1DY6A

Structure of the imipenem-hydrolyzing beta-lactamase sme-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
267
Chain Sequence
NKSDAAAKQIKKLEEDFDGRIGVFAIDTGSGNTFGYRSDERFPLCSSFKGFLAAAVLERVQQKKLDINQKVKYESRDLEYHSPITTKYKGSGMTLGDMASAALQYSDNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWELELNTAIPGDKRDTSTPKAVANSLNKLALGNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIWPKNRAPLIVSIYTTRKSKDDKHSDKTIAEASRIAIQAID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Imipenem-Hydrolyzing Class a Beta-Lactamase Sme-1 from Serratia Marcescens.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
total genus 98
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1dy6A00
2ZQ9A 1PW1A 5GLBA 4KZ6A 1YM1A 1BZAA 4WEJA 5GLAA 4E3LA 1NXYA 4N92A 4GN2A 4QY5A 5CRFA 3SH7A 2IWCA 3G31A 3OPLA 1MXOA 4RX3A 3E2KA 4E3OA 3C4OA 4MBKA 1YLTA 1NZOA 3VMAA 4OKPA 1XGIA 2J9PA 4FCFA 3UPOA 4F94A 5DTKA 4U0TA 1KVLA 4WZ5C 4N9LA 4BQMA 2V20A 4C6YA 1FSWA 5CHJA 3ITAA 1XGJA 4OPYA 1H8ZA 3HBRA 1E25A 5BOHA 3PBQA 4HEFA 1CI8A 4N9KA 1JWZA 2V1ZA 4ZTKA 2H5SA 1EWZA 3V50A 1HTZA 1VQQA 3SOIA 5HL1A 1KE4A 3PBRA 5FAOA 3IF5A 2HDRA 1NJ4A 5E43A 5HFOA 3MXSA 4IEDA 3S4XA 2Q9MA 5CERA 4KZ3A 2ZC5B 4OONA 5EVIB 3UDIA 5HX9A 1WYBA 1E4DA 2ZJ9A 4XUZA 3Q81A 3GTCA 1K55A 2UWXA 1JWVA 3IXDA 4O7DA 3VP0A 2R9WA 3SS3A 1S6RA 1YLYA 3Q7ZA 2GDNA 4GDNA 1PWDA 1Q2QA 3QNBA 4LENA 3IF6B 1BLHA 3UDFA 4E3JA 4FD8A 1HVBA 2PBYA 2A49A 5A90A 1GHMA 4WM9A 1BLSA 1W7FA 1GHPA 5F82A 4BD1A 3VFFA 5I94A 4R1GA 1H8YA 1ERQA 1FCNA 2Y59A 4OOLA 4X68A 2IWBA 2V2FF 1ONHA 1ALQA 3VOZA 1NYYA 5FI7A 3SS5A 4S2OA 5KZHA 1YMXA 3LCEA 2PU2A 3FWLA 3MKFA 3UNWA 4P87A 2HP9A 4Y0UA 1RCJA 2H0YA 5L2FA 5KMWA 1K57C 3MFDA 4FH4A 5FI6A 1E3UD 3A3IA 4QY6A 1DY6A 3EQVA 1QMEA 4E3MA 2ZQCA 1W8QA 4DE0A 5J8XA 2Y4AA 3VSKA 4EQIA 3IXGA 4KZ7A 5FSRA 3M6HA 4JXVA 4PPRA 4QD4A 5FQKA 2ZQ8A 3GMWA 3PBSA 1BLPA 1Q2PA 1MY8A 2Y91A 5EE8A 1O07A 3CZDA 2Y2NA 2G2UA 5A92A 1N9BA 3FZCA 1WE4A 4DDSA 3G35A 1IYSA 4MNRA 3SH9A 2XEPA 4DE3A 4PM6A 4NK3A 1RGYA 3CMZA 1ES3A 5HARA 2J9OA 5AQ7A 5FI2A 4C3QA 1KGEA 1JTDA 3A3EA 4S2NA 1M40A 3N8RA 4DE1A 3BFFA 5A93A 4KZ5A 1XXMA 2B5RA 1E3UA 1NYMA 4XXRA 1PIOA 3W4PA 4PM5A 2PU4A 4JBFA 4PM9A 1KE3A 2FFYA 3GV9A 3SH8A 3ZG5A 4EUZA 3LY3A 4NETA 3IWQA 1KDWA 2P9VA 4OLGA 4RA7A 3MXRA 1G6AA 5KSCA 3VP3A 5CECA 1YLJA 4LV0A 1XX2A 3ZVWA 3RXXA 1GA9A 1YMSA 5EVIC 5CTMA 1IYQA 1MPLA 4UA9A 1FCMA 1LHYA 4R3JA 3IWIA 4K0WA 2HP6A 2VGKA 4E3NA 1YLZA 4WZ4A 3WRZA 2HDQA 1HD8A 4WZ5A 2XGNA 2WZZA 2H0TA 5EPHA 1LI0A 2EX9A 2FFFB 3BFDA 3ZDJA 4PMAA 1SKFA 4QJGA 4UAAA 2G2WA 2Y2PA 3IXHA 1NY0A 4R23A 3ZG0A 3IT9A 3C5AA 1SDEA 1DJBA 3M2KA 4OOMA 2QPNA 5FQIA 2EX2A 3V3SA 1GA0A 4ZBEA 4IBRA 4S2JA 3JYIA 3ZG8B 4LCMA 3OPHA 2DNSA 1SDNA 3O88A 3TG9A 3PBNA 1YT4A 3AGEA 4JF5A 3W4OA 1ZG4A 4JLFA 1I2WA 2X01A 3UY6A 2Y2MA 1FSYA 1PI5A 2XK1A 3QNCA 1IKGA 3N4IA 5HAQA 2XH9A 2XFTA 3HLWA 5GL9A 4OLDA 4OH0A 2BLSA 3V39A 3G32A 5E2EA 1LI9A 1JWPA 2ZC6B 1LL9A 3ZCZA 1K4FA 4OVDA 3NY4A 2Z2MB 1TDLA 4B88A 3WS4A 4BD0A 1XA7A 4JXGA 4X56A 4RVAA 2Y2KA 4UHUA 5GHYA 4N1HA 1PWGA 4ZJ3A 5E2FA 2EFXA 1Y54A 3D4FA 2BG1A 4A5RA 5EOEA 3V5MA 4R0QA 5FDHA 5FAQA 4GKUA 1BLCA 5FQ9A 4IVIA 5G18A 5CHMA 1RGZA 1YQSA 3ZG7B 2C6WB 1BSGA 1S0WA 3UE0A 2Y2IA 1ZG6A 2EXBA 1LLBA 4JKTA 2Y2OA 4P0MA 5FATA 4EWFA 3WWXA 5F1GA 3BECA 4LV3A 5DF8A 4E3KA 3VP2A 1FR1A 2ZMAA 3IF6A 3A3JA 1W5DA 1N4OA 4HBTA 4YINA 4OP8A 2OV5A 3UE3A 2WZXA 2X02A 3IQAA 1PI4A 1C3BA 3NDEA 1MWSA 3HLEA 1K54C 3OPRA 1W79A 1M6KA 2Z2LB 2A3UA 3VFHA 2WYXA 4L0LA 4OQHA 2Q9NA 3DW0A 1SHVA 1BUEA 3ZNTA 3VP1A 3HLDA 1AXBA 2EX6A 2Y2LA 2WGIA 3IHAA 4OQGA 4R4RA 2Y55A 1KGFA 5EVID 1O7EA 3LEZA 5FA7A 3WRTA 2Y2JA 2WKEA 4E6XA 2WKHA 5A91A 1BULA 3V3RA 5CHUA 1L0EA 2WGWA 4EBPA 3RXWA 1HZOA 3G34A 4BLMA 4C75A 4P6BA 3HVFA 5JYPA 4X53A 4S2MA 1VM1A 4HESA 3IH8A 3N6IA 1ERMA 1K56D 3PBTA 2X71A 4E3IA 3UDXA 1J9MA 4Y0TA 5HAIA 1XPBA 2ZC7A 4Q8IA 3DWZA 4GOGA 2JCHA 5EUAA 3NCKA 3HLCA 3I7JA 4OQIA 1W8YA 4OQ0A 1PWCA 3N7WA 1XP4A 3ZGAB 4P85A 4PM7A 2HPBA 1EI5A 1L2SA 3ZNYA 3TSGA 1G68A 1NRFA 2DCFA 2I72A 2ZLYA 5TGFA 1IELA 2VGJA 3LY4A 3VP4A 3C4PA 4ZDXA 4ZJ2A 4OP5A 2CC1A 1H5XA 2ZM2A 4S2LA 1MWTA 4MBFA 1TVFA 3IXBA 3VOYA 4KG2A 2H10A 4MLLA 5DTTA 4JF6A 1ONGA 2ZQAA 3A3FA 3BYDA 5AQBA 3UN7A 2XQZA 4JPMA 5EECA 2ZM8A 4DKIA 4DXCA 4GD8A 1PZPA 5AQ9A 5GHXA 2WGVA 5TFQA 1EROA 3PAEA 5GLDA 1ESUA 5CXWA 1ES2A 1KDSA 4ZAMA 1SCWA 1IYOA 4QU3A 4KG6A 1L0GA 1CK3A 3PAGA 3UO9A 1ZKJA 4S2IA 2EX8A 3VSLA 2JC7A 2JE5A 4QB8A 2ZQ7A 3N8LA 3W4QA 4DDYA 1MWRA 5CEBA 1QMFA 3OZHA 2QMIA 3W8KA 3IH9A 1KGGA 1OMEA 4KQQA 4KENB 2EFUA 4GB7A 4S2KA 4E6WA 4X69A 3G2YA 3ISGA 2XLNA 5IHVA 1IYPA 2WKIA 3MZFA 3GVBA 5D3OA 1PZOA 3OCLA 3ZVTA 5EOOA 4K91A 5DTSA 4DXBA 1K25A 4DE2A 3AGDA 3HL9A 4KZ4A 4FSFA 2WGWB 3IHBA 4YFMA 5DF9A 5FQQA 4RX2A 1K38A 3N8SA 3HUNA 3BLSA 3P09A 4CPKA 4ZJ1A 1MBLA 4M3KA 3WS5A 4D2OA 4KZ9A 3EQUA 1K54A 3O87A 4KZ8A 2ZD8A 4UA7A 1XA1A 2RCXA 3BEBA 4N1XA 4GDBA 2Y2HA 3IF6C 4BL2A 3BLMA 3G30A 4X55A 3HLBA 2HP5A 3C7UA 1KVMA 3DWKA 2P9VB 4K0XA 1PW8A 4B4XA 4UA6A 5F1FA 1WYCA 3WS2A 1MWUA 4WYYA 1JVJA 3PTEA 3WS0A 3HLGA 3FV7A 5HAPA 3GRJA 3DTMA 1BT5A 1KE0A 3MZEA 3ITBA 1RP5A 1L0FA 3SS4A 4WEKA 4PM8A 3PBOA 4KQOA 2WADA 3E2LA 1DJCA 1Z6FA 4S2PA 5CGXA 4Y0OA 5DF7A 3M2JA 3Q07A 1GCEA 1XKZA 2RL3A 3M6BA 3GSGA 3MBZA 4EBNA 5FASA 3BFGA 4EV4A 1CEFA 4H8RA 3NIAA 3OC2A 2JBFA 1IKIA 4KZBA 1FQGA 3CJMA 3O86A 4BJPA 4BL3A 2XDMA 5M1AA 1CEGA 2EXAA 1ES5A 3G2ZA 3FKVA 1K4EA 3BM6A 1I5QA 1PYYA 5M19A 3NI9A 2P74A 3OCNA 4WMCD 1YLWA 2J8YA 4IBXA 4DRTA 4FH2A 3HUMA 5CGSA 3CG5A 5FQMA 1K6RA 1FOFA 1TDGA 2ZQDA 4GZBA 4KZAA 2OSUA 3S22A 2ZM0A 2ZC4B 4EBLA 1TEMA 3IWOA 5E2GA 2E8IA 3GR2A 2XR0A 4CJNA 2OLUA 4JXWA 5F83A 5FQJA 1ES4A 1K57A 5E2HA 1ZC2A 3BRMA 4GNUA 4U0XA 4JXSA 4KG5A 2XF3A 2XD5A 3AGFA 1GHIA 5DVAA 2HDSA 4MBHA 4BENA 4Z9QA 3ZG9B 3HLFA 3C7VA 5KSHA 4LCLA 1L0DA 1FR6A 3UE1A 2XD1A 1DJAA 1K6SA 3HREA 3P98A 4QHCA 4LV1A 5CGWA 2J7VA 4Y7PA 3MKEA 3O3VA 4U3TA 1CI9A 2XFSA 3B3XA 3Q7VB 5GLCA 5U47A 3UPPA 3ZHHA 5EVLA 4B4ZA 3A3DA 1NZUA 5TR7A 3FKWA 3S1YA 5FAPA 5EVIA 3G4PA 1U60A 3FYZA 1K55C 3MZDA 4OOYA 1YLPA 4XUXA 5CEDA 1BTLA 3BFCA 1IEMA 3ZFZA 5AQAA 4OPQA 1LL5A 3NDGA 4OPRA 4RYEA 1JTGA 2OLVA 4KQRA 3OPPA 4WBGA 1ESIA 3RJUA 3Q7VA 4LV2A 2WAFA 3HUOA 2HDUA 4R3BA 3Q82A 3WS1A 5JYOA 3NC8A 4ID4A 2WAEA 4WMCA 4S2NC 4X6TA 4OPZA 4WELA 3GQZA 2WK0A 3TOIA 5M18A 4GD6A 1MKIA 3UPNA 5HW3A 2C5WB 4R4SA 3Q1FA 1K56A 2ZC3B 3QHYA 2R9XA 5GHZA 3LO7A 4JF4A 1FCOA 2WUQA 4IVKA 2DRWA 4DF6A 4HBUA 3BFEA 3NBLA 5CTNA 1I2SA 2IWDA 2Y2QA 4MEZA 2QZ6A 2Y2GA
chains in the Genus database with same CATH superfamily
4X25A 3S7NA 5GLBA 4KZ6A 4WEJA 3QP4A 3PHYA 3EGXC 2IWCA 3G31A 3EEAA 4Y5FA 2JKGA 1NZOA 4OKPA 2J9PA 2GNXA 3UPOA 4WZ5C 1F98A 2QYBA 3BQAA 5CHJA 3ITAA 1E25A 3PBQA 2Q0OA 3H82A 4ZTKA 2H5SA 3CUEC 3PBRA 4GHIA 5E43A 3S4XA 1WYBA 2KX6A 1K55A 3E4QA 3SS3A 3S7QA 1ODVA 4BBVA 5L8MA 1D7EA 4GDNA 3QNBA 4LENA 3K3CA 1BLHA 3T4KA 3KYZA 3LR0A 4M4XA 1GHMA 3F1OA 4WM9A 1FCNA 1D06A 3UB8A 3MQ0A 1ALQA 1NYYA 1YMXA 3E4PA 4IUHA 4P87A 3VE3A 2XA7S 2H0YA 4FH4A 4NXBA 2ZQCA 2A2LA 4EQIA 2IA2A 1N9LA 3M6HA 1MZUA 2ZQ8A 5EE8A 1N9BA 4DDSA 3G35A 4MNRA 3SH9A 3C30A 2NUPC 1JTDA 2PYPA 3A3EA 4XXRA 3MFXA 1ACFA 2JKRM 3CAXA 3SH8A 4NETA 3IWQA 2P9VA 3MXRA 5FEGA 4LV0A 4II7A 3RXXA 5EVIC 5CTMA 3UMEA 1EW0A 1K0KA 5KIZA 1OPXA 2VGKA 1T1BA 3ICYA 1MC0A 3MSHA 3V67A 2EX9A 2FFFB 3ZDJA 2GJ3A 4PMAA 2G2WA 5HDDA 2PD7A 3IT9A 3M2KA 4OOMA 2QPNA 1S1YA 1OJGA 2B95A 3B47A 4ZBEA 5HWVA 2PT7A 4JGRA 2I9VA 4H6JA 3OPHA 1YT4A 3AGEA 2V0WA 4JLFA 1YSPA 2BTFP 4OLDA 3R4KA 4OH0A 3ZCZA 1K4FA 4B88A 4X56A 4N1HA 3D4FA 1N9NA 1Y54A 2VKSA 2BG1A 3V5MA 1BLCA 5G18A 5CHMA 3ZG7B 3UE0A 5HPFA 4R70A 2VZWA 5FATA 1G28A 3QP2A 5F1GA 3BECA 4HI4A 3A3JA 1N4OA 2OV5A 2WZXA 2X02A 1PI4A 1MWSA 3OPRA 2Z2LB 3BY8A 3VFHA 1NLZA 2Q9NA 1SKOA 3DW0A 5FEFA 4MN7A 4UQIS 4R4RA 2EX6A 2Y2LA 5FA7A 4E6XA 1HZOA 2XA7M 3LIDA 2KDKA 3LGOA 3R7WA 1H8MA 3N6IA 1ERMA 1A0KA 2ZMFA 3UDXA 4Y0TA 5HAIA 3CITA 2HF6A 3DWZA 4GOGA 1F2KA 3D3OA 1XP4A 3PYPA 4P85A 1VB6A 1L2SA 1NRFA 1V9ZA 3C4PA 4ZDXA 2CC1A 2HZ5A 4NG2A 2ZM2A 1MWTA 3IXBA 3RH8B 1UWNX 4MLLA 5DTTA 4EEUA 4JF6A 2ZQAA 3ULFA 4GD8A 1PZPA 5DJTA 5GHXA 1OTBA 1EROA 3PAEA 3IX4A 2YKHA 5AVEA 3L7HA 1CK3A 1ZKJA 3VSLA 3N8LA 4GHIB 3CI6A 5IS1A 3F1NA 3IH9A 3TW8A 1OMEA 4KENB 4GB7A 4WL9A 5IHVA 1IYPA 4WUJA 2O9AA 5EM0A 3AGDA 3HL9A 3UMDA 2WGWB 3IHBA 5DF9A 3HUNA 3BLSA 4CPKA 4M3KA 4GS9B 4KZ9A 1K54A 4UA7A 2J3WA 2RCXA 3BEBA 4N1XA 4L9GA 2Y2HA 4BL2A 1KVMA 4HY8A 4B4XA 1PW8A 4YWZA 5F1FA 1WYCA 3DAVA 3FV7A 3H82B 5HAPA 2K2NA 1KOUA 3ITBA 1L0FA 4PM8A 4G3VA 1W63M 2XRNA 3M2JA 4HJ3A 3MBZA 4WLAA 4NXFA 4L9EA 3CJMA 5F6AA 1CEGA 2EXAA 1ES5A 2ZL1B 5L10A 1PYYA 3NI9A 3LI8A 4DRTA 5CGSA 2QHKA 4KZAA 4Q0HA 2FH5A 2ZC4B 3GR2A 4BBUA 4JXWA 2MJ6A 3LICA 2XSSA 4BENA 2V8FA 1GHIA 5DVAA 2HDSA 4MBHA 5C5KA 4Z9QA 3C7VA 5KSHA 3KO6A 4LCLA 1K6SA 3T4JA 2FZ0A 3LFVA 1CI9A 3B3XA 3UPPA 5GLCA 2UV0E 3EGDC 3A3DA 1NZUA 3S1YA 3K3DA 5EVIA 4OOYA 3O5YA 1YLPA 4OPQA 4RYEA 2M7UA 5AJGA 4WBGA 3RJUA 2OAP1 2WAFA 4R3BA 3WS1A 3LR3A 2W3DA 3TOIA 5F5YA 5HW3A 4R4SA 3Q1FA 4HQAA 2M1CA 3S7PA 5CTNA 2EA9A 4MEZA 2Y2GA 2ZQ9A 4E3LA 2W27A 4O0PA 4GN2A 5CRFA 3OPLA 1MXOA 1TS8A 3C4OA 4MBKA 1YLTA 1Y28A 1YSQA 2JKTM 4FCFA 4Y15A 3IS2B 4N9LA 2W1TA 1H8ZA 5BOHA 1OT9A 4HEFA 4N9KA 1JWZA 2V1ZA 3LIAA 3T4TA 3SOIA 5HL1A 5FAOA 3IF5A 2YKFA 2EWWA 1NJ4A 5HFOA 2Q9MA 4OONA 5HX9A 4XUZA 1JWVA 3VP0A 2VLGA 1S1ZA 1S6RA 1YLYA 2P04A 2GDNA 4HIAA 1Q2QA 2OAQ1 4E3JA 2PBYA 2A49A 1GHPA 5HWWA 5I94A 3H7WA 3VFFA 2VEAA 5KZHA 3UNWA 2P7JA 5HWTA 1K57C 2VX8A 1T19A 3A3IA 1N9OA 4E3MA 1W8QA 1V9YA 3F1OB 3F1NB 4QD4A 5DKKA 5FQKA 3NJAA 1MY8A 5F68A 3CZDA 2Y2NA 5A92A 2L1MA 1WE4A 2XEPA 4DE3A 1RGYA 3CMZA 2PD8A 2J9OA 5AQ7A 1VETB 5FI2A 1KGEA 1F5MA 4S2NA 3N8RA 1DP8A 3BFFA 4KZ5A 3W4PA 2B02A 4X1MA 2A24A 3FC7A 1KE3A 4LFUA 3ZG5A 4IHQA 1KDWA 4I5SA 4RA7A 5CECA 4GW9A 4UA9A 1FCMA 1LHYA 4R3JA 3CPTA 3IWIA 4K0WA 2HP6A 4ARZA 5MC7A 4I38A 3UB5P 5EPHA 3BFDA 4QJGA 4UAAA 1NY0A 3DTEA 3ZG0A 2WKRA 3MR0A 5FQIA 1GA0A 4IBRA 4S2JA 1BYWA 3O88A 1SDNA 3W4OA 3PBNA 4JF5A 5G4ZA 3UY6A 2X01A 2Y2MA 4GS9A 1IKGA 4IJGA 2XH9A 3D72A 5I5LA 2BLSA 5J4EA 5HD3A 5HDCA 4ME4A 2ZBBA 4BD0A 1XA7A 4JXGA 3DBAA 4RVAA 5GHYA 4ZJ3A 5E2FA 2L0WA 4A5RA 3IBJA 1SKOB 2PR5A 4CLCC 2V0UA 2Y2IA 1ZG6A 2Y2OA 4P0MA 4YOFA 1DRMA 5DF8A 2ZMAA 3IF6A 4YINA 4HBTA 4OP8A 3IQAA 3NDEA 3BW6A 1W79A 1M6KA 4Y2FA 2HJ9C 2WYXA 1LSVA 2JKTI 3IHAA 3WRTA 2WKHA 5A91A 5CHUA 1L0EA 4EBPA 4BLMA 4P6BA 4X53A 1VM1A 3IH8A 4E3IA 1J9MA 1XPBA 1XFNA 1W8YA 4OQ0A 2VGLS 1PWCA 3ZGAB 1S66L 4NKPA 2HPBA 3ZNYA 3TSGA 2I72A 4JGPA 1P9WA 1H5XA 2O9CA 1PNEA 3P01A 4JGOA 2M7VA 3D9YA 2ZM8A 4DXCA 3UE6A 5DFXA 4NXEA 2WGVA 4CLCE 1WA9A 3QP6A 5GLDA 5CXWA 1IYOA 1S4SA 3PAGA 3UO9A 3G6OA 4S2IA 4QB8A 4DDYA 1MWRA 5CEBA 4MCWA 4WF0A 3W8KA 4MDZA 4S2KA 4F3LA 3ISGA 1IOUA 4DN0A 2WKIA 3MZFA 3LIFA 3ZVTA 4KUKA 4K91A 4HP4A 5DTSA 3H9WA 4DXBA 4FSFA 3GDIA 4HH2A 5IU1A 3N8SA 2AVXA 1UGUA 4D2OA 3WS5A 3EQUA 3O87A 5HZHA 2ZD8A 3BLMA 1TD5A 3FG8A 2W3GA 3HLBA 3C7UA 4HOIA 2P9VB 4K0XA 1DP9A 1FILA 4EXOA 3WS0A 3HLGA 1DP6A 3GRJA 4Z1WA 1KE0A 3VOLA 1RP5A 3SS4A 4WEKA 3CLOA 4KQOA 3Q07A 1GCEA 3GSGA 4HNBA 1CEFA 4EV4A 2R78A 5A8BA 2W0NA 3O86A 4FTXA 2XDMA 4BL3A 3NULA 3A0RA 1TF1A 3FKVA 5HPIA 1K4EA 3BM6A 3UB7A 5M19A 2P74A 3OCNA 4WMCD 4IBXA 4Y13A 3DTKA 5FQMA 1K6RA 1CQAA 4GZBA 3IWOA 5E2GA 4EU0A 4CJNA 3ZYTA 4B9OA 2OLUA 5FQJA 4ARZB 1K57A 3T1SA 5EVEA 4MMNA 1AWIA 2PYRA 2XF3A 3AGFA 1CJFA 4RQ9A 1L0DA 1FR6A 1ZHHB 4LV1A 1XJ3A 2OOLA 3MKEA 3O3VA 3ZHHA 5U47A 1VETA 5EVLA 2PBDP 3MZDA 4GLQA 1CF0A 1BTLA 3T4QA 1IEMA 3QP5A 4Q0JA 1LL5A 4OPRA 1JTGA 4PKYG 4LLOB 3B42A 2GZAA 2VV6A 1Z09A 1OTIA 3ZQ5A 4G3KA 1K56A 2ZC3B 3QHYA 2R9XA 4JF4A 2NUTC 2DRWA 4QWOA 3BFEA 5HSQA 2PDRA 3E98A 2W1TB 1YM1A 1BZAA 5GLAA 4QY5A 3TE8A 3SH7A 4K08A 4BWIA 3F1PB 3BQ8A 4L9FA 4F94A 1KVLA 3T1RA 4LRYC 4BQMA 1FSWA 4OPYA 1H3QA 1EWZA 2KOIA 1HTZA 4HH3A 1GSVA 4MN5A 3MXSA 4IEDA 4KZ3A 1LL8A 2ZC5B 3UDIA 3A0SA 3LR4A 2UWXA 3S7OA 3IXDA 2R9WA 3T12B 1PWDA 3UDFA 2K31A 4FD8A 1P9RA 1HVBA 5A90A 4NEED 1BLSA 3KX0X 3U4LP 5F82A 1H8YA 1YAXA 2V2FF 1ONHA 3VOZA 4S2OA 3LCEA 2PU2A 3DTIA 4Y0UA 1RCJA 5L2FA 1T18A 5KMWA 1E3UD 4QY6A 1DY6A 3EQVA 1QMEA 4DE0A 5J8XA 3EEHA 4KZ7A 5FSRA 4JXVA 4PPRA 3GMWA 3PBSA 1BLPA 1O07A 2W3HA 2G2UA 3FZCA 1MKMA 4NK3A 1ES3A 3BJNA 4C3QA 3T50A 2DMWA 3JVVA 3SW1A 1E3UA 3CPTB 1PIOA 2FFYA 3GV9A 4EUZA 3LY3A 2V8CA 4OLGA 3T4LA 3LYXA 1G6AA 3VP3A 1XX2A 2W1RA 1IYQA 3CUEA 4BMWA 4E3NA 4WZ4A 3WRZA 2HDQA 4P6ZS 4WZ5A 2WZZA 2H0TA 1LI0A 4WN5A 1SKFA 4I3IA 3NOPC 3C5AA 4Q0IA 1SDEA 1DJBA 3R7WB 1HLUP 4LGWA 1OT6A 4DJ2A 2D01A 3V3SA 3T4OA 1T1AA 3RFBA 1ZG4A 2W3FA 1PI5A 3A0VA 3N4IA 2QWSA 2LB5A 5E2EA 2BASA 1JWPA 2ZC6B 4XT2B 3LI9A 2PHYA 4OVDA 3NY4A 2Z2MB 3OBFA 4LRXC 3WS4A 2EWVA 2Y2KA 4UHUA 3KSFA 4FOFA 5FAQA 4B93A 5FQ9A 4IVIA 1RGZA 5FDSA 1S0WA 2EXBA 1LLBA 4JKTA 4CLCB 4EWFA 3WWXA 4E3KA 3VP2A 1FR1A 3UE3A 4YNRA 2B18A 2JN7A 4BBTA 3HLEA 4OQHA 2JHEA 4AFIA 1SHVA 1STZA 4GCZA 3ZNTA 3NOUC 1AXBA 2Y55A 1KGFA 2Y2JA 3V3RA 3QP1A 2WGWA 3RXWA 3G34A 4C75A 3RTYA 5JYPA 3HVFA 4S2MA 1H0MA 2X71A 2JCHA 3NCKA 3HLCA 1S67L 4PM7A 1EI5A 4DMZA 2ZLYA 1TS6A 5TGFA 2VGJA 3LY4A 4ZJ2A 2PRFA 4S2LA 3VOYA 2JKRI 2H10A 2GX5A 1ONGA 3A3FA 5AQBA 4DKIA 5EECA 4I39A 2J3TD 1F9IA 2H28A 1ESUA 4KG6A 5K5BA 3E4OA 2EX8A 2JC7A 2J3TC 2ZQ7A 4EQ1A 2KLIA 3BY9A 1QMFA 4ZRRA 2V9AA 4UQIM 2QMIA 1KGGA 4KQQA 2EFUA 3G2YA 3MMHA 2XLNA 2WKQA 5AVFA 1XJ6A 5D3OA 1J3WA 1K25A 4DE2A 1YPRA 4DJ3A 5FQQA 3P09A 4ZJ1A 1MBLA 4KZ8A 4HP9A 1XA1A 4GDBA 3IF6C 2HGVA 5LBRA 4X55A 3KSHA 3DWKA 3LIBA 3WS2A 4WYYA 5G4YA 1JVJA 3PTEA 2VGLM 1ZTUA 2W3EA 1BT5A 2WADA 3E2LA 3IX8A 4S2PA 4Y0OA 2RL3A 3M6BA 4EBNA 5FASA 3BFGA 3OC2A 4PKYA 1FQGA 1TS7A 3NECA 2J8YA 3HUMA 3CG5A 2V1AA 2ZQDA 3S22A 1TEMA 1VHMA 5F83A 5E2HA 2O9BA 1ZC2A 4U0XA 4JXSA 4HJ6A 5TBMA 4Y17A 3HLFA 2QKPA 3JPUA 2XD1A 1DJAA 5F69A 3P98A 2PR6A 5CGWA 4U3TA 1FIKA 2XFSA 3Q7VB 4O01A 4B4ZA 3PR6A 2Y8HA 5FAPA 3G4PA 3FYZA 1K55C 4XUXA 5CEDA 3BFCA 2WKPA 4IUKA 4UEYA 3PXPA 4QPRA 2OLVA 4KQRA 4ETXA 2HDUA 3Q82A 2D02A 4EEPA 4ID4A 3H7WB 4WMCA 4X6TA 4WELA 3GQZA 2WK0A 3KSIA 5M18A 2C5WB 3FPVA 4R38A 3F1PA 4CQHA 3C8CA 4KUOA 1W63Q 4KQDA 5IT5A 3NBLA 1I2SA 2Y2QA 2QZ6A 3IBRA 1PW1A 1NXYA 2QJ7A 4N92A 4HJ4A 4RX3A 3E2KA 4E3OA 3VMAA 1XGIA 4P6ZM 5TBMB 1G6OA 4O8GA 5DTKA 4U0TA 2OWJA 4C6YA 2V20A 1XGJA 4JGQA 2ZOIA 3HBRA 4EW7A 1CI8A 3V50A 1VQQA 3T1XA 4X1LA 3MXQA 1KE4A 2L4RA 2HDRA 2A24B 5CERA 5EVIB 1E4DA 2ZJ9A 1NLYA 3Q81A 3GTCA 5EFWA 4O7DA 3Q7ZA 1XFQA 3GECA 1W7FA 2Z6CA 4BD1A 4R1GA 3IX3A 2VA0A 2IWBA 1ERQA 2Y59A 4OOLA 4X68A 5FI7A 3SS5A 3FWLA 3MKFA 1JNUA 2HP9A 4FUWA 4ESPA 3MFDA 5FI6A 3MF0A 2G7UA 1PFLA 5DKLA 3EOIA 3MJQA 2Y4AA 3VSKA 3IXGA 1PRQA 2INWA 1Q2PA 2Y91A 1IYSA 3UB6A 4PM6A 5HARA 3IS2A 4DE1A 1M40A 5A93A 1XXMA 2B5RA 1NYMA 2VJWA 4PM5A 2PU4A 3QP8A 4JBFA 5J3WA 3BWLA 4PM9A 3TRCA 4D60A 5KSCA 1YLJA 3P7NA 3ZVWA 1GA9A 1YMSA 3E0YA 1MPLA 3NHQA 3W2ZA 1YLZA 1HD8A 2XGNA 2QJ5A 2Y2PA 3IXHA 1NRJA 4R23A 2O99A 2EX2A 5J7EA 3JYIA 3ZG8B 4LCMA 3TG9A 2DNSA 1I2WA 1FSYA 2XK1A 3QNCA 5HAQA 2XFTA 3HLWA 5GL9A 5L09A 1OTAA 3V39A 3CWFA 3G32A 1LI9A 1P0ZA 3LR5A 1LL9A 2K7SA 3JVUA 3T1QB 1TDLA 3HJKA 1PWGA 2ACGA 2EFXA 5EOEA 4R0QA 3EWKA 5FDHA 4GKUA 1UWPX 4EETB 1YQSA 3SZTA 2C6WB 1BSGA 2ZOHA 5L07A 3NOTC 2VV8A 4LV3A 1SZVA 1W5DA 5EM1A 4E04A 3T4SA 1C3BA 1K54C 1VEUA 3L9KA 2A3UA 1YKDA 4L0LA 2VV7A 5CX7A 1BUEA 3VP1A 3HLDA 1GSWA 4OQGA 2WGIA 5EVID 1LSWA 1O7EA 3LEZA 4G3WA 2WKEA 1BULA 5HD5A 4PHTA 4NXGA 2E8JA 4HESA 1K56D 3PBTA 4EERA 2ZC7A 3MQOA 4Q8IA 5EUAA 3I7JA 4OQIA 1G5UA 3N7WA 3LUQA 1G68A 1XJ2A 2DCFA 2O0YA 1IELA 3VP4A 4OP5A 1OTEA 1Y4OA 2OWHA 3C2WA 3OOVA 3B33A 4MBFA 1T1CA 1TVFA 4EESA 4KG2A 5DFYA 3BYDA 3UN7A 2XQZA 4JPMA 5AQ9A 5TFQA 3LEQA 1ES2A 1KDSA 4MN6A 4ZAMA 1SCWA 4QU3A 1L0GA 1LT0A 3VV4A 2JE5A 1LSXA 1XJ4A 4I3JA 3W4QA 3HCYA 3OZHA 4EUVA 1VEUB 4E6WA 2PAVP 4X69A 3C38A 4Y3IA 3GVBA 4I3AA 1PZOA 3OCLA 5EOOA 4LRZE 4LPZA 4KZ4A 1X0OA 4YFMA 4RX2A 1K38A 1OJ5A 5EV0A 3G30A 4XT2A 2HP5A 3LIEA 4UA6A 1MWUA 4R6LA 1L3LA 5DJUA 3DTMA 3MZEA 2J80A 3FPWA 2ZL1A 2XROA 3PBOA 2JKFA 1DJCA 1Z6FA 3CHWP 2HV1A 5CGXA 5DF7A 4CLCA 1NWZA 1XKZA 3U2AA 3HJIA 4ETZA 4H8RA 4HHDA 3NIAA 2JBFA 5HDSA 1IKIA 4KZBA 4BJPA 5M1AA 2CMNA 3G2ZA 4H6JB 5FL3A 1I5QA 3KYQA 1YLWA 4F3LB 4FH2A 2HJEA 1FOFA 1TDGA 2OSUA 2ZM0A 4EBLA 2E8IA 2XR0A 2LB9A 1ES4A 4CLCD 3BRMA 4GNUA 4KG5A 2XD5A 4PAUA 5HL6A 2Y79A 1D1JA 3ZG9B 3MQQA 3UE1A 2V1BA 3HREA 4QHCA 3KYEA 3OLOA 2J7VA 4Y7PA 2Z6DA 2P08A 1TS0A 5TR7A 3TJZC 3FKWA 3MS6A 3K2NA 1U60A 3KSGA 1GSXA 3ZFZA 5TJJA 5AQAA 4GJ4A 3NDGA 3OPPA 1ESIA 2VK3A 3Q7VA 4LV2A 3HUOA 1IFQA 1S4RA 5JYOA 3NC8A 2WAEA 4S2NC 4OPZA 4GD6A 1MKIA 3UPNA 3VE4A 1OTDA 1P97A 5GHZA 3LO7A 1FCOA 2WUQA 4IVKA 4R3AA 2ZMVA 4DF6A 4HBUA 2IWDA 3UB9A 3IF6B
chains in the Genus database with same CATH topology
2ZQ9A 1PW1A 5GLBA 4KZ6A 1YM1A 1BZAA 4WEJA 5GLAA 4E3LA 1NXYA 4N92A 4GN2A 4QY5A 5CRFA 3SH7A 2IWCA 3G31A 3OPLA 1MXOA 4RX3A 3E2KA 4E3OA 3C4OA 4MBKA 1YLTA 1NZOA 3VMAA 4OKPA 1XGIA 2J9PA 4FCFA 3UPOA 4F94A 5DTKA 4U0TA 1KVLA 4WZ5C 4N9LA 4BQMA 2V20A 4C6YA 1FSWA 5CHJA 3ITAA 1XGJA 4OPYA 1H8ZA 3HBRA 1E25A 5BOHA 3PBQA 4HEFA 1CI8A 4N9KA 1JWZA 2V1ZA 4ZTKA 2H5SA 1EWZA 3V50A 1HTZA 1VQQA 3SOIA 5HL1A 1KE4A 3PBRA 5FAOA 3IF5A 2HDRA 1NJ4A 5E43A 5HFOA 3MXSA 4IEDA 3S4XA 2Q9MA 5CERA 4KZ3A 2ZC5B 4OONA 5EVIB 3UDIA 5HX9A 1WYBA 1E4DA 2ZJ9A 4XUZA 3Q81A 3GTCA 1K55A 2UWXA 1JWVA 3IXDA 4O7DA 3VP0A 2R9WA 3SS3A 1S6RA 1YLYA 3Q7ZA 2GDNA 4GDNA 1PWDA 1Q2QA 3QNBA 4LENA 3IF6B 1BLHA 3UDFA 4E3JA 4FD8A 1HVBA 2PBYA 2A49A 5A90A 1GHMA 4WM9A 1BLSA 1W7FA 1GHPA 5F82A 4BD1A 3VFFA 5I94A 4R1GA 1H8YA 1ERQA 1FCNA 2Y59A 4OOLA 4X68A 2IWBA 2V2FF 1ONHA 1ALQA 3VOZA 1NYYA 5FI7A 3SS5A 4S2OA 5KZHA 1YMXA 3LCEA 2PU2A 3FWLA 3MKFA 3UNWA 4P87A 2HP9A 4Y0UA 1RCJA 2H0YA 5L2FA 5KMWA 1K57C 3MFDA 4FH4A 5FI6A 1E3UD 3A3IA 4QY6A 1DY6A 3EQVA 1QMEA 4E3MA 2ZQCA 1W8QA 4DE0A 5J8XA 2Y4AA 3VSKA 4EQIA 3IXGA 4KZ7A 5FSRA 3M6HA 4JXVA 4PPRA 4QD4A 5FQKA 2ZQ8A 3GMWA 3PBSA 1BLPA 1Q2PA 1MY8A 2Y91A 5EE8A 1O07A 3CZDA 2Y2NA 2G2UA 5A92A 1N9BA 3FZCA 1WE4A 4DDSA 3G35A 1IYSA 4MNRA 3SH9A 2XEPA 4DE3A 4PM6A 4NK3A 1RGYA 3CMZA 1ES3A 5HARA 2J9OA 5AQ7A 5FI2A 4C3QA 1KGEA 1JTDA 3A3EA 4S2NA 1M40A 3N8RA 4DE1A 3BFFA 5A93A 4KZ5A 1XXMA 2B5RA 1E3UA 1NYMA 4XXRA 1PIOA 3W4PA 4PM5A 2PU4A 4JBFA 4PM9A 1KE3A 2FFYA 3GV9A 3SH8A 3ZG5A 4EUZA 3LY3A 4NETA 3IWQA 1KDWA 2P9VA 4OLGA 4RA7A 3MXRA 1G6AA 5KSCA 3VP3A 5CECA 1YLJA 4LV0A 1XX2A 3ZVWA 3RXXA 1GA9A 1YMSA 5EVIC 5CTMA 1IYQA 1MPLA 4UA9A 1FCMA 1LHYA 4R3JA 3IWIA 4K0WA 2HP6A 2VGKA 4E3NA 1YLZA 4WZ4A 3WRZA 2HDQA 1HD8A 4WZ5A 2XGNA 2WZZA 2H0TA 5EPHA 1LI0A 2EX9A 2FFFB 3BFDA 3ZDJA 4PMAA 1SKFA 4QJGA 4UAAA 2G2WA 2Y2PA 3IXHA 1NY0A 4R23A 3ZG0A 3IT9A 3C5AA 1SDEA 1DJBA 3M2KA 4OOMA 2QPNA 5FQIA 2EX2A 3V3SA 1GA0A 4ZBEA 4IBRA 4S2JA 3JYIA 3ZG8B 4LCMA 3OPHA 2DNSA 1SDNA 3O88A 3TG9A 3PBNA 1YT4A 3AGEA 4JF5A 3W4OA 1ZG4A 4JLFA 1I2WA 2X01A 3UY6A 2Y2MA 1FSYA 1PI5A 2XK1A 3QNCA 1IKGA 3N4IA 5HAQA 2XH9A 2XFTA 3HLWA 5GL9A 4OLDA 4OH0A 2BLSA 3V39A 3G32A 5E2EA 1LI9A 1JWPA 2ZC6B 1LL9A 3ZCZA 1K4FA 4OVDA 3NY4A 2Z2MB 1TDLA 4B88A 3WS4A 4BD0A 1XA7A 4JXGA 4X56A 4RVAA 2Y2KA 4UHUA 5GHYA 4N1HA 1PWGA 4ZJ3A 5E2FA 2EFXA 1Y54A 3D4FA 2BG1A 4A5RA 5EOEA 3V5MA 4R0QA 5FDHA 5FAQA 4GKUA 1BLCA 5FQ9A 4IVIA 5G18A 5CHMA 1RGZA 1YQSA 3ZG7B 2C6WB 1BSGA 1S0WA 3UE0A 2Y2IA 1ZG6A 2EXBA 1LLBA 4JKTA 2Y2OA 4P0MA 5FATA 4EWFA 3WWXA 5F1GA 3BECA 4LV3A 5DF8A 4E3KA 3VP2A 1FR1A 2ZMAA 3IF6A 3A3JA 1W5DA 1N4OA 4HBTA 4YINA 4OP8A 2OV5A 3UE3A 2WZXA 2X02A 3IQAA 1PI4A 1C3BA 3NDEA 1MWSA 3HLEA 1K54C 3OPRA 1W79A 1M6KA 2Z2LB 2A3UA 3VFHA 2WYXA 4L0LA 4OQHA 2Q9NA 3DW0A 1SHVA 1BUEA 3ZNTA 3VP1A 3HLDA 1AXBA 2EX6A 2Y2LA 2WGIA 3IHAA 4OQGA 4R4RA 2Y55A 1KGFA 5EVID 1O7EA 3LEZA 5FA7A 3WRTA 2Y2JA 2WKEA 4E6XA 2WKHA 5A91A 1BULA 3V3RA 5CHUA 1L0EA 2WGWA 4EBPA 3RXWA 1HZOA 3G34A 4BLMA 4C75A 4P6BA 3HVFA 5JYPA 4X53A 4S2MA 1VM1A 4HESA 3IH8A 3N6IA 1ERMA 1K56D 3PBTA 2X71A 4E3IA 3UDXA 1J9MA 4Y0TA 5HAIA 1XPBA 2ZC7A 4Q8IA 3DWZA 4GOGA 2JCHA 5EUAA 3NCKA 3HLCA 3I7JA 4OQIA 1W8YA 4OQ0A 1PWCA 3N7WA 1XP4A 3ZGAB 4P85A 4PM7A 2HPBA 1EI5A 1L2SA 3ZNYA 3TSGA 1G68A 1NRFA 2DCFA 2I72A 2ZLYA 5TGFA 1IELA 2VGJA 3LY4A 3VP4A 3C4PA 4ZDXA 4ZJ2A 4OP5A 2CC1A 1H5XA 2ZM2A 4S2LA 1MWTA 4MBFA 1TVFA 3IXBA 3VOYA 4KG2A 2H10A 4MLLA 5DTTA 4JF6A 1ONGA 2ZQAA 3A3FA 3BYDA 5AQBA 3UN7A 2XQZA 4JPMA 5EECA 2ZM8A 4DKIA 4DXCA 4GD8A 1PZPA 5AQ9A 5GHXA 2WGVA 5TFQA 1EROA 3PAEA 5GLDA 1ESUA 5CXWA 1ES2A 1KDSA 4ZAMA 1SCWA 1IYOA 4QU3A 4KG6A 1L0GA 1CK3A 3PAGA 3UO9A 1ZKJA 4S2IA 2EX8A 3VSLA 2JC7A 2JE5A 4QB8A 2ZQ7A 3N8LA 3W4QA 4DDYA 1MWRA 5CEBA 1QMFA 3OZHA 2QMIA 3W8KA 3IH9A 1KGGA 1OMEA 4KQQA 4KENB 2EFUA 4GB7A 4S2KA 4E6WA 4X69A 3G2YA 3ISGA 2XLNA 5IHVA 1IYPA 2WKIA 3MZFA 3GVBA 5D3OA 1PZOA 3OCLA 3ZVTA 5EOOA 4K91A 5DTSA 4DXBA 1K25A 4DE2A 3AGDA 3HL9A 4KZ4A 4FSFA 2WGWB 3IHBA 4YFMA 5DF9A 5FQQA 4RX2A 1K38A 3N8SA 3HUNA 3BLSA 3P09A 4CPKA 4ZJ1A 1MBLA 4M3KA 3WS5A 4D2OA 4KZ9A 3EQUA 1K54A 3O87A 4KZ8A 2ZD8A 4UA7A 1XA1A 2RCXA 3BEBA 4N1XA 4GDBA 2Y2HA 3IF6C 4BL2A 3BLMA 3G30A 4X55A 3HLBA 2HP5A 3C7UA 1KVMA 3DWKA 2P9VB 4K0XA 1PW8A 4B4XA 4UA6A 5F1FA 1WYCA 3WS2A 1MWUA 4WYYA 1JVJA 3PTEA 3WS0A 3HLGA 3FV7A 5HAPA 3GRJA 3DTMA 1BT5A 1KE0A 3MZEA 3ITBA 1RP5A 1L0FA 3SS4A 4WEKA 4PM8A 3PBOA 4KQOA 2WADA 3E2LA 1DJCA 1Z6FA 4S2PA 5CGXA 4Y0OA 5DF7A 3M2JA 3Q07A 1GCEA 1XKZA 2RL3A 3M6BA 3GSGA 3MBZA 4EBNA 5FASA 3BFGA 4EV4A 1CEFA 4H8RA 3NIAA 3OC2A 2JBFA 1IKIA 4KZBA 1FQGA 3CJMA 3O86A 4BJPA 4BL3A 2XDMA 5M1AA 1CEGA 2EXAA 1ES5A 3G2ZA 3FKVA 1K4EA 3BM6A 1I5QA 1PYYA 5M19A 3NI9A 2P74A 3OCNA 4WMCD 1YLWA 2J8YA 4IBXA 4DRTA 4FH2A 3HUMA 5CGSA 3CG5A 5FQMA 1K6RA 1FOFA 1TDGA 2ZQDA 4GZBA 4KZAA 2OSUA 3S22A 2ZM0A 2ZC4B 4EBLA 1TEMA 3IWOA 5E2GA 2E8IA 3GR2A 2XR0A 4CJNA 2OLUA 4JXWA 5F83A 5FQJA 1ES4A 1K57A 5E2HA 1ZC2A 3BRMA 4GNUA 4U0XA 4JXSA 4KG5A 2XF3A 2XD5A 3AGFA 1GHIA 5DVAA 2HDSA 4MBHA 4BENA 4Z9QA 3ZG9B 3HLFA 3C7VA 5KSHA 4LCLA 1L0DA 1FR6A 3UE1A 2XD1A 1DJAA 1K6SA 3HREA 3P98A 4QHCA 4LV1A 5CGWA 2J7VA 4Y7PA 3MKEA 3O3VA 4U3TA 1CI9A 2XFSA 3B3XA 3Q7VB 5GLCA 5U47A 3UPPA 3ZHHA 5EVLA 4B4ZA 3A3DA 1NZUA 5TR7A 3FKWA 3S1YA 5FAPA 5EVIA 3G4PA 1U60A 3FYZA 1K55C 3MZDA 4OOYA 1YLPA 4XUXA 5CEDA 1BTLA 3BFCA 1IEMA 3ZFZA 5AQAA 4OPQA 1LL5A 3NDGA 4OPRA 4RYEA 1JTGA 2OLVA 4KQRA 3OPPA 4WBGA 1ESIA 3RJUA 3Q7VA 4LV2A 2WAFA 3HUOA 2HDUA 4R3BA 3Q82A 3WS1A 5JYOA 3NC8A 4ID4A 2WAEA 4WMCA 4S2NC 4X6TA 4OPZA 4WELA 3GQZA 2WK0A 3TOIA 5M18A 4GD6A 1MKIA 3UPNA 5HW3A 2C5WB 4R4SA 3Q1FA 1K56A 2ZC3B 3QHYA 2R9XA 5GHZA 3LO7A 4JF4A 1FCOA 2WUQA 4IVKA 2DRWA 4DF6A 4HBUA 3BFEA 3NBLA 5CTNA 1I2SA 2IWDA 2Y2QA 4MEZA 2QZ6A 2Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQ9 A;  1PW1 A;  5GLB A;  4KZ6 A;  1YM1 A;  1BZA A;  4WEJ A;  5GLA A;  4E3L A;  1NXY A;  4N92 A;  4GN2 A;  4QY5 A;  5CRF A;  3SH7 A;  2IWC A;  3G31 A;  3OPL A;  1MXO A;  4RX3 A;  3E2K A;  4E3O A;  3C4O A;  4MBK A;  1YLT A;  1NZO A;  3VMA A;  4OKP A;  1XGI A;  2J9P A;  4FCF A;  3UPO A;  4F94 A;  5DTK A;  4U0T A;  1KVL A;  4WZ5 C;  4N9L A;  4BQM A;  2V20 A;  4C6Y A;  1FSW A;  5CHJ A;  3ITA A;  1XGJ A;  4OPY A;  1H8Z A;  3HBR A;  1E25 A;  5BOH A;  3PBQ A;  4HEF A;  1CI8 A;  4N9K A;  1JWZ A;  2V1Z A;  4ZTK A;  2H5S A;  1EWZ A;  3V50 A;  1HTZ A;  1VQQ A;  3SOI A;  5HL1 A;  1KE4 A;  3PBR A;  5FAO A;  3IF5 A;  2HDR A;  1NJ4 A;  5E43 A;  5HFO A;  3MXS A;  4IED A;  3S4X A;  2Q9M A;  5CER A;  4KZ3 A;  2ZC5 B;  4OON A;  5EVI B;  3UDI A;  5HX9 A;  1WYB A;  1E4D A;  2ZJ9 A;  4XUZ A;  3Q81 A;  3GTC A;  1K55 A;  2UWX A;  1JWV A;  3IXD A;  4O7D A;  3VP0 A;  2R9W A;  3SS3 A;  1S6R A;  1YLY A;  3Q7Z A;  2GDN A;  4GDN A;  1PWD A;  1Q2Q A;  3QNB A;  4LEN A;  3IF6 B;  1BLH A;  3UDF A;  4E3J A;  4FD8 A;  1HVB A;  2PBY A;  2A49 A;  5A90 A;  1GHM A;  4WM9 A;  1BLS A;  1W7F A;  1GHP A;  5F82 A;  4BD1 A;  3VFF A;  5I94 A;  4R1G A;  1H8Y A;  1ERQ A;  1FCN A;  2Y59 A;  4OOL A;  4X68 A;  2IWB A;  2V2F F;  1ONH A;  1ALQ A;  3VOZ A;  1NYY A;  5FI7 A;  3SS5 A;  4S2O A;  5KZH A;  1YMX A;  3LCE A;  2PU2 A;  3FWL A;  3MKF A;  3UNW A;  4P87 A;  2HP9 A;  4Y0U A;  1RCJ A;  2H0Y A;  5L2F A;  5KMW A;  1K57 C;  3MFD A;  4FH4 A;  5FI6 A;  1E3U D;  3A3I A;  4QY6 A;  1DY6 A;  3EQV A;  1QME A;  4E3M A;  2ZQC A;  1W8Q A;  4DE0 A;  5J8X A;  2Y4A A;  3VSK A;  4EQI A;  3IXG A;  4KZ7 A;  5FSR A;  3M6H A;  4JXV A;  4PPR A;  4QD4 A;  5FQK A;  2ZQ8 A;  3GMW A;  3PBS A;  1BLP A;  1Q2P A;  1MY8 A;  2Y91 A;  5EE8 A;  1O07 A;  3CZD A;  2Y2N A;  2G2U A;  5A92 A;  1N9B A;  3FZC A;  1WE4 A;  4DDS A;  3G35 A;  1IYS A;  4MNR A;  3SH9 A;  2XEP A;  4DE3 A;  4PM6 A;  4NK3 A;  1RGY A;  3CMZ A;  1ES3 A;  5HAR A;  2J9O A;  5AQ7 A;  5FI2 A;  4C3Q A;  1KGE A;  1JTD A;  3A3E A;  4S2N A;  1M40 A;  3N8R A;  4DE1 A;  3BFF A;  5A93 A;  4KZ5 A;  1XXM A;  2B5R A;  1E3U A;  1NYM A;  4XXR A;  1PIO A;  3W4P A;  4PM5 A;  2PU4 A;  4JBF A;  4PM9 A;  1KE3 A;  2FFY A;  3GV9 A;  3SH8 A;  3ZG5 A;  4EUZ A;  3LY3 A;  4NET A;  3IWQ A;  1KDW A;  2P9V A;  4OLG A;  4RA7 A;  3MXR A;  1G6A A;  5KSC A;  3VP3 A;  5CEC A;  1YLJ A;  4LV0 A;  1XX2 A;  3ZVW A;  3RXX A;  1GA9 A;  1YMS A;  5EVI C;  5CTM A;  1IYQ A;  1MPL A;  4UA9 A;  1FCM A;  1LHY A;  4R3J A;  3IWI A;  4K0W A;  2HP6 A;  2VGK A;  4E3N A;  1YLZ A;  4WZ4 A;  3WRZ A;  2HDQ A;  1HD8 A;  4WZ5 A;  2XGN A;  2WZZ A;  2H0T A;  5EPH A;  1LI0 A;  2EX9 A;  2FFF B;  3BFD A;  3ZDJ A;  4PMA A;  1SKF A;  4QJG A;  4UAA A;  2G2W A;  2Y2P A;  3IXH A;  1NY0 A;  4R23 A;  3ZG0 A;  3IT9 A;  3C5A A;  1SDE A;  1DJB A;  3M2K A;  4OOM A;  2QPN A;  5FQI A;  2EX2 A;  3V3S A;  1GA0 A;  4ZBE A;  4IBR A;  4S2J A;  3JYI A;  3ZG8 B;  4LCM A;  3OPH A;  2DNS A;  1SDN A;  3O88 A;  3TG9 A;  3PBN A;  1YT4 A;  3AGE A;  4JF5 A;  3W4O A;  1ZG4 A;  4JLF A;  1I2W A;  2X01 A;  3UY6 A;  2Y2M A;  1FSY A;  1PI5 A;  2XK1 A;  3QNC A;  1IKG A;  3N4I A;  5HAQ A;  2XH9 A;  2XFT A;  3HLW A;  5GL9 A;  4OLD A;  4OH0 A;  2BLS A;  3V39 A;  3G32 A;  5E2E A;  1LI9 A;  1JWP A;  2ZC6 B;  1LL9 A;  3ZCZ A;  1K4F A;  4OVD A;  3NY4 A;  2Z2M B;  1TDL A;  4B88 A;  3WS4 A;  4BD0 A;  1XA7 A;  4JXG A;  4X56 A;  4RVA A;  2Y2K A;  4UHU A;  5GHY A;  4N1H A;  1PWG A;  4ZJ3 A;  5E2F A;  2EFX A;  1Y54 A;  3D4F A;  2BG1 A;  4A5R A;  5EOE A;  3V5M A;  4R0Q A;  5FDH A;  5FAQ A;  4GKU A;  1BLC A;  5FQ9 A;  4IVI A;  5G18 A;  5CHM A;  1RGZ A;  1YQS A;  3ZG7 B;  2C6W B;  1BSG A;  1S0W A;  3UE0 A;  2Y2I A;  1ZG6 A;  2EXB A;  1LLB A;  4JKT A;  2Y2O A;  4P0M A;  5FAT A;  4EWF A;  3WWX A;  5F1G A;  3BEC A;  4LV3 A;  5DF8 A;  4E3K A;  3VP2 A;  1FR1 A;  2ZMA A;  3IF6 A;  3A3J A;  1W5D A;  1N4O A;  4HBT A;  4YIN A;  4OP8 A;  2OV5 A;  3UE3 A;  2WZX A;  2X02 A;  3IQA A;  1PI4 A;  1C3B A;  3NDE A;  1MWS A;  3HLE A;  1K54 C;  3OPR A;  1W79 A;  1M6K A;  2Z2L B;  2A3U A;  3VFH A;  2WYX A;  4L0L A;  4OQH A;  2Q9N A;  3DW0 A;  1SHV A;  1BUE A;  3ZNT A;  3VP1 A;  3HLD A;  1AXB A;  2EX6 A;  2Y2L A;  2WGI A;  3IHA A;  4OQG A;  4R4R A;  2Y55 A;  1KGF A;  5EVI D;  1O7E A;  3LEZ A;  5FA7 A;  3WRT A;  2Y2J A;  2WKE A;  4E6X A;  2WKH A;  5A91 A;  1BUL A;  3V3R A;  5CHU A;  1L0E A;  2WGW A;  4EBP A;  3RXW A;  1HZO A;  3G34 A;  4BLM A;  4C75 A;  4P6B A;  3HVF A;  5JYP A;  4X53 A;  4S2M A;  1VM1 A;  4HES A;  3IH8 A;  3N6I A;  1ERM A;  1K56 D;  3PBT A;  2X71 A;  4E3I A;  3UDX A;  1J9M A;  4Y0T A;  5HAI A;  1XPB A;  2ZC7 A;  4Q8I A;  3DWZ A;  4GOG A;  2JCH A;  5EUA A;  3NCK A;  3HLC A;  3I7J A;  4OQI A;  1W8Y A;  4OQ0 A;  1PWC A;  3N7W A;  1XP4 A;  3ZGA B;  4P85 A;  4PM7 A;  2HPB A;  1EI5 A;  1L2S A;  3ZNY A;  3TSG A;  1G68 A;  1NRF A;  2DCF A;  2I72 A;  2ZLY A;  5TGF A;  1IEL A;  2VGJ A;  3LY4 A;  3VP4 A;  3C4P A;  4ZDX A;  4ZJ2 A;  4OP5 A;  2CC1 A;  1H5X A;  2ZM2 A;  4S2L A;  1MWT A;  4MBF A;  1TVF A;  3IXB A;  3VOY A;  4KG2 A;  2H10 A;  4MLL A;  5DTT A;  4JF6 A;  1ONG A;  2ZQA A;  3A3F A;  3BYD A;  5AQB A;  3UN7 A;  2XQZ A;  4JPM A;  5EEC A;  2ZM8 A;  4DKI A;  4DXC A;  4GD8 A;  1PZP A;  5AQ9 A;  5GHX A;  2WGV A;  5TFQ A;  1ERO A;  3PAE A;  5GLD A;  1ESU A;  5CXW A;  1ES2 A;  1KDS A;  4ZAM A;  1SCW A;  1IYO A;  4QU3 A;  4KG6 A;  1L0G A;  1CK3 A;  3PAG A;  3UO9 A;  1ZKJ A;  4S2I A;  2EX8 A;  3VSL A;  2JC7 A;  2JE5 A;  4QB8 A;  2ZQ7 A;  3N8L A;  3W4Q A;  4DDY A;  1MWR A;  5CEB A;  1QMF A;  3OZH A;  2QMI A;  3W8K A;  3IH9 A;  1KGG A;  1OME A;  4KQQ A;  4KEN B;  2EFU A;  4GB7 A;  4S2K A;  4E6W A;  4X69 A;  3G2Y A;  3ISG A;  2XLN A;  5IHV A;  1IYP A;  2WKI A;  3MZF A;  3GVB A;  5D3O A;  1PZO A;  3OCL A;  3ZVT A;  5EOO A;  4K91 A;  5DTS A;  4DXB A;  1K25 A;  4DE2 A;  3AGD A;  3HL9 A;  4KZ4 A;  4FSF A;  2WGW B;  3IHB A;  4YFM A;  5DF9 A;  5FQQ A;  4RX2 A;  1K38 A;  3N8S A;  3HUN A;  3BLS A;  3P09 A;  4CPK A;  4ZJ1 A;  1MBL A;  4M3K A;  3WS5 A;  4D2O A;  4KZ9 A;  3EQU A;  1K54 A;  3O87 A;  4KZ8 A;  2ZD8 A;  4UA7 A;  1XA1 A;  2RCX A;  3BEB A;  4N1X A;  4GDB A;  2Y2H A;  3IF6 C;  4BL2 A;  3BLM A;  3G30 A;  4X55 A;  3HLB A;  2HP5 A;  3C7U A;  1KVM A;  3DWK A;  2P9V B;  4K0X A;  1PW8 A;  4B4X A;  4UA6 A;  5F1F A;  1WYC A;  3WS2 A;  1MWU A;  4WYY A;  1JVJ A;  3PTE A;  3WS0 A;  3HLG A;  3FV7 A;  5HAP A;  3GRJ A;  3DTM A;  1BT5 A;  1KE0 A;  3MZE A;  3ITB A;  1RP5 A;  1L0F A;  3SS4 A;  4WEK A;  4PM8 A;  3PBO A;  4KQO A;  2WAD A;  3E2L A;  1DJC A;  1Z6F A;  4S2P A;  5CGX A;  4Y0O A;  5DF7 A;  3M2J A;  3Q07 A;  1GCE A;  1XKZ A;  2RL3 A;  3M6B A;  3GSG A;  3MBZ A;  4EBN A;  5FAS A;  3BFG A;  4EV4 A;  1CEF A;  4H8R A;  3NIA A;  3OC2 A;  2JBF A;  1IKI A;  4KZB A;  1FQG A;  3CJM A;  3O86 A;  4BJP A;  4BL3 A;  2XDM A;  5M1A A;  1CEG A;  2EXA A;  1ES5 A;  3G2Z A;  3FKV A;  1K4E A;  3BM6 A;  1I5Q A;  1PYY A;  5M19 A;  3NI9 A;  2P74 A;  3OCN A;  4WMC D;  1YLW A;  2J8Y A;  4IBX A;  4DRT A;  4FH2 A;  3HUM A;  5CGS A;  3CG5 A;  5FQM A;  1K6R A;  1FOF A;  1TDG A;  2ZQD A;  4GZB A;  4KZA A;  2OSU A;  3S22 A;  2ZM0 A;  2ZC4 B;  4EBL A;  1TEM A;  3IWO A;  5E2G A;  2E8I A;  3GR2 A;  2XR0 A;  4CJN A;  2OLU A;  4JXW A;  5F83 A;  5FQJ A;  1ES4 A;  1K57 A;  5E2H A;  1ZC2 A;  3BRM A;  4GNU A;  4U0X A;  4JXS A;  4KG5 A;  2XF3 A;  2XD5 A;  3AGF A;  1GHI A;  5DVA A;  2HDS A;  4MBH A;  4BEN A;  4Z9Q A;  3ZG9 B;  3HLF A;  3C7V A;  5KSH A;  4LCL A;  1L0D A;  1FR6 A;  3UE1 A;  2XD1 A;  1DJA A;  1K6S A;  3HRE A;  3P98 A;  4QHC A;  4LV1 A;  5CGW A;  2J7V A;  4Y7P A;  3MKE A;  3O3V A;  4U3T A;  1CI9 A;  2XFS A;  3B3X A;  3Q7V B;  5GLC A;  5U47 A;  3UPP A;  3ZHH A;  5EVL A;  4B4Z A;  3A3D A;  1NZU A;  5TR7 A;  3FKW A;  3S1Y A;  5FAP A;  5EVI A;  3G4P A;  1U60 A;  3FYZ A;  1K55 C;  3MZD A;  4OOY A;  1YLP A;  4XUX A;  5CED A;  1BTL A;  3BFC A;  1IEM A;  3ZFZ A;  5AQA A;  4OPQ A;  1LL5 A;  3NDG A;  4OPR A;  4RYE A;  1JTG A;  2OLV A;  4KQR A;  3OPP A;  4WBG A;  1ESI A;  3RJU A;  3Q7V A;  4LV2 A;  2WAF A;  3HUO A;  2HDU A;  4R3B A;  3Q82 A;  3WS1 A;  5JYO A;  3NC8 A;  4ID4 A;  2WAE A;  4WMC A;  4S2N C;  4X6T A;  4OPZ A;  4WEL A;  3GQZ A;  2WK0 A;  3TOI A;  5M18 A;  4GD6 A;  1MKI A;  3UPN A;  5HW3 A;  2C5W B;  4R4S A;  3Q1F A;  1K56 A;  2ZC3 B;  3QHY A;  2R9X A;  5GHZ A;  3LO7 A;  4JF4 A;  1FCO A;  2WUQ A;  4IVK A;  2DRW A;  4DF6 A;  4HBU A;  3BFE A;  3NBL A;  5CTN A;  1I2S A;  2IWD A;  2Y2Q A;  4MEZ A;  2QZ6 A;  2Y2G A; 
#chains in the Genus database with same CATH topology
 4X25 A;  3S7N A;  5GLB A;  4KZ6 A;  4WEJ A;  3QP4 A;  3PHY A;  3EGX C;  2IWC A;  3G31 A;  3EEA A;  4Y5F A;  2JKG A;  1NZO A;  4OKP A;  2J9P A;  2GNX A;  3UPO A;  4WZ5 C;  1F98 A;  2QYB A;  3BQA A;  5CHJ A;  3ITA A;  1E25 A;  3PBQ A;  2Q0O A;  3H82 A;  4ZTK A;  2H5S A;  3CUE C;  3PBR A;  4GHI A;  5E43 A;  3S4X A;  1WYB A;  2KX6 A;  1K55 A;  3E4Q A;  3SS3 A;  3S7Q A;  1ODV A;  4BBV A;  5L8M A;  1D7E A;  4GDN A;  3QNB A;  4LEN A;  3K3C A;  1BLH A;  3T4K A;  3KYZ A;  3LR0 A;  4M4X A;  1GHM A;  3F1O A;  4WM9 A;  1FCN A;  1D06 A;  3UB8 A;  3MQ0 A;  1ALQ A;  1NYY A;  1YMX A;  3E4P A;  4IUH A;  4P87 A;  3VE3 A;  2XA7 S;  2H0Y A;  4FH4 A;  4NXB A;  2ZQC A;  2A2L A;  4EQI A;  2IA2 A;  1N9L A;  3M6H A;  1MZU A;  2ZQ8 A;  5EE8 A;  1N9B A;  4DDS A;  3G35 A;  4MNR A;  3SH9 A;  3C30 A;  2NUP C;  1JTD A;  2PYP A;  3A3E A;  4XXR A;  3MFX A;  1ACF A;  2JKR M;  3CAX A;  3SH8 A;  4NET A;  3IWQ A;  2P9V A;  3MXR A;  5FEG A;  4LV0 A;  4II7 A;  3RXX A;  5EVI C;  5CTM A;  3UME A;  1EW0 A;  1K0K A;  5KIZ A;  1OPX A;  2VGK A;  1T1B A;  3ICY A;  1MC0 A;  3MSH A;  3V67 A;  2EX9 A;  2FFF B;  3ZDJ A;  2GJ3 A;  4PMA A;  2G2W A;  5HDD A;  2PD7 A;  3IT9 A;  3M2K A;  4OOM A;  2QPN A;  1S1Y A;  1OJG A;  2B95 A;  3B47 A;  4ZBE A;  5HWV A;  2PT7 A;  4JGR A;  2I9V A;  4H6J A;  3OPH A;  1YT4 A;  3AGE A;  2V0W A;  4JLF A;  1YSP A;  2BTF P;  4OLD A;  3R4K A;  4OH0 A;  3ZCZ A;  1K4F A;  4B88 A;  4X56 A;  4N1H A;  3D4F A;  1N9N A;  1Y54 A;  2VKS A;  2BG1 A;  3V5M A;  1BLC A;  5G18 A;  5CHM A;  3ZG7 B;  3UE0 A;  5HPF A;  4R70 A;  2VZW A;  5FAT A;  1G28 A;  3QP2 A;  5F1G A;  3BEC A;  4HI4 A;  3A3J A;  1N4O A;  2OV5 A;  2WZX A;  2X02 A;  1PI4 A;  1MWS A;  3OPR A;  2Z2L B;  3BY8 A;  3VFH A;  1NLZ A;  2Q9N A;  1SKO A;  3DW0 A;  5FEF A;  4MN7 A;  4UQI S;  4R4R A;  2EX6 A;  2Y2L A;  5FA7 A;  4E6X A;  1HZO A;  2XA7 M;  3LID A;  2KDK A;  3LGO A;  3R7W A;  1H8M A;  3N6I A;  1ERM A;  1A0K A;  2ZMF A;  3UDX A;  4Y0T A;  5HAI A;  3CIT A;  2HF6 A;  3DWZ A;  4GOG A;  1F2K A;  3D3O A;  1XP4 A;  3PYP A;  4P85 A;  1VB6 A;  1L2S A;  1NRF A;  1V9Z A;  3C4P A;  4ZDX A;  2CC1 A;  2HZ5 A;  4NG2 A;  2ZM2 A;  1MWT A;  3IXB A;  3RH8 B;  1UWN X;  4MLL A;  5DTT A;  4EEU A;  4JF6 A;  2ZQA A;  3ULF A;  4GD8 A;  1PZP A;  5DJT A;  5GHX A;  1OTB A;  1ERO A;  3PAE A;  3IX4 A;  2YKH A;  5AVE A;  3L7H A;  1CK3 A;  1ZKJ A;  3VSL A;  3N8L A;  4GHI B;  3CI6 A;  5IS1 A;  3F1N A;  3IH9 A;  3TW8 A;  1OME A;  4KEN B;  4GB7 A;  4WL9 A;  5IHV A;  1IYP A;  4WUJ A;  2O9A A;  5EM0 A;  3AGD A;  3HL9 A;  3UMD A;  2WGW B;  3IHB A;  5DF9 A;  3HUN A;  3BLS A;  4CPK A;  4M3K A;  4GS9 B;  4KZ9 A;  1K54 A;  4UA7 A;  2J3W A;  2RCX A;  3BEB A;  4N1X A;  4L9G A;  2Y2H A;  4BL2 A;  1KVM A;  4HY8 A;  4B4X A;  1PW8 A;  4YWZ A;  5F1F A;  1WYC A;  3DAV A;  3FV7 A;  3H82 B;  5HAP A;  2K2N A;  1KOU A;  3ITB A;  1L0F A;  4PM8 A;  4G3V A;  1W63 M;  2XRN A;  3M2J A;  4HJ3 A;  3MBZ A;  4WLA A;  4NXF A;  4L9E A;  3CJM A;  5F6A A;  1CEG A;  2EXA A;  1ES5 A;  2ZL1 B;  5L10 A;  1PYY A;  3NI9 A;  3LI8 A;  4DRT A;  5CGS A;  2QHK A;  4KZA A;  4Q0H A;  2FH5 A;  2ZC4 B;  3GR2 A;  4BBU A;  4JXW A;  2MJ6 A;  3LIC A;  2XSS A;  4BEN A;  2V8F A;  1GHI A;  5DVA A;  2HDS A;  4MBH A;  5C5K A;  4Z9Q A;  3C7V A;  5KSH A;  3KO6 A;  4LCL A;  1K6S A;  3T4J A;  2FZ0 A;  3LFV A;  1CI9 A;  3B3X A;  3UPP A;  5GLC A;  2UV0 E;  3EGD C;  3A3D A;  1NZU A;  3S1Y A;  3K3D A;  5EVI A;  4OOY A;  3O5Y A;  1YLP A;  4OPQ A;  4RYE A;  2M7U A;  5AJG A;  4WBG A;  3RJU A;  2OAP 1;  2WAF A;  4R3B A;  3WS1 A;  3LR3 A;  2W3D A;  3TOI A;  5F5Y A;  5HW3 A;  4R4S A;  3Q1F A;  4HQA A;  2M1C A;  3S7P A;  5CTN A;  2EA9 A;  4MEZ A;  2Y2G A;  2ZQ9 A;  4E3L A;  2W27 A;  4O0P A;  4GN2 A;  5CRF A;  3OPL A;  1MXO A;  1TS8 A;  3C4O A;  4MBK A;  1YLT A;  1Y28 A;  1YSQ A;  2JKT M;  4FCF A;  4Y15 A;  3IS2 B;  4N9L A;  2W1T A;  1H8Z A;  5BOH A;  1OT9 A;  4HEF A;  4N9K A;  1JWZ A;  2V1Z A;  3LIA A;  3T4T A;  3SOI A;  5HL1 A;  5FAO A;  3IF5 A;  2YKF A;  2EWW A;  1NJ4 A;  5HFO A;  2Q9M A;  4OON A;  5HX9 A;  4XUZ A;  1JWV A;  3VP0 A;  2VLG A;  1S1Z A;  1S6R A;  1YLY A;  2P04 A;  2GDN A;  4HIA A;  1Q2Q A;  2OAQ 1;  4E3J A;  2PBY A;  2A49 A;  1GHP A;  5HWW A;  5I94 A;  3H7W A;  3VFF A;  2VEA A;  5KZH A;  3UNW A;  2P7J A;  5HWT A;  1K57 C;  2VX8 A;  1T19 A;  3A3I A;  1N9O A;  4E3M A;  1W8Q A;  1V9Y A;  3F1O B;  3F1N B;  4QD4 A;  5DKK A;  5FQK A;  3NJA A;  1MY8 A;  5F68 A;  3CZD A;  2Y2N A;  5A92 A;  2L1M A;  1WE4 A;  2XEP A;  4DE3 A;  1RGY A;  3CMZ A;  2PD8 A;  2J9O A;  5AQ7 A;  1VET B;  5FI2 A;  1KGE A;  1F5M A;  4S2N A;  3N8R A;  1DP8 A;  3BFF A;  4KZ5 A;  3W4P A;  2B02 A;  4X1M A;  2A24 A;  3FC7 A;  1KE3 A;  4LFU A;  3ZG5 A;  4IHQ A;  1KDW A;  4I5S A;  4RA7 A;  5CEC A;  4GW9 A;  4UA9 A;  1FCM A;  1LHY A;  4R3J A;  3CPT A;  3IWI A;  4K0W A;  2HP6 A;  4ARZ A;  5MC7 A;  4I38 A;  3UB5 P;  5EPH A;  3BFD A;  4QJG A;  4UAA A;  1NY0 A;  3DTE A;  3ZG0 A;  2WKR A;  3MR0 A;  5FQI A;  1GA0 A;  4IBR A;  4S2J A;  1BYW A;  3O88 A;  1SDN A;  3W4O A;  3PBN A;  4JF5 A;  5G4Z A;  3UY6 A;  2X01 A;  2Y2M A;  4GS9 A;  1IKG A;  4IJG A;  2XH9 A;  3D72 A;  5I5L A;  2BLS A;  5J4E A;  5HD3 A;  5HDC A;  4ME4 A;  2ZBB A;  4BD0 A;  1XA7 A;  4JXG A;  3DBA A;  4RVA A;  5GHY A;  4ZJ3 A;  5E2F A;  2L0W A;  4A5R A;  3IBJ A;  1SKO B;  2PR5 A;  4CLC C;  2V0U A;  2Y2I A;  1ZG6 A;  2Y2O A;  4P0M A;  4YOF A;  1DRM A;  5DF8 A;  2ZMA A;  3IF6 A;  4YIN A;  4HBT A;  4OP8 A;  3IQA A;  3NDE A;  3BW6 A;  1W79 A;  1M6K A;  4Y2F A;  2HJ9 C;  2WYX A;  1LSV A;  2JKT I;  3IHA A;  3WRT A;  2WKH A;  5A91 A;  5CHU A;  1L0E A;  4EBP A;  4BLM A;  4P6B A;  4X53 A;  1VM1 A;  3IH8 A;  4E3I A;  1J9M A;  1XPB A;  1XFN A;  1W8Y A;  4OQ0 A;  2VGL S;  1PWC A;  3ZGA B;  1S66 L;  4NKP A;  2HPB A;  3ZNY A;  3TSG A;  2I72 A;  4JGP A;  1P9W A;  1H5X A;  2O9C A;  1PNE A;  3P01 A;  4JGO A;  2M7V A;  3D9Y A;  2ZM8 A;  4DXC A;  3UE6 A;  5DFX A;  4NXE A;  2WGV A;  4CLC E;  1WA9 A;  3QP6 A;  5GLD A;  5CXW A;  1IYO A;  1S4S A;  3PAG A;  3UO9 A;  3G6O A;  4S2I A;  4QB8 A;  4DDY A;  1MWR A;  5CEB A;  4MCW A;  4WF0 A;  3W8K A;  4MDZ A;  4S2K A;  4F3L A;  3ISG A;  1IOU A;  4DN0 A;  2WKI A;  3MZF A;  3LIF A;  3ZVT A;  4KUK A;  4K91 A;  4HP4 A;  5DTS A;  3H9W A;  4DXB A;  4FSF A;  3GDI A;  4HH2 A;  5IU1 A;  3N8S A;  2AVX A;  1UGU A;  4D2O A;  3WS5 A;  3EQU A;  3O87 A;  5HZH A;  2ZD8 A;  3BLM A;  1TD5 A;  3FG8 A;  2W3G A;  3HLB A;  3C7U A;  4HOI A;  2P9V B;  4K0X A;  1DP9 A;  1FIL A;  4EXO A;  3WS0 A;  3HLG A;  1DP6 A;  3GRJ A;  4Z1W A;  1KE0 A;  3VOL A;  1RP5 A;  3SS4 A;  4WEK A;  3CLO A;  4KQO A;  3Q07 A;  1GCE A;  3GSG A;  4HNB A;  1CEF A;  4EV4 A;  2R78 A;  5A8B A;  2W0N A;  3O86 A;  4FTX A;  2XDM A;  4BL3 A;  3NUL A;  3A0R A;  1TF1 A;  3FKV A;  5HPI A;  1K4E A;  3BM6 A;  3UB7 A;  5M19 A;  2P74 A;  3OCN A;  4WMC D;  4IBX A;  4Y13 A;  3DTK A;  5FQM A;  1K6R A;  1CQA A;  4GZB A;  3IWO A;  5E2G A;  4EU0 A;  4CJN A;  3ZYT A;  4B9O A;  2OLU A;  5FQJ A;  4ARZ B;  1K57 A;  3T1S A;  5EVE A;  4MMN A;  1AWI A;  2PYR A;  2XF3 A;  3AGF A;  1CJF A;  4RQ9 A;  1L0D A;  1FR6 A;  1ZHH B;  4LV1 A;  1XJ3 A;  2OOL A;  3MKE A;  3O3V A;  3ZHH A;  5U47 A;  1VET A;  5EVL A;  2PBD P;  3MZD A;  4GLQ A;  1CF0 A;  1BTL A;  3T4Q A;  1IEM A;  3QP5 A;  4Q0J A;  1LL5 A;  4OPR A;  1JTG A;  4PKY G;  4LLO B;  3B42 A;  2GZA A;  2VV6 A;  1Z09 A;  1OTI A;  3ZQ5 A;  4G3K A;  1K56 A;  2ZC3 B;  3QHY A;  2R9X A;  4JF4 A;  2NUT C;  2DRW A;  4QWO A;  3BFE A;  5HSQ A;  2PDR A;  3E98 A;  2W1T B;  1YM1 A;  1BZA A;  5GLA A;  4QY5 A;  3TE8 A;  3SH7 A;  4K08 A;  4BWI A;  3F1P B;  3BQ8 A;  4L9F A;  4F94 A;  1KVL A;  3T1R A;  4LRY C;  4BQM A;  1FSW A;  4OPY A;  1H3Q A;  1EWZ A;  2KOI A;  1HTZ A;  4HH3 A;  1GSV A;  4MN5 A;  3MXS A;  4IED A;  4KZ3 A;  1LL8 A;  2ZC5 B;  3UDI A;  3A0S A;  3LR4 A;  2UWX A;  3S7O A;  3IXD A;  2R9W A;  3T12 B;  1PWD A;  3UDF A;  2K31 A;  4FD8 A;  1P9R A;  1HVB A;  5A90 A;  4NEE D;  1BLS A;  3KX0 X;  3U4L P;  5F82 A;  1H8Y A;  1YAX A;  2V2F F;  1ONH A;  3VOZ A;  4S2O A;  3LCE A;  2PU2 A;  3DTI A;  4Y0U A;  1RCJ A;  5L2F A;  1T18 A;  5KMW A;  1E3U D;  4QY6 A;  1DY6 A;  3EQV A;  1QME A;  4DE0 A;  5J8X A;  3EEH A;  4KZ7 A;  5FSR A;  4JXV A;  4PPR A;  3GMW A;  3PBS A;  1BLP A;  1O07 A;  2W3H A;  2G2U A;  3FZC A;  1MKM A;  4NK3 A;  1ES3 A;  3BJN A;  4C3Q A;  3T50 A;  2DMW A;  3JVV A;  3SW1 A;  1E3U A;  3CPT B;  1PIO A;  2FFY A;  3GV9 A;  4EUZ A;  3LY3 A;  2V8C A;  4OLG A;  3T4L A;  3LYX A;  1G6A A;  3VP3 A;  1XX2 A;  2W1R A;  1IYQ A;  3CUE A;  4BMW A;  4E3N A;  4WZ4 A;  3WRZ A;  2HDQ A;  4P6Z S;  4WZ5 A;  2WZZ A;  2H0T A;  1LI0 A;  4WN5 A;  1SKF A;  4I3I A;  3NOP C;  3C5A A;  4Q0I A;  1SDE A;  1DJB A;  3R7W B;  1HLU P;  4LGW A;  1OT6 A;  4DJ2 A;  2D01 A;  3V3S A;  3T4O A;  1T1A A;  3RFB A;  1ZG4 A;  2W3F A;  1PI5 A;  3A0V A;  3N4I A;  2QWS A;  2LB5 A;  5E2E A;  2BAS A;  1JWP A;  2ZC6 B;  4XT2 B;  3LI9 A;  2PHY A;  4OVD A;  3NY4 A;  2Z2M B;  3OBF A;  4LRX C;  3WS4 A;  2EWV A;  2Y2K A;  4UHU A;  3KSF A;  4FOF A;  5FAQ A;  4B93 A;  5FQ9 A;  4IVI A;  1RGZ A;  5FDS A;  1S0W A;  2EXB A;  1LLB A;  4JKT A;  4CLC B;  4EWF A;  3WWX A;  4E3K A;  3VP2 A;  1FR1 A;  3UE3 A;  4YNR A;  2B18 A;  2JN7 A;  4BBT A;  3HLE A;  4OQH A;  2JHE A;  4AFI A;  1SHV A;  1STZ A;  4GCZ A;  3ZNT A;  3NOU C;  1AXB A;  2Y55 A;  1KGF A;  2Y2J A;  3V3R A;  3QP1 A;  2WGW A;  3RXW A;  3G34 A;  4C75 A;  3RTY A;  5JYP A;  3HVF A;  4S2M A;  1H0M A;  2X71 A;  2JCH A;  3NCK A;  3HLC A;  1S67 L;  4PM7 A;  1EI5 A;  4DMZ A;  2ZLY A;  1TS6 A;  5TGF A;  2VGJ A;  3LY4 A;  4ZJ2 A;  2PRF A;  4S2L A;  3VOY A;  2JKR I;  2H10 A;  2GX5 A;  1ONG A;  3A3F A;  5AQB A;  4DKI A;  5EEC A;  4I39 A;  2J3T D;  1F9I A;  2H28 A;  1ESU A;  4KG6 A;  5K5B A;  3E4O A;  2EX8 A;  2JC7 A;  2J3T C;  2ZQ7 A;  4EQ1 A;  2KLI A;  3BY9 A;  1QMF A;  4ZRR A;  2V9A A;  4UQI M;  2QMI A;  1KGG A;  4KQQ A;  2EFU A;  3G2Y A;  3MMH A;  2XLN A;  2WKQ A;  5AVF A;  1XJ6 A;  5D3O A;  1J3W A;  1K25 A;  4DE2 A;  1YPR A;  4DJ3 A;  5FQQ A;  3P09 A;  4ZJ1 A;  1MBL A;  4KZ8 A;  4HP9 A;  1XA1 A;  4GDB A;  3IF6 C;  2HGV A;  5LBR A;  4X55 A;  3KSH A;  3DWK A;  3LIB A;  3WS2 A;  4WYY A;  5G4Y A;  1JVJ A;  3PTE A;  2VGL M;  1ZTU A;  2W3E A;  1BT5 A;  2WAD A;  3E2L A;  3IX8 A;  4S2P A;  4Y0O A;  2RL3 A;  3M6B A;  4EBN A;  5FAS A;  3BFG A;  3OC2 A;  4PKY A;  1FQG A;  1TS7 A;  3NEC A;  2J8Y A;  3HUM A;  3CG5 A;  2V1A A;  2ZQD A;  3S22 A;  1TEM A;  1VHM A;  5F83 A;  5E2H A;  2O9B A;  1ZC2 A;  4U0X A;  4JXS A;  4HJ6 A;  5TBM A;  4Y17 A;  3HLF A;  2QKP A;  3JPU A;  2XD1 A;  1DJA A;  5F69 A;  3P98 A;  2PR6 A;  5CGW A;  4U3T A;  1FIK A;  2XFS A;  3Q7V B;  4O01 A;  4B4Z A;  3PR6 A;  2Y8H A;  5FAP A;  3G4P A;  3FYZ A;  1K55 C;  4XUX A;  5CED A;  3BFC A;  2WKP A;  4IUK A;  4UEY A;  3PXP A;  4QPR A;  2OLV A;  4KQR A;  4ETX A;  2HDU A;  3Q82 A;  2D02 A;  4EEP A;  4ID4 A;  3H7W B;  4WMC A;  4X6T A;  4WEL A;  3GQZ A;  2WK0 A;  3KSI A;  5M18 A;  2C5W B;  3FPV A;  4R38 A;  3F1P A;  4CQH A;  3C8C A;  4KUO A;  1W63 Q;  4KQD A;  5IT5 A;  3NBL A;  1I2S A;  2Y2Q A;  2QZ6 A;  3IBR A;  1PW1 A;  1NXY A;  2QJ7 A;  4N92 A;  4HJ4 A;  4RX3 A;  3E2K A;  4E3O A;  3VMA A;  1XGI A;  4P6Z M;  5TBM B;  1G6O A;  4O8G A;  5DTK A;  4U0T A;  2OWJ A;  4C6Y A;  2V20 A;  1XGJ A;  4JGQ A;  2ZOI A;  3HBR A;  4EW7 A;  1CI8 A;  3V50 A;  1VQQ A;  3T1X A;  4X1L A;  3MXQ A;  1KE4 A;  2L4R A;  2HDR A;  2A24 B;  5CER A;  5EVI B;  1E4D A;  2ZJ9 A;  1NLY A;  3Q81 A;  3GTC A;  5EFW A;  4O7D A;  3Q7Z A;  1XFQ A;  3GEC A;  1W7F A;  2Z6C A;  4BD1 A;  4R1G A;  3IX3 A;  2VA0 A;  2IWB A;  1ERQ A;  2Y59 A;  4OOL A;  4X68 A;  5FI7 A;  3SS5 A;  3FWL A;  3MKF A;  1JNU A;  2HP9 A;  4FUW A;  4ESP A;  3MFD A;  5FI6 A;  3MF0 A;  2G7U A;  1PFL A;  5DKL A;  3EOI A;  3MJQ A;  2Y4A A;  3VSK A;  3IXG A;  1PRQ A;  2INW A;  1Q2P A;  2Y91 A;  1IYS A;  3UB6 A;  4PM6 A;  5HAR A;  3IS2 A;  4DE1 A;  1M40 A;  5A93 A;  1XXM A;  2B5R A;  1NYM A;  2VJW A;  4PM5 A;  2PU4 A;  3QP8 A;  4JBF A;  5J3W A;  3BWL A;  4PM9 A;  3TRC A;  4D60 A;  5KSC A;  1YLJ A;  3P7N A;  3ZVW A;  1GA9 A;  1YMS A;  3E0Y A;  1MPL A;  3NHQ A;  3W2Z A;  1YLZ A;  1HD8 A;  2XGN A;  2QJ5 A;  2Y2P A;  3IXH A;  1NRJ A;  4R23 A;  2O99 A;  2EX2 A;  5J7E A;  3JYI A;  3ZG8 B;  4LCM A;  3TG9 A;  2DNS A;  1I2W A;  1FSY A;  2XK1 A;  3QNC A;  5HAQ A;  2XFT A;  3HLW A;  5GL9 A;  5L09 A;  1OTA A;  3V39 A;  3CWF A;  3G32 A;  1LI9 A;  1P0Z A;  3LR5 A;  1LL9 A;  2K7S A;  3JVU A;  3T1Q B;  1TDL A;  3HJK A;  1PWG A;  2ACG A;  2EFX A;  5EOE A;  4R0Q A;  3EWK A;  5FDH A;  4GKU A;  1UWP X;  4EET B;  1YQS A;  3SZT A;  2C6W B;  1BSG A;  2ZOH A;  5L07 A;  3NOT C;  2VV8 A;  4LV3 A;  1SZV A;  1W5D A;  5EM1 A;  4E04 A;  3T4S A;  1C3B A;  1K54 C;  1VEU A;  3L9K A;  2A3U A;  1YKD A;  4L0L A;  2VV7 A;  5CX7 A;  1BUE A;  3VP1 A;  3HLD A;  1GSW A;  4OQG A;  2WGI A;  5EVI D;  1LSW A;  1O7E A;  3LEZ A;  4G3W A;  2WKE A;  1BUL A;  5HD5 A;  4PHT A;  4NXG A;  2E8J A;  4HES A;  1K56 D;  3PBT A;  4EER A;  2ZC7 A;  3MQO A;  4Q8I A;  5EUA A;  3I7J A;  4OQI A;  1G5U A;  3N7W A;  3LUQ A;  1G68 A;  1XJ2 A;  2DCF A;  2O0Y A;  1IEL A;  3VP4 A;  4OP5 A;  1OTE A;  1Y4O A;  2OWH A;  3C2W A;  3OOV A;  3B33 A;  4MBF A;  1T1C A;  1TVF A;  4EES A;  4KG2 A;  5DFY A;  3BYD A;  3UN7 A;  2XQZ A;  4JPM A;  5AQ9 A;  5TFQ A;  3LEQ A;  1ES2 A;  1KDS A;  4MN6 A;  4ZAM A;  1SCW A;  4QU3 A;  1L0G A;  1LT0 A;  3VV4 A;  2JE5 A;  1LSX A;  1XJ4 A;  4I3J A;  3W4Q A;  3HCY A;  3OZH A;  4EUV A;  1VEU B;  4E6W A;  2PAV P;  4X69 A;  3C38 A;  4Y3I A;  3GVB A;  4I3A A;  1PZO A;  3OCL A;  5EOO A;  4LRZ E;  4LPZ A;  4KZ4 A;  1X0O A;  4YFM A;  4RX2 A;  1K38 A;  1OJ5 A;  5EV0 A;  3G30 A;  4XT2 A;  2HP5 A;  3LIE A;  4UA6 A;  1MWU A;  4R6L A;  1L3L A;  5DJU A;  3DTM A;  3MZE A;  2J80 A;  3FPW A;  2ZL1 A;  2XRO A;  3PBO A;  2JKF A;  1DJC A;  1Z6F A;  3CHW P;  2HV1 A;  5CGX A;  5DF7 A;  4CLC A;  1NWZ A;  1XKZ A;  3U2A A;  3HJI A;  4ETZ A;  4H8R A;  4HHD A;  3NIA A;  2JBF A;  5HDS A;  1IKI A;  4KZB A;  4BJP A;  5M1A A;  2CMN A;  3G2Z A;  4H6J B;  5FL3 A;  1I5Q A;  3KYQ A;  1YLW A;  4F3L B;  4FH2 A;  2HJE A;  1FOF A;  1TDG A;  2OSU A;  2ZM0 A;  4EBL A;  2E8I A;  2XR0 A;  2LB9 A;  1ES4 A;  4CLC D;  3BRM A;  4GNU A;  4KG5 A;  2XD5 A;  4PAU A;  5HL6 A;  2Y79 A;  1D1J A;  3ZG9 B;  3MQQ A;  3UE1 A;  2V1B A;  3HRE A;  4QHC A;  3KYE A;  3OLO A;  2J7V A;  4Y7P A;  2Z6D A;  2P08 A;  1TS0 A;  5TR7 A;  3TJZ C;  3FKW A;  3MS6 A;  3K2N A;  1U60 A;  3KSG A;  1GSX A;  3ZFZ A;  5TJJ A;  5AQA A;  4GJ4 A;  3NDG A;  3OPP A;  1ESI A;  2VK3 A;  3Q7V A;  4LV2 A;  3HUO A;  1IFQ A;  1S4R A;  5JYO A;  3NC8 A;  2WAE A;  4S2N C;  4OPZ A;  4GD6 A;  1MKI A;  3UPN A;  3VE4 A;  1OTD A;  1P97 A;  5GHZ A;  3LO7 A;  1FCO A;  2WUQ A;  4IVK A;  4R3A A;  2ZMV A;  4DF6 A;  4HBU A;  2IWD A;  3UB9 A;  3IF6 B; 
#chains in the Genus database with same CATH homology
 2ZQ9 A;  1PW1 A;  5GLB A;  4KZ6 A;  1YM1 A;  1BZA A;  4WEJ A;  5GLA A;  4E3L A;  1NXY A;  4N92 A;  4GN2 A;  4QY5 A;  5CRF A;  3SH7 A;  2IWC A;  3G31 A;  3OPL A;  1MXO A;  4RX3 A;  3E2K A;  4E3O A;  3C4O A;  4MBK A;  1YLT A;  1NZO A;  3VMA A;  4OKP A;  1XGI A;  2J9P A;  4FCF A;  3UPO A;  4F94 A;  5DTK A;  4U0T A;  1KVL A;  4WZ5 C;  4N9L A;  4BQM A;  2V20 A;  4C6Y A;  1FSW A;  5CHJ A;  3ITA A;  1XGJ A;  4OPY A;  1H8Z A;  3HBR A;  1E25 A;  5BOH A;  3PBQ A;  4HEF A;  1CI8 A;  4N9K A;  1JWZ A;  2V1Z A;  4ZTK A;  2H5S A;  1EWZ A;  3V50 A;  1HTZ A;  1VQQ A;  3SOI A;  5HL1 A;  1KE4 A;  3PBR A;  5FAO A;  3IF5 A;  2HDR A;  1NJ4 A;  5E43 A;  5HFO A;  3MXS A;  4IED A;  3S4X A;  2Q9M A;  5CER A;  4KZ3 A;  2ZC5 B;  4OON A;  5EVI B;  3UDI A;  5HX9 A;  1WYB A;  1E4D A;  2ZJ9 A;  4XUZ A;  3Q81 A;  3GTC A;  1K55 A;  2UWX A;  1JWV A;  3IXD A;  4O7D A;  3VP0 A;  2R9W A;  3SS3 A;  1S6R A;  1YLY A;  3Q7Z A;  2GDN A;  4GDN A;  1PWD A;  1Q2Q A;  3QNB A;  4LEN A;  3IF6 B;  1BLH A;  3UDF A;  4E3J A;  4FD8 A;  1HVB A;  2PBY A;  2A49 A;  5A90 A;  1GHM A;  4WM9 A;  1BLS A;  1W7F A;  1GHP A;  5F82 A;  4BD1 A;  3VFF A;  5I94 A;  4R1G A;  1H8Y A;  1ERQ A;  1FCN A;  2Y59 A;  4OOL A;  4X68 A;  2IWB A;  2V2F F;  1ONH A;  1ALQ A;  3VOZ A;  1NYY A;  5FI7 A;  3SS5 A;  4S2O A;  5KZH A;  1YMX A;  3LCE A;  2PU2 A;  3FWL A;  3MKF A;  3UNW A;  4P87 A;  2HP9 A;  4Y0U A;  1RCJ A;  2H0Y A;  5L2F A;  5KMW A;  1K57 C;  3MFD A;  4FH4 A;  5FI6 A;  1E3U D;  3A3I A;  4QY6 A;  1DY6 A;  3EQV A;  1QME A;  4E3M A;  2ZQC A;  1W8Q A;  4DE0 A;  5J8X A;  2Y4A A;  3VSK A;  4EQI A;  3IXG A;  4KZ7 A;  5FSR A;  3M6H A;  4JXV A;  4PPR A;  4QD4 A;  5FQK A;  2ZQ8 A;  3GMW A;  3PBS A;  1BLP A;  1Q2P A;  1MY8 A;  2Y91 A;  5EE8 A;  1O07 A;  3CZD A;  2Y2N A;  2G2U A;  5A92 A;  1N9B A;  3FZC A;  1WE4 A;  4DDS A;  3G35 A;  1IYS A;  4MNR A;  3SH9 A;  2XEP A;  4DE3 A;  4PM6 A;  4NK3 A;  1RGY A;  3CMZ A;  1ES3 A;  5HAR A;  2J9O A;  5AQ7 A;  5FI2 A;  4C3Q A;  1KGE A;  1JTD A;  3A3E A;  4S2N A;  1M40 A;  3N8R A;  4DE1 A;  3BFF A;  5A93 A;  4KZ5 A;  1XXM A;  2B5R A;  1E3U A;  1NYM A;  4XXR A;  1PIO A;  3W4P A;  4PM5 A;  2PU4 A;  4JBF A;  4PM9 A;  1KE3 A;  2FFY A;  3GV9 A;  3SH8 A;  3ZG5 A;  4EUZ A;  3LY3 A;  4NET A;  3IWQ A;  1KDW A;  2P9V A;  4OLG A;  4RA7 A;  3MXR A;  1G6A A;  5KSC A;  3VP3 A;  5CEC A;  1YLJ A;  4LV0 A;  1XX2 A;  3ZVW A;  3RXX A;  1GA9 A;  1YMS A;  5EVI C;  5CTM A;  1IYQ A;  1MPL A;  4UA9 A;  1FCM A;  1LHY A;  4R3J A;  3IWI A;  4K0W A;  2HP6 A;  2VGK A;  4E3N A;  1YLZ A;  4WZ4 A;  3WRZ A;  2HDQ A;  1HD8 A;  4WZ5 A;  2XGN A;  2WZZ A;  2H0T A;  5EPH A;  1LI0 A;  2EX9 A;  2FFF B;  3BFD A;  3ZDJ A;  4PMA A;  1SKF A;  4QJG A;  4UAA A;  2G2W A;  2Y2P A;  3IXH A;  1NY0 A;  4R23 A;  3ZG0 A;  3IT9 A;  3C5A A;  1SDE A;  1DJB A;  3M2K A;  4OOM A;  2QPN A;  5FQI A;  2EX2 A;  3V3S A;  1GA0 A;  4ZBE A;  4IBR A;  4S2J A;  3JYI A;  3ZG8 B;  4LCM A;  3OPH A;  2DNS A;  1SDN A;  3O88 A;  3TG9 A;  3PBN A;  1YT4 A;  3AGE A;  4JF5 A;  3W4O A;  1ZG4 A;  4JLF A;  1I2W A;  2X01 A;  3UY6 A;  2Y2M A;  1FSY A;  1PI5 A;  2XK1 A;  3QNC A;  1IKG A;  3N4I A;  5HAQ A;  2XH9 A;  2XFT A;  3HLW A;  5GL9 A;  4OLD A;  4OH0 A;  2BLS A;  3V39 A;  3G32 A;  5E2E A;  1LI9 A;  1JWP A;  2ZC6 B;  1LL9 A;  3ZCZ A;  1K4F A;  4OVD A;  3NY4 A;  2Z2M B;  1TDL A;  4B88 A;  3WS4 A;  4BD0 A;  1XA7 A;  4JXG A;  4X56 A;  4RVA A;  2Y2K A;  4UHU A;  5GHY A;  4N1H A;  1PWG A;  4ZJ3 A;  5E2F A;  2EFX A;  1Y54 A;  3D4F A;  2BG1 A;  4A5R A;  5EOE A;  3V5M A;  4R0Q A;  5FDH A;  5FAQ A;  4GKU A;  1BLC A;  5FQ9 A;  4IVI A;  5G18 A;  5CHM A;  1RGZ A;  1YQS A;  3ZG7 B;  2C6W B;  1BSG A;  1S0W A;  3UE0 A;  2Y2I A;  1ZG6 A;  2EXB A;  1LLB A;  4JKT A;  2Y2O A;  4P0M A;  5FAT A;  4EWF A;  3WWX A;  5F1G A;  3BEC A;  4LV3 A;  5DF8 A;  4E3K A;  3VP2 A;  1FR1 A;  2ZMA A;  3IF6 A;  3A3J A;  1W5D A;  1N4O A;  4HBT A;  4YIN A;  4OP8 A;  2OV5 A;  3UE3 A;  2WZX A;  2X02 A;  3IQA A;  1PI4 A;  1C3B A;  3NDE A;  1MWS A;  3HLE A;  1K54 C;  3OPR A;  1W79 A;  1M6K A;  2Z2L B;  2A3U A;  3VFH A;  2WYX A;  4L0L A;  4OQH A;  2Q9N A;  3DW0 A;  1SHV A;  1BUE A;  3ZNT A;  3VP1 A;  3HLD A;  1AXB A;  2EX6 A;  2Y2L A;  2WGI A;  3IHA A;  4OQG A;  4R4R A;  2Y55 A;  1KGF A;  5EVI D;  1O7E A;  3LEZ A;  5FA7 A;  3WRT A;  2Y2J A;  2WKE A;  4E6X A;  2WKH A;  5A91 A;  1BUL A;  3V3R A;  5CHU A;  1L0E A;  2WGW A;  4EBP A;  3RXW A;  1HZO A;  3G34 A;  4BLM A;  4C75 A;  4P6B A;  3HVF A;  5JYP A;  4X53 A;  4S2M A;  1VM1 A;  4HES A;  3IH8 A;  3N6I A;  1ERM A;  1K56 D;  3PBT A;  2X71 A;  4E3I A;  3UDX A;  1J9M A;  4Y0T A;  5HAI A;  1XPB A;  2ZC7 A;  4Q8I A;  3DWZ A;  4GOG A;  2JCH A;  5EUA A;  3NCK A;  3HLC A;  3I7J A;  4OQI A;  1W8Y A;  4OQ0 A;  1PWC A;  3N7W A;  1XP4 A;  3ZGA B;  4P85 A;  4PM7 A;  2HPB A;  1EI5 A;  1L2S A;  3ZNY A;  3TSG A;  1G68 A;  1NRF A;  2DCF A;  2I72 A;  2ZLY A;  5TGF A;  1IEL A;  2VGJ A;  3LY4 A;  3VP4 A;  3C4P A;  4ZDX A;  4ZJ2 A;  4OP5 A;  2CC1 A;  1H5X A;  2ZM2 A;  4S2L A;  1MWT A;  4MBF A;  1TVF A;  3IXB A;  3VOY A;  4KG2 A;  2H10 A;  4MLL A;  5DTT A;  4JF6 A;  1ONG A;  2ZQA A;  3A3F A;  3BYD A;  5AQB A;  3UN7 A;  2XQZ A;  4JPM A;  5EEC A;  2ZM8 A;  4DKI A;  4DXC A;  4GD8 A;  1PZP A;  5AQ9 A;  5GHX A;  2WGV A;  5TFQ A;  1ERO A;  3PAE A;  5GLD A;  1ESU A;  5CXW A;  1ES2 A;  1KDS A;  4ZAM A;  1SCW A;  1IYO A;  4QU3 A;  4KG6 A;  1L0G A;  1CK3 A;  3PAG A;  3UO9 A;  1ZKJ A;  4S2I A;  2EX8 A;  3VSL A;  2JC7 A;  2JE5 A;  4QB8 A;  2ZQ7 A;  3N8L A;  3W4Q A;  4DDY A;  1MWR A;  5CEB A;  1QMF A;  3OZH A;  2QMI A;  3W8K A;  3IH9 A;  1KGG A;  1OME A;  4KQQ A;  4KEN B;  2EFU A;  4GB7 A;  4S2K A;  4E6W A;  4X69 A;  3G2Y A;  3ISG A;  2XLN A;  5IHV A;  1IYP A;  2WKI A;  3MZF A;  3GVB A;  5D3O A;  1PZO A;  3OCL A;  3ZVT A;  5EOO A;  4K91 A;  5DTS A;  4DXB A;  1K25 A;  4DE2 A;  3AGD A;  3HL9 A;  4KZ4 A;  4FSF A;  2WGW B;  3IHB A;  4YFM A;  5DF9 A;  5FQQ A;  4RX2 A;  1K38 A;  3N8S A;  3HUN A;  3BLS A;  3P09 A;  4CPK A;  4ZJ1 A;  1MBL A;  4M3K A;  3WS5 A;  4D2O A;  4KZ9 A;  3EQU A;  1K54 A;  3O87 A;  4KZ8 A;  2ZD8 A;  4UA7 A;  1XA1 A;  2RCX A;  3BEB A;  4N1X A;  4GDB A;  2Y2H A;  3IF6 C;  4BL2 A;  3BLM A;  3G30 A;  4X55 A;  3HLB A;  2HP5 A;  3C7U A;  1KVM A;  3DWK A;  2P9V B;  4K0X A;  1PW8 A;  4B4X A;  4UA6 A;  5F1F A;  1WYC A;  3WS2 A;  1MWU A;  4WYY A;  1JVJ A;  3PTE A;  3WS0 A;  3HLG A;  3FV7 A;  5HAP A;  3GRJ A;  3DTM A;  1BT5 A;  1KE0 A;  3MZE A;  3ITB A;  1RP5 A;  1L0F A;  3SS4 A;  4WEK A;  4PM8 A;  3PBO A;  4KQO A;  2WAD A;  3E2L A;  1DJC A;  1Z6F A;  4S2P A;  5CGX A;  4Y0O A;  5DF7 A;  3M2J A;  3Q07 A;  1GCE A;  1XKZ A;  2RL3 A;  3M6B A;  3GSG A;  3MBZ A;  4EBN A;  5FAS A;  3BFG A;  4EV4 A;  1CEF A;  4H8R A;  3NIA A;  3OC2 A;  2JBF A;  1IKI A;  4KZB A;  1FQG A;  3CJM A;  3O86 A;  4BJP A;  4BL3 A;  2XDM A;  5M1A A;  1CEG A;  2EXA A;  1ES5 A;  3G2Z A;  3FKV A;  1K4E A;  3BM6 A;  1I5Q A;  1PYY A;  5M19 A;  3NI9 A;  2P74 A;  3OCN A;  4WMC D;  1YLW A;  2J8Y A;  4IBX A;  4DRT A;  4FH2 A;  3HUM A;  5CGS A;  3CG5 A;  5FQM A;  1K6R A;  1FOF A;  1TDG A;  2ZQD A;  4GZB A;  4KZA A;  2OSU A;  3S22 A;  2ZM0 A;  2ZC4 B;  4EBL A;  1TEM A;  3IWO A;  5E2G A;  2E8I A;  3GR2 A;  2XR0 A;  4CJN A;  2OLU A;  4JXW A;  5F83 A;  5FQJ A;  1ES4 A;  1K57 A;  5E2H A;  1ZC2 A;  3BRM A;  4GNU A;  4U0X A;  4JXS A;  4KG5 A;  2XF3 A;  2XD5 A;  3AGF A;  1GHI A;  5DVA A;  2HDS A;  4MBH A;  4BEN A;  4Z9Q A;  3ZG9 B;  3HLF A;  3C7V A;  5KSH A;  4LCL A;  1L0D A;  1FR6 A;  3UE1 A;  2XD1 A;  1DJA A;  1K6S A;  3HRE A;  3P98 A;  4QHC A;  4LV1 A;  5CGW A;  2J7V A;  4Y7P A;  3MKE A;  3O3V A;  4U3T A;  1CI9 A;  2XFS A;  3B3X A;  3Q7V B;  5GLC A;  5U47 A;  3UPP A;  3ZHH A;  5EVL A;  4B4Z A;  3A3D A;  1NZU A;  5TR7 A;  3FKW A;  3S1Y A;  5FAP A;  5EVI A;  3G4P A;  1U60 A;  3FYZ A;  1K55 C;  3MZD A;  4OOY A;  1YLP A;  4XUX A;  5CED A;  1BTL A;  3BFC A;  1IEM A;  3ZFZ A;  5AQA A;  4OPQ A;  1LL5 A;  3NDG A;  4OPR A;  4RYE A;  1JTG A;  2OLV A;  4KQR A;  3OPP A;  4WBG A;  1ESI A;  3RJU A;  3Q7V A;  4LV2 A;  2WAF A;  3HUO A;  2HDU A;  4R3B A;  3Q82 A;  3WS1 A;  5JYO A;  3NC8 A;  4ID4 A;  2WAE A;  4WMC A;  4S2N C;  4X6T A;  4OPZ A;  4WEL A;  3GQZ A;  2WK0 A;  3TOI A;  5M18 A;  4GD6 A;  1MKI A;  3UPN A;  5HW3 A;  2C5W B;  4R4S A;  3Q1F A;  1K56 A;  2ZC3 B;  3QHY A;  2R9X A;  5GHZ A;  3LO7 A;  4JF4 A;  1FCO A;  2WUQ A;  4IVK A;  2DRW A;  4DF6 A;  4HBU A;  3BFE A;  3NBL A;  5CTN A;  1I2S A;  2IWD A;  2Y2Q A;  4MEZ A;  2QZ6 A;  2Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...