI9A 3OPHA 1H8ZA 4ZDXA 3LICA 2XF3A 3R7WB 5A90A 4ZBEA 4S2NA 2R9XA 4BBTA 4HI4A 4JLFA 2L0WA 5FAOA 4D60A 2Y2HA 3LR3A 4XUZA 4P6BA 2XR0A 4PPRA 1BLCA 5AQ9A 1LSVA 1NRJA 1TDGA 2Y2PA 5AQBA 2HP9A 5DF8A 3CPTB 1XFNA 3A3IA 2WGIA 3LEZA 1WYCA 1W79A 1K55C 3NCKA 4DRTA 3HLCA 4JGOA 1NZUA 5CEDA 4GD6A 1GHPA 4P87A 4GB7A 2WKPA 4ESPA 1TD5A 5HARA 3G6OA 3OBFA 2O9CA 3A3FA 3T1RA 1TS7A 3UDIA 3T4SA 4QU3A 3VE3A 4NXFA 3EEAA 4E3LA 3Q7VA 1VQQA 5G4YA 4Q0HA 1YLZA 4JBFA 2WAEA 4WLAA 5M1AA 1V9ZA 4EBPA 1K54A 1K4EA 3O86A 5FQIA 3BW6A 3V50A 2DRWA 1VB6A 1PI5A 3F1OB 2PR6A 1L0DA 3HJIA 4C6YA 2ZMAA 5CRFA 1NXYA 2Y2LA 4CLCC 2PYPA 3WS0A 1ZC2A 4EEPA 4FUWA 3MKEA 4CQHA 1PFLA 3IX3A 4EESA 3PBTA 2LB5A 1W8YA 3AGDA 3Q7ZA 1FSYA 3OOVA 2WKRA 3MFDA 3ZYTA 3R7WA 2R78A 5L8MA 2W3FA 4JXGA 4B4ZA 3MS6A 4LLOB 1ESIA 1W5DA 2A49A 1SKFA 1ESUA 3UB5P 1JWPA 4BL3A 1T19A 5FSRA 4BD0A 3H82B 3BQ8A 4GOGA 4B88A 2XEPA 2J9OA 3NY4A 1CEFA 3C38A 5HL6A 3ITBA 5GLDA 3MBZA 5FQJA 2XQZA 1VEUB 3CPTA 1SDNA 1HZOA 5HWTA 1KDWA 4BL2A 3GR2A 2ZOHA 1I2SA 2HZ5A 2P9VB 1JTGA 4GDNA 4CLCE 4DE2A 1CI9A 3G2YA 3QP4A 5G4ZA 3SZTA 2CC1A 3A0RA 1G6OA 1H8MA 3E98A 3OPPA 1NYMA 5FDHA 2FFYA 3UN7A 2EA9A 3JYIA 1S4SA 4N1HA 1YMSA 5FEGA 1CI8A 2H0YA 2XFSA 3PYPA 3V3RA 2J3TC 3F1OA 2VGLS 4E3JA 4HH2A 4WL9A 5HWVA 4R38A 4KZBA 2VA0A 5HDCA 5GHXA 4DE1A 4YFMA 4JXVA 4EQIA 3UMDA 4LGWA 1ERQA 3ZGAB 3ZFZA 1EROA 4WZ5C 3A3JA 3BFEA 1WA9A 1LSXA 4S2PA 5KSCA 1ES2A 3K2NA 3E4OA 2WADA 4UAAA 3V39A 2XLNA 1PI4A 2XA7M 1SHVA 3PTEA 2PBDP 1GA0A 3N8SA 2QKPA 3H82A 3W4PA 4FOFA 1MWTA 2WYXA 1VM1A 5GLCA 2HDQA 1DRMA 1S66L 1VEUA 4EERA 1BSGA 4X68A 3ZG7B 4OQHA 2M7UA 1O07A 3ZHHA 3UPPA 5J4EA 2P9VA 4R23A 2D02A 4R3JA 2Y91A 3IX8A 4R3AA 1OJGA 2K31A 1ES4A 1BLHA 3N8LA 4S2NC 3B47A 4OLDA 5GL9A 5M18A 3UE1A 4HJ3A 2LB9A 3ZG8B 3GSGA 5HAIA 3FG8A 4NEED 2A2LA 3S7NA 3QP6A 1TS6A 4BJPA 5C5KA 4M3KA 1FQGA 4AFIA 4GHIB 4S2IA 3C7VA 4LRYC 4IBRA 5HX9A 1FCMA 1P9WA 2XH9A 5DF7A 1M40A 1YLJA 3MXSA 1XXMA 2DMWA 1Z6FA 1DP9A 4KG6A 5GLAA 1ZKJA 1YT4A 5CHUA 3PBNA 3DTMA 1Q2PA 3KSHA 3K3DA 3UDFA 4RX3A 3AGFA 1BTLA 3JVVA 3S1YA 1S6RA 4K0WA 4GKUA 2KOIA 3BECA 2OV5A 3RFBA 5HZHA 1WYBA 5EPHA 4YNRA 5HPIA 1W63Q 1K54C 4O01A 2PT7A 4JKTA 4LV1A 3NECA 4JXWA 2O9AA 2E8JA 4OOMA 1OTIA 5K5BA 1FCNA 2NUTC 3TE8A 3BFFA 3OPLA 3MFXA 2OAQ1 3VE4A 1D7EA 3L7HA 4F94A 2M1CA 5DTTA 1RP5A 3G4PA 1YAXA 2CMNA 4MEZA 2Y59A 5CXWA 1MC0A 2OWJA 5CTMA 4L0LA 4DE0A 3D3OA 4DJ2A 1L3LA 3B33A 2WK0A 4WELA 2W1TB 5CGXA 5TR7A 3S7QA 2Q0OA 3UB7A 2EX9A 3VOLA 5CGSA 3ICYA 5FL3A 3NULA 4UA9A 3SH8A 4KG5A 4BQMA 1Y54A 1FOFA 2W3GA 3CHWP 5DKLA 1A0KA 4CLCD 4GHIA 3LYXA 4BLMA 3BRMA 2VGJA 2DNSA 2AVXA 1DP6A 3QP2A 1KOUA 2WZZA 1MWUA 1KVMA 1N9NA 2KDKA 5EOEA 3OC2A 2QPNA 4HH3A 4HNBA 3UE0A 3IH9A 1JTDA 3C4OA 4CPKA 5KZHA 5TBMB 5EE8A 2W0NA 4X53A 1E25A 1YQSA 3N8RA 2A3UA 5TJJA 3SS3A 2XD5A 5FDSA 1PZPA 3QHYA 3ZNTA 3ULFA 4GJ4A 5HFOA 4U3TA 4OPZA 1S1YA 4R1GA 4QWOA 4OPRA 2ZM8A 1K6SA 3SS4A 4ZRRA 2V9AA 1WE4A 3O88A 3IXGA 1GA9A 2HGVA 4KUKA 4KZ6A 4IVKA 4S2LA 3ZDJA 4RVAA 2VX8A 4U0TA 2W1TA 5E43A 2QZ6A 4DJ3A 1DJBA 2J3TD 1D06A 2VZWA 3A3EA 4I38A 4I3AA 3MSHA 4HP4A 4Y13A 4WZ5A 1ACFA 4EEUA 1PWGA 1ALQA 2EXBA 1KGFA 1JWZA 1CF0A 4IJGA 4GNUA 1F5MA 4F3LB 4FSFA 1IYQA 2JKFA 1HVBA 4QD4A 2OOLA 4LCLA 4Y0OA 5TBMA 3IF6B 1M6KA 2ZOIA 1XJ2A 1F9IA 3MZEA 3CITA 2Y79A 3FPVA 5AJGA 2JC7A 4QY5A 1KE3A 3DBAA 2E8IA 2Y8HA 3QP1A 2W3DA 2GJ3A 4EW7A 5DTKA 1PWDA 1P97A 4X25A 3U2AA 4LV2A 2HJEA 2ZQCA 1TDLA 4IUHA 2ZLYA 3BYDA 4S2MA 3T4LA 4OOYA 3V5MA 3W4QA 3MQQA 2ZMVA 3QP8A 4R0QA 3NOPC 5HW3A 4EBNA 3CLOA 4X1MA 4QPRA 4NK3A 4FD8A 1IYOA 4P6ZM 3H7WB 1FCOA 5D3OA 3HLFA 4WN5A 3HUOA 4LENA 4X1LA 3T4QA 3DW0A 4WBGA 5EUAA 4LPZA 4MN6A 5HAQA 4Y0TA 3LIFA 5IHVA 1LHYA 1L0FA 3T12B 5KSHA 3T4TA 5IU1A 4ZTKA 4NXGA 3LR0A 2QHKA 3A3DA 3UNWA 3HLGA 1KVLA 2A24B 2Z2MB 1ODVA 3IQAA 5L10A 1KGEA 2PBYA 4QHCA 4KENB 2O0YA 3C5AA 3P7NA 4HJ4A 3MXRA 2ZC7A 2IWCA 4JGQA 1KDSA 2V8CA 1C3BA 3B42A 5EVEA 3CMZA 4F3LA 4XUXA 3UPOA 3T4KA 1OMEA 1MBLA 3IF6A 3NOUC 4KZ5A 4C3QA 1MXOA 2BTFP 3HLDA 3BWLA 1NY0A 2D01A 4HBUA 4PM5A 3SW1A 1U60A 2GNXA 4S2OA 4GS9B 4GDBA 1BULA 2Z6CA 4H6JB 2P7JA 3C4PA 3ZNYA 1IOUA 2K2NA 2QMIA 2V8FA 3IWOA 4HBTA 5HDDA 2GX5A 4NKPA 3CI6A 4FH2A 1ES5A 3A0SA 4ETZA 2MJ6A 4XXRA 5I5LA 2Y2JA 3Q1FA 3O5YA 2PD8A 1NWZA 4HQAA 1CQAA 1K56A 2XK1A 3H7WA 5IT5A 2ZQ8A 4DE3A 4K0XA 4Q8IA 2JN7A 3IWIA 4JPMA 5U47A 3PBRA 2P04A 1STZA 1N4OA 1F98A 2VV8A 3MQOA 3K3CA 3T1QB 1S4RA 3E4QA 2YKFA 3MKFA 2Q9MA 2A24A 4I3JA 1YPRA 2XA7S 3IWQA 2JKTM 4HJ6A 4KQOA 3M6BA 2PU4A 1BT5A 3MXQA 4X6TA 1H3QA 4FH4A 4Q0IA 4RA7A 4CJNA 1ES3A 4WZ4A 3LUQA 1IFQA 5DVAA 2ZQ9A 4R6LA 5HL1A 5F1GA 1TEMA 4N92A 3HLEA 3G35A 1K4FA 4G3WA 1JWVA 2VV6A 3EEHA 5AVFA 5EVLA 1KE4A 5EVIB 1BLSA 1YLPA 3HLWA 1Z09A 3WRZA 3KYEA 4MBHA 4HHDA 4GS9A 1DY6A 4JF5A 4H6JA 1N9BA 2WZXA 4OKPA 5KIZA 2WUQA 4LFUA 2Q9NA 4NXBA 5FAPA 4OOLA 4WUJA 3FV7A 5DF9A 2X01A 1E3UA 2I72A 2IWDA 5A91A 1RGZA 2XGNA 4KZ8A 2G2WA 3VP2A 5F68A 3ZVWA 4MNRA 2WKEA 1MY8A 4X69A 2EXAA 1PWCA 3LIAA 3R4KA 4OH0A 4NXEA 2ZQAA 3LI9A 3DWZA 1N9OA 4C75A 1L0EA 3NHQA 2IWBA 5CGWA 4QJGA 2P08A 3BFDA 3WS2A 5AQ7A 3Q81A 4MN7A 5E2GA 3HUNA 3VMAA 1W8QA 3GTCA 4K91A 5E2HA 2O9BA 3LGOA 1XJ6A 4L9EA 1O7EA 5HSQA 1HD8A 3CWFA 3CZDA 3MZFA 1GSXA 2UWXA 3D9YA 3GV9A 1G68A 3KSIA 1NLYA 3G31A 2Y2QA 4DMZA 2WKHA 1P9RA 2HF6A 5EVIA 2ZQDA 5HAPA 1Y4OA 5HPFA 5FQQA 2KLIA 4E6WA 3DWKA 5HDSA 2OAP1 4P0MA 4WMCA 4Y3IA 2RCXA 3FKWA 3UMEA 4GW9A 5FQMA 5DFXA 1JNUA 1RGYA 1BLPA 4OONA 2EX8A 3NBLA 4WMCD 4JXSA 4I39A 4OLGA 3VP3A 3FWLA 1W7FA 3PXPA 2X71A 3KYQA 4H8RA 1VETB 1OPXA 2C5WB 4Y15A 2B02A 3UPNA 3HUMA 4R4RA 1FSWA 2V0UA 2EWVA 3IF6C 3DTEA 5FAQA 2ZMFA 2EWWA 4Y0UA 3IX4A 3RH8B 2H28A 2XFTA 5FA7A 1YLWA 5CEBA 1ZG4A 4ZJ1A 5AQAA 2ZC5B 4LV3A 2L4RA 3BEBA 3T4OA 3UE6A 3F1NB 4DDYA 1KE0A 4G3KA 1UWPX 2VLGA 1PRQA 5F69A 4KZAA 3HJKA 5F82A 1S67L 1DJCA 2J3WA 5JYOA 4KQRA 3IH8A 3UDXA 3FC7A 3W4OA 2OLUA 4E6XA 3LEQA 3KO6A 2VKSA 4MDZA 3PAEA 5DJTA 4G3VA 5FI6A 1E4DA 3IXDA 3L9KA 4S2JA 5EV0A 4EXOA 3TG9A 2JKGA 3RJUA 1XGJA 1BYWA 5FI7A 2PYRA 3WS5A 3MQ0A 5TFQA 5FASA 4IVIA 1TS0A 4NG2A 1VETA 1I5QA 3WS1A 1NLZA 4OQIA 3HCYA 4IEDA 3A0VA 3RXXA 4MBKA 1Q2QA 4HOIA 4OPYA 3T4JA 3JVUA 5LBRA 3BFGA 5L09A 5E2EA 2KX6A 1LL5A 4E3KA 2HP5A 3NC8A 1YSPA 3Q07A 4PHTA 4KG2A 1F2KA 1UWNX 1NZOA 1EWZA 3F1NA 1YKDA 1YSQA 2B5RA 2P74A 3E2LA 2Y55A 4R4SA 4KZ3A 2V20A 4RQ9A 1J3WA 4Q0JA 3ZCZA 1T1AA 4BD1A 2G7UA 2PR5A 2V1BA 1FIKA 3HL9A 3D72A 1I2WA 3PBOA 3LIEA 4OQ0A 4JF6A 5G18A 4PKYG 4MCWA 4KQQA 5CX7A 5F83A 2Y4AA 4P6ZS 3OZHA 4I5SA 3CUEA 4KZ9A 1DP8A 2QJ7A 2ZBBA 2EFXA 3MMHA 3LFVA 2XSSA 3VSKA 3E0YA 3GQZA 3RTYA 3GECA 3TSGA 4LRZE 2OSUA 2OWHA 1DJAA 3UO9A 1XJ4A 3VP1A 3TW8A 4HIAA 1PW1A 1TVFA 1V9YA 3M2JA 1PNEA 1CJFA 3N4IA 5EVIC 1IYPA 4WM9A 3NDGA 5EM1A 4FTXA 4UQIM 1GSVA 2PAVP 3B3XA 4KZ4A 1LL9A 4WEKA 3SOIA 4DDSA 4Y17A 5GHZA 4ME4A 4IUKA 1OT9A 3F1PB 3SH9A 1RCJA 3IBJA 4EV4A 4ZJ2A 1MZUA 3RXWA 2J8YA 4WEJA 3H9WA 5CERA 1L2SA 3BQAA 3ZG0A 4RYEA 3PHYA 4HESA 4QY6A 1K57A 1PW8A 4L9GA 1LLBA 3QP5A 2PD7A 4K08A 3NDEA 2V1AA 2V1ZA 2W27A 2GZAA 4O7DA 2Y2GA 4BBVA 3V3SA 4I3IA 3NIAA 2PHYA 1CK3A 1GSWA 4X55A 1QMFA 1P0ZA 4B4XA 3TRCA 4O8GA 4B9OA 4ZAMA 3GRJA 3FPWA 5CHJA 1K25A 5F6AA 4JGPA 2J9PA 2QYBA 1XPBA 4N9KA 2RL3A 3HREA 3N7WA 4EU0A 1BZAA 3FZCA 4E3NA 1YMXA 1J9MA 1G6AA 1OTBA 4GCZA 2M7VA 3WWXA 1SCWA 4QB8A 3LY4A 5EOOA 3LR4A 3UE3A 4M4XA 1PZOA 2ZJ9A 4S2KA 2Y2KA 2ACGA 1LSWA 2WKIA 2JHEA 2JKRM 4HY8A 4EETB 2NUPC 3E2KA 3C7UA 2FH5A 3PBQA 3D4FA 1IKGA 1LT0A 2Y2OA 3UY6A 3LCEA 2JKRI 5FQKA 2X02A 2V2FF 3F1PA 3EWKA 1SKOB 2GDNA 4B93A 1ZTUA 3G32A 4UEYA 1YLTA 1SZVA 3NI9A 4EBLA 1G5UA 2Y2NA 1K56D 2PRFA 3PBSA 3VOYA 3CJMA 3QNCA 3SH7A 5EFWA 1FILA 4L9FA 2FFFB 1XGIA 4EQ1A 1X0OA 4ETXA 3DTIA 4IHQA 3VP4A 1TF1A 1OTDA 4UA7A 3O87A 5DTSA 3MF0A 1FR1A 1EI5A 3MR0A 3W2ZA 5FEFA 1TS8A 4KQDA 3EQVA 3ITAA 2EFUA 2JKTI 3EGXC 3HLBA 4YINA 2L1MA 5DFYA 1OT6A 3BY9A 3OCNA 3VP0A 5KMWA 4UHUA 2VJWA 2JE5A 4PKYA 4EUVA 4GN2A 5J7EA 2VGKA 5I94A 1BUEA 1S1ZA 4MBFA 2ZM0A 3VFHA 3UB9A 1IYSA 4MMNA 3IXHA 1T1CA 1GHMA 3BY8A 3BFCA 4LRXC 3CAXA 2ZC4B 1G28A 4YOFA 4EWFA 4DF6A 2B18A 5DJUA 3G30A 2W1RA 3IHBA 3CUEC 5CTNA 3KSFA 3CG5A 2I9VA 3C30A 3Q82A 3BJNA
chains in the Genus database with same CATH topology
1E3UD 3BEBA 1PI5A 4WZ5A 2R9WA 5J8XA 1L0DA 4DDYA 1KE0A 4C6YA 3ZG9B 4PM9A 2ZMAA 5BOHA 2G2UA 1PWGA 1LI0A 4RX2A 5CRFA 1NXYA 1ALQA 2HPBA 2Y2LA 4KZAA 5L2FA 2EXBA 1KGFA 1JWZA 3WS0A 1ZC2A 5F82A 1DJCA 5JYOA 1MWSA 3ZVTA 4GNUA 3MKEA 4NETA 4PM6A 4FSFA 4Z9QA 1IYQA 4KQRA 2HP6A 3IH8A 3PBTA 1HVBA 1W8YA 4QD4A 3UDXA 4LCLA 4Y0OA 5FATA 3AGDA 3Q7ZA 1AXBA 1FSYA 3IF6B 1M6KA 3MFDA 3W4OA 5CECA 2OLUA 4E6XA 4JXGA 4B4ZA 3MZEA 2XDMA 2ZC6B 1ESIA 1W5DA 2A49A 3IHAA 1SKFA 3PAEA 2EX2A 3TOIA 1ESUA 2JC7A 4QY5A 1JWPA 1KE3A 4ID4A 4BL3A 2E8IA 5FSRA 5FI6A 1E4DA 1YM1A 4BD0A 3IXDA 4GOGA 4B88A 2XEPA 2J9OA 4S2JA 5DTKA 3TG9A 3NY4A 1PWDA 4IBXA 5GHYA 3RJUA 1SDEA 1XGJA 1CEFA 4Y7PA 5FI7A 4LV2A 3ITBA 5GLDA 3MBZA 2ZQCA 3WS5A 1TDLA 5FQJA 2XQZA 2ZLYA 2HDSA 1IKIA 3BYDA 1SDNA 5TFQA 4P85A 1HZOA 5FASA 4S2MA 1KDWA 4UA6A 4OOYA 4BL2A 3V5MA 3W4QA 4IVIA 3IT9A 4PM7A 1XP4A 3GR2A 3ISGA 4R0QA 1K57C 1I2SA 5HW3A 4EBNA 5GLBA 1I5QA 2P9VB 4EUZA 1JTGA 3M2KA 3BLSA 4GDNA 3WS1A 4DE2A 5EVID 1CEGA 2H5SA 1CI9A 2BLSA 3G2YA 4NK3A 4FD8A 1IYOA 4OQIA 4IEDA 1FCOA 2ZD8A 5D3OA 3RXXA 3IF5A 3HLFA 4MBKA 1Q2QA 3HUOA 4LENA 3DW0A 4OPYA 4WBGA 5EUAA 3BFGA 5HAQA 2CC1A 4Y0TA 3OPPA 5IHVA 5E2EA 1LHYA 1L0FA 1LL5A 2HP5A 3NC8A 1NYMA 4E3KA 5FDHA 1XA7A 2FFYA 1XA1A 2Y2MA 3UN7A 3JYIA 3Q07A 2WGVA 2WAFA 4WYYA 4MLLA 1PYYA 5KSHA 1MKIA 4N1HA 4ZTKA 1YMSA 1CI8A 2H0YA 4KG2A 3A3DA 2XFSA 3UNWA 5FI2A 3WS4A 3HLGA 1KVLA 2Z2MB 3V3RA 4KZ7A 1NZOA 3IQAA 1EWZA 3WRTA 1KGEA 2PBYA 2XD1A 4KENB 4QHCA 2B5RA 2P74A 3E2LA 4E3JA 5CEDA 1K6RA 2Y55A 3C5AA 4R4SA 4KZBA 4KZ3A 3MXRA 2ZC7A 2V20A 1ONHA 2IWCA 1MPLA 1KDSA 4A5RA 5GHXA 3ZCZA 4DE1A 1C3BA 3VOZA 2ZC3B 3PAGA 2PU2A 4YFMA 1GCEA 4JXVA 3S4XA 1K55A 3CMZA 4PMAA 4EQIA 4BD1A 4OP8A 4XUXA 3UPOA 2OLVA 3G34A 3BLMA 1OMEA 3HL9A 1ERQA 3ZGAB 3ZFZA 1EROA 4WZ5C 1H5XA 3A3JA 1MBLA 5M19A 3BFEA 1I2WA 3IF6A 4D2OA 3PBOA 3VFFA 4OQ0A 4KZ5A 3SS5A 4JF6A 4C3QA 1MXOA 3HLDA 1K38A 4S2PA 5G18A 5KSCA 1ES2A 1NY0A 2Z2LB 2WADA 4HBUA 3AGEA 4UAAA 4PM5A 3V39A 2XLNA 1PI4A 1SHVA 3PTEA 1U60A 1PIOA 4S2OA 4KQQA 5E2FA 4GDBA 1GA0A 3N8SA 1BULA 3W4PA 5F83A 2Y4AA 3C4PA 3ZNYA 3OZHA 1H8YA 3EQUA 4KZ9A 2QMIA 1NRFA 1MWTA 3IWOA 4HBTA 2WYXA 1VM1A 3P09A 2EFXA 5GLCA 2HDQA 1ZG6A 3HVFA 2DCFA 4FH2A 3VSKA 1ES5A 1ERMA 3S22A 3GQZA 1BSGA 4X68A 4XXRA 3ZG7B 4OQHA 2Y2JA 3Q1FA 5TGFA 4JF4A 5F1FA 3TSGA 1O07A 2OSUA 3ZHHA 3UPPA 3ZG5A 4DKIA 1DJAA 2P9VA 3HBRA 4R23A 4R3JA 3UO9A 2Y91A 3VP1A 1K56A 2XK1A 4LV0A 2C6WB 1PW1A 5CHMA 1TVFA 2ZQ8A 4DE3A 4K0XA 3M2JA 1ES4A 1BLHA 3N8LA 4S2NC 4Q8IA 4OLDA 5GL9A 3N4IA 5M18A 1JVJA 3IWIA 5EVIC 1XKZA 2WGWB 4BENA 3UE1A 4JPMA 1IYPA 5U47A 4WM9A 3NDGA 3BM6A 3N6IA 3PBRA 3ZG8B 4E3OA 3GSGA 1QMEA 5HAIA 1N4OA 2H0TA 3G2ZA 5JYPA 4BJPA 3B3XA 4KZ4A 1LL9A 3OCLA 4WEKA 3SOIA 4DDSA 5GHZA 5FQ9A 3MKFA 1FQGA 4M3KA 2Q9MA 3SH9A 1RCJA 4S2IA 3IWQA 4EV4A 4KQOA 4ZJ2A 3GMWA 3IXBA 3M6BA 2PU4A 1BT5A 4OVDA 3C7VA 3RXWA 4X6TA 2J8YA 4IBRA 4WEJA 5HX9A 1FCMA 4FH4A 2XH9A 5CERA 1L2SA 4OP5A 3ZG0A 5DF7A 1M40A 3M6HA 1YLJA 3MXSA 4HESA 4RA7A 4RYEA 4R3BA 4CJNA 4QY6A 1ES3A 1XXMA 4WZ4A 4FCFA 2J7VA 1S0WA 1K57A 1PW8A 1Z6FA 4KG6A 5GLAA 4DXBA 1ZKJA 5DVAA 2ZQ9A 1YT4A 5CHUA 1LLBA 3PBNA 3DTMA 3FYZA 5HL1A 5F1GA 1Q2PA 3NDEA 3O3VA 3UDFA 5A92A 2V1ZA 3QNBA 1TEMA 4GZBA 2Y2GA 4O7DA 4N92A 3HLEA 3V3SA 3NIAA 3G35A 1K4FA 3MZDA 4N1XA 4RX3A 1JWVA 3AGFA 1BTLA 4U0XA 1CK3A 2ZQ7A 5EVLA 3S1YA 1KE4A 1HTZA 1S6RA 4K0WA 1QMFA 4X55A 4GKUA 5EVIB 1BLSA 1YLPA 3BECA 2OV5A 3HLWA 4B4XA 3WRZA 1WYBA 4MBHA 5EPHA 2EX6A 1DY6A 4JF5A 4ZAMA 1K54C 3GRJA 1N9BA 2WZXA 4OKPA 4DXCA 2WUQA 4JKTA 5CHJA 1K25A 4HEFA 4LV1A 1ONGA 2Q9NA 2J9PA 1KGGA 4JXWA 4OOMA 5FAPA 1FCNA 1XPBA 4N9KA 2RL3A 3BFFA 3HREA 3OPLA 4E3IA 3GVBA 3N7WA 4OOLA 1BZAA 3FZCA 1L0GA 3FV7A 4F94A 4E3NA 1XX2A 1MWRA 1YMXA 5DF9A 5DTTA 2X01A 1RP5A 3G4PA 4MEZA 1J9MA 2Y59A 1E3UA 5CXWA 2BG1A 1G6AA 1YLYA 2I72A 2IWDA 5A91A 3WWXA 1SCWA 5CTMA 1RGZA 4QB8A 3LY4A 4L0LA 5A93A 4DE0A 2XGNA 4KZ8A 2G2WA 3VP2A 1IEMA 5EOOA 3UE3A 3ZVWA 2HDUA 1PZOA 2ZJ9A 4MNRA 2WKEA 4S2KA 2WK0A 1MY8A 4N9LA 4ZJ3A 4X69A 2Y2KA 4WELA 5TR7A 5CGXA 2EXAA 3LY3A 3Q7VB 1PWCA 4OH0A 2WKIA 3VSLA 1NYYA 2WGWA 3OPRA 3I7JA 2EX9A 2ZQAA 3E2KA 3FKVA 3C7UA 3PBQA 5CGSA 3D4FA 3DWZA 1IELA 4UA9A 3SH8A 1IKGA 3P98A 1L0EA 4PM8A 2IWBA 4C75A 4KG5A 2Y2OA 4X56A 3UY6A 4BQMA 5CGWA 1GHIA 1Y54A 1FOFA 2H10A 2HDRA 4QJGA 3BFDA 3WS2A 3LCEA 5AQ7A 5FQKA 2X02A 2JBFA 2V2FF 3Q81A 1FR6A 4OQGA 4BLMA 2GDNA 5E2GA 3HUNA 3LO7A 3VMAA 4LCMA 3BRMA 1W8QA 3GTCA 3G32A 4K91A 5E2HA 2Y2IA 2VGJA 1YLTA 1O7EA 3NI9A 3W8KA 2DNSA 4EBLA 5EECA 2Y2NA 1K56D 3PBSA 2JCHA 3VOYA 4E3MA 1HD8A 2WZZA 1MWUA 3CZDA 3MZFA 1KVMA 2ZM2A 3CJMA 4GD8A 4OPQA 2UWXA 1NJ4A 3QNCA 3SH7A 5EOEA 3OC2A 2QPNA 1LI9A 2FFFB 3UE0A 1XGIA 3IH9A 3OPHA 3GV9A 1G68A 1JTDA 3C4OA 4CPKA 5KZHA 1H8ZA 3G31A 4ZDXA 2Y2QA 5EE8A 2XF3A 3VP4A 5A90A 4X53A 1E25A 1YQSA 3N8RA 4ZBEA 2WKHA 4UA7A 4S2NA 2R9XA 3O87A 5DTSA 2A3UA 5EVIA 4JLFA 1FR1A 1EI5A 2ZQDA 5FAOA 2XD5A 3SS3A 5HAPA 5FQQA 3EQVA 3ITAA 2Y2HA 4E6WA 2EFUA 3DWKA 4XUZA 4P0MA 3HLBA 4P6BA 1PZPA 4YINA 3QHYA 4WMCA 2RCXA 2XR0A 3FKWA 5FQMA 3ZNTA 4PPRA 1BLCA 1RGYA 5AQ9A 1TDGA 3OCNA 3VP0A 2Y2PA 1BLPA 4OONA 5AQBA 5HFOA 2HP9A 4U3TA 4OPZA 5DF8A 4UHUA 5KMWA 2EX8A 3NBLA 4R1GA 4WMCD 3A3IA 4OPRA 4JXSA 4OLGA 2ZM8A 2JE5A 2WGIA 3LEZA 1K6SA 3FWLA 4GN2A 1W7FA 3SS4A 3VP3A 1WYCA 2VGKA 1W79A 5I94A 2X71A 1K55C 4H8RA 3NCKA 4DRTA 1BUEA 1WE4A 2C5WB 3HLCA 1NZUA 4MBFA 4GD6A 1GHPA 2ZM0A 4GB7A 4P87A 3UPNA 5HARA 3VFHA 3O88A 3HUMA 3IXGA 4R4RA 1FSWA 1GA9A 1IYSA 3IXHA 4KZ6A 3A3FA 4IVKA 3IF6C 4S2LA 3ZDJA 1GHMA 3UDIA 4RVAA 4QU3A 3BFCA 4E3LA 4U0TA 3Q7VA 5E43A 5FAQA 1VQQA 2ZC4B 2QZ6A 4Y0UA 1YLZA 4JBFA 1DJBA 4EWFA 4DF6A 2WAEA 2XFTA 3G30A 5M1AA 5FA7A 1YLWA 5CEBA 3A3EA 3IHBA 1ZG4A 4EBPA 1K54A 5CTNA 4ZJ1A 1K4EA 3O86A 5AQAA 5FQIA 3CG5A 3V50A 2ZC5B 4LV3A 3Q82A 2DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3U D;  3BEB A;  1PI5 A;  4WZ5 A;  2R9W A;  5J8X A;  1L0D A;  4DDY A;  1KE0 A;  4C6Y A;  3ZG9 B;  4PM9 A;  2ZMA A;  5BOH A;  2G2U A;  1PWG A;  1LI0 A;  4RX2 A;  5CRF A;  1NXY A;  1ALQ A;  2HPB A;  2Y2L A;  4KZA A;  5L2F A;  2EXB A;  1KGF A;  1JWZ A;  3WS0 A;  1ZC2 A;  5F82 A;  1DJC A;  5JYO A;  1MWS A;  3ZVT A;  4GNU A;  3MKE A;  4NET A;  4PM6 A;  4FSF A;  4Z9Q A;  1IYQ A;  4KQR A;  2HP6 A;  3IH8 A;  3PBT A;  1HVB A;  1W8Y A;  4QD4 A;  3UDX A;  4LCL A;  4Y0O A;  5FAT A;  3AGD A;  3Q7Z A;  1AXB A;  1FSY A;  3IF6 B;  1M6K A;  3MFD A;  3W4O A;  5CEC A;  2OLU A;  4E6X A;  4JXG A;  4B4Z A;  3MZE A;  2XDM A;  2ZC6 B;  1ESI A;  1W5D A;  2A49 A;  3IHA A;  1SKF A;  3PAE A;  2EX2 A;  3TOI A;  1ESU A;  2JC7 A;  4QY5 A;  1JWP A;  1KE3 A;  4ID4 A;  4BL3 A;  2E8I A;  5FSR A;  5FI6 A;  1E4D A;  1YM1 A;  4BD0 A;  3IXD A;  4GOG A;  4B88 A;  2XEP A;  2J9O A;  4S2J A;  5DTK A;  3TG9 A;  3NY4 A;  1PWD A;  4IBX A;  5GHY A;  3RJU A;  1SDE A;  1XGJ A;  1CEF A;  4Y7P A;  5FI7 A;  4LV2 A;  3ITB A;  5GLD A;  3MBZ A;  2ZQC A;  3WS5 A;  1TDL A;  5FQJ A;  2XQZ A;  2ZLY A;  2HDS A;  1IKI A;  3BYD A;  1SDN A;  5TFQ A;  4P85 A;  1HZO A;  5FAS A;  4S2M A;  1KDW A;  4UA6 A;  4OOY A;  4BL2 A;  3V5M A;  3W4Q A;  4IVI A;  3IT9 A;  4PM7 A;  1XP4 A;  3GR2 A;  3ISG A;  4R0Q A;  1K57 C;  1I2S A;  5HW3 A;  4EBN A;  5GLB A;  1I5Q A;  2P9V B;  4EUZ A;  1JTG A;  3M2K A;  3BLS A;  4GDN A;  3WS1 A;  4DE2 A;  5EVI D;  1CEG A;  2H5S A;  1CI9 A;  2BLS A;  3G2Y A;  4NK3 A;  4FD8 A;  1IYO A;  4OQI A;  4IED A;  1FCO A;  2ZD8 A;  5D3O A;  3RXX A;  3IF5 A;  3HLF A;  4MBK A;  1Q2Q A;  3HUO A;  4LEN A;  3DW0 A;  4OPY A;  4WBG A;  5EUA A;  3BFG A;  5HAQ A;  2CC1 A;  4Y0T A;  3OPP A;  5IHV A;  5E2E A;  1LHY A;  1L0F A;  1LL5 A;  2HP5 A;  3NC8 A;  1NYM A;  4E3K A;  5FDH A;  1XA7 A;  2FFY A;  1XA1 A;  2Y2M A;  3UN7 A;  3JYI A;  3Q07 A;  2WGV A;  2WAF A;  4WYY A;  4MLL A;  1PYY A;  5KSH A;  1MKI A;  4N1H A;  4ZTK A;  1YMS A;  1CI8 A;  2H0Y A;  4KG2 A;  3A3D A;  2XFS A;  3UNW A;  5FI2 A;  3WS4 A;  3HLG A;  1KVL A;  2Z2M B;  3V3R A;  4KZ7 A;  1NZO A;  3IQA A;  1EWZ A;  3WRT A;  1KGE A;  2PBY A;  2XD1 A;  4KEN B;  4QHC A;  2B5R A;  2P74 A;  3E2L A;  4E3J A;  5CED A;  1K6R A;  2Y55 A;  3C5A A;  4R4S A;  4KZB A;  4KZ3 A;  3MXR A;  2ZC7 A;  2V20 A;  1ONH A;  2IWC A;  1MPL A;  1KDS A;  4A5R A;  5GHX A;  3ZCZ A;  4DE1 A;  1C3B A;  3VOZ A;  2ZC3 B;  3PAG A;  2PU2 A;  4YFM A;  1GCE A;  4JXV A;  3S4X A;  1K55 A;  3CMZ A;  4PMA A;  4EQI A;  4BD1 A;  4OP8 A;  4XUX A;  3UPO A;  2OLV A;  3G34 A;  3BLM A;  1OME A;  3HL9 A;  1ERQ A;  3ZGA B;  3ZFZ A;  1ERO A;  4WZ5 C;  1H5X A;  3A3J A;  1MBL A;  5M19 A;  3BFE A;  1I2W A;  3IF6 A;  4D2O A;  3PBO A;  3VFF A;  4OQ0 A;  4KZ5 A;  3SS5 A;  4JF6 A;  4C3Q A;  1MXO A;  3HLD A;  1K38 A;  4S2P A;  5G18 A;  5KSC A;  1ES2 A;  1NY0 A;  2Z2L B;  2WAD A;  4HBU A;  3AGE A;  4UAA A;  4PM5 A;  3V39 A;  2XLN A;  1PI4 A;  1SHV A;  3PTE A;  1U60 A;  1PIO A;  4S2O A;  4KQQ A;  5E2F A;  4GDB A;  1GA0 A;  3N8S A;  1BUL A;  3W4P A;  5F83 A;  2Y4A A;  3C4P A;  3ZNY A;  3OZH A;  1H8Y A;  3EQU A;  4KZ9 A;  2QMI A;  1NRF A;  1MWT A;  3IWO A;  4HBT A;  2WYX A;  1VM1 A;  3P09 A;  2EFX A;  5GLC A;  2HDQ A;  1ZG6 A;  3HVF A;  2DCF A;  4FH2 A;  3VSK A;  1ES5 A;  1ERM A;  3S22 A;  3GQZ A;  1BSG A;  4X68 A;  4XXR A;  3ZG7 B;  4OQH A;  2Y2J A;  3Q1F A;  5TGF A;  4JF4 A;  5F1F A;  3TSG A;  1O07 A;  2OSU A;  3ZHH A;  3UPP A;  3ZG5 A;  4DKI A;  1DJA A;  2P9V A;  3HBR A;  4R23 A;  4R3J A;  3UO9 A;  2Y91 A;  3VP1 A;  1K56 A;  2XK1 A;  4LV0 A;  2C6W B;  1PW1 A;  5CHM A;  1TVF A;  2ZQ8 A;  4DE3 A;  4K0X A;  3M2J A;  1ES4 A;  1BLH A;  3N8L A;  4S2N C;  4Q8I A;  4OLD A;  5GL9 A;  3N4I A;  5M18 A;  1JVJ A;  3IWI A;  5EVI C;  1XKZ A;  2WGW B;  4BEN A;  3UE1 A;  4JPM A;  1IYP A;  5U47 A;  4WM9 A;  3NDG A;  3BM6 A;  3N6I A;  3PBR A;  3ZG8 B;  4E3O A;  3GSG A;  1QME A;  5HAI A;  1N4O A;  2H0T A;  3G2Z A;  5JYP A;  4BJP A;  3B3X A;  4KZ4 A;  1LL9 A;  3OCL A;  4WEK A;  3SOI A;  4DDS A;  5GHZ A;  5FQ9 A;  3MKF A;  1FQG A;  4M3K A;  2Q9M A;  3SH9 A;  1RCJ A;  4S2I A;  3IWQ A;  4EV4 A;  4KQO A;  4ZJ2 A;  3GMW A;  3IXB A;  3M6B A;  2PU4 A;  1BT5 A;  4OVD A;  3C7V A;  3RXW A;  4X6T A;  2J8Y A;  4IBR A;  4WEJ A;  5HX9 A;  1FCM A;  4FH4 A;  2XH9 A;  5CER A;  1L2S A;  4OP5 A;  3ZG0 A;  5DF7 A;  1M40 A;  3M6H A;  1YLJ A;  3MXS A;  4HES A;  4RA7 A;  4RYE A;  4R3B A;  4CJN A;  4QY6 A;  1ES3 A;  1XXM A;  4WZ4 A;  4FCF A;  2J7V A;  1S0W A;  1K57 A;  1PW8 A;  1Z6F A;  4KG6 A;  5GLA A;  4DXB A;  1ZKJ A;  5DVA A;  2ZQ9 A;  1YT4 A;  5CHU A;  1LLB A;  3PBN A;  3DTM A;  3FYZ A;  5HL1 A;  5F1G A;  1Q2P A;  3NDE A;  3O3V A;  3UDF A;  5A92 A;  2V1Z A;  3QNB A;  1TEM A;  4GZB A;  2Y2G A;  4O7D A;  4N92 A;  3HLE A;  3V3S A;  3NIA A;  3G35 A;  1K4F A;  3MZD A;  4N1X A;  4RX3 A;  1JWV A;  3AGF A;  1BTL A;  4U0X A;  1CK3 A;  2ZQ7 A;  5EVL A;  3S1Y A;  1KE4 A;  1HTZ A;  1S6R A;  4K0W A;  1QMF A;  4X55 A;  4GKU A;  5EVI B;  1BLS A;  1YLP A;  3BEC A;  2OV5 A;  3HLW A;  4B4X A;  3WRZ A;  1WYB A;  4MBH A;  5EPH A;  2EX6 A;  1DY6 A;  4JF5 A;  4ZAM A;  1K54 C;  3GRJ A;  1N9B A;  2WZX A;  4OKP A;  4DXC A;  2WUQ A;  4JKT A;  5CHJ A;  1K25 A;  4HEF A;  4LV1 A;  1ONG A;  2Q9N A;  2J9P A;  1KGG A;  4JXW A;  4OOM A;  5FAP A;  1FCN A;  1XPB A;  4N9K A;  2RL3 A;  3BFF A;  3HRE A;  3OPL A;  4E3I A;  3GVB A;  3N7W A;  4OOL A;  1BZA A;  3FZC A;  1L0G A;  3FV7 A;  4F94 A;  4E3N A;  1XX2 A;  1MWR A;  1YMX A;  5DF9 A;  5DTT A;  2X01 A;  1RP5 A;  3G4P A;  4MEZ A;  1J9M A;  2Y59 A;  1E3U A;  5CXW A;  2BG1 A;  1G6A A;  1YLY A;  2I72 A;  2IWD A;  5A91 A;  3WWX A;  1SCW A;  5CTM A;  1RGZ A;  4QB8 A;  3LY4 A;  4L0L A;  5A93 A;  4DE0 A;  2XGN A;  4KZ8 A;  2G2W A;  3VP2 A;  1IEM A;  5EOO A;  3UE3 A;  3ZVW A;  2HDU A;  1PZO A;  2ZJ9 A;  4MNR A;  2WKE A;  4S2K A;  2WK0 A;  1MY8 A;  4N9L A;  4ZJ3 A;  4X69 A;  2Y2K A;  4WEL A;  5TR7 A;  5CGX A;  2EXA A;  3LY3 A;  3Q7V B;  1PWC A;  4OH0 A;  2WKI A;  3VSL A;  1NYY A;  2WGW A;  3OPR A;  3I7J A;  2EX9 A;  2ZQA A;  3E2K A;  3FKV A;  3C7U A;  3PBQ A;  5CGS A;  3D4F A;  3DWZ A;  1IEL A;  4UA9 A;  3SH8 A;  1IKG A;  3P98 A;  1L0E A;  4PM8 A;  2IWB A;  4C75 A;  4KG5 A;  2Y2O A;  4X56 A;  3UY6 A;  4BQM A;  5CGW A;  1GHI A;  1Y54 A;  1FOF A;  2H10 A;  2HDR A;  4QJG A;  3BFD A;  3WS2 A;  3LCE A;  5AQ7 A;  5FQK A;  2X02 A;  2JBF A;  2V2F F;  3Q81 A;  1FR6 A;  4OQG A;  4BLM A;  2GDN A;  5E2G A;  3HUN A;  3LO7 A;  3VMA A;  4LCM A;  3BRM A;  1W8Q A;  3GTC A;  3G32 A;  4K91 A;  5E2H A;  2Y2I A;  2VGJ A;  1YLT A;  1O7E A;  3NI9 A;  3W8K A;  2DNS A;  4EBL A;  5EEC A;  2Y2N A;  1K56 D;  3PBS A;  2JCH A;  3VOY A;  4E3M A;  1HD8 A;  2WZZ A;  1MWU A;  3CZD A;  3MZF A;  1KVM A;  2ZM2 A;  3CJM A;  4GD8 A;  4OPQ A;  2UWX A;  1NJ4 A;  3QNC A;  3SH7 A;  5EOE A;  3OC2 A;  2QPN A;  1LI9 A;  2FFF B;  3UE0 A;  1XGI A;  3IH9 A;  3OPH A;  3GV9 A;  1G68 A;  1JTD A;  3C4O A;  4CPK A;  5KZH A;  1H8Z A;  3G31 A;  4ZDX A;  2Y2Q A;  5EE8 A;  2XF3 A;  3VP4 A;  5A90 A;  4X53 A;  1E25 A;  1YQS A;  3N8R A;  4ZBE A;  2WKH A;  4UA7 A;  4S2N A;  2R9X A;  3O87 A;  5DTS A;  2A3U A;  5EVI A;  4JLF A;  1FR1 A;  1EI5 A;  2ZQD A;  5FAO A;  2XD5 A;  3SS3 A;  5HAP A;  5FQQ A;  3EQV A;  3ITA A;  2Y2H A;  4E6W A;  2EFU A;  3DWK A;  4XUZ A;  4P0M A;  3HLB A;  4P6B A;  1PZP A;  4YIN A;  3QHY A;  4WMC A;  2RCX A;  2XR0 A;  3FKW A;  5FQM A;  3ZNT A;  4PPR A;  1BLC A;  1RGY A;  5AQ9 A;  1TDG A;  3OCN A;  3VP0 A;  2Y2P A;  1BLP A;  4OON A;  5AQB A;  5HFO A;  2HP9 A;  4U3T A;  4OPZ A;  5DF8 A;  4UHU A;  5KMW A;  2EX8 A;  3NBL A;  4R1G A;  4WMC D;  3A3I A;  4OPR A;  4JXS A;  4OLG A;  2ZM8 A;  2JE5 A;  2WGI A;  3LEZ A;  1K6S A;  3FWL A;  4GN2 A;  1W7F A;  3SS4 A;  3VP3 A;  1WYC A;  2VGK A;  1W79 A;  5I94 A;  2X71 A;  1K55 C;  4H8R A;  3NCK A;  4DRT A;  1BUE A;  1WE4 A;  2C5W B;  3HLC A;  1NZU A;  4MBF A;  4GD6 A;  1GHP A;  2ZM0 A;  4GB7 A;  4P87 A;  3UPN A;  5HAR A;  3VFH A;  3O88 A;  3HUM A;  3IXG A;  4R4R A;  1FSW A;  1GA9 A;  1IYS A;  3IXH A;  4KZ6 A;  3A3F A;  4IVK A;  3IF6 C;  4S2L A;  3ZDJ A;  1GHM A;  3UDI A;  4RVA A;  4QU3 A;  3BFC A;  4E3L A;  4U0T A;  3Q7V A;  5E43 A;  5FAQ A;  1VQQ A;  2ZC4 B;  2QZ6 A;  4Y0U A;  1YLZ A;  4JBF A;  1DJB A;  4EWF A;  4DF6 A;  2WAE A;  2XFT A;  3G30 A;  5M1A A;  5FA7 A;  1YLW A;  5CEB A;  3A3E A;  3IHB A;  1ZG4 A;  4EBP A;  1K54 A;  5CTN A;  4ZJ1 A;  1K4E A;  3O86 A;  5AQA A;  5FQI A;  3CG5 A;  3V50 A;  2ZC5 B;  4LV3 A;  3Q82 A;  2DRW A; 
#chains in the Genus database with same CATH topology
 3IS2 B;  2BAS A;  1H0M A;  1E3U D;  1SKO A;  2R9W A;  5J8X A;  3ZG9 B;  4PM9 A;  5BOH A;  2G2U A;  4RX2 A;  1LI0 A;  2HPB A;  5L2F A;  2QWS A;  3LIB A;  1MWS A;  3ZVT A;  4NET A;  4PM6 A;  4Z9Q A;  1T1B A;  2O99 A;  2HP6 A;  5FAT A;  1AXB A;  5CEC A;  1T18 A;  2INW A;  2XDM A;  2PDR A;  2ZC6 B;  4KUO A;  3IHA A;  1ZHH B;  2EX2 A;  2VGL M;  3TOI A;  3DTK A;  4ID4 A;  1YM1 A;  1EW0 A;  5MC7 A;  3UB6 A;  1OTE A;  4YWZ A;  2XRO A;  4XT2 B;  4IBX A;  5GHY A;  1SDE A;  4WF0 A;  4Y7P A;  5L07 A;  1XFQ A;  2HDS A;  1IKI A;  4P85 A;  1AWI A;  4UA6 A;  4CLC B;  3IT9 A;  4PM7 A;  1XP4 A;  3ISG A;  1K57 C;  5GLB A;  4BMW A;  4O0P A;  4EUZ A;  2IA2 A;  3BLS A;  3M2K A;  2VEA A;  5EVI D;  1CEG A;  2H5S A;  2BLS A;  2Z6D A;  2ZD8 A;  3IF5 A;  3IBR A;  1VHM A;  4II7 A;  2K7S A;  3LR5 A;  1XA7 A;  1XA1 A;  2Y2M A;  2WGV A;  2WAF A;  4WYY A;  5EM0 A;  4MLL A;  1PYY A;  1Y28 A;  1MKI A;  5A8B A;  3WS4 A;  5FI2 A;  3IS2 A;  2B95 A;  4KZ7 A;  3WRT A;  2XD1 A;  5F5Y A;  2YKH A;  1HLU P;  3T50 A;  1K6R A;  4DN0 A;  4BBU A;  1OTA A;  1ONH A;  5AVE A;  4A5R A;  1MPL A;  3VOZ A;  2ZC3 B;  3PAG A;  2PU2 A;  1GCE A;  3S4X A;  1K55 A;  4PMA A;  2ZL1 B;  3P01 A;  2VV7 A;  4OP8 A;  2OLV A;  3LI8 A;  3G34 A;  3BLM A;  3OLO A;  1H5X A;  5M19 A;  4D2O A;  2VK3 A;  3VFF A;  3SS5 A;  1K38 A;  2Z2L B;  3AGE A;  3DAV A;  1PIO A;  5E2F A;  1H8Y A;  3EQU A;  4XT2 A;  1NRF A;  4HP9 A;  3P09 A;  4MN5 A;  1MKM A;  1W63 M;  1ZG6 A;  3HVF A;  2DCF A;  1ERM A;  3S22 A;  4CLC A;  2FZ0 A;  5TGF A;  4JF4 A;  5F1F A;  2HV1 A;  3ZG5 A;  4DKI A;  3HBR A;  2W3E A;  4LV0 A;  3JPU A;  2C6W B;  5CHM A;  3UB8 A;  1JVJ A;  2V0W A;  1XKZ A;  2WGW B;  4BEN A;  3BM6 A;  3N6I A;  4E3O A;  1QME A;  2H0T A;  3G2Z A;  4E04 A;  1XJ3 A;  5JYP A;  3GDI A;  4ARZ B;  3OCL A;  5FQ9 A;  3GMW A;  3IXB A;  3C8C A;  4OVD A;  3ZQ5 A;  5HWW A;  4PAU A;  4OP5 A;  3M6H A;  4R3B A;  4FCF A;  2J7V A;  1S0W A;  2W3H A;  4DXB A;  2ZL1 A;  4GLQ A;  3FYZ A;  3O3V A;  5A92 A;  3QNB A;  4GZB A;  4Y2F A;  4R70 A;  1UGU A;  3MZD A;  4N1X A;  4U0X A;  3NJA A;  2J80 A;  2ZQ7 A;  1HTZ A;  1K0K A;  1D1J A;  3T1X A;  3U4L P;  3PR6 A;  2WKQ A;  2EX6 A;  4Z1W A;  3S7O A;  4DXC A;  3V67 A;  5HD5 A;  4Y5F A;  4HEF A;  1N9L A;  3S7P A;  1ONG A;  1KGG A;  5DKK A;  4E3I A;  3GVB A;  5IS1 A;  1L0G A;  4UQI S;  1XX2 A;  1MWR A;  3C2W A;  3KX0 X;  3LID A;  2BG1 A;  1YLY A;  3TJZ C;  3KSG A;  5A93 A;  1IEM A;  3KYZ A;  2HDU A;  1LL8 A;  4N9L A;  4ZJ3 A;  3LY3 A;  3Q7V B;  3VSL A;  1NYY A;  2WGW A;  3OPR A;  5J3W A;  3I7J A;  3EGD C;  3T1S A;  3FKV A;  1OJ5 A;  3MJQ A;  2QJ5 A;  3EOI A;  1IEL A;  3P98 A;  2UV0 E;  4PM8 A;  4X56 A;  4ARZ A;  1GHI A;  2H10 A;  2HDR A;  3E4P A;  4BWI A;  2JBF A;  1FR6 A;  4OQG A;  3LO7 A;  4LCM A;  5HD3 A;  2Y2I A;  3W8K A;  2HJ9 C;  5EEC A;  4JGR A;  2JCH A;  4E3M A;  3NOT C;  2ZM2 A;  4GD8 A;  4OPQ A;  2XRN A;  3VV4 A;  1NJ4 A;  1LI9 A;  3OPH A;  1H8Z A;  4ZDX A;  3LIC A;  2XF3 A;  3R7W B;  5A90 A;  4ZBE A;  4S2N A;  2R9X A;  4BBT A;  4HI4 A;  4JLF A;  2L0W A;  5FAO A;  4D60 A;  2Y2H A;  3LR3 A;  4XUZ A;  4P6B A;  2XR0 A;  4PPR A;  1BLC A;  5AQ9 A;  1LSV A;  1NRJ A;  1TDG A;  2Y2P A;  5AQB A;  2HP9 A;  5DF8 A;  3CPT B;  1XFN A;  3A3I A;  2WGI A;  3LEZ A;  1WYC A;  1W79 A;  1K55 C;  3NCK A;  4DRT A;  3HLC A;  4JGO A;  1NZU A;  5CED A;  4GD6 A;  1GHP A;  4P87 A;  4GB7 A;  2WKP A;  4ESP A;  1TD5 A;  5HAR A;  3G6O A;  3OBF A;  2O9C A;  3A3F A;  3T1R A;  1TS7 A;  3UDI A;  3T4S A;  4QU3 A;  3VE3 A;  4NXF A;  3EEA A;  4E3L A;  3Q7V A;  1VQQ A;  5G4Y A;  4Q0H A;  1YLZ A;  4JBF A;  2WAE A;  4WLA A;  5M1A A;  1V9Z A;  4EBP A;  1K54 A;  1K4E A;  3O86 A;  5FQI A;  3BW6 A;  3V50 A;  2DRW A;  1VB6 A;  1PI5 A;  3F1O B;  2PR6 A;  1L0D A;  3HJI A;  4C6Y A;  2ZMA A;  5CRF A;  1NXY A;  2Y2L A;  4CLC C;  2PYP A;  3WS0 A;  1ZC2 A;  4EEP A;  4FUW A;  3MKE A;  4CQH A;  1PFL A;  3IX3 A;  4EES A;  3PBT A;  2LB5 A;  1W8Y A;  3AGD A;  3Q7Z A;  1FSY A;  3OOV A;  2WKR A;  3MFD A;  3ZYT A;  3R7W A;  2R78 A;  5L8M A;  2W3F A;  4JXG A;  4B4Z A;  3MS6 A;  4LLO B;  1ESI A;  1W5D A;  2A49 A;  1SKF A;  1ESU A;  3UB5 P;  1JWP A;  4BL3 A;  1T19 A;  5FSR A;  4BD0 A;  3H82 B;  3BQ8 A;  4GOG A;  4B88 A;  2XEP A;  2J9O A;  3NY4 A;  1CEF A;  3C38 A;  5HL6 A;  3ITB A;  5GLD A;  3MBZ A;  5FQJ A;  2XQZ A;  1VEU B;  3CPT A;  1SDN A;  1HZO A;  5HWT A;  1KDW A;  4BL2 A;  3GR2 A;  2ZOH A;  1I2S A;  2HZ5 A;  2P9V B;  1JTG A;  4GDN A;  4CLC E;  4DE2 A;  1CI9 A;  3G2Y A;  3QP4 A;  5G4Z A;  3SZT A;  2CC1 A;  3A0R A;  1G6O A;  1H8M A;  3E98 A;  3OPP A;  1NYM A;  5FDH A;  2FFY A;  3UN7 A;  2EA9 A;  3JYI A;  1S4S A;  4N1H A;  1YMS A;  5FEG A;  1CI8 A;  2H0Y A;  2XFS A;  3PYP A;  3V3R A;  2J3T C;  3F1O A;  2VGL S;  4E3J A;  4HH2 A;  4WL9 A;  5HWV A;  4R38 A;  4KZB A;  2VA0 A;  5HDC A;  5GHX A;  4DE1 A;  4YFM A;  4JXV A;  4EQI A;  3UMD A;  4LGW A;  1ERQ A;  3ZGA B;  3ZFZ A;  1ERO A;  4WZ5 C;  3A3J A;  3BFE A;  1WA9 A;  1LSX A;  4S2P A;  5KSC A;  1ES2 A;  3K2N A;  3E4O A;  2WAD A;  4UAA A;  3V39 A;  2XLN A;  1PI4 A;  2XA7 M;  1SHV A;  3PTE A;  2PBD P;  1GA0 A;  3N8S A;  2QKP A;  3H82 A;  3W4P A;  4FOF A;  1MWT A;  2WYX A;  1VM1 A;  5GLC A;  2HDQ A;  1DRM A;  1S66 L;  1VEU A;  4EER A;  1BSG A;  4X68 A;  3ZG7 B;  4OQH A;  2M7U A;  1O07 A;  3ZHH A;  3UPP A;  5J4E A;  2P9V A;  4R23 A;  2D02 A;  4R3J A;  2Y91 A;  3IX8 A;  4R3A A;  1OJG A;  2K31 A;  1ES4 A;  1BLH A;  3N8L A;  4S2N C;  3B47 A;  4OLD A;  5GL9 A;  5M18 A;  3UE1 A;  4HJ3 A;  2LB9 A;  3ZG8 B;  3GSG A;  5HAI A;  3FG8 A;  4NEE D;  2A2L A;  3S7N A;  3QP6 A;  1TS6 A;  4BJP A;  5C5K A;  4M3K A;  1FQG A;  4AFI A;  4GHI B;  4S2I A;  3C7V A;  4LRY C;  4IBR A;  5HX9 A;  1FCM A;  1P9W A;  2XH9 A;  5DF7 A;  1M40 A;  1YLJ A;  3MXS A;  1XXM A;  2DMW A;  1Z6F A;  1DP9 A;  4KG6 A;  5GLA A;  1ZKJ A;  1YT4 A;  5CHU A;  3PBN A;  3DTM A;  1Q2P A;  3KSH A;  3K3D A;  3UDF A;  4RX3 A;  3AGF A;  1BTL A;  3JVV A;  3S1Y A;  1S6R A;  4K0W A;  4GKU A;  2KOI A;  3BEC A;  2OV5 A;  3RFB A;  5HZH A;  1WYB A;  5EPH A;  4YNR A;  5HPI A;  1W63 Q;  1K54 C;  4O01 A;  2PT7 A;  4JKT A;  4LV1 A;  3NEC A;  4JXW A;  2O9A A;  2E8J A;  4OOM A;  1OTI A;  5K5B A;  1FCN A;  2NUT C;  3TE8 A;  3BFF A;  3OPL A;  3MFX A;  2OAQ 1;  3VE4 A;  1D7E A;  3L7H A;  4F94 A;  2M1C A;  5DTT A;  1RP5 A;  3G4P A;  1YAX A;  2CMN A;  4MEZ A;  2Y59 A;  5CXW A;  1MC0 A;  2OWJ A;  5CTM A;  4L0L A;  4DE0 A;  3D3O A;  4DJ2 A;  1L3L A;  3B33 A;  2WK0 A;  4WEL A;  2W1T B;  5CGX A;  5TR7 A;  3S7Q A;  2Q0O A;  3UB7 A;  2EX9 A;  3VOL A;  5CGS A;  3ICY A;  5FL3 A;  3NUL A;  4UA9 A;  3SH8 A;  4KG5 A;  4BQM A;  1Y54 A;  1FOF A;  2W3G A;  3CHW P;  5DKL A;  1A0K A;  4CLC D;  4GHI A;  3LYX A;  4BLM A;  3BRM A;  2VGJ A;  2DNS A;  2AVX A;  1DP6 A;  3QP2 A;  1KOU A;  2WZZ A;  1MWU A;  1KVM A;  1N9N A;  2KDK A;  5EOE A;  3OC2 A;  2QPN A;  4HH3 A;  4HNB A;  3UE0 A;  3IH9 A;  1JTD A;  3C4O A;  4CPK A;  5KZH A;  5TBM B;  5EE8 A;  2W0N A;  4X53 A;  1E25 A;  1YQS A;  3N8R A;  2A3U A;  5TJJ A;  3SS3 A;  2XD5 A;  5FDS A;  1PZP A;  3QHY A;  3ZNT A;  3ULF A;  4GJ4 A;  5HFO A;  4U3T A;  4OPZ A;  1S1Y A;  4R1G A;  4QWO A;  4OPR A;  2ZM8 A;  1K6S A;  3SS4 A;  4ZRR A;  2V9A A;  1WE4 A;  3O88 A;  3IXG A;  1GA9 A;  2HGV A;  4KUK A;  4KZ6 A;  4IVK A;  4S2L A;  3ZDJ A;  4RVA A;  2VX8 A;  4U0T A;  2W1T A;  5E43 A;  2QZ6 A;  4DJ3 A;  1DJB A;  2J3T D;  1D06 A;  2VZW A;  3A3E A;  4I38 A;  4I3A A;  3MSH A;  4HP4 A;  4Y13 A;  4WZ5 A;  1ACF A;  4EEU A;  1PWG A;  1ALQ A;  2EXB A;  1KGF A;  1JWZ A;  1CF0 A;  4IJG A;  4GNU A;  1F5M A;  4F3L B;  4FSF A;  1IYQ A;  2JKF A;  1HVB A;  4QD4 A;  2OOL A;  4LCL A;  4Y0O A;  5TBM A;  3IF6 B;  1M6K A;  2ZOI A;  1XJ2 A;  1F9I A;  3MZE A;  3CIT A;  2Y79 A;  3FPV A;  5AJG A;  2JC7 A;  4QY5 A;  1KE3 A;  3DBA A;  2E8I A;  2Y8H A;  3QP1 A;  2W3D A;  2GJ3 A;  4EW7 A;  5DTK A;  1PWD A;  1P97 A;  4X25 A;  3U2A A;  4LV2 A;  2HJE A;  2ZQC A;  1TDL A;  4IUH A;  2ZLY A;  3BYD A;  4S2M A;  3T4L A;  4OOY A;  3V5M A;  3W4Q A;  3MQQ A;  2ZMV A;  3QP8 A;  4R0Q A;  3NOP C;  5HW3 A;  4EBN A;  3CLO A;  4X1M A;  4QPR A;  4NK3 A;  4FD8 A;  1IYO A;  4P6Z M;  3H7W B;  1FCO A;  5D3O A;  3HLF A;  4WN5 A;  3HUO A;  4LEN A;  4X1L A;  3T4Q A;  3DW0 A;  4WBG A;  5EUA A;  4LPZ A;  4MN6 A;  5HAQ A;  4Y0T A;  3LIF A;  5IHV A;  1LHY A;  1L0F A;  3T12 B;  5KSH A;  3T4T A;  5IU1 A;  4ZTK A;  4NXG A;  3LR0 A;  2QHK A;  3A3D A;  3UNW A;  3HLG A;  1KVL A;  2A24 B;  2Z2M B;  1ODV A;  3IQA A;  5L10 A;  1KGE A;  2PBY A;  4QHC A;  4KEN B;  2O0Y A;  3C5A A;  3P7N A;  4HJ4 A;  3MXR A;  2ZC7 A;  2IWC A;  4JGQ A;  1KDS A;  2V8C A;  1C3B A;  3B42 A;  5EVE A;  3CMZ A;  4F3L A;  4XUX A;  3UPO A;  3T4K A;  1OME A;  1MBL A;  3IF6 A;  3NOU C;  4KZ5 A;  4C3Q A;  1MXO A;  2BTF P;  3HLD A;  3BWL A;  1NY0 A;  2D01 A;  4HBU A;  4PM5 A;  3SW1 A;  1U60 A;  2GNX A;  4S2O A;  4GS9 B;  4GDB A;  1BUL A;  2Z6C A;  4H6J B;  2P7J A;  3C4P A;  3ZNY A;  1IOU A;  2K2N A;  2QMI A;  2V8F A;  3IWO A;  4HBT A;  5HDD A;  2GX5 A;  4NKP A;  3CI6 A;  4FH2 A;  1ES5 A;  3A0S A;  4ETZ A;  2MJ6 A;  4XXR A;  5I5L A;  2Y2J A;  3Q1F A;  3O5Y A;  2PD8 A;  1NWZ A;  4HQA A;  1CQA A;  1K56 A;  2XK1 A;  3H7W A;  5IT5 A;  2ZQ8 A;  4DE3 A;  4K0X A;  4Q8I A;  2JN7 A;  3IWI A;  4JPM A;  5U47 A;  3PBR A;  2P04 A;  1STZ A;  1N4O A;  1F98 A;  2VV8 A;  3MQO A;  3K3C A;  3T1Q B;  1S4R A;  3E4Q A;  2YKF A;  3MKF A;  2Q9M A;  2A24 A;  4I3J A;  1YPR A;  2XA7 S;  3IWQ A;  2JKT M;  4HJ6 A;  4KQO A;  3M6B A;  2PU4 A;  1BT5 A;  3MXQ A;  4X6T A;  1H3Q A;  4FH4 A;  4Q0I A;  4RA7 A;  4CJN A;  1ES3 A;  4WZ4 A;  3LUQ A;  1IFQ A;  5DVA A;  2ZQ9 A;  4R6L A;  5HL1 A;  5F1G A;  1TEM A;  4N92 A;  3HLE A;  3G35 A;  1K4F A;  4G3W A;  1JWV A;  2VV6 A;  3EEH A;  5AVF A;  5EVL A;  1KE4 A;  5EVI B;  1BLS A;  1YLP A;  3HLW A;  1Z09 A;  3WRZ A;  3KYE A;  4MBH A;  4HHD A;  4GS9 A;  1DY6 A;  4JF5 A;  4H6J A;  1N9B A;  2WZX A;  4OKP A;  5KIZ A;  2WUQ A;  4LFU A;  2Q9N A;  4NXB A;  5FAP A;  4OOL A;  4WUJ A;  3FV7 A;  5DF9 A;  2X01 A;  1E3U A;  2I72 A;  2IWD A;  5A91 A;  1RGZ A;  2XGN A;  4KZ8 A;  2G2W A;  3VP2 A;  5F68 A;  3ZVW A;  4MNR A;  2WKE A;  1MY8 A;  4X69 A;  2EXA A;  1PWC A;  3LIA A;  3R4K A;  4OH0 A;  4NXE A;  2ZQA A;  3LI9 A;  3DWZ A;  1N9O A;  4C75 A;  1L0E A;  3NHQ A;  2IWB A;  5CGW A;  4QJG A;  2P08 A;  3BFD A;  3WS2 A;  5AQ7 A;  3Q81 A;  4MN7 A;  5E2G A;  3HUN A;  3VMA A;  1W8Q A;  3GTC A;  4K91 A;  5E2H A;  2O9B A;  3LGO A;  1XJ6 A;  4L9E A;  1O7E A;  5HSQ A;  1HD8 A;  3CWF A;  3CZD A;  3MZF A;  1GSX A;  2UWX A;  3D9Y A;  3GV9 A;  1G68 A;  3KSI A;  1NLY A;  3G31 A;  2Y2Q A;  4DMZ A;  2WKH A;  1P9R A;  2HF6 A;  5EVI A;  2ZQD A;  5HAP A;  1Y4O A;  5HPF A;  5FQQ A;  2KLI A;  4E6W A;  3DWK A;  5HDS A;  2OAP 1;  4P0M A;  4WMC A;  4Y3I A;  2RCX A;  3FKW A;  3UME A;  4GW9 A;  5FQM A;  5DFX A;  1JNU A;  1RGY A;  1BLP A;  4OON A;  2EX8 A;  3NBL A;  4WMC D;  4JXS A;  4I39 A;  4OLG A;  3VP3 A;  3FWL A;  1W7F A;  3PXP A;  2X71 A;  3KYQ A;  4H8R A;  1VET B;  1OPX A;  2C5W B;  4Y15 A;  2B02 A;  3UPN A;  3HUM A;  4R4R A;  1FSW A;  2V0U A;  2EWV A;  3IF6 C;  3DTE A;  5FAQ A;  2ZMF A;  2EWW A;  4Y0U A;  3IX4 A;  3RH8 B;  2H28 A;  2XFT A;  5FA7 A;  1YLW A;  5CEB A;  1ZG4 A;  4ZJ1 A;  5AQA A;  2ZC5 B;  4LV3 A;  2L4R A;  3BEB A;  3T4O A;  3UE6 A;  3F1N B;  4DDY A;  1KE0 A;  4G3K A;  1UWP X;  2VLG A;  1PRQ A;  5F69 A;  4KZA A;  3HJK A;  5F82 A;  1S67 L;  1DJC A;  2J3W A;  5JYO A;  4KQR A;  3IH8 A;  3UDX A;  3FC7 A;  3W4O A;  2OLU A;  4E6X A;  3LEQ A;  3KO6 A;  2VKS A;  4MDZ A;  3PAE A;  5DJT A;  4G3V A;  5FI6 A;  1E4D A;  3IXD A;  3L9K A;  4S2J A;  5EV0 A;  4EXO A;  3TG9 A;  2JKG A;  3RJU A;  1XGJ A;  1BYW A;  5FI7 A;  2PYR A;  3WS5 A;  3MQ0 A;  5TFQ A;  5FAS A;  4IVI A;  1TS0 A;  4NG2 A;  1VET A;  1I5Q A;  3WS1 A;  1NLZ A;  4OQI A;  3HCY A;  4IED A;  3A0V A;  3RXX A;  4MBK A;  1Q2Q A;  4HOI A;  4OPY A;  3T4J A;  3JVU A;  5LBR A;  3BFG A;  5L09 A;  5E2E A;  2KX6 A;  1LL5 A;  4E3K A;  2HP5 A;  3NC8 A;  1YSP A;  3Q07 A;  4PHT A;  4KG2 A;  1F2K A;  1UWN X;  1NZO A;  1EWZ A;  3F1N A;  1YKD A;  1YSQ A;  2B5R A;  2P74 A;  3E2L A;  2Y55 A;  4R4S A;  4KZ3 A;  2V20 A;  4RQ9 A;  1J3W A;  4Q0J A;  3ZCZ A;  1T1A A;  4BD1 A;  2G7U A;  2PR5 A;  2V1B A;  1FIK A;  3HL9 A;  3D72 A;  1I2W A;  3PBO A;  3LIE A;  4OQ0 A;  4JF6 A;  5G18 A;  4PKY G;  4MCW A;  4KQQ A;  5CX7 A;  5F83 A;  2Y4A A;  4P6Z S;  3OZH A;  4I5S A;  3CUE A;  4KZ9 A;  1DP8 A;  2QJ7 A;  2ZBB A;  2EFX A;  3MMH A;  3LFV A;  2XSS A;  3VSK A;  3E0Y A;  3GQZ A;  3RTY A;  3GEC A;  3TSG A;  4LRZ E;  2OSU A;  2OWH A;  1DJA A;  3UO9 A;  1XJ4 A;  3VP1 A;  3TW8 A;  4HIA A;  1PW1 A;  1TVF A;  1V9Y A;  3M2J A;  1PNE A;  1CJF A;  3N4I A;  5EVI C;  1IYP A;  4WM9 A;  3NDG A;  5EM1 A;  4FTX A;  4UQI M;  1GSV A;  2PAV P;  3B3X A;  4KZ4 A;  1LL9 A;  4WEK A;  3SOI A;  4DDS A;  4Y17 A;  5GHZ A;  4ME4 A;  4IUK A;  1OT9 A;  3F1P B;  3SH9 A;  1RCJ A;  3IBJ A;  4EV4 A;  4ZJ2 A;  1MZU A;  3RXW A;  2J8Y A;  4WEJ A;  3H9W A;  5CER A;  1L2S A;  3BQA A;  3ZG0 A;  4RYE A;  3PHY A;  4HES A;  4QY6 A;  1K57 A;  1PW8 A;  4L9G A;  1LLB A;  3QP5 A;  2PD7 A;  4K08 A;  3NDE A;  2V1A A;  2V1Z A;  2W27 A;  2GZA A;  4O7D A;  2Y2G A;  4BBV A;  3V3S A;  4I3I A;  3NIA A;  2PHY A;  1CK3 A;  1GSW A;  4X55 A;  1QMF A;  1P0Z A;  4B4X A;  3TRC A;  4O8G A;  4B9O A;  4ZAM A;  3GRJ A;  3FPW A;  5CHJ A;  1K25 A;  5F6A A;  4JGP A;  2J9P A;  2QYB A;  1XPB A;  4N9K A;  2RL3 A;  3HRE A;  3N7W A;  4EU0 A;  1BZA A;  3FZC A;  4E3N A;  1YMX A;  1J9M A;  1G6A A;  1OTB A;  4GCZ A;  2M7V A;  3WWX A;  1SCW A;  4QB8 A;  3LY4 A;  5EOO A;  3LR4 A;  3UE3 A;  4M4X A;  1PZO A;  2ZJ9 A;  4S2K A;  2Y2K A;  2ACG A;  1LSW A;  2WKI A;  2JHE A;  2JKR M;  4HY8 A;  4EET B;  2NUP C;  3E2K A;  3C7U A;  2FH5 A;  3PBQ A;  3D4F A;  1IKG A;  1LT0 A;  2Y2O A;  3UY6 A;  3LCE A;  2JKR I;  5FQK A;  2X02 A;  2V2F F;  3F1P A;  3EWK A;  1SKO B;  2GDN A;  4B93 A;  1ZTU A;  3G32 A;  4UEY A;  1YLT A;  1SZV A;  3NI9 A;  4EBL A;  1G5U A;  2Y2N A;  1K56 D;  2PRF A;  3PBS A;  3VOY A;  3CJM A;  3QNC A;  3SH7 A;  5EFW A;  1FIL A;  4L9F A;  2FFF B;  1XGI A;  4EQ1 A;  1X0O A;  4ETX A;  3DTI A;  4IHQ A;  3VP4 A;  1TF1 A;  1OTD A;  4UA7 A;  3O87 A;  5DTS A;  3MF0 A;  1FR1 A;  1EI5 A;  3MR0 A;  3W2Z A;  5FEF A;  1TS8 A;  4KQD A;  3EQV A;  3ITA A;  2EFU A;  2JKT I;  3EGX C;  3HLB A;  4YIN A;  2L1M A;  5DFY A;  1OT6 A;  3BY9 A;  3OCN A;  3VP0 A;  5KMW A;  4UHU A;  2VJW A;  2JE5 A;  4PKY A;  4EUV A;  4GN2 A;  5J7E A;  2VGK A;  5I94 A;  1BUE A;  1S1Z A;  4MBF A;  2ZM0 A;  3VFH A;  3UB9 A;  1IYS A;  4MMN A;  3IXH A;  1T1C A;  1GHM A;  3BY8 A;  3BFC A;  4LRX C;  3CAX A;  2ZC4 B;  1G28 A;  4YOF A;  4EWF A;  4DF6 A;  2B18 A;  5DJU A;  3G30 A;  2W1R A;  3IHB A;  3CUE C;  5CTN A;  3KSF A;  3CG5 A;  2I9V A;  3C30 A;  3Q82 A;  3BJN A; 
#chains in the Genus database with same CATH homology
 1E3U D;  3BEB A;  1PI5 A;  4WZ5 A;  2R9W A;  5J8X A;  1L0D A;  4DDY A;  1KE0 A;  4C6Y A;  3ZG9 B;  4PM9 A;  2ZMA A;  5BOH A;  2G2U A;  1PWG A;  1LI0 A;  4RX2 A;  5CRF A;  1NXY A;  1ALQ A;  2HPB A;  2Y2L A;  4KZA A;  5L2F A;  2EXB A;  1KGF A;  1JWZ A;  3WS0 A;  1ZC2 A;  5F82 A;  1DJC A;  5JYO A;  1MWS A;  3ZVT A;  4GNU A;  3MKE A;  4NET A;  4PM6 A;  4FSF A;  4Z9Q A;  1IYQ A;  4KQR A;  2HP6 A;  3IH8 A;  3PBT A;  1HVB A;  1W8Y A;  4QD4 A;  3UDX A;  4LCL A;  4Y0O A;  5FAT A;  3AGD A;  3Q7Z A;  1AXB A;  1FSY A;  3IF6 B;  1M6K A;  3MFD A;  3W4O A;  5CEC A;  2OLU A;  4E6X A;  4JXG A;  4B4Z A;  3MZE A;  2XDM A;  2ZC6 B;  1ESI A;  1W5D A;  2A49 A;  3IHA A;  1SKF A;  3PAE A;  2EX2 A;  3TOI A;  1ESU A;  2JC7 A;  4QY5 A;  1JWP A;  1KE3 A;  4ID4 A;  4BL3 A;  2E8I A;  5FSR A;  5FI6 A;  1E4D A;  1YM1 A;  4BD0 A;  3IXD A;  4GOG A;  4B88 A;  2XEP A;  2J9O A;  4S2J A;  5DTK A;  3TG9 A;  3NY4 A;  1PWD A;  4IBX A;  5GHY A;  3RJU A;  1SDE A;  1XGJ A;  1CEF A;  4Y7P A;  5FI7 A;  4LV2 A;  3ITB A;  5GLD A;  3MBZ A;  2ZQC A;  3WS5 A;  1TDL A;  5FQJ A;  2XQZ A;  2ZLY A;  2HDS A;  1IKI A;  3BYD A;  1SDN A;  5TFQ A;  4P85 A;  1HZO A;  5FAS A;  4S2M A;  1KDW A;  4UA6 A;  4OOY A;  4BL2 A;  3V5M A;  3W4Q A;  4IVI A;  3IT9 A;  4PM7 A;  1XP4 A;  3GR2 A;  3ISG A;  4R0Q A;  1K57 C;  1I2S A;  5HW3 A;  4EBN A;  5GLB A;  1I5Q A;  2P9V B;  4EUZ A;  1JTG A;  3M2K A;  3BLS A;  4GDN A;  3WS1 A;  4DE2 A;  5EVI D;  1CEG A;  2H5S A;  1CI9 A;  2BLS A;  3G2Y A;  4NK3 A;  4FD8 A;  1IYO A;  4OQI A;  4IED A;  1FCO A;  2ZD8 A;  5D3O A;  3RXX A;  3IF5 A;  3HLF A;  4MBK A;  1Q2Q A;  3HUO A;  4LEN A;  3DW0 A;  4OPY A;  4WBG A;  5EUA A;  3BFG A;  5HAQ A;  2CC1 A;  4Y0T A;  3OPP A;  5IHV A;  5E2E A;  1LHY A;  1L0F A;  1LL5 A;  2HP5 A;  3NC8 A;  1NYM A;  4E3K A;  5FDH A;  1XA7 A;  2FFY A;  1XA1 A;  2Y2M A;  3UN7 A;  3JYI A;  3Q07 A;  2WGV A;  2WAF A;  4WYY A;  4MLL A;  1PYY A;  5KSH A;  1MKI A;  4N1H A;  4ZTK A;  1YMS A;  1CI8 A;  2H0Y A;  4KG2 A;  3A3D A;  2XFS A;  3UNW A;  5FI2 A;  3WS4 A;  3HLG A;  1KVL A;  2Z2M B;  3V3R A;  4KZ7 A;  1NZO A;  3IQA A;  1EWZ A;  3WRT A;  1KGE A;  2PBY A;  2XD1 A;  4KEN B;  4QHC A;  2B5R A;  2P74 A;  3E2L A;  4E3J A;  5CED A;  1K6R A;  2Y55 A;  3C5A A;  4R4S A;  4KZB A;  4KZ3 A;  3MXR A;  2ZC7 A;  2V20 A;  1ONH A;  2IWC A;  1MPL A;  1KDS A;  4A5R A;  5GHX A;  3ZCZ A;  4DE1 A;  1C3B A;  3VOZ A;  2ZC3 B;  3PAG A;  2PU2 A;  4YFM A;  1GCE A;  4JXV A;  3S4X A;  1K55 A;  3CMZ A;  4PMA A;  4EQI A;  4BD1 A;  4OP8 A;  4XUX A;  3UPO A;  2OLV A;  3G34 A;  3BLM A;  1OME A;  3HL9 A;  1ERQ A;  3ZGA B;  3ZFZ A;  1ERO A;  4WZ5 C;  1H5X A;  3A3J A;  1MBL A;  5M19 A;  3BFE A;  1I2W A;  3IF6 A;  4D2O A;  3PBO A;  3VFF A;  4OQ0 A;  4KZ5 A;  3SS5 A;  4JF6 A;  4C3Q A;  1MXO A;  3HLD A;  1K38 A;  4S2P A;  5G18 A;  5KSC A;  1ES2 A;  1NY0 A;  2Z2L B;  2WAD A;  4HBU A;  3AGE A;  4UAA A;  4PM5 A;  3V39 A;  2XLN A;  1PI4 A;  1SHV A;  3PTE A;  1U60 A;  1PIO A;  4S2O A;  4KQQ A;  5E2F A;  4GDB A;  1GA0 A;  3N8S A;  1BUL A;  3W4P A;  5F83 A;  2Y4A A;  3C4P A;  3ZNY A;  3OZH A;  1H8Y A;  3EQU A;  4KZ9 A;  2QMI A;  1NRF A;  1MWT A;  3IWO A;  4HBT A;  2WYX A;  1VM1 A;  3P09 A;  2EFX A;  5GLC A;  2HDQ A;  1ZG6 A;  3HVF A;  2DCF A;  4FH2 A;  3VSK A;  1ES5 A;  1ERM A;  3S22 A;  3GQZ A;  1BSG A;  4X68 A;  4XXR A;  3ZG7 B;  4OQH A;  2Y2J A;  3Q1F A;  5TGF A;  4JF4 A;  5F1F A;  3TSG A;  1O07 A;  2OSU A;  3ZHH A;  3UPP A;  3ZG5 A;  4DKI A;  1DJA A;  2P9V A;  3HBR A;  4R23 A;  4R3J A;  3UO9 A;  2Y91 A;  3VP1 A;  1K56 A;  2XK1 A;  4LV0 A;  2C6W B;  1PW1 A;  5CHM A;  1TVF A;  2ZQ8 A;  4DE3 A;  4K0X A;  3M2J A;  1ES4 A;  1BLH A;  3N8L A;  4S2N C;  4Q8I A;  4OLD A;  5GL9 A;  3N4I A;  5M18 A;  1JVJ A;  3IWI A;  5EVI C;  1XKZ A;  2WGW B;  4BEN A;  3UE1 A;  4JPM A;  1IYP A;  5U47 A;  4WM9 A;  3NDG A;  3BM6 A;  3N6I A;  3PBR A;  3ZG8 B;  4E3O A;  3GSG A;  1QME A;  5HAI A;  1N4O A;  2H0T A;  3G2Z A;  5JYP A;  4BJP A;  3B3X A;  4KZ4 A;  1LL9 A;  3OCL A;  4WEK A;  3SOI A;  4DDS A;  5GHZ A;  5FQ9 A;  3MKF A;  1FQG A;  4M3K A;  2Q9M A;  3SH9 A;  1RCJ A;  4S2I A;  3IWQ A;  4EV4 A;  4KQO A;  4ZJ2 A;  3GMW A;  3IXB A;  3M6B A;  2PU4 A;  1BT5 A;  4OVD A;  3C7V A;  3RXW A;  4X6T A;  2J8Y A;  4IBR A;  4WEJ A;  5HX9 A;  1FCM A;  4FH4 A;  2XH9 A;  5CER A;  1L2S A;  4OP5 A;  3ZG0 A;  5DF7 A;  1M40 A;  3M6H A;  1YLJ A;  3MXS A;  4HES A;  4RA7 A;  4RYE A;  4R3B A;  4CJN A;  4QY6 A;  1ES3 A;  1XXM A;  4WZ4 A;  4FCF A;  2J7V A;  1S0W A;  1K57 A;  1PW8 A;  1Z6F A;  4KG6 A;  5GLA A;  4DXB A;  1ZKJ A;  5DVA A;  2ZQ9 A;  1YT4 A;  5CHU A;  1LLB A;  3PBN A;  3DTM A;  3FYZ A;  5HL1 A;  5F1G A;  1Q2P A;  3NDE A;  3O3V A;  3UDF A;  5A92 A;  2V1Z A;  3QNB A;  1TEM A;  4GZB A;  2Y2G A;  4O7D A;  4N92 A;  3HLE A;  3V3S A;  3NIA A;  3G35 A;  1K4F A;  3MZD A;  4N1X A;  4RX3 A;  1JWV A;  3AGF A;  1BTL A;  4U0X A;  1CK3 A;  2ZQ7 A;  5EVL A;  3S1Y A;  1KE4 A;  1HTZ A;  1S6R A;  4K0W A;  1QMF A;  4X55 A;  4GKU A;  5EVI B;  1BLS A;  1YLP A;  3BEC A;  2OV5 A;  3HLW A;  4B4X A;  3WRZ A;  1WYB A;  4MBH A;  5EPH A;  2EX6 A;  1DY6 A;  4JF5 A;  4ZAM A;  1K54 C;  3GRJ A;  1N9B A;  2WZX A;  4OKP A;  4DXC A;  2WUQ A;  4JKT A;  5CHJ A;  1K25 A;  4HEF A;  4LV1 A;  1ONG A;  2Q9N A;  2J9P A;  1KGG A;  4JXW A;  4OOM A;  5FAP A;  1FCN A;  1XPB A;  4N9K A;  2RL3 A;  3BFF A;  3HRE A;  3OPL A;  4E3I A;  3GVB A;  3N7W A;  4OOL A;  1BZA A;  3FZC A;  1L0G A;  3FV7 A;  4F94 A;  4E3N A;  1XX2 A;  1MWR A;  1YMX A;  5DF9 A;  5DTT A;  2X01 A;  1RP5 A;  3G4P A;  4MEZ A;  1J9M A;  2Y59 A;  1E3U A;  5CXW A;  2BG1 A;  1G6A A;  1YLY A;  2I72 A;  2IWD A;  5A91 A;  3WWX A;  1SCW A;  5CTM A;  1RGZ A;  4QB8 A;  3LY4 A;  4L0L A;  5A93 A;  4DE0 A;  2XGN A;  4KZ8 A;  2G2W A;  3VP2 A;  1IEM A;  5EOO A;  3UE3 A;  3ZVW A;  2HDU A;  1PZO A;  2ZJ9 A;  4MNR A;  2WKE A;  4S2K A;  2WK0 A;  1MY8 A;  4N9L A;  4ZJ3 A;  4X69 A;  2Y2K A;  4WEL A;  5TR7 A;  5CGX A;  2EXA A;  3LY3 A;  3Q7V B;  1PWC A;  4OH0 A;  2WKI A;  3VSL A;  1NYY A;  2WGW A;  3OPR A;  3I7J A;  2EX9 A;  2ZQA A;  3E2K A;  3FKV A;  3C7U A;  3PBQ A;  5CGS A;  3D4F A;  3DWZ A;  1IEL A;  4UA9 A;  3SH8 A;  1IKG A;  3P98 A;  1L0E A;  4PM8 A;  2IWB A;  4C75 A;  4KG5 A;  2Y2O A;  4X56 A;  3UY6 A;  4BQM A;  5CGW A;  1GHI A;  1Y54 A;  1FOF A;  2H10 A;  2HDR A;  4QJG A;  3BFD A;  3WS2 A;  3LCE A;  5AQ7 A;  5FQK A;  2X02 A;  2JBF A;  2V2F F;  3Q81 A;  1FR6 A;  4OQG A;  4BLM A;  2GDN A;  5E2G A;  3HUN A;  3LO7 A;  3VMA A;  4LCM A;  3BRM A;  1W8Q A;  3GTC A;  3G32 A;  4K91 A;  5E2H A;  2Y2I A;  2VGJ A;  1YLT A;  1O7E A;  3NI9 A;  3W8K A;  2DNS A;  4EBL A;  5EEC A;  2Y2N A;  1K56 D;  3PBS A;  2JCH A;  3VOY A;  4E3M A;  1HD8 A;  2WZZ A;  1MWU A;  3CZD A;  3MZF A;  1KVM A;  2ZM2 A;  3CJM A;  4GD8 A;  4OPQ A;  2UWX A;  1NJ4 A;  3QNC A;  3SH7 A;  5EOE A;  3OC2 A;  2QPN A;  1LI9 A;  2FFF B;  3UE0 A;  1XGI A;  3IH9 A;  3OPH A;  3GV9 A;  1G68 A;  1JTD A;  3C4O A;  4CPK A;  5KZH A;  1H8Z A;  3G31 A;  4ZDX A;  2Y2Q A;  5EE8 A;  2XF3 A;  3VP4 A;  5A90 A;  4X53 A;  1E25 A;  1YQS A;  3N8R A;  4ZBE A;  2WKH A;  4UA7 A;  4S2N A;  2R9X A;  3O87 A;  5DTS A;  2A3U A;  5EVI A;  4JLF A;  1FR1 A;  1EI5 A;  2ZQD A;  5FAO A;  2XD5 A;  3SS3 A;  5HAP A;  5FQQ A;  3EQV A;  3ITA A;  2Y2H A;  4E6W A;  2EFU A;  3DWK A;  4XUZ A;  4P0M A;  3HLB A;  4P6B A;  1PZP A;  4YIN A;  3QHY A;  4WMC A;  2RCX A;  2XR0 A;  3FKW A;  5FQM A;  3ZNT A;  4PPR A;  1BLC A;  1RGY A;  5AQ9 A;  1TDG A;  3OCN A;  3VP0 A;  2Y2P A;  1BLP A;  4OON A;  5AQB A;  5HFO A;  2HP9 A;  4U3T A;  4OPZ A;  5DF8 A;  4UHU A;  5KMW A;  2EX8 A;  3NBL A;  4R1G A;  4WMC D;  3A3I A;  4OPR A;  4JXS A;  4OLG A;  2ZM8 A;  2JE5 A;  2WGI A;  3LEZ A;  1K6S A;  3FWL A;  4GN2 A;  1W7F A;  3SS4 A;  3VP3 A;  1WYC A;  2VGK A;  1W79 A;  5I94 A;  2X71 A;  1K55 C;  4H8R A;  3NCK A;  4DRT A;  1BUE A;  1WE4 A;  2C5W B;  3HLC A;  1NZU A;  4MBF A;  4GD6 A;  1GHP A;  2ZM0 A;  4GB7 A;  4P87 A;  3UPN A;  5HAR A;  3VFH A;  3O88 A;  3HUM A;  3IXG A;  4R4R A;  1FSW A;  1GA9 A;  1IYS A;  3IXH A;  4KZ6 A;  3A3F A;  4IVK A;  3IF6 C;  4S2L A;  3ZDJ A;  1GHM A;  3UDI A;  4RVA A;  4QU3 A;  3BFC A;  4E3L A;  4U0T A;  3Q7V A;  5E43 A;  5FAQ A;  1VQQ A;  2ZC4 B;  2QZ6 A;  4Y0U A;  1YLZ A;  4JBF A;  1DJB A;  4EWF A;  4DF6 A;  2WAE A;  2XFT A;  3G30 A;  5M1A A;  5FA7 A;  1YLW A;  5CEB A;  3A3E A;  3IHB A;  1ZG4 A;  4EBP A;  1K54 A;  5CTN A;  4ZJ1 A;  1K4E A;  3O86 A;  5AQA A;  5FQI A;  3CG5 A;  3V50 A;  2ZC5 B;  4LV3 A;  3Q82 A;  2DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...