1DYOA

Xylan-binding domain from cbm 22, formally x6b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
PDAGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGSESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQRYDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X6 Thermostabilising Domains of Xylanases are Carbohydrate Binding Modules: Structure and Biochemistry of the Clostridium Thermocellum X6B Domain
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE Y
total genus 31
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1dyoA00
4QB1A 5JXIA 1K42A 1L7QA 1UY1A 3OGRA 5LA2A 4ZXEA 3T0AA 4W4ZA 3WNLA 1UWWA 3CMGA 3MV11 2VZPA 4RN5A 5DN2A 3A21A 2WN2A 2VZSA 3K75B 1F4AA 4E8CA 1CZTA 4BK5A 5HPOA 1L7RA 2RV9A 4GWIA 1CZVA 1GOGA 2ZEYA 1KGYA 3DYMA 3I2JA 1W8NA 2VMEA 2EIEA 3HNBM 3JXSA 1SDDB 3C7HA 2E31A 3LPGA 2DCJA 4PQQA 4FI9A 3CZJA 1YQ2A 2LS6A 2W1QA 2VZQA 2WDBA 1W8OA 2E26A 3C7EA 4W8JA 3LEKA 2Y6GA 3WF4A 4IUGA 5C7GA 2DCKA 2WZ8A 4MGSA 3T08A 3MV01 3HPNA 3W5MA 2Y6HA 1US2A 2ZEWA 1JZ7A 2J1AA 3AC0A 4D0QA 2VM9A 2VCCA 3VD7A 1OD3A 2E33A 5IHRA 2YFUA 4ZZ8A 2VQUA 3EB7A 4XUTA 3WNMA 4P02B 3VDCA 3SKJE 1O8SA 4BK4A 2B4KA 3I97A 5HXMA 1BHGA 2VZRA 3UESA 4A3ZA 4QX0A 1GOFA 4MGQA 2VZUA 3WF0A 2ID4A 1O59A 5B4NA 3NQHA 1W9TA 2Y8KA 2XOMA 4CUCA 1GQPA 2QQIA 2QQOA 3UETA 3P1IA 4UAPA 2YC2A 2WAOA 5JXGA 1GMMA 2WYSA 3BN6A 2VQTA 2VMCA 2ZXQA 3CKHA 5G04L 2VZVA 4KMQA 3K4AA 3LEGA 1D7PM 3WNKA 1UY2A 4M4RA 1J83A 4CUBA 3T2QA 3VDAA 4QX3A 2HYXA 3WF3A 2VMDA 5B4XA 2W94A 1HN1A 4ZZ5A 3ACHA 4BDVB 3K4ZA 2WO3A 4DXRA 3W5NA 1XNTA 2YC4A 3C7OA 5F7UA 2C26A 2W87A 3BGAA 3FHAA 5JR2A 1JZ4A 3T09A 2HLEA 3VDBA 3ABZA 2CDPA 3E1F1 2WBKA 3GDBA 1PMHX 4A6OA 1I5PA 1JHJA 3MUZ1 3NRUA 2BBAA 1OF4A 5JXJA 4PT6A 5EJZB 2J7MA 4ARXA 4AAXA 2VTFA 5IJRA 5C70A 1LNSA 4QX1A 1EUUA 5I0DA 4XUPA 1UY4A 3IAPA 1RYYA 4DUWA 1W0NA 2BGPA 2X10A 1MPXA 2Y6KA 3UNPA 1H6YA 2CDOA 3OBAA 1DYOA 2Z4FA 1R64A 2W9XA 3GGLA 3DYPA 5G05L 1JZ3A 4QDSA 2WN3A 4OMDA 3IB3A 2W91A 4CU8A 1P8JA 2QBXA 2W95A 1JI6A 4XVHA 4ET7A 4HG6B 2QQLA 1W9WA 3ACIA 4M4PA 4BXSV 2B9VA 3T0DA 4XZUG 2BZDA 2WABA 4KI5M 5LA1A 2VZ3A 4XUOA 2J1VA 3PUHA 4TTGA 5LA0A 4CVUA 2VZ1A 4JKLA 5IFPA 4OYUA 4OUEA 1TG7A 2J1UA 3T2PA 1OH4A 4QPWA 1T2XA 3VD3A 2QQMA 2DDUA 4AG4A 4DUVA 1JYWA 2EICA 5C71A 3J7HA 3K77A 3HNYM 3FL7A 1TVGA 2WO1A 3NJVA 2VZTA 2RJ2A 5DPNA 2V72A 1SG3A 5CYYA 3EYPA 3IAQA 3MUY1 2BGOA 3T0BA 1OT5A 3THDA 3WQBA 3DECA 3K46A 2VR4A 2PQSA 3ACFA 2VL4A 1F4HA 4ARYA 2W1SA 1GUIA 2OKXA 1UXXX 4XUNA 4A45A 3I3EA 3C8XA 3WF1A 1EUTA 4E8DA 1JZ8A 1O8PA 4P5YA 4OZOA 2EIDA 4Z2AA 4TXWA 1UYZA 1XPWA 3HOBA 3C7FA 1ULOA 3D3AA 1JYVA 4LHSA 1PMJX 4MOAA 2VJXA 4QB6A 1CX1A 3IDAA 1XNAA 2EIBA 4D8MA 5CZKA 3VD9A 5EJ1B 1GNYA 1UYXA 4QDQA 2L9LA 1UY3A 4L0PA 3CQOA 3I2HA 2WO2A 3NNGA 1JZ6A 2LW8A 2W92A 4JKMA 3LE0A 1NAEA 1NKGA 3PUIA 2ORXA 1XC6A 3IIIA 1JU4A 2J1TA 2QQJA 3MBWA 3P6BA 4UOJA 4CUAA 2BERA 3WF2A 2J1RA 2J1EA 1UYYA 4JKKA 2W3JA 4XURA 2V4VA 3I2IA 5IYYA 3OB8A 1WKYA 2WAAA 4A4AA 1NUKA 2WUHA 2WZEA 2W47A 2WQ8A 3HEIA 2W5FA 2XHNA 3VD5A 3I3DA 1UX7A 2VO5A 5A1AA 1SHWB 4BJ0A 5JMOA 3DYOA 4CU7A 3WNOA 3K4DA 1UY0A 4QX2A 4A41A 4LKSA 1UXZA 2JKXA 5J1XA 3OGVA 4QB2A 4RYDA 1W99A 1NX9A 2Y6LA 3I3BA 4YPJA 1PX4A 2W46A 3A23A 3LQCA 1JYXA 2VCAA 3WNNA 3I2GA 1K3IA 2ZEXA 3SEEA 1KEXA 2VOTA 2VCBA 2Y64A 3U37A 3ZM8A 3THCA 5LCWL 1CZSA 2E32A 4UI9L 3ECQA 4KWUA 4QAWA 3OEBA 4OMCA 1H6XA 4MADA 3SEPA 2Y6JA 5JXHA 3GM8A 4DUXA 5IFTA 2J1SA 1JZ5A 4ZY9A 2XONA 4XUQA 1J84A 3NJXA 1JU3A 3C7GA 4LPLA 3WSOA 4PF1A 2VMFA 4CU6A 2JD9A 4W50A 1UZ0A 2VC9A 1OF3A 4DEVA 1IQDC 1DP0A 3I2FA 4JX0A 2YB7A 2YG0A 4QDRA 3VD4A 2W1UA 3MO4A 1ULPA 4A42A 1GU3A 3HN3A 2X05A 3FHQA 5DMYA 1US3A 4DEQA 4JHZA 3LPFA 3GXUA 1PX3A 1K12A 3SKVA 2VZOA 4LQRA 2XQXA 4CU9A 3T2OA 3LEIA 1DLCA 3CZUA 2C4XA 3OGSA 4P00B 2W1WA 1K45A 2R7EB 2RVAA 2C9KA 3I2KA 1UMIA 2JDAA 4MO3M 3ETPA 3OEAA 4DXSA 3WEZA 1JYNA 2J22A 3A22A 3HJRA 5EIYB 2KD7A 5FUIA 1CIYA 2JE8A 3ACGA 3OG2A 5JUVA 2YFZA 5DQ0A 1GOHA 1W9SA 4A44A 4GWJA 1UMHA 4DXTA 2ORZA 4GZ9A 1JZ2A 4P08A 2V5DA 3CIHA 2ZEZA 3CDZB 2QQKA 2QQNA 1WCQA 3HNMA 3WNPA 2X09A 3FN9A 3A7QA 3F2ZA
chains in the Genus database with same CATH superfamily
2A71A 1ZZ8A 3WW2A 5HV0A 3TEWA 1AVBA 4OQ9A 2CGPA 4BISA 2P5BA 5GM0A 2WWUA 1ALYA 1POQA 1UY1A 2JDKA 4X6QB 3UKVA 4L92A 5LA2A 1A78A 3T0AA 3WNLA 1QEXA 4LOSA 1UWWA 1Z7S1 3NNLA 4ZXKA 3VBUC 5IATA 4WZFA 3DL3A 4XJ9A 5AC93 5M0TA 4RN5A 5DN2A 3RJRA 2FDHA 3LDRA 2OA2A 4HSLA 1C1FA 5GLZA 3JD72 4YZ2A 1S0DA 4FTSA 4I09A 3EMRA 4CZSA 4JTOA 1F4AA 5HCAA 4YGEA 1CZTA 4AVCA 3WX5A 4BK5A 3NV4A 5HPOA 4YVSC 4QHOA 2BFUS 2RS32 1DLLA 1PGL2 1CZVA 2GC1A 4Q8KA 2R043 1Y43B 1QJFA 1GZWB 1AR92 2EIEA 3CNAA 3HNBM 1W8ZA 1NE6A 2DCJA 2VXJA 5FMBA 2XJVA 2YPDA 4FI9A 4LKDA 4CYDA 1W8UA 1FAYA 4OZXA 5DG1A 5LB6A 4G3YC 1W8OA 2WIIB 2XG3A 3LEKA 5DZEA 4FVVA 4INDA 4D94A 3IDEA 2Z69A 1CAXA 1V70A 1YYNA 1N1SA 1LR5A 4QPIB 5DABA 5E6HA 1ODMA 2RR13 2WRAA 2Y6HA 3INAA 3USUA 3WDYA 3AVRA 4PDWA 4YGCA 1ULEA 2E7QA 2OZJA 4IGOA 4MZUA 2RMU3 4EN9B 2YBPA 1OD3A 2WNOA 4YYOA 2E33A 4AVAA 1XYNA 4UFIA 2MEV3 2F4LA 4YGBA 1SFNA 1PK6C 3WNMA 3RGBA 1WWYA 3JBG1 5L9BA 3TRSB 4P02B 1PVC2 2VUAA 2VUJA 3LDBA 4LBQB 1SLTA 5D2AA 3SKJE 3KD4A 3VDCA 5GLUA 2RE9A 2VMIA 5CA6A 1XNCA 2ZABA 1BHGA 2VZRA 2UYAA 2WNVB 1I6XA 3BKZA 2BOIA 3EQEA 5KR7A 3ZKUA 1BEV1 1LOFC 2O8QA 5FR3A 2D3PA 2GC0A 3OGJA 2R49A 3WF0A 2A70A 3CJIB 4I0AA 1CAVA 1UL9A 4OHWA 4PIZA 5EWSA 2FZ1A 1D2QA 1G9FA 3NQHA 5T54A 4LO5B 2Y8KA 1REEA 2JDYA 2WQZC 2XOMA 1R081 5K0UC 5E16A 2QQIA 2QQOA 3OPTA 3ZFGB 3P1IA 5GZEA 4K40A 3I2DA 3LA7A 3VZLA 3VZOA 5K7PA 3BN6A 4FOWA 4YW5A 4CCLA 3N9OA 4DB5A 2VMCA 4BQXA 1IS6A 4KMQA 3SQOA 4CDWA 1STMA 3LEGA 1D7PM 2W0XA 3WNKA 3UL2A 1TNRA 4F83A 1RUNA 1AXYA 2K2SA 3B5LB 1YI9A 4DOUA 4JQTA 5GLTA 1COV3 1AXKA 5FCCA 4B1LA 2AREA 1D4VB 4ZZ5A 3ACHA 4RS5A 4FTEA 4PHZA 1FNYA 1GLHA 3POFA 2CYFA 3KM5A 4NOTA 1K5MA 1WGPA 4BLIA 3H8UA 1XNTA 4XXPA 4FPHA 2SLIA 4XPVA 3B69A 3Q8FA 3GALA 1YEWA 3T09A 4NE9A 3SCHA 5FDBA 3OUJA 3DXTA 5FP9A 3WXPA 4IV3C 3ZPOA 1ENRA 1PMHX 2QVSB 1W8FA 4QPYA 3VZKA 3SMHA 1SBEA 3ZSKA 1EPWA 2ZAHA 3BOPA 2BBAA 2ZX2A 3MIFA 3NRUA 4FT8A 3HVDA 1E5IA 5EJZB 4ARXA 3WW1A 1MS0A 3EHKA 1NCQB 5IJRA 2DF7A 2P3YA 5I0UA 1LNSA 2CU5A 2VG9A 1J1TA 3FC0A 4QQ2A 5DAVA 4QX1A 1EUUA 5C5TA 1RUG1 1QJU3 3H3ZA 5L73A 5KBFA 1QJZA 2WA4A 1X33A 3I2OA 1A3KA 3IAPA 3GZEA 4YFZA 1UZZA 3KF5A 3KT4A 4Z07A 5BUVA 2BGPA 2X10A 2HYKA 4QGNA 1QNYA 2CDOA 4LBLA 1FV3A 1UZWA 1RUH2 1GQHA 4N9IA 4CDUC 2Z79A 4DY3A 2H6CA 2QQPA 3M4FA 4F8AA 5FOJB 2W91A 3GJBA 3R0RA 4IEPA 4X6RB 4CU8A 1SPPA 2VOVA 2WS91 3GCXA 1AX1A 4XJAA 2FCVA 2P37A 5D8AB 1POV1 4H55A 3V0BB 1WMXA 3B01A 1PVXA 1TE1B 4XTPA 1W9WA 1NYWA 2ZTNA 1LECA 1RTVA 3ACIA 2BUKA 1YFUA 2RM21 3POSA 4LO8A 4NPRA 4UBGA 4FO9A 1G8WA 1ND2C 2BQPA 3RNSA 4CEWB 4FPCA 2BZDA 2WABA 4Q0QA 3T1LA 4F7ZA 2GU9A 2JKBA 2ERFA 3OUIA 2VZ3A 5DDJ1 3ZMOA 2J1VA 1YIPA 4DS0A 1RUJ1 3D82A 2IFWA 1TQ5A 2MHFA 4B1MA 2BW8A 2ZOEB 4H14A 5LA0A 2QDNA 2BTVC 1HRI1 1S4CA 3VBRC 5FLHA 4V1PA 5DZGA 5AVPA 2P6HA 2YMZA 3MPPG 1ZRCA 5L7OB 2FDFA 1OA4A 2VZ1A 5IFPA 1XNBA 3ZFGC 3O0VA 4GB31 1N1TA 1SEFA 1HIXA 4IESA 4JRAA 4R9DA 4BQ2A 1O3TA 3MW3A 1W6MB 2VBPA 5FWEA 4DNYA 2Z2SB 3VBUB 1TG7A 2P4EA 3T2PA 1DQ4A 5C9AA 2OVUA 4JDNA 4EJRA 1T2XA 1TME3 4EWDA 2CSGA 4K3UA 4Q4V1 1QXJA 1OSGA 3FBYA 4HKLA 3V56A 4AI0A 3IIAA 3KF3A 2XPJA 3S57A 3KGLA 4DUVA 2PLV2 1JYWA 1CN1A 4HONA 1DZTA 4Z2WA 1JBCA 2OYZA 4NUBA 3POWA 5C6CA 1YI7A 2K9ZA 1RJ7A 4UFJA 3OPWA 2AEZA 2ZBJA 1A6CA 1TVGA 3H7JA 5F2WA 1N1VA 2FBEA 1SG3A 3L9JT 4LK7A 3EYPA 2Q5TA 3IAQA 4NPLA 5CYYA 5FPUA 1H2MA 5IVVA 2BGOA 5F5AA 3HD8B 5LK5A 4YARA 2CWMA 2EA7A 3DF0A 2WNUC 4H7MA 4HOOA 1ENSA 2PXJA 1NLRA 2VR4A 3EBRA 5FO7B 1HB3A 2TBVA 2BVBA 1F8VA 2HKXA 3IDCB 2UYBA 2JDZA 4AXOA 4BZ4A 1UXXX 2FMDA 4AVBA 3Q8EA 4UFHA 2YGMA 4BA6A 5A6YA 5JWPA 1CESA 4A45A 2JE7A 4COUA 3PVBB 2LUWA 4QPIC 4IGPA 3WQ7A 1RUI1 2G9GA 4QKFA 5FZ0A 2XVLA 1GZCA 3VBSB 3MW2A 4LE3A 1WA6X 2CHHA 1QJX3 3DKQA 2EF6A 4CEWA 1OVSA 1XU1A 1YJLA 1BJQA 1H8TA 1D0GA 2RG4A 4A2UA 3ZXKA 5H9PA 4C1XA 2DV9A 3BU0A 1DGRN 1WLWA 1JYVA 2WNUA 1V6KA 5FQ0A 2JG9B 4MGZE 1JUHA 1ZYBA 2VJXA 2WZR3 4I02A 4NAOA 4AI1A 2FDGA 1CX1A 4R4ZA 1R1ZA 3H8OA 3HMYA 1DZRA 3KSCA 1GNZA 3AMNA 4S2GA 1APNA 5C4WB 3W9AA 3W58A 4NHXA 1O7FA 2Q8EA 3AP4A 3FMGA 1OVPA 2YPJA 4KWKA 1D0HA 3VBFC 1UYXA 5FOBB 4KBZA 1YLLA 2L9LA 5FYUA 2YDEA 1WD3A 1X7NA 3D6EA 5FZDA 4AVSA 1DG6A 4FSJA 3DGTA 1W3VA 5JCTA 4YSFA 3I2HA 3O12A 1XXNA 1YC61 4LITA 1DGRA 3NNGA 1JMUB 2B45X 2WINB 1MEC2 4DMIA 5A1FA 1G9BA 4WVZA 4RR3A 5F32A 1MR5A 3VDDA 5C9AC 1AJKA 3U11A 3IIIA 3ZDSA 4PIXA 2J1TA 1OOPC 1PNGA 1X50A 4RA0A 3OTFA 3DXUA 1TME2 3P6BA 4YM0A 5F3CA 3VB9A 5CVRA 3LOBA 2J1RA 4RFT0 5ABJB 3ZYBA 2ATFA 3K3OA 5CADA 5I0TA 4JKKA 4XJWA 3GZUC 2LM3A 3APBA 2RS51 4CCCA 1FYUA 4FPFA 4YG6A 4GMP0 1W05A 1GKBA 2H6BA 3UGFA 4IV1A 2WAAA 3B9IA 5FAXA 4A4AA 2KM2A 5FY5A 1PMIA 4AWDA 2W47A 2WQ8A 1QXPA 2Q8DA 2B9UA 4BM8A 2ZJCA 2VTXJ 1POV0 2Q1FA 4K1YA 1M4WA 1HXS1 2VO5A 3K48A 5FZAA 4NWWA 4WM7A 4BJ0A 5A1AA 5JMOA 3KV6A 5CFCA 3JQWA 2A73B 3DYOA 5EPAA 1E5HA 3WNOA 4AI9A 1UY0A 1QGLA 2RS13 1RUJ3 4A41A 1QJX1 3AP9A 4AFMA 2JKXA 3FLTA 3ZN6B 4EROA 2QDRA 4RYDA 2Y6LA 1XNDA 1CX4A 4KWJA 4YW7A 5KXBA 1QY4A 2HWC3 2WFF1 3A23A 1QH7A 1JYXA 3WW4A 4KNCA 1SCSA 4A7ZA 4FBFA 1FMD1 1OLME 1CPNA 5F8PA 3LIGA 1C57A 5JAXA 4P9WA 3SH4A 5HXVA 1JXNA 1XYOA 3WG3A 3BTXA 4HBNA 4KWUA 1X9TA 5LBBA 4QAWA 3K51A 4OMCA 1R1A3 1VBD2 1WBLA 4DO0A 1FPN2 4YZ3A 5JXHA 1HXS3 4Y5Z0 3OGGA 3ES1A 5BNOA 5HCFA 1VAVA 3AM2A 4ZY9A 5A7NA 1JU3A 3CO2A 3OCPA 3C7GA 3AZVA 2GNDA 4K8RB 4YZ5A 5KHGA 1GQGA 2OPKA 4PF1A 4UW6A 1JYIA 1OD5A 2VMFA 2BJSA 2JD9A 3G7DA 1WBFA 1LOBA 1WLDA 2VPVA 3PVOA 3H0OA 5ANNA 1KQRA 1CPMA 1OF3A 1ZX5A 4FPKA 3HAGA 4MGKE 1GZ9A 4QX5A 3PVEA 3TEYA 4E4SA 1PIV2 3PVNA 1CR7A 2XLGA 5C3PA 5FV3A 3MIDA 2OS2A 2WLPA 4FPGA 4AEKA 5JOZA 2W68A 4QDRA 3VBFB 3MO4A 4KWLA 1TME1 3IT8A 1XYPA 3CJIC 1A34A 4E2QA 3ORJA 5A7WB 1PVC1 1AL23 5DMYA 3NAPB 4XFBA 1DHKB 1HRV3 1YFXA 1W3XA 2XL7A 1LGNA 1EV12 1BXHA 5T55A 3GXUA 1GICA 1K12A 2Y34A 5C9AB 1Q5OA 5CBLA 5JOXA 3S7EA 3USSA 3RFRA 1OQDA 1QQP1 3VHPA 2P6CA 2XQXA 3ROUA 2FZ2A 1CONA 3N9PA 1HXS2 1S0JA 2HWB1 3K3NA 3LEIA 4Y33A 3CZUA 3RMYA 3WG2A 3TEZA 2IVIB 2WR9A 3VUOA 4Q26A 3I2KA 1QJX2 1VP6A 1DYKA 2V09A 3AZXA 3ZR6A 2QQWA 1NCRB 2IXKA 4LIUA 3OEAA 4NAMA 2J42A 4DXSA 3O1PA 1W90A 5FMDA 1JYNA 3ZX7A 3AXEA 2Y6FA 3HJRA 5FYVA 5JPNB 1VBB1 4OI0A 1WCUA 2K0GA 2WFF2 3O1RA 4MLOA 5IAVA 3LZZA 4D7YA 2WZR2 1I5ZA 1SBFA 4RR3B 3LA2A 4META 5BNPC 4E27A 1BVVA 1W2NA 5H9SA 1CIYA 2VMHA 1PZ9A 2ET1A 1IPKA 2ADDA 2IXJA 2XH6A 5GZFA 4M3CB 5DQ0A 2LALA 2O0OA 1C8NA 1ZA4A 4LO7A 2H0BA 1W6OB 3M8LA 4IGQA 5EV7A 4GKYA 2OX0A 4W6YA 1VMHA 3JBG3 1JZ2A 1I9RA 4P08A 1O4TA 1W6OA 2YY1A 3VHNA 2D43A 1WD4A 2R0HA 5C4WA 1IS4A 5JDBA 4BU2A 1YXWA 2EALA 3BUCA 2QUOA 4QX8A 4BOWA 1PO11 5C3QA 4XAEA 2WNUB 3MF6A 5A33A 3NAPC 2ZX4A 1SCRA 5FZBA 2JJ6A 2HWB3 3F2ZA 3H1WA 4LA3A 4AK3A 5JIAA 1VRH1 2JG9C 4OHVA 3HR9A 1AR82 4JZRA 5DXDA 2RDSA 3NV3A 3POJA 4WVMA 4RD7A 3OGRA 3IMMA 4TLFA 5E8AA 2VVEA 4ZXEA 1RITA 5FY1A 4CPBA 2P3KA 3HQRA 4PI0A 5FYSA 2UU8A 5DAQA 2PHTA 3OD4A 4FPYA 2R30A 2VZPA 1TMF2 1W6NB 3LKJA 1Q8QA 4LOTA 4MUVA 4M01A 5FZGA 4HVOA 2CAUA 4XBNA 5FJHA 1Q3EA 2GSYA 5FK7A 2VD7A 4JGZB 3VBHB 3K75B 5IWFA 4XCBA 4IL7A 5FY4A 1FI2A 4B4QA 4E9KA 1AXZA 1RVF3 1S2BA 1F15A 2JG8A 1ACCA 2OQ7A 2RV9A 4CXWA 1YQ8A 4FPEA 5FZFA 4Q4Y3 1VB4A 4CCKA 1A8DA 1KS5A 1KGYA 3DYMA 3I2JA 3A4UA 3MZHA 3ZSJA 2IXIA 2QJVA 3C7HA 4O61A 1HQLA 1QJY2 4ISQA 4P9YA 5FMCA 3CZJA 2AC1A 2FD8A 1VBA2 1RHI1 2VZQA 2HBUA 2W1QA 1QU0A 3FLRA 3ZSMA 3AKTA 1LU2A 2P2KA 3QLQA 3LWCA 1L7LA 2Y6GA 4P9XA 1GSLA 1R1A1 4YRDA 5HV4A 5I8TA 4LLFA 3GBGA 3T08A 2WT0A 3T30A 3VLBB 1ND3A 5E88A 2ZGNA 4IEUA 5C3SA 3VL8A 1MZFA 1YUDA 4M3CF 3ZXJA 4WVVA 1V6NA 2DFCA 3AC0A 1UZYA 2VM9A 1EPZA 1HRI2 1RHI3 4JGYC 3O1UA 3VD7A 1RUF1 5FWJA 5I8YA 3GBWA 5JI9A 3IZOA 3VZMA 4XETA 3EB7A 2WT2A 4HKOA 3AL5A 5AC92 2OW4A 5FZ3A 1LHUA 4OUMA 3N9QA 4JAAA 5FYYA 5A70A 2PAMA 2BPA2 4WM8A 5FZ6A 3E6BA 2VU9A 2FMYA 2G9ZA 4GALA 4BK4A 2B4KA 1K5JA 3I97A 3N7JA 5FYTA 5FZ4A 4CCJA 5BNOB 5CFDC 5HXMA 4J25A 4XE9A 4OI1A 4HVRA 3R6SA 3UESA 3DUIA 5FO9B 4AGRA 2KXLA 3KCXA 3V64A 1C5IA 4LE4A 4AQ2A 4QGLA 5F9TA 4KH9A 2ID4A 5T50A 5BNPB 5B4NA 3BTAA 2RS11 4WV8A 1PO12 2YHJA 4CA9A 2G19A 4BYYA 4FP3A 2WZPP 4ZONA 3PHMA 2WAOA 5JXGA 4KU8A 2E63A 2WYSA 4NIAA 1YO8A 2NZ9A 1B35B 2ZXQA 3K4AA 2V4AA 3DCQA 3MHZA 1V0AA 2W08A 3UYJA 4OVEA 4BQ4A 4W6XA 1PO13 1XE7A 2HYXA 2BYVE 2VGDA 1QJEA 5FZ7A 4A6SA 3OPZA 2W94A 2I45A 3WOGA 4NHYA 4BDVB 4H3WA 4IE4A 5JI7A 5KXDA 2XJSA 2HEYF 3I7DA 2R042 3M1HA 3EO6A 3MIEA 5D21A 4DXRA 1KRIA 3N9MA 2RDRA 4BQ1A 2YC4A 4L2NA 4AVTA 2C26A 1VBE3 3DEMA 3FHAA 1RUD3 4YVWC 3VDBA 1OA2A 3ABZA 3P3PA 4XDQA 5CEHA 3NNFA 1EAH1 3IN9A 2HWD2 3GDBA 4KGQA 4WM8C 5JSRA 5SV5A 3I49A 2WLQA 1NOVA 2D6NA 1JHJA 1OQEA 2VNRA 2IVJA 1OF4A 1R092 5FMOS 3W20A 2ZGMA 3BYWA 3O14A 2J7MA 3KCYA 2Y0IA 4FPOB 3AYCA 4I3PA 3RI8A 4AAXA 1AR63 3O1OA 1LHOA 2JDNA 5T3NA 5C70A 5C8WA 2DBIA 4HT1T 1W6QA 2XXZA 2K46A 4RS5B 4LBMA 1E5SA 2C9AA 2RR11 1NQJA 3ME2A 5JOYA 4XUPA 1UY4A 1SPPB 3JD71 3KVBA 1QOTA 2RJKA 2JDMA 1PGW1 2ZX1A 5BNNC 4CSWA 2AZ5A 3WD5A 1LEDA 3H7YA 4UT5A 1MPXA 2Y6KA 4AHXA 1QIQA 3U75A 1ASJ2 2W9XA 3OYWB 5G05L 1NZCA 1MEC3 1PK6A 1KDMA 4Y5TA 4M3CE 3ZN6A 4I01A 1QJU2 3WHTA 4XHBA 2QBXA 5I0SA 1YQ6A 2Y33A 1AR91 1DGWA 5LRRA 2A6VA 3BPZA 4GAZA 2QQLA 5F5IA 4Y26A 1RUC3 1W6PB 2RDNA 2VE1A 1UOFA 4Y24A 5FY0A 3N7MA 1NCQA 1SACA 2B9VA 1ASJ3 4RGAA 3T0DA 5CKNA 1IOAA 4U36A 5JPMB 2RS33 5FIXA 3POYA 3FFZA 4KI5M 2XVGA 4AHWA 3RWKX 3QOPA 5IK7A 1D4M3 3PUHA 4CEYB 1O5UA 5FZ8A 5FLJA 1Q8VA 3ST7A 1ZZ9A 2C1FA 2XJPA 3NWKA 4HANA 5HI0A 3TN93 1HB1A 5A32B 3H3UA 2WA3A 1S0IA 1UOBA 3IBMA 3AKSA 3E6DA 3LA3A 2FCUA 2ARBA 4OYUA 3WDWA 2ZGQA 3USUB 5A3TA 4LUMA 3LEMA 2B39A 2J1UA 2GAUA 2GP5A 1XE0A 4QPWA 1CAUA 3VD3A 1RUD2 2Q8CA 4DPNA 1RGSA 5J98B 1E5RA 1OI6A 3TN92 4AI8A 1G86A 2VBDA 5GZDA 1VBD1 1PIV3 4AFCA 2SBAA 1HV1A 1UU5A 4AFBA 3N7LA 5EP9A 1EAH2 2HWD1 4AZZA 4Y4YA 4LHNA 4OHZA 5EYXA 4MVTA 1R082 1IPSA 1DGWX 3LFMA 1ZBE1 1LODA 5CKMA 5C8CB 1Q43A 4Y1YA 3RZJA 2JG8C 2R063 4Y1ZA 2IXLA 4XDOA 3AZWA 5DAXA 3M3EA 5KXEA 1X36A 5FYCA 3T0BA 3D4KA 3THDA 2EXIA 3JUUA 3VBOC 3RZMA 5LRSA 1LOFA 4MHUA 4R52A 3K46A 1RJ8A 1ULDA 2CTVA 3ACFA 1OC1A 3WDTA 1IS3A 5C8CA 2WQ4A 1AX0A 3RYRA 4C91A 3AMQA 3QD6A 2W1SA 1GUIA 5K0UB 4XMAA 2ZAAA 2ZGTA 4GJZA 4BIFA 1NXMA 3O5SA 2F17A 3HT2A 3C8XA 1FNZA 3POIA 3WF1A 4E8DA 1DQ2A 4D69A 3TYJA 1H4GA 2GMEA 4P5YA 4LBQA 5FZCA 4OZOA 2EIDA 5K4LA 4CE8A 1S0BA 1UYZA 1UOJA 3HOBA 4FFFA 3ZVXA 1UD1A 1ZM1A 3AFKA 1V6IA 3GHMA 2VOKA 4L97A 2MPFA 1WW5A 2ADEA 4IEQA 4RS5C 2AENA 5LBFA 2C5DA 1QJU1 3M3OA 2VOWA 1ULOA 2Z42A 1LOEA 2XKOA 3H1MA 5D8AA 3NW4A 2XGXA 3Q8AA 1YFWA 1K5MC 1U0AA 2AACA 1AR62 3RJ2X 2IFRA 1J58A 4RGKA 2GMPA 1V9U3 1AYN1 2QQVA 3AFGA 5CZKA 1CAXB 4D6QA 4FAHA 1V6LA 5ANQA 2IWGB 4JGZA 3O0WA 2ZHMA 5A3UA 4AFAA 4L0PA 4AI2A 5IVEA 3T2TA 1H2KA 3WT3A 1SLIA 4Q0PA 3CQOA 3BB6A 4CDWC 1RUG2 2JB8A 3KQRA 5JZGA 4LO4B 4N90A 1JZ6A 4K8FA 2W92A 4GWNA 4CDXA 4CP9B 5FXXA 3N36A 1NAEA 2IXCA 2AGSA 2UWAA 2ORXA 2V5YA 3JZVA 1SBDA 1XC6A 2JG8B 4HSJA 4LNVA 2WZR1 5TSWA 1W6PA 3VGIA 2QQJA 1G7YA 2PELA 3MBWA 4H2AA 4QU2A 4XFGA 4Z1VA 1JTZX 2CL2A 2OIIA 4AF9A 1WZXA 2OQ6A 3WF2A 1ZVFA 1Q8OA 1YFYA 2J1EA 4XFAA 3WLUA 3WW3A 3ZR5A 4JDMA 1V6JA 2DUOA 2W3JA 3A0KA 4ASKA 1VE0A 1PK6B 4E4DX 2V4VA 2VY0A 2WS92 4N7IA 3R4DB 5ABJA 2VTXA 5IYYA 4DRRA 5DDJ3 4DIQA 2WZEA 4QXHA 4MXVA 4UFMA 5KHHA 4HPKA 1VIWB 3PJYA 3ON7A 4S2HA 4CDQA 3GNEA 4K20A 4N43A 3CHXA 4NRQA 5F2SA 4HL0A 1SHWB 4LMFA 5A7PA 4BQYA 2Q1MA 5ACA1 3K4DA 1D4M1 4BMBA 3AP6A 1GP6A 4LKSA 2D6KA 4CDQB 1SLBA 1DDLA 4OCTA 1DGLA 4K6BA 4SBVA 1O4ZA 3I3BA 4MHRA 2A6WA 2HEVF 4S2DA 2DVAA 1HB2A 2VCAA 5GLVA 3BPSA 1AUYA 5H9QA 1G6NA 1K3IA 1XSQA 2ZS6B 1GR3A 2ZEXA 4GB32 1Q56A 2DBNA 4OHXA 2VOTA 1BBT1 5LBEA 1QKQA 1IGOA 4CCEA 1COV2 3VKLA 1MZ5A 4YWAA 5C5UA 2VCBA 2Y64A 3U37A 3Q8CA 2DCTA 3THCA 5LCWL 1CZSA 2E32A 1H8TB 2VULA 3ECQA 4UI9L 2JWPA 3RZLA 3KV9A 4IV1C 1FMD3 4MADA 3MLLA 3KB5A 3N7KA 2HWD3 4J6GA 1HB4A 3Q8BA 4DUXA 5JOWA 1U5XA 3ALQA 4KBBA 3OY8A 1ZBE3 4NRPA 5GJ6A 3QBQA 2XONA 5CB7A 3NAPA 2X5IC 3ZYFA 3J9SA 1AHSA 4C0HA 3NJXA 4XIKA 1GWMA 4WZCA 4EWAA 4MH0E 2TUNA 1AYN2 1X8EA 5ERLA 1X82A 1NLQA 3TBDA 2R072 1W2OA 4XFIA 2E51A 1ONAA 1EP0A 5EFUA 4C0BA 1H30A 4E4HA 5KHIA 4C1WA 5GKAC 3RZGA 5A6QA 2VC9A 3KS7A 4LORA 1PHMA 2DCYA 4ZPIA 1N3PA 3UKNA 1UZVA 2RM23 4JCKA 4RHV2 1HLCA 1D2SA 4NVPA 1JN2P 5BNPA 4NWVA 4HLTA 1DP0A 1H2LA 2LROA 1KJLA 4JX0A 5AC91 2YG0A 4CDQC 4N7UA 3VD4A 3WDUA 2PHDA 4V2WA 1ULPA 5D1IA 1LEMA 1GU3A 3HN3A 3A0NA 4O7XA 1T6BX 2XL9A 2GZWA 3ZLIA 4EN6B 4CDWB 4DY5A 1O5LA 1RVF2 5FMOL 5J09A 1W6MA 2A75A 1C1LA 2JB4A 3X29B 1IKQA 1ZREA 3KV4A 4B29A 1LJ7A 3FLPA 2V73A 4LTAA 2Q1ZB 1ZBA1 5GZGA 4LBOA 4CU9A 2JX9A 1AR83 4XFFA 3BIEA 3PU3A 2XLFA 2RS12 3VBHC 2XDVA 3CJIA 1W9FA 2D6LX 1K45A 1N47A 1OHFA 2RVAA 3M70A 2C9KA 3OBTA 1UMIA 4XW3A 2JDAA 2D6MA 3ETPA 4R8HA 5CNAA 3ZXGA 3WEZA 3DKWA 4MGTA 3ZYIB 2VAUA 4FXGB 4YVSB 5J37A 5E1RA 4N53B 1GBGA 5EQUA 2VBBA 2KD7A 2DURA 5FUIA 2YBKA 3O0XA 4HK9A 2PAKA 3H1YA 1GWKA 2RMU2 4ORFA 4QHZA 2JE9A 1BBT2 3HN1A 3CF6E 1QQP3 3L2HA 4P5HA 4I30A 3VKNA 2BWAA 2YU1A 2WWJA 3ACGA 2Q30A 2WYFA 5JUVA 1SDWA 2VVFA 1W9SA 3FUOA 3J7NA 3BOWA 4GWJA 1UMHA 3HBKA 1R093 3AJYA 4IV3A 2ZKNA 4DXTA 2HWC1 1MS3A 2WFF3 5FP3A 1YQ5A 2ORZA 2XUEA 4GZ9A 3S5AA 3ACLA 2V5DA 1BYHA 3AYEA 2ZEZA 4MYEA 2DTYA 5C8CC 5BY5A 2DUQA 1OPMA 4EV0A 2YGLA 4IE5A 4E2GA 4NIIA 3SHRA 2QFEA 3OD0A 1HQNA 5FY8A 1WCQA 1DF0A 3DV8A 3E5UA 3RZHA 3WNPA 2P17A 5T5OA 4DQAA 2PA7A 1EY2A 1H8TC 3AVSA 4QB1A 1Y7BA 4WM7B 3VHOA 1UKRA 1PM7A 5FZEA 1K42A 1REFA 1L7QA 5LEJA 2R16A 2R071 3ZSEA 4BXFA 1WMFA 3SNMA 4NO4A 4LKFA 1DBNA 4W4ZA 2O8OA 1BVP1 3QH6A 3CMGA 4Q4W2 1VJ2A 2VECA 3ZKYA 5A3PA 4FTBA 4Y20A 4MX3A 1XNKA 3MV11 5E89A 5A33B 2OT7A 5IVCA 3PIJA 3MW4A 4BHPA 2WN2A 3O1TA 1RIRA 2WNVC 3ZDVA 1CAWA 5KWRA 1FMD2 4Q1RA 4PLNA 1UYPA 3AZZA 5F3GA 3AYAA 3S5QA 2CGOA 1PGW2 1TEIA 3BCWA 1OFNA 1UOGA 4IV3B 1NT0A 1JOPA 4FXKB 1EV13 4E8CA 1HRV2 3NNMA 1ASJ1 3TNQA 1U5IA 3H8XA 1K5MB 5T5LA 4GWIA 1WLTA 3T4HB 3K2OA 4MXWA 3NL1A 1W0OA 4AEJA 2VVDA 4HETA 3T4VA 1GOGA 1RVF1 3LIHA 3WY6A 2JICA 4K7JA 1QDCA 4OI4A 1W8NA 2VMEA 4ASLA 4YW1A 3BTYA 3H50A 1SDDB 1URXA 2E31A 3PUAA 1JHNA 1YQCA 3KVAA 4HKWA 4L8QA 4JGZC 2ET7A 4ASMB 3RQ0A 2NP0A 2W39A 3KZ4C 3J8F3 2ZMLA 2WDBA 2AYHA 2ZHNA 2ES3A 5F3EA 3C7EA 3GYDA 1C28A 4W8JA 2DVGA 3NV1A 5C7GA 2DCKA 4NROA 1NCRA 2B46X 4Q0UA 4GULA 4G9SB 4RL7A 4R9CA 3J4UH 1VRH3 3OF1A 4IERA 1US2A 1PGSA 2XWBB 3LGRA 3ZFGA 1UIJA 5BNOC 5CFDB 2J1AA 1V00A 1OKQA 1VBA3 3FBMA 1O3QA 4TZDA 4Y22B 1MACA 1Y9MA 4D0QA 2VCCA 4YG0A 4DINB 5CG9A 3E6CC 4XILA 4QQOA 1GP5A 5IHRA 4JV4A 5DUWA 4ZZ8A 4GMP3 1NY72 1YIFA 4GJYA 4LBNA 1ZZCA 4XUTA 1BK1A 4Q29A 2BU9A 4AEDC 5JZGB 1RUI3 2VQAA 3WVJA 3WV6A 4Z82A 4YM2A 1Y9GA 1N3OA 3ES4A 5FZOA 1QF3A 2B42B 2QZ3A 2R062 3M3CA 4LT5A 2YYOA 2VUDA 3LOIA 1C8M1 1RUE3 1ZBA3 3WDXA 3ZOIA 2D98A 3U10A 3WINE 1ULFA 1ZNPA 4MGQA 5JLVA 1O59A 1O91A 4GIQA 1MVEA 1BK0A 2RM22 4IE0A 2HWB2 1W9TA 3HQUA 4M0HA 3ENRA 1AL22 4GA9A 1GQPA 3WNXA 5FKBA 4CUCA 2VUCA 3UETA 3O1VA 3B94A 3GCWA 4PQ9A 2UURA 1GMMA 2UY9A 1IS5A 2KR2A 2VQTA 2XVKA 3CKHA 3RSJA 1A8MA 2VZVA 1SMVA 1WA4A 1RUJ2 2BGCA 4XYXA 4CEYA 1CJDA 3P3NA 4XC9A 1J83A 4JQRA 1WCDJ 3T2QA 2ZGUA 4W65A 4P9JA 4Q27A 1W6NA 4NPMA 3I59A 3ELNA 3WF3A 2VMDA 1OFSA 5B4XA 4TYSA 3VN4A 5IVJA 5K0UA 5LBCA 1RMU3 4GWMA 2P3JA 4WVMB 4ATEA 5EYYA 1RC6A 2WO3A 4COYA 1HRV1 1FPN3 3PMEA 1CQ9A 1QJY3 4FFIA 2W87A 5F7UA 3BGAA 3CLPA 5FRAA 4DXZA 5C3OA 2HLEA 3HQXA 5A7SA 1TNFA 4FAGA 3SC7X 2HWF2 3BTZA 3N9NA 4U2AA 1IG3A 5FZ1A 4JDOA 4XJ8A 1AZDA 1I5PA 5FZLA 3C2UA 1NA1C 2VOXA 3DN7A 4BLJA 2JDHA 2ZPXA 2D44A 1TMF3 4LEJA 4UW3A 5FLIA 5L7OC 1VRH2 5JXJA 1VR3A 2D7FA 2I2SA 4PT6A 3VBSC 4LHKA 4Y1XA 3WCSA 3I54A 1RB8G 2VTFA 2YV8A 4LO6B 2YU2A 1KFXL 2XJTA 1J59A 3FHIB 1E57A 3M3QA 4COZA 5L7OA 2D3SA 5L19A 1JUIA 4AI3A 4NHLA 2ZGPA 4I0WB 4DUWA 2H0VA 1RUI2 1WCSA 4I0BA 1J3QA 4A7YA 1NA1B 1NY71 2ZZJA 3IMNA 3P5BA 1ND2A 3UNPA 1H6YA 3LSEA 5BYNA 5LATA 2ZGRA 1R64A 2BVVA 2PFWA 1JZ3A 2WN3A 3MEPA 4K21A 1I3HA 4OMDA 2YXSA 1MS8A 1SLLA 1OLRA 4BE3A 2R061 3AK0A 3LB9A 1JI6A 1MZEA 3QACA 4XVHA 2F6BA 2R0FA 4IW3A 1QJY1 1H0BA 4PF5A 1QH6A 5JSPA 1VBA1 1AYM3 1FXZA 4K1ZA 4FOQA 4M4PA 5IAXA 3H8RA 4AQ6A 1W03A 4XZUG 1DQ6A 4LK6A 3TB0A 3WUDA 4AQTA 2WNEA 1AL21 4YFWA 5ISLA 4GD4A 2NLRA 4QT6A 5L9RA 4ZKTB 5ACA2 1QWRA 4XUOA 3PDQA 4EE2A 1NXD1 5J96B 1RXGA 4QD2A 4TTGA 4XAAA 1W04A 3CU7A 1LTEA 2PN5A 2XLAA 1RUF2 4IEXA 4BH9A 4CVUA 1W8WA 3MF9A 1GNHA 4LUKA 5J7MA 2HH9A 1ODNA 4B7KA 3MFCA 3WCRA 2R6QA 2UWBA 3FUQA 4FPLA 4NHMA 5FFOC 3JU9A 1VPHA 4BIOA 4O9GA 5F39A 1NE4A 1V6OA 1W6QB 5FREA 3EJKA 3RMXA 2TEPA 1CIWA 5EXOA 1CWPA 1OH4A 5F3IA 2GMMA 2RS52 3PNAA 5DUXA 2AEYA 3ZYJB 2DDUA 1KS4A 4PBOA 4PLMA 4AG4A 5FZHA 5C71A 3J7HA 3PUQA 3VBSA 2HWE3 4LBKA 4YZ4A 3WQ1A 1XB9A 3AB0A 2Y0OA 2CNAA 1FATA 2HWF1 3K77A 3KT7A 5A3LA 2PHXA 1S0CA 4ONUA 1QOSA 3ZYGA 3FL7A 3PTYA 3SH3A 3BODA 2WO1A 3NJVA 2RJ2A 2VZTA 5DPNA 3KV5A 5CISA 2V72A 2QCSB 3MUY1 2MEV1 5EHDA 1W06A 1DQ1A 4DRVA 2OPWA 5T5JA 1GP4A 2UWCA 1OT5A 2XJUA 3WQBA 4TSVA 4C90A 3DECA 1VBB3 2A3YA 1S2KA 4IEWA 2PQSA 1OQ1A 4JGYA 1F4HA 3POBA 2OXBA 5JVVA 1WW6A 2OKXA 4AVVA 4XUNA 4ES9A 4Z92B 4QX7A 2OUJA 3ZSLA 4CEWC 4AE2A 4L9BA 3I3EA 1VBE2 1I1EA 1LHNA 4MGIE 2FDJA 4KG0A 5K8SA 2ZHKA 1XU2A 1JZ8A 2A5ZA 4CPBD 4EZHA 4TXWA 1XPWA 4QPGB 1AJOA 1F5JA 1B35A 2NMNA 2WL1A 5GLWA 5FPXA 3C7FA 1UAIA 1DU3D 1FPN1 1S0EA 3I4IA 1UF2C 3VBUA 1KITA 2B7YA 2D6OX 5CAZA 1OXCA 3AJZA 3VV1A 1U5ZA 1Q8SA 4QB6A 2RDQA 2GC3A 1VBD3 1VAKA 2EIBA 1MZ6A 1OMIA 1XBFA 3BU7A 4D8MA 3N4MA 3NJYA 4KG8A 2IZWA 5EJ1B 5BXXA 3WZ1A 4GQ7A 3H9AA 1LENA 4AFDA 4QDQA 2CV6A 4JHTA 2A1XA 2A6ZA 4AHYA 4XXAA 4WM8B 4ZU5A 4YM1A 4CDXC 2WO2A 1S0FA 2RR12 2LW8A 2A3XA 4JKMA 3J26N 3LE0A 3PUIA 1NKGA 5FY9A 3ILRA 5FYZA 1JU4A 1F2NA 1AF9A 2AH2A 4JRLA 1LOAA 2D93A 2ETEA 2JECA 1W2AX 3UJOA 2RS53 5CFCC 5A3WA 4QM8A 4Q0VA 2Q0AA 1S0GA 1UYYA 2BNMA 4NMIA 5BNNA 4TLGA 5FKCA 1J1LA 2BRTA 3I2IA 4Q4V2 3PURA 3OB8A 5FTTC 5BNNB 4N8MA 3NSTA 4Y1UA 4BPZA 2F4PA 3W59A 2XJQA 1QQP2 2JG9A 3VD5A 3DPRC 3CL1A 1O4YA 1DCSA 2GC2A 2JD4A 3VL9A 5AFBA 5KC5A 4MV2A 4W6WA 4CU7A 3MLKA 1PZ7A 2ZCWA 2P34A 4URTA 4HPKB 5F6KA 1HQWA 3ZYPA 4R9AA 3BVCA 2LRPA 5LK7B 1F9KA 4ZS3A 5A1LA 3ZPYA 4Q4W1 1PX4A 3ZXLA 2W46A 4X8PA 3R4SA 5IVBA 2ZA9A 2VQ0A 3RDIA 4GH4C 3IKWA 1OKOA 2PLV3 1KEXA 3J8F1 4XDPA 1Z78A 5LY2A 3AXDA 2GN7A 1V6MA 4FQZA 4XABA 3ZM8A 3LSDA 4ES8A 3QH7A 2Y26A 4CDXB 1OA3A 4AW7A 4NHKA 5L9VA 1RUD1 1BBT3 2HJIA 3OEBA 3WP4A 1NQDA 3SEPA 1W2TA 3NKTA 1HDKA 5IVYA 4QPGA 2C6SA 4Y3OA 1BMV2 5LY1A 3GM8A 5IFTA 1H2NA 2HWE1 2J1SA 1LHVA 5FP4A 4XUQA 3PTRB 1J84A 5FYHA 4BQWA 5J36A 1GZTA 5A80A 2DU0A 4PJYA 3S30A 4AQSA 1LAJA 3SCGA 3O1MA 1H4HA 4B4PA 1AR71 1N3QA 2PAEA 4HXCA 1AR81 4Q4X1 3LF7A 1SQ4A 2X5IA 2NPIA 2VW1A 3VKOA 1VMFA 1F5FA 1Z7S3 4HMZA 1XRUA 3VZJA 1YNAA 3RZKA 1LULA 5DZFA 4BWOA 3UGHA 1ENQA 1NZIA 3AMMA 4DEVA 4Y22A 4IQPA 4AEMA 3UK9A 4Z8BA 3R05A 1IQDC 5CFDA 3BI3A 2P3IA 4RQPB 1RL3A 3MFAA 2PHWA 2YB7A 5HBAA 2ARCA 2N7GA 1UQXA 3Q9OA 4LULA 5LEKA 1RXFA 4A42A 3AP5A 2XWJB 3JBG2 1W39A 2X05A 2W52A 3FHQA 1JYTA 3O1SA 4XHXA 1OH3A 4BCUA 1OOPA 4F3JA 1KXGA 2VNOA 4FPJA 2BBVA 3LPFA 4IEYA 1PO23 5K9YA 1PX3A 1DYPA 5C33A 3SKVA 2BNNA 2XKPA 1GFF2 3JB8A 3MYXA 4Q4Y2 4XF0A 3ZXDA 3N35A 2DVDA 2EAKA 4XZPA 3T2OA 3IWZA 2I74A 4D6RA 4AOCA 3B9CA 2Q4SA 1DLCA 1S2EA 2W1WA 2R7EB 1ZZ6A 5CKQA 4WVWA 4CCMA 2XR4A 3WG4A 1DQ0A 3GF6A 4GH4A 5A7WA 5F37A 3B3QE 4XQDA 3JB4C 4K9SA 2J22A 4L99A 5KXCA 1CAUB 3A22A 1OLMA 3VBFA 5EIYB 5DG2A 5F1RA 1HJGA 3LFIA 4LKEA 4QQLA 5C3RA 3UGGA 5FPZA 4ZS2A 2ZGOA 4XACA 4E4ZA 5I93A 3ASIA 2JE8A 3MGUA 4IEOA 3ZN5A 4YLZA 4BB3A 2GN3A 3G6JB 3OG2A 3ZXFA 3RPQA 2YFZA 3CBNA 1GOHA 4RFRB 2AUYA 3OSDA 4NN0A 5A6XA 3DPRA 5FPLA 4FOYA 3AKQA 3AL6A 1B35C 2ZHLA 3U4SA 4ATFA 2A7AA 1OBNA 4RQPC 1MVQA 4HN0A 5F5QA 4LA2A 3SISA 3CIHA 1BMV1 4V2VA 2OUHA 3OUHA 4CP0A 2WO7A 4XTMA 2G1MA 1G9AA 2HWE2 3GJAA 4NJ4A 4SLIA 5LW9A 1FOD1 2PMWB 2X09A 3FN9A 1SFPA 4XBLA 3FWEA 1RUH3 2I07B 3EXUA 4LBQD 1PM4A 4XFCA 1PO21 2GNTA 3D0JA 1CD3G 3MDPA 4LR4A 2GALA 4Q4V3 5FZIA 4HZFA 4AL9A 1UU6A 4Q4X2 4D7TA 1WW4A 2TNFA 5JR7B 3WDVA 2YC0A 3M7AA 3NV2A 2X8KA 3KMHA 4ZHNA 2VW2A 3LAGA 2E7TA 4EWEA 1OURA 3A21A 4H7LA 4EQVA 1PIV1 3ILNA 4CTEA 2VZSA 3ZXAC 1PVC3 4BQ5A 5A7QA 2D3RA 1COV1 4MSVA 3B02A 4R9BA 3RYPA 2XQRA 3PU8A 1HKDA 2CGNA 4IE7A 2R041 4NR1A 1V9U1 3RI9A 1IPJA 5IW0A 2MNGA 3IPVA 3UV9A 1L7RA 1RUH1 5JIUA 4FFHA 2RHPA 5FQ0B 4XF3A 4QKBA 1AX2A 1XE8A 1LOCA 2WKKA 4IEVA 5CU1A 1EV11 2ZEYA 3ZIXA 3RG0A 1XQNA 1MS4A 5CFCB 1CAVB 2BDRA 3JXSA 2VNVA 3LPGA 4UFKA 4PQQA 1O3RA 1NG0A 1C8M3 1RUE1 1YQ2A 2LS6A 2WC2A 3ZXEA 1KDKA 2FDKA 3QCWA 1W0PA 1ULCA 1EYBA 4E2SA 4UF0B 2GDFA 4HVQA 2E26A 4FCAA 5B2GB 5JXIA 2B5HA 3CEWA 3WF4A 4B7EA 4IUGA 4XCAA 2WZ8A 3PIGA 2BFUL 4MGSA 4XJZA 1HV0A 1RUC2 3MV01 3HPNA 5FP7A 5JMCA 3W5MA 2DTWA 2ZEWA 1JZ7A 1QHDA 4KU7A 4AAPA 2PHFA 3WP6A 4CCDA 3AKPA 4QXKA 4ZU4A 5ACA3 1BEV3 2BNOA 1ND3C 1LU1A 3BIWE 1JYCA 2YFUA 3SITA 3ZFEA 3V0AB 2YUEA 2P1BA 2VQUA 1F35A 3PMSA 4QHBA 3TNPB 2YZ4A 4IE6A 4QPIA 4IXLA 1BQPA 1ZRIA 4OUSA 5EJ3A 4RGGA 5IK8A 1O8SA 4OFGA 2WSUA 3U4XA 1UKGA 4JC1A 5A3MA 4LHLA 5DAPA 3ETQA 2ZX3A 1WCKA 1ENXA 3OOXA 4GMP1 1NCQC 4A3ZA 1KJRA 3OY8B 1YCIA 1ZZ7A 3L2YA 4QX0A 3U07A 1VMJA 5FO8B 2WFPA 1GOFA 4RR3C 4QM9A 4B4RA 2VZUA 1B09A 3O7OA 4PCRA 5FYMA 4QQPA 5FYBA 4XOGA 4COWA 3J7MA 2ZX0A 1FOD2 4XIOA 2ILMA 4UAPA 4R4XA 2E9QA 2JIJA 2YC2A 4AYUA 3PLQA 4URAA 2EXKA 1PO22 4PIYA 3FE5A 4D6SA 1T6GC 1GV9A 5G04L 3E97A 2XBO2 3J7LA 4HK8A 3WUCA 1GYKA 5T52A 2GH2A 2O1QA 2PTMA 1UY2A 4M4RA 2D6PA 2WSVA 3I8TA 4QPGC 3GZTB 4CUBA 3VDAA 2GP3A 3U14A 4QX3A 4S2FA 2W2IA 4QMAA 5AVAA 4YW2A 5HCBA 4QKNA 1VBE1 4A7KA 4P9GA 1HN1A 2HBTA 5FXZA 1IHMA 2GNBA 2CAVA 1CGPA 4XBQA 4EN8B 2D40A 3HT1A 3ZFFA 2UY8A 5AFEA 3MPBA 1V9U2 1H1AA 3K4ZA 3W5NA 1UO9A 2G9FA 4O65A 4TWTA 2DVFA 1ZZBA 3C7OA 4MXWB 4YW4A 3TN91 5IK5A 1ND3B 3HWJA 5JR2A 1JZ4A 2VCMA 1MS5A 2CDPA 2IC1A 2R32A 3AZYA 1JOBA 3E1F1 4Q4X3 2WBKA 2CWSA 5FZMA 3KHCA 3VBRB 1G9CA 4CEYC 2ZACA 1BZWA 4B3NA 4A6OA 1W8TA 1RUE2 3NO8A 4YM3A 4QGMA 3TOJA 4CDUA 4DZGA 1ZBE2 5FZ9A 2E53A 3MUZ1 2R073 3WHUA 2X53S 4LBJA 4NRMA 4Y1VA 4NIHA 1VALA 5FBZA 4M0NA 2VW0A 1RUC1 1UNBA 4J1XA 1UX6A 1Z7S2 4YVWA 2PQQA 1Y9QA 1REDA 4IEZA 4CP9A 5I91A 3AMHA 1S1AA 5I0DA 3CJXA 4P9LA 5LZ6A 4Q2FA 3T3YA 4QXCA 1IQAA 1RYYA 4YW6A 4WBBA 4IV1B 4XFHA 3GHNA 4KQ7A 4XEZA 4Y4RA 1W0NA 4C8DA 4MG2A 3M3IA 5FP8A 4LIVA 1VBC2 5DUVA 5IVFA 2JIGA 2XMLA 1DYOA 2Z4FA 3OBAA 1J3RA 4O9EA 3GGLA 3DYPA 4Q4W3 1NA1A 2NM1A 2NQYA 2RJLA 4QDSA 3URFA 1PGL1 1BCXA 5KHKA 3IB3A 1WUVA 4RSUA 1P8JA 2W95A 3HBZA 5BV6A 4XQWA 1J3PA 4ET7A 4HG6B 4CCNA 1AR61 2EIGA 1SLAA 4BXSV 1UPSA 1HN0A 1NCRC 4YW3A 3ZFFB 3E5XA 4KGGA 4N53A 1H9WA 4FQ4A 1U5YA 4CDUB 4N43C 4GH4B 1GWLA 1YRZA 4FFGA 5EZWA 3VBRA 5LA1A 1MQTC 4CUGA 1LHWA 1JW6A 2XBO1 3NKGA 4Y5SA 3RWNA 2VNGA 5IT6A 2ZGKA 4IDZA 2XHKA 4M3CA 3MIHA 3VKFC 4JKLA 5DUUA 4P9IA 1M06G 2IXHA 2JDUA 2JENA 5A3OA 4Q0SA 3IM0A 4AGGA 3J8F2 3RYKA 2YBSA 2XUMA 4I2OA 4ISRA 2Z5WA 4OUEA 4XF1A 5BPXA 1HX6A 3BALA 3I3MA 1TZOA 5CIRA 5T5PA 1UW8A 4CXYA 5HCHA 4FOVA 4EN0A 3N3HA 2VMGA 1SFYA 2QQMA 1L3JA 1MQTB 2EVXA 4MGYE 2WNVA 2NN8A 1WMDA 1BEV2 2EICA 3RVHA 5F5CA 3SCFA 3LDKA 3AMPA 3ZIWA 4AEDB 1LGCA 3HNYM 2Q8OA 3POEA 4BQ3A 4XF9A 2ZGSA 4RHV3 4QU1A 3THTA 4YG3A 1H8VA 2E6VA 1X9PA 3D5OA 3ZYHA 4N53C 5FJKA 1R091 1AR72 1CJPA 2BEOA 5CG8A 4N9HA 3ZFEB 5FZKA 3WR0A 1OLQA 3V0AA 2QTWB 4PDWB 2JDPA 5KC6A 5D8AC 1G9DA 1GANA 2VL4A 2B8MA 1AYN3 2WT1A 4ARYA 2EXHA 1LRHA 3ZFFC 2DYCA 3H42B 5APAA 1ZRRA 4IETA 1YWKA 4AEDA 1UPIA 1EUTA 2ZMKA 5FZOB 3ATGA 3R4UA 3MIGA 1O8PA 3OJBA 3LD8A 1OUSA 3S6PA 2QQUA 2BP6A 2HWF3 2NMOA 4CCOA 5GZCA 4AGVA 1VBC1 4Z2AA 3GBFA 4YNIA 4JGYB 3T1MA 1UN1A 2ARXA 1N1YA 4AR2A 1H1MA 1GZWA 2XJRA 4UFLA 5FPBA 2C24A 4PDWC 3OBZA 5L36A 3D3AA 1O6UA 3KT1A 3RRDA 5FYIA 4LHSA 4UXAA 3E5QA 1PMJX 4MOAA 4Q4Y1 5IK4A 5J48A 3KLSA 1NLSA 3VKMA 1RMU2 1MS1A 4HN1A 5FK8A 3IDAA 5A7OA 2ARAA 1XNAA 3S7IA 1H9PA 1JS9A 2O14A 4J1WA 1JODA 1MS9A 2AR6A 3WP3A 3VD9A 4D3WA 4Q5OA 4TN7A 3V65A 4UBHA 1GNYA 2QE3A 2ZKLA 3NVCA 3HIFA 3KHBA 3POGA 1UY3A 2DFBA 1QOOA 4L11A 1Y3TA 2YROA 2ZZQA 1VRBA 4GKXA 5FXWA 1Z0HA 4RHV1 2X29A 5FUNA 4AHZA 1VBB2 4UYBA 4UW4A 2PHUA 1QDOA 5KHJA 3WG1A 1WMEA 3IPVB 3V0BA 2A6YA 3ITQA 5FUPA 4QQHA 3ZFEC 4Q1PA 3IDBB 4UOJA 3UT0A 2BERA 3VZNA 4CUAA 4YGDA 2VXRA 1W9YA 3KCCA 2JXAA 1DQ5A 3LCPA 4XURA 3AX4A 1C3HA 1VLNA 2KA3A 2Y38A 1C5HA 3ILFA 1PNFA 3PJQA 5GALA 2A6XA 3U0ZA 1WKYA 4OI2A 2JEMA 3NNJA 3W21A 1NUKA 1R083 2WUHA 4LXLA 1DFQA 4XJUA 4XQ4A 4Y20B 4CP2A 1OPOA 1ZBA2 3B7MA 2W5FA 2XHNA 3HEIA 3KGZA 3NJZA 3I3DA 5H9RA 1UX7A 2BWCA 4PLOA 1AYM1 1IG0A 1RUF3 2R1BA 4YVWB 2D5FA 3AP7A 3FZ3A 2XBO3 4QX2A 1VBC3 5FXVA 4XF4A 1POV3 3I59B 4XMIA 5DDJ2 3ZO0B 4PBPA 3ZMNA 3TWIA 1UXZA 5F6LB 4HFSA 4FP2A 5J1XA 4UW5A 2A3WA 3OGVA 4JVAA 2QKDA 1W99A 1NX9A 2ENRA 4QB2A 4YPJA 3WP5A 3WQ0A 3DPRB 1U12A 4EN7B 2QNKA 2DCZA 4OQ8A 1HJFA 4Q8LA 1TMF1 3M2MA 4COVA 5A6ZA 5JSOA 3WNNA 2WWSA 3I2GA 4LJHA 5LWBA 1O3SA 3SEEA 2RMU1 3PUSA 4UWDA 2R1DA 1ULGA 5DAWA 1YHFA 2WJSA 3VDDB 5SV8A 3PL0A 4YZ1A 1ZRFA 2HWC2 3FX3A 1H6XA 2PLV1 4CP1A 4EZ4A 1VB2A 2Y6JA 1KFUL 2DVBA 2LTNA 1AL0G 4GB33 1UCXA 1UMZA 3D8CA 4QXBA 4YVSA 3U1XA 2Y60A 4ZU7A 2ZMNA 4NIGA 1JZ5A 1IKPA 1RMU1 3JCIA 1OOPB 4B8EA 4I3GA 1HRI3 1RHI2 1SLCA 2D97A 2QZ2A 3C3VA 2PHRA 4LPLA 5FPAA 3WSOA 2MEV2 3UJQA 2EXJA 1R1A2 1VAMA 4P14A 3VDDC 5LASA 3ZYRA 4CU6A 4NIDA 4RQPA 4W50A 2GNMA 2BOJA 2G4IA 1UZ0A 2PHLA 4LLOA 3VHRA 1JH5A 1QMJA 2NYYA 1LOGA 4M00A 1S55A 1OUXA 2BV4A 1Q8PA 1W8HA 1WW7A 1WLCA 3OBRA 3VBOA 1PZ8A 1FOD3 1EAH3 1XSRA 1ZA7A 2X5IB 3NMBA 1AR73 3I2FA 5FY7A 1QXRA 5A3NA 2D5HA 2W1UA 3KWVA 4OHYA 2WS93 2FCTA 3KQ4B 2CY6A 2RS31 3FFQA 1ST8A 1US3A 2C0ZA 1YJKA 4JHZA 4WM7C 4DEQA 1W28A 4G4FA 3FJSA 3UKTA 2VZOA 2HEWF 3GZAA 4LQRA 4N43B 1XOYA 4D7SA 1AR93 2IUWA 2FHRA 4CRQA 1RUG3 1UU4A 4DFSA 1Y4WA 1AYM2 2C4XA 3AYDA 3F95A 3OGSA 4P00B 3SH5A 1LKNA 1RINA 5A32A 5BNQA 1RUOA 4PI2A 4JTNA 1CAWB 1D4M2 3B00A 5JZGC 4OLLA 1LESA 1JOJA 4MO3M 3MI8A 3VBHA 2ZGLA 4EYUA 1UIKA 2FDIA 3AKRA 5C4WC 3JD73 1MEC1 2DUPA 1C4RA 1KD7A 3JQXA 4UF0A 2PYTA 3SLIA 1XJAA 1MQTA 4OULA 3RZZA 2OZ6A 4KL1A 3RS6A 3U78A 3VBOB 1LB2A 2XB6C 2VH9A 3MIBA 3S0MA 3B93A 1FV2A 1W2UA 2DU1A 5FPVA 1ZRDA 1DIWA 4ITCA 1BLZA 4BMEA 3THPA 1SZBA 2FQPA 4QWNA 2DWRA 4A44A 4A3XA 4CXXA 3ZN4A 3D0SA 1ND2B 5I8SA 1C8M2 1DZQA 1H1IA 2GH8A 5I0RA 3OYWA 1FT9A 1IZ3A 1QNWA 5J3UA 3N9LA 5LA9A 1LGBA 5IUQA 1FX5A 3CDZB 2EAAA 4X8NA 3TEXA 1CVNA 2QQKA 3TAYA 5ABJC 3MLJA 2E7AA 2QQNA 4QKDA 1BKZA 1LCLA 3HNMA 3I3QA 1F31A 3MICA 1HW5A 3A7QA 3LQCA 4GXLA 3SXWA 1X8MA 5FBJA 3H3LA
chains in the Genus database with same CATH topology
4QB1A 5JXIA 1K42A 1L7QA 1UY1A 3OGRA 5LA2A 4ZXEA 3T0AA 4W4ZA 3WNLA 1UWWA 3CMGA 3MV11 2VZPA 4RN5A 5DN2A 3A21A 2WN2A 2VZSA 3K75B 1F4AA 4E8CA 1CZTA 4BK5A 5HPOA 1L7RA 2RV9A 4GWIA 1CZVA 1GOGA 2ZEYA 1KGYA 3DYMA 3I2JA 1W8NA 2VMEA 2EIEA 3HNBM 3JXSA 1SDDB 3C7HA 2E31A 3LPGA 2DCJA 4PQQA 4FI9A 3CZJA 1YQ2A 2LS6A 2W1QA 2VZQA 2WDBA 1W8OA 2E26A 3C7EA 4W8JA 3LEKA 2Y6GA 3WF4A 4IUGA 5C7GA 2DCKA 2WZ8A 4MGSA 3T08A 3MV01 3HPNA 3W5MA 2Y6HA 1US2A 2ZEWA 1JZ7A 2J1AA 3AC0A 4D0QA 2VM9A 2VCCA 3VD7A 1OD3A 2E33A 5IHRA 2YFUA 4ZZ8A 2VQUA 3EB7A 4XUTA 3WNMA 4P02B 3VDCA 3SKJE 1O8SA 4BK4A 2B4KA 3I97A 5HXMA 1BHGA 2VZRA 3UESA 4A3ZA 4QX0A 1GOFA 4MGQA 2VZUA 3WF0A 2ID4A 1O59A 5B4NA 3NQHA 1W9TA 2Y8KA 2XOMA 4CUCA 1GQPA 2QQIA 2QQOA 3UETA 3P1IA 4UAPA 2YC2A 2WAOA 5JXGA 1GMMA 2WYSA 3BN6A 2VQTA 2VMCA 2ZXQA 3CKHA 5G04L 2VZVA 4KMQA 3K4AA 3LEGA 1D7PM 3WNKA 1UY2A 4M4RA 1J83A 4CUBA 3T2QA 3VDAA 4QX3A 2HYXA 3WF3A 2VMDA 5B4XA 2W94A 1HN1A 4ZZ5A 3ACHA 4BDVB 3K4ZA 2WO3A 4DXRA 3W5NA 1XNTA 2YC4A 3C7OA 5F7UA 2C26A 2W87A 3BGAA 3FHAA 5JR2A 1JZ4A 3T09A 2HLEA 3VDBA 3ABZA 2CDPA 3E1F1 2WBKA 3GDBA 1PMHX 4A6OA 1I5PA 1JHJA 3MUZ1 3NRUA 2BBAA 1OF4A 5JXJA 4PT6A 5EJZB 2J7MA 4ARXA 4AAXA 2VTFA 5IJRA 5C70A 1LNSA 4QX1A 1EUUA 5I0DA 4XUPA 1UY4A 3IAPA 1RYYA 4DUWA 1W0NA 2BGPA 2X10A 1MPXA 2Y6KA 3UNPA 1H6YA 2CDOA 3OBAA 1DYOA 2Z4FA 1R64A 2W9XA 3GGLA 3DYPA 5G05L 1JZ3A 4QDSA 2WN3A 4OMDA 3IB3A 2W91A 4CU8A 1P8JA 2QBXA 2W95A 1JI6A 4XVHA 4ET7A 4HG6B 2QQLA 1W9WA 3ACIA 4M4PA 4BXSV 2B9VA 3T0DA 4XZUG 2BZDA 2WABA 4KI5M 5LA1A 2VZ3A 4XUOA 2J1VA 3PUHA 4TTGA 5LA0A 4CVUA 2VZ1A 4JKLA 5IFPA 4OYUA 4OUEA 1TG7A 2J1UA 3T2PA 1OH4A 4QPWA 1T2XA 3VD3A 2QQMA 2DDUA 4AG4A 4DUVA 1JYWA 2EICA 5C71A 3J7HA 3K77A 3HNYM 3FL7A 1TVGA 2WO1A 3NJVA 2VZTA 2RJ2A 5DPNA 2V72A 1SG3A 5CYYA 3EYPA 3IAQA 3MUY1 2BGOA 3T0BA 1OT5A 3THDA 3WQBA 3DECA 3K46A 2VR4A 2PQSA 3ACFA 2VL4A 1F4HA 4ARYA 2W1SA 1GUIA 2OKXA 1UXXX 4XUNA 4A45A 3I3EA 3C8XA 3WF1A 1EUTA 4E8DA 1JZ8A 1O8PA 4P5YA 4OZOA 2EIDA 4Z2AA 4TXWA 1UYZA 1XPWA 3HOBA 3C7FA 1ULOA 3D3AA 1JYVA 4LHSA 1PMJX 4MOAA 2VJXA 4QB6A 1CX1A 3IDAA 1XNAA 2EIBA 4D8MA 5CZKA 3VD9A 5EJ1B 1GNYA 1UYXA 4QDQA 2L9LA 1UY3A 4L0PA 3CQOA 3I2HA 2WO2A 3NNGA 1JZ6A 2LW8A 2W92A 4JKMA 3LE0A 1NAEA 1NKGA 3PUIA 2ORXA 1XC6A 3IIIA 1JU4A 2J1TA 2QQJA 3MBWA 3P6BA 4UOJA 4CUAA 2BERA 3WF2A 2J1RA 2J1EA 1UYYA 4JKKA 2W3JA 4XURA 2V4VA 3I2IA 5IYYA 3OB8A 1WKYA 2WAAA 4A4AA 1NUKA 2WUHA 2WZEA 2W47A 2WQ8A 3HEIA 2W5FA 2XHNA 3VD5A 3I3DA 1UX7A 2VO5A 5A1AA 1SHWB 4BJ0A 5JMOA 3DYOA 4CU7A 3WNOA 3K4DA 1UY0A 4QX2A 4A41A 4LKSA 1UXZA 2JKXA 5J1XA 3OGVA 4QB2A 4RYDA 1W99A 1NX9A 2Y6LA 3I3BA 4YPJA 1PX4A 2W46A 3A23A 3LQCA 1JYXA 2VCAA 3WNNA 3I2GA 1K3IA 2ZEXA 3SEEA 1KEXA 2VOTA 2VCBA 2Y64A 3U37A 3ZM8A 3THCA 5LCWL 1CZSA 2E32A 4UI9L 3ECQA 4KWUA 4QAWA 3OEBA 4OMCA 1H6XA 4MADA 3SEPA 2Y6JA 5JXHA 3GM8A 4DUXA 5IFTA 2J1SA 1JZ5A 4ZY9A 2XONA 4XUQA 1J84A 3NJXA 1JU3A 3C7GA 4LPLA 3WSOA 4PF1A 2VMFA 4CU6A 2JD9A 4W50A 1UZ0A 2VC9A 1OF3A 4DEVA 1IQDC 1DP0A 3I2FA 4JX0A 2YB7A 2YG0A 4QDRA 3VD4A 2W1UA 3MO4A 1ULPA 4A42A 1GU3A 3HN3A 2X05A 3FHQA 5DMYA 1US3A 4DEQA 4JHZA 3LPFA 3GXUA 1PX3A 1K12A 3SKVA 2VZOA 4LQRA 2XQXA 4CU9A 3T2OA 3LEIA 1DLCA 3CZUA 2C4XA 3OGSA 4P00B 2W1WA 1K45A 2R7EB 2RVAA 2C9KA 3I2KA 1UMIA 2JDAA 4MO3M 3ETPA 3OEAA 4DXSA 3WEZA 1JYNA 2J22A 3A22A 3HJRA 5EIYB 2KD7A 5FUIA 1CIYA 2JE8A 3ACGA 3OG2A 5JUVA 2YFZA 5DQ0A 1GOHA 1W9SA 4A44A 4GWJA 1UMHA 4DXTA 2ORZA 4GZ9A 1JZ2A 4P08A 2V5DA 3CIHA 2ZEZA 3CDZB 2QQKA 2QQNA 1WCQA 3HNMA 3WNPA 2X09A 3FN9A 3A7QA 3F2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB1 A;  5JXI A;  1K42 A;  1L7Q A;  1UY1 A;  3OGR A;  5LA2 A;  4ZXE A;  3T0A A;  4W4Z A;  3WNL A;  1UWW A;  3CMG A;  3MV1 1;  2VZP A;  4RN5 A;  5DN2 A;  3A21 A;  2WN2 A;  2VZS A;  3K75 B;  1F4A A;  4E8C A;  1CZT A;  4BK5 A;  5HPO A;  1L7R A;  2RV9 A;  4GWI A;  1CZV A;  1GOG A;  2ZEY A;  1KGY A;  3DYM A;  3I2J A;  1W8N A;  2VME A;  2EIE A;  3HNB M;  3JXS A;  1SDD B;  3C7H A;  2E31 A;  3LPG A;  2DCJ A;  4PQQ A;  4FI9 A;  3CZJ A;  1YQ2 A;  2LS6 A;  2W1Q A;  2VZQ A;  2WDB A;  1W8O A;  2E26 A;  3C7E A;  4W8J A;  3LEK A;  2Y6G A;  3WF4 A;  4IUG A;  5C7G A;  2DCK A;  2WZ8 A;  4MGS A;  3T08 A;  3MV0 1;  3HPN A;  3W5M A;  2Y6H A;  1US2 A;  2ZEW A;  1JZ7 A;  2J1A A;  3AC0 A;  4D0Q A;  2VM9 A;  2VCC A;  3VD7 A;  1OD3 A;  2E33 A;  5IHR A;  2YFU A;  4ZZ8 A;  2VQU A;  3EB7 A;  4XUT A;  3WNM A;  4P02 B;  3VDC A;  3SKJ E;  1O8S A;  4BK4 A;  2B4K A;  3I97 A;  5HXM A;  1BHG A;  2VZR A;  3UES A;  4A3Z A;  4QX0 A;  1GOF A;  4MGQ A;  2VZU A;  3WF0 A;  2ID4 A;  1O59 A;  5B4N A;  3NQH A;  1W9T A;  2Y8K A;  2XOM A;  4CUC A;  1GQP A;  2QQI A;  2QQO A;  3UET A;  3P1I A;  4UAP A;  2YC2 A;  2WAO A;  5JXG A;  1GMM A;  2WYS A;  3BN6 A;  2VQT A;  2VMC A;  2ZXQ A;  3CKH A;  5G04 L;  2VZV A;  4KMQ A;  3K4A A;  3LEG A;  1D7P M;  3WNK A;  1UY2 A;  4M4R A;  1J83 A;  4CUB A;  3T2Q A;  3VDA A;  4QX3 A;  2HYX A;  3WF3 A;  2VMD A;  5B4X A;  2W94 A;  1HN1 A;  4ZZ5 A;  3ACH A;  4BDV B;  3K4Z A;  2WO3 A;  4DXR A;  3W5N A;  1XNT A;  2YC4 A;  3C7O A;  5F7U A;  2C26 A;  2W87 A;  3BGA A;  3FHA A;  5JR2 A;  1JZ4 A;  3T09 A;  2HLE A;  3VDB A;  3ABZ A;  2CDP A;  3E1F 1;  2WBK A;  3GDB A;  1PMH X;  4A6O A;  1I5P A;  1JHJ A;  3MUZ 1;  3NRU A;  2BBA A;  1OF4 A;  5JXJ A;  4PT6 A;  5EJZ B;  2J7M A;  4ARX A;  4AAX A;  2VTF A;  5IJR A;  5C70 A;  1LNS A;  4QX1 A;  1EUU A;  5I0D A;  4XUP A;  1UY4 A;  3IAP A;  1RYY A;  4DUW A;  1W0N A;  2BGP A;  2X10 A;  1MPX A;  2Y6K A;  3UNP A;  1H6Y A;  2CDO A;  3OBA A;  1DYO A;  2Z4F A;  1R64 A;  2W9X A;  3GGL A;  3DYP A;  5G05 L;  1JZ3 A;  4QDS A;  2WN3 A;  4OMD A;  3IB3 A;  2W91 A;  4CU8 A;  1P8J A;  2QBX A;  2W95 A;  1JI6 A;  4XVH A;  4ET7 A;  4HG6 B;  2QQL A;  1W9W A;  3ACI A;  4M4P A;  4BXS V;  2B9V A;  3T0D A;  4XZU G;  2BZD A;  2WAB A;  4KI5 M;  5LA1 A;  2VZ3 A;  4XUO A;  2J1V A;  3PUH A;  4TTG A;  5LA0 A;  4CVU A;  2VZ1 A;  4JKL A;  5IFP A;  4OYU A;  4OUE A;  1TG7 A;  2J1U A;  3T2P A;  1OH4 A;  4QPW A;  1T2X A;  3VD3 A;  2QQM A;  2DDU A;  4AG4 A;  4DUV A;  1JYW A;  2EIC A;  5C71 A;  3J7H A;  3K77 A;  3HNY M;  3FL7 A;  1TVG A;  2WO1 A;  3NJV A;  2VZT A;  2RJ2 A;  5DPN A;  2V72 A;  1SG3 A;  5CYY A;  3EYP A;  3IAQ A;  3MUY 1;  2BGO A;  3T0B A;  1OT5 A;  3THD A;  3WQB A;  3DEC A;  3K46 A;  2VR4 A;  2PQS A;  3ACF A;  2VL4 A;  1F4H A;  4ARY A;  2W1S A;  1GUI A;  2OKX A;  1UXX X;  4XUN A;  4A45 A;  3I3E A;  3C8X A;  3WF1 A;  1EUT A;  4E8D A;  1JZ8 A;  1O8P A;  4P5Y A;  4OZO A;  2EID A;  4Z2A A;  4TXW A;  1UYZ A;  1XPW A;  3HOB A;  3C7F A;  1ULO A;  3D3A A;  1JYV A;  4LHS A;  1PMJ X;  4MOA A;  2VJX A;  4QB6 A;  1CX1 A;  3IDA A;  1XNA A;  2EIB A;  4D8M A;  5CZK A;  3VD9 A;  5EJ1 B;  1GNY A;  1UYX A;  4QDQ A;  2L9L A;  1UY3 A;  4L0P A;  3CQO A;  3I2H A;  2WO2 A;  3NNG A;  1JZ6 A;  2LW8 A;  2W92 A;  4JKM A;  3LE0 A;  1NAE A;  1NKG A;  3PUI A;  2ORX A;  1XC6 A;  3III A;  1JU4 A;  2J1T A;  2QQJ A;  3MBW A;  3P6B A;  4UOJ A;  4CUA A;  2BER A;  3WF2 A;  2J1R A;  2J1E A;  1UYY A;  4JKK A;  2W3J A;  4XUR A;  2V4V A;  3I2I A;  5IYY A;  3OB8 A;  1WKY A;  2WAA A;  4A4A A;  1NUK A;  2WUH A;  2WZE A;  2W47 A;  2WQ8 A;  3HEI A;  2W5F A;  2XHN A;  3VD5 A;  3I3D A;  1UX7 A;  2VO5 A;  5A1A A;  1SHW B;  4BJ0 A;  5JMO A;  3DYO A;  4CU7 A;  3WNO A;  3K4D A;  1UY0 A;  4QX2 A;  4A41 A;  4LKS A;  1UXZ A;  2JKX A;  5J1X A;  3OGV A;  4QB2 A;  4RYD A;  1W99 A;  1NX9 A;  2Y6L A;  3I3B A;  4YPJ A;  1PX4 A;  2W46 A;  3A23 A;  3LQC A;  1JYX A;  2VCA A;  3WNN A;  3I2G A;  1K3I A;  2ZEX A;  3SEE A;  1KEX A;  2VOT A;  2VCB A;  2Y64 A;  3U37 A;  3ZM8 A;  3THC A;  5LCW L;  1CZS A;  2E32 A;  4UI9 L;  3ECQ A;  4KWU A;  4QAW A;  3OEB A;  4OMC A;  1H6X A;  4MAD A;  3SEP A;  2Y6J A;  5JXH A;  3GM8 A;  4DUX A;  5IFT A;  2J1S A;  1JZ5 A;  4ZY9 A;  2XON A;  4XUQ A;  1J84 A;  3NJX A;  1JU3 A;  3C7G A;  4LPL A;  3WSO A;  4PF1 A;  2VMF A;  4CU6 A;  2JD9 A;  4W50 A;  1UZ0 A;  2VC9 A;  1OF3 A;  4DEV A;  1IQD C;  1DP0 A;  3I2F A;  4JX0 A;  2YB7 A;  2YG0 A;  4QDR A;  3VD4 A;  2W1U A;  3MO4 A;  1ULP A;  4A42 A;  1GU3 A;  3HN3 A;  2X05 A;  3FHQ A;  5DMY A;  1US3 A;  4DEQ A;  4JHZ A;  3LPF A;  3GXU A;  1PX3 A;  1K12 A;  3SKV A;  2VZO A;  4LQR A;  2XQX A;  4CU9 A;  3T2O A;  3LEI A;  1DLC A;  3CZU A;  2C4X A;  3OGS A;  4P00 B;  2W1W A;  1K45 A;  2R7E B;  2RVA A;  2C9K A;  3I2K A;  1UMI A;  2JDA A;  4MO3 M;  3ETP A;  3OEA A;  4DXS A;  3WEZ A;  1JYN A;  2J22 A;  3A22 A;  3HJR A;  5EIY B;  2KD7 A;  5FUI A;  1CIY A;  2JE8 A;  3ACG A;  3OG2 A;  5JUV A;  2YFZ A;  5DQ0 A;  1GOH A;  1W9S A;  4A44 A;  4GWJ A;  1UMH A;  4DXT A;  2ORZ A;  4GZ9 A;  1JZ2 A;  4P08 A;  2V5D A;  3CIH A;  2ZEZ A;  3CDZ B;  2QQK A;  2QQN A;  1WCQ A;  3HNM A;  3WNP A;  2X09 A;  3FN9 A;  3A7Q A;  3F2Z A; 
#chains in the Genus database with same CATH topology
 2A71 A;  1ZZ8 A;  3WW2 A;  5HV0 A;  3TEW A;  1AVB A;  4OQ9 A;  2CGP A;  4BIS A;  2P5B A;  5GM0 A;  2WWU A;  1ALY A;  1POQ A;  1UY1 A;  2JDK A;  4X6Q B;  3UKV A;  4L92 A;  5LA2 A;  1A78 A;  3T0A A;  3WNL A;  1QEX A;  4LOS A;  1UWW A;  1Z7S 1;  3NNL A;  4ZXK A;  3VBU C;  5IAT A;  4WZF A;  3DL3 A;  4XJ9 A;  5AC9 3;  5M0T A;  4RN5 A;  5DN2 A;  3RJR A;  2FDH A;  3LDR A;  2OA2 A;  4HSL A;  1C1F A;  5GLZ A;  3JD7 2;  4YZ2 A;  1S0D A;  4FTS A;  4I09 A;  3EMR A;  4CZS A;  4JTO A;  1F4A A;  5HCA A;  4YGE A;  1CZT A;  4AVC A;  3WX5 A;  4BK5 A;  3NV4 A;  5HPO A;  4YVS C;  4QHO A;  2BFU S;  2RS3 2;  1DLL A;  1PGL 2;  1CZV A;  2GC1 A;  4Q8K A;  2R04 3;  1Y43 B;  1QJF A;  1GZW B;  1AR9 2;  2EIE A;  3CNA A;  3HNB M;  1W8Z A;  1NE6 A;  2DCJ A;  2VXJ A;  5FMB A;  2XJV A;  2YPD A;  4FI9 A;  4LKD A;  4CYD A;  1W8U A;  1FAY A;  4OZX A;  5DG1 A;  5LB6 A;  4G3Y C;  1W8O A;  2WII B;  2XG3 A;  3LEK A;  5DZE A;  4FVV A;  4IND A;  4D94 A;  3IDE A;  2Z69 A;  1CAX A;  1V70 A;  1YYN A;  1N1S A;  1LR5 A;  4QPI B;  5DAB A;  5E6H A;  1ODM A;  2RR1 3;  2WRA A;  2Y6H A;  3INA A;  3USU A;  3WDY A;  3AVR A;  4PDW A;  4YGC A;  1ULE A;  2E7Q A;  2OZJ A;  4IGO A;  4MZU A;  2RMU 3;  4EN9 B;  2YBP A;  1OD3 A;  2WNO A;  4YYO A;  2E33 A;  4AVA A;  1XYN A;  4UFI A;  2MEV 3;  2F4L A;  4YGB A;  1SFN A;  1PK6 C;  3WNM A;  3RGB A;  1WWY A;  3JBG 1;  5L9B A;  3TRS B;  4P02 B;  1PVC 2;  2VUA A;  2VUJ A;  3LDB A;  4LBQ B;  1SLT A;  5D2A A;  3SKJ E;  3KD4 A;  3VDC A;  5GLU A;  2RE9 A;  2VMI A;  5CA6 A;  1XNC A;  2ZAB A;  1BHG A;  2VZR A;  2UYA A;  2WNV B;  1I6X A;  3BKZ A;  2BOI A;  3EQE A;  5KR7 A;  3ZKU A;  1BEV 1;  1LOF C;  2O8Q A;  5FR3 A;  2D3P A;  2GC0 A;  3OGJ A;  2R49 A;  3WF0 A;  2A70 A;  3CJI B;  4I0A A;  1CAV A;  1UL9 A;  4OHW A;  4PIZ A;  5EWS A;  2FZ1 A;  1D2Q A;  1G9F A;  3NQH A;  5T54 A;  4LO5 B;  2Y8K A;  1REE A;  2JDY A;  2WQZ C;  2XOM A;  1R08 1;  5K0U C;  5E16 A;  2QQI A;  2QQO A;  3OPT A;  3ZFG B;  3P1I A;  5GZE A;  4K40 A;  3I2D A;  3LA7 A;  3VZL A;  3VZO A;  5K7P A;  3BN6 A;  4FOW A;  4YW5 A;  4CCL A;  3N9O A;  4DB5 A;  2VMC A;  4BQX A;  1IS6 A;  4KMQ A;  3SQO A;  4CDW A;  1STM A;  3LEG A;  1D7P M;  2W0X A;  3WNK A;  3UL2 A;  1TNR A;  4F83 A;  1RUN A;  1AXY A;  2K2S A;  3B5L B;  1YI9 A;  4DOU A;  4JQT A;  5GLT A;  1COV 3;  1AXK A;  5FCC A;  4B1L A;  2ARE A;  1D4V B;  4ZZ5 A;  3ACH A;  4RS5 A;  4FTE A;  4PHZ A;  1FNY A;  1GLH A;  3POF A;  2CYF A;  3KM5 A;  4NOT A;  1K5M A;  1WGP A;  4BLI A;  3H8U A;  1XNT A;  4XXP A;  4FPH A;  2SLI A;  4XPV A;  3B69 A;  3Q8F A;  3GAL A;  1YEW A;  3T09 A;  4NE9 A;  3SCH A;  5FDB A;  3OUJ A;  3DXT A;  5FP9 A;  3WXP A;  4IV3 C;  3ZPO A;  1ENR A;  1PMH X;  2QVS B;  1W8F A;  4QPY A;  3VZK A;  3SMH A;  1SBE A;  3ZSK A;  1EPW A;  2ZAH A;  3BOP A;  2BBA A;  2ZX2 A;  3MIF A;  3NRU A;  4FT8 A;  3HVD A;  1E5I A;  5EJZ B;  4ARX A;  3WW1 A;  1MS0 A;  3EHK A;  1NCQ B;  5IJR A;  2DF7 A;  2P3Y A;  5I0U A;  1LNS A;  2CU5 A;  2VG9 A;  1J1T A;  3FC0 A;  4QQ2 A;  5DAV A;  4QX1 A;  1EUU A;  5C5T A;  1RUG 1;  1QJU 3;  3H3Z A;  5L73 A;  5KBF A;  1QJZ A;  2WA4 A;  1X33 A;  3I2O A;  1A3K A;  3IAP A;  3GZE A;  4YFZ A;  1UZZ A;  3KF5 A;  3KT4 A;  4Z07 A;  5BUV A;  2BGP A;  2X10 A;  2HYK A;  4QGN A;  1QNY A;  2CDO A;  4LBL A;  1FV3 A;  1UZW A;  1RUH 2;  1GQH A;  4N9I A;  4CDU C;  2Z79 A;  4DY3 A;  2H6C A;  2QQP A;  3M4F A;  4F8A A;  5FOJ B;  2W91 A;  3GJB A;  3R0R A;  4IEP A;  4X6R B;  4CU8 A;  1SPP A;  2VOV A;  2WS9 1;  3GCX A;  1AX1 A;  4XJA A;  2FCV A;  2P37 A;  5D8A B;  1POV 1;  4H55 A;  3V0B B;  1WMX A;  3B01 A;  1PVX A;  1TE1 B;  4XTP A;  1W9W A;  1NYW A;  2ZTN A;  1LEC A;  1RTV A;  3ACI A;  2BUK A;  1YFU A;  2RM2 1;  3POS A;  4LO8 A;  4NPR A;  4UBG A;  4FO9 A;  1G8W A;  1ND2 C;  2BQP A;  3RNS A;  4CEW B;  4FPC A;  2BZD A;  2WAB A;  4Q0Q A;  3T1L A;  4F7Z A;  2GU9 A;  2JKB A;  2ERF A;  3OUI A;  2VZ3 A;  5DDJ 1;  3ZMO A;  2J1V A;  1YIP A;  4DS0 A;  1RUJ 1;  3D82 A;  2IFW A;  1TQ5 A;  2MHF A;  4B1M A;  2BW8 A;  2ZOE B;  4H14 A;  5LA0 A;  2QDN A;  2BTV C;  1HRI 1;  1S4C A;  3VBR C;  5FLH A;  4V1P A;  5DZG A;  5AVP A;  2P6H A;  2YMZ A;  3MPP G;  1ZRC A;  5L7O B;  2FDF A;  1OA4 A;  2VZ1 A;  5IFP A;  1XNB A;  3ZFG C;  3O0V A;  4GB3 1;  1N1T A;  1SEF A;  1HIX A;  4IES A;  4JRA A;  4R9D A;  4BQ2 A;  1O3T A;  3MW3 A;  1W6M B;  2VBP A;  5FWE A;  4DNY A;  2Z2S B;  3VBU B;  1TG7 A;  2P4E A;  3T2P A;  1DQ4 A;  5C9A A;  2OVU A;  4JDN A;  4EJR A;  1T2X A;  1TME 3;  4EWD A;  2CSG A;  4K3U A;  4Q4V 1;  1QXJ A;  1OSG A;  3FBY A;  4HKL A;  3V56 A;  4AI0 A;  3IIA A;  3KF3 A;  2XPJ A;  3S57 A;  3KGL A;  4DUV A;  2PLV 2;  1JYW A;  1CN1 A;  4HON A;  1DZT A;  4Z2W A;  1JBC A;  2OYZ A;  4NUB A;  3POW A;  5C6C A;  1YI7 A;  2K9Z A;  1RJ7 A;  4UFJ A;  3OPW A;  2AEZ A;  2ZBJ A;  1A6C A;  1TVG A;  3H7J A;  5F2W A;  1N1V A;  2FBE A;  1SG3 A;  3L9J T;  4LK7 A;  3EYP A;  2Q5T A;  3IAQ A;  4NPL A;  5CYY A;  5FPU A;  1H2M A;  5IVV A;  2BGO A;  5F5A A;  3HD8 B;  5LK5 A;  4YAR A;  2CWM A;  2EA7 A;  3DF0 A;  2WNU C;  4H7M A;  4HOO A;  1ENS A;  2PXJ A;  1NLR A;  2VR4 A;  3EBR A;  5FO7 B;  1HB3 A;  2TBV A;  2BVB A;  1F8V A;  2HKX A;  3IDC B;  2UYB A;  2JDZ A;  4AXO A;  4BZ4 A;  1UXX X;  2FMD A;  4AVB A;  3Q8E A;  4UFH A;  2YGM A;  4BA6 A;  5A6Y A;  5JWP A;  1CES A;  4A45 A;  2JE7 A;  4COU A;  3PVB B;  2LUW A;  4QPI C;  4IGP A;  3WQ7 A;  1RUI 1;  2G9G A;  4QKF A;  5FZ0 A;  2XVL A;  1GZC A;  3VBS B;  3MW2 A;  4LE3 A;  1WA6 X;  2CHH A;  1QJX 3;  3DKQ A;  2EF6 A;  4CEW A;  1OVS A;  1XU1 A;  1YJL A;  1BJQ A;  1H8T A;  1D0G A;  2RG4 A;  4A2U A;  3ZXK A;  5H9P A;  4C1X A;  2DV9 A;  3BU0 A;  1DGR N;  1WLW A;  1JYV A;  2WNU A;  1V6K A;  5FQ0 A;  2JG9 B;  4MGZ E;  1JUH A;  1ZYB A;  2VJX A;  2WZR 3;  4I02 A;  4NAO A;  4AI1 A;  2FDG A;  1CX1 A;  4R4Z A;  1R1Z A;  3H8O A;  3HMY A;  1DZR A;  3KSC A;  1GNZ A;  3AMN A;  4S2G A;  1APN A;  5C4W B;  3W9A A;  3W58 A;  4NHX A;  1O7F A;  2Q8E A;  3AP4 A;  3FMG A;  1OVP A;  2YPJ A;  4KWK A;  1D0H A;  3VBF C;  1UYX A;  5FOB B;  4KBZ A;  1YLL A;  2L9L A;  5FYU A;  2YDE A;  1WD3 A;  1X7N A;  3D6E A;  5FZD A;  4AVS A;  1DG6 A;  4FSJ A;  3DGT A;  1W3V A;  5JCT A;  4YSF A;  3I2H A;  3O12 A;  1XXN A;  1YC6 1;  4LIT A;  1DGR A;  3NNG A;  1JMU B;  2B45 X;  2WIN B;  1MEC 2;  4DMI A;  5A1F A;  1G9B A;  4WVZ A;  4RR3 A;  5F32 A;  1MR5 A;  3VDD A;  5C9A C;  1AJK A;  3U11 A;  3III A;  3ZDS A;  4PIX A;  2J1T A;  1OOP C;  1PNG A;  1X50 A;  4RA0 A;  3OTF A;  3DXU A;  1TME 2;  3P6B A;  4YM0 A;  5F3C A;  3VB9 A;  5CVR A;  3LOB A;  2J1R A;  4RFT 0;  5ABJ B;  3ZYB A;  2ATF A;  3K3O A;  5CAD A;  5I0T A;  4JKK A;  4XJW A;  3GZU C;  2LM3 A;  3APB A;  2RS5 1;  4CCC A;  1FYU A;  4FPF A;  4YG6 A;  4GMP 0;  1W05 A;  1GKB A;  2H6B A;  3UGF A;  4IV1 A;  2WAA A;  3B9I A;  5FAX A;  4A4A A;  2KM2 A;  5FY5 A;  1PMI A;  4AWD A;  2W47 A;  2WQ8 A;  1QXP A;  2Q8D A;  2B9U A;  4BM8 A;  2ZJC A;  2VTX J;  1POV 0;  2Q1F A;  4K1Y A;  1M4W A;  1HXS 1;  2VO5 A;  3K48 A;  5FZA A;  4NWW A;  4WM7 A;  4BJ0 A;  5A1A A;  5JMO A;  3KV6 A;  5CFC A;  3JQW A;  2A73 B;  3DYO A;  5EPA A;  1E5H A;  3WNO A;  4AI9 A;  1UY0 A;  1QGL A;  2RS1 3;  1RUJ 3;  4A41 A;  1QJX 1;  3AP9 A;  4AFM A;  2JKX A;  3FLT A;  3ZN6 B;  4ERO A;  2QDR A;  4RYD A;  2Y6L A;  1XND A;  1CX4 A;  4KWJ A;  4YW7 A;  5KXB A;  1QY4 A;  2HWC 3;  2WFF 1;  3A23 A;  1QH7 A;  1JYX A;  3WW4 A;  4KNC A;  1SCS A;  4A7Z A;  4FBF A;  1FMD 1;  1OLM E;  1CPN A;  5F8P A;  3LIG A;  1C57 A;  5JAX A;  4P9W A;  3SH4 A;  5HXV A;  1JXN A;  1XYO A;  3WG3 A;  3BTX A;  4HBN A;  4KWU A;  1X9T A;  5LBB A;  4QAW A;  3K51 A;  4OMC A;  1R1A 3;  1VBD 2;  1WBL A;  4DO0 A;  1FPN 2;  4YZ3 A;  5JXH A;  1HXS 3;  4Y5Z 0;  3OGG A;  3ES1 A;  5BNO A;  5HCF A;  1VAV A;  3AM2 A;  4ZY9 A;  5A7N A;  1JU3 A;  3CO2 A;  3OCP A;  3C7G A;  3AZV A;  2GND A;  4K8R B;  4YZ5 A;  5KHG A;  1GQG A;  2OPK A;  4PF1 A;  4UW6 A;  1JYI A;  1OD5 A;  2VMF A;  2BJS A;  2JD9 A;  3G7D A;  1WBF A;  1LOB A;  1WLD A;  2VPV A;  3PVO A;  3H0O A;  5ANN A;  1KQR A;  1CPM A;  1OF3 A;  1ZX5 A;  4FPK A;  3HAG A;  4MGK E;  1GZ9 A;  4QX5 A;  3PVE A;  3TEY A;  4E4S A;  1PIV 2;  3PVN A;  1CR7 A;  2XLG A;  5C3P A;  5FV3 A;  3MID A;  2OS2 A;  2WLP A;  4FPG A;  4AEK A;  5JOZ A;  2W68 A;  4QDR A;  3VBF B;  3MO4 A;  4KWL A;  1TME 1;  3IT8 A;  1XYP A;  3CJI C;  1A34 A;  4E2Q A;  3ORJ A;  5A7W B;  1PVC 1;  1AL2 3;  5DMY A;  3NAP B;  4XFB A;  1DHK B;  1HRV 3;  1YFX A;  1W3X A;  2XL7 A;  1LGN A;  1EV1 2;  1BXH A;  5T55 A;  3GXU A;  1GIC A;  1K12 A;  2Y34 A;  5C9A B;  1Q5O A;  5CBL A;  5JOX A;  3S7E A;  3USS A;  3RFR A;  1OQD A;  1QQP 1;  3VHP A;  2P6C A;  2XQX A;  3ROU A;  2FZ2 A;  1CON A;  3N9P A;  1HXS 2;  1S0J A;  2HWB 1;  3K3N A;  3LEI A;  4Y33 A;  3CZU A;  3RMY A;  3WG2 A;  3TEZ A;  2IVI B;  2WR9 A;  3VUO A;  4Q26 A;  3I2K A;  1QJX 2;  1VP6 A;  1DYK A;  2V09 A;  3AZX A;  3ZR6 A;  2QQW A;  1NCR B;  2IXK A;  4LIU A;  3OEA A;  4NAM A;  2J42 A;  4DXS A;  3O1P A;  1W90 A;  5FMD A;  1JYN A;  3ZX7 A;  3AXE A;  2Y6F A;  3HJR A;  5FYV A;  5JPN B;  1VBB 1;  4OI0 A;  1WCU A;  2K0G A;  2WFF 2;  3O1R A;  4MLO A;  5IAV A;  3LZZ A;  4D7Y A;  2WZR 2;  1I5Z A;  1SBF A;  4RR3 B;  3LA2 A;  4MET A;  5BNP C;  4E27 A;  1BVV A;  1W2N A;  5H9S A;  1CIY A;  2VMH A;  1PZ9 A;  2ET1 A;  1IPK A;  2ADD A;  2IXJ A;  2XH6 A;  5GZF A;  4M3C B;  5DQ0 A;  2LAL A;  2O0O A;  1C8N A;  1ZA4 A;  4LO7 A;  2H0B A;  1W6O B;  3M8L A;  4IGQ A;  5EV7 A;  4GKY A;  2OX0 A;  4W6Y A;  1VMH A;  3JBG 3;  1JZ2 A;  1I9R A;  4P08 A;  1O4T A;  1W6O A;  2YY1 A;  3VHN A;  2D43 A;  1WD4 A;  2R0H A;  5C4W A;  1IS4 A;  5JDB A;  4BU2 A;  1YXW A;  2EAL A;  3BUC A;  2QUO A;  4QX8 A;  4BOW A;  1PO1 1;  5C3Q A;  4XAE A;  2WNU B;  3MF6 A;  5A33 A;  3NAP C;  2ZX4 A;  1SCR A;  5FZB A;  2JJ6 A;  2HWB 3;  3F2Z A;  3H1W A;  4LA3 A;  4AK3 A;  5JIA A;  1VRH 1;  2JG9 C;  4OHV A;  3HR9 A;  1AR8 2;  4JZR A;  5DXD A;  2RDS A;  3NV3 A;  3POJ A;  4WVM A;  4RD7 A;  3OGR A;  3IMM A;  4TLF A;  5E8A A;  2VVE A;  4ZXE A;  1RIT A;  5FY1 A;  4CPB A;  2P3K A;  3HQR A;  4PI0 A;  5FYS A;  2UU8 A;  5DAQ A;  2PHT A;  3OD4 A;  4FPY A;  2R30 A;  2VZP A;  1TMF 2;  1W6N B;  3LKJ A;  1Q8Q A;  4LOT A;  4MUV A;  4M01 A;  5FZG A;  4HVO A;  2CAU A;  4XBN A;  5FJH A;  1Q3E A;  2GSY A;  5FK7 A;  2VD7 A;  4JGZ B;  3VBH B;  3K75 B;  5IWF A;  4XCB A;  4IL7 A;  5FY4 A;  1FI2 A;  4B4Q A;  4E9K A;  1AXZ A;  1RVF 3;  1S2B A;  1F15 A;  2JG8 A;  1ACC A;  2OQ7 A;  2RV9 A;  4CXW A;  1YQ8 A;  4FPE A;  5FZF A;  4Q4Y 3;  1VB4 A;  4CCK A;  1A8D A;  1KS5 A;  1KGY A;  3DYM A;  3I2J A;  3A4U A;  3MZH A;  3ZSJ A;  2IXI A;  2QJV A;  3C7H A;  4O61 A;  1HQL A;  1QJY 2;  4ISQ A;  4P9Y A;  5FMC A;  3CZJ A;  2AC1 A;  2FD8 A;  1VBA 2;  1RHI 1;  2VZQ A;  2HBU A;  2W1Q A;  1QU0 A;  3FLR A;  3ZSM A;  3AKT A;  1LU2 A;  2P2K A;  3QLQ A;  3LWC A;  1L7L A;  2Y6G A;  4P9X A;  1GSL A;  1R1A 1;  4YRD A;  5HV4 A;  5I8T A;  4LLF A;  3GBG A;  3T08 A;  2WT0 A;  3T30 A;  3VLB B;  1ND3 A;  5E88 A;  2ZGN A;  4IEU A;  5C3S A;  3VL8 A;  1MZF A;  1YUD A;  4M3C F;  3ZXJ A;  4WVV A;  1V6N A;  2DFC A;  3AC0 A;  1UZY A;  2VM9 A;  1EPZ A;  1HRI 2;  1RHI 3;  4JGY C;  3O1U A;  3VD7 A;  1RUF 1;  5FWJ A;  5I8Y A;  3GBW A;  5JI9 A;  3IZO A;  3VZM A;  4XET A;  3EB7 A;  2WT2 A;  4HKO A;  3AL5 A;  5AC9 2;  2OW4 A;  5FZ3 A;  1LHU A;  4OUM A;  3N9Q A;  4JAA A;  5FYY A;  5A70 A;  2PAM A;  2BPA 2;  4WM8 A;  5FZ6 A;  3E6B A;  2VU9 A;  2FMY A;  2G9Z A;  4GAL A;  4BK4 A;  2B4K A;  1K5J A;  3I97 A;  3N7J A;  5FYT A;  5FZ4 A;  4CCJ A;  5BNO B;  5CFD C;  5HXM A;  4J25 A;  4XE9 A;  4OI1 A;  4HVR A;  3R6S A;  3UES A;  3DUI A;  5FO9 B;  4AGR A;  2KXL A;  3KCX A;  3V64 A;  1C5I A;  4LE4 A;  4AQ2 A;  4QGL A;  5F9T A;  4KH9 A;  2ID4 A;  5T50 A;  5BNP B;  5B4N A;  3BTA A;  2RS1 1;  4WV8 A;  1PO1 2;  2YHJ A;  4CA9 A;  2G19 A;  4BYY A;  4FP3 A;  2WZP P;  4ZON A;  3PHM A;  2WAO A;  5JXG A;  4KU8 A;  2E63 A;  2WYS A;  4NIA A;  1YO8 A;  2NZ9 A;  1B35 B;  2ZXQ A;  3K4A A;  2V4A A;  3DCQ A;  3MHZ A;  1V0A A;  2W08 A;  3UYJ A;  4OVE A;  4BQ4 A;  4W6X A;  1PO1 3;  1XE7 A;  2HYX A;  2BYV E;  2VGD A;  1QJE A;  5FZ7 A;  4A6S A;  3OPZ A;  2W94 A;  2I45 A;  3WOG A;  4NHY A;  4BDV B;  4H3W A;  4IE4 A;  5JI7 A;  5KXD A;  2XJS A;  2HEY F;  3I7D A;  2R04 2;  3M1H A;  3EO6 A;  3MIE A;  5D21 A;  4DXR A;  1KRI A;  3N9M A;  2RDR A;  4BQ1 A;  2YC4 A;  4L2N A;  4AVT A;  2C26 A;  1VBE 3;  3DEM A;  3FHA A;  1RUD 3;  4YVW C;  3VDB A;  1OA2 A;  3ABZ A;  3P3P A;  4XDQ A;  5CEH A;  3NNF A;  1EAH 1;  3IN9 A;  2HWD 2;  3GDB A;  4KGQ A;  4WM8 C;  5JSR A;  5SV5 A;  3I49 A;  2WLQ A;  1NOV A;  2D6N A;  1JHJ A;  1OQE A;  2VNR A;  2IVJ A;  1OF4 A;  1R09 2;  5FMO S;  3W20 A;  2ZGM A;  3BYW A;  3O14 A;  2J7M A;  3KCY A;  2Y0I A;  4FPO B;  3AYC A;  4I3P A;  3RI8 A;  4AAX A;  1AR6 3;  3O1O A;  1LHO A;  2JDN A;  5T3N A;  5C70 A;  5C8W A;  2DBI A;  4HT1 T;  1W6Q A;  2XXZ A;  2K46 A;  4RS5 B;  4LBM A;  1E5S A;  2C9A A;  2RR1 1;  1NQJ A;  3ME2 A;  5JOY A;  4XUP A;  1UY4 A;  1SPP B;  3JD7 1;  3KVB A;  1QOT A;  2RJK A;  2JDM A;  1PGW 1;  2ZX1 A;  5BNN C;  4CSW A;  2AZ5 A;  3WD5 A;  1LED A;  3H7Y A;  4UT5 A;  1MPX A;  2Y6K A;  4AHX A;  1QIQ A;  3U75 A;  1ASJ 2;  2W9X A;  3OYW B;  5G05 L;  1NZC A;  1MEC 3;  1PK6 A;  1KDM A;  4Y5T A;  4M3C E;  3ZN6 A;  4I01 A;  1QJU 2;  3WHT A;  4XHB A;  2QBX A;  5I0S A;  1YQ6 A;  2Y33 A;  1AR9 1;  1DGW A;  5LRR A;  2A6V A;  3BPZ A;  4GAZ A;  2QQL A;  5F5I A;  4Y26 A;  1RUC 3;  1W6P B;  2RDN A;  2VE1 A;  1UOF A;  4Y24 A;  5FY0 A;  3N7M A;  1NCQ A;  1SAC A;  2B9V A;  1ASJ 3;  4RGA A;  3T0D A;  5CKN A;  1IOA A;  4U36 A;  5JPM B;  2RS3 3;  5FIX A;  3POY A;  3FFZ A;  4KI5 M;  2XVG A;  4AHW A;  3RWK X;  3QOP A;  5IK7 A;  1D4M 3;  3PUH A;  4CEY B;  1O5U A;  5FZ8 A;  5FLJ A;  1Q8V A;  3ST7 A;  1ZZ9 A;  2C1F A;  2XJP A;  3NWK A;  4HAN A;  5HI0 A;  3TN9 3;  1HB1 A;  5A32 B;  3H3U A;  2WA3 A;  1S0I A;  1UOB A;  3IBM A;  3AKS A;  3E6D A;  3LA3 A;  2FCU A;  2ARB A;  4OYU A;  3WDW A;  2ZGQ A;  3USU B;  5A3T A;  4LUM A;  3LEM A;  2B39 A;  2J1U A;  2GAU A;  2GP5 A;  1XE0 A;  4QPW A;  1CAU A;  3VD3 A;  1RUD 2;  2Q8C A;  4DPN A;  1RGS A;  5J98 B;  1E5R A;  1OI6 A;  3TN9 2;  4AI8 A;  1G86 A;  2VBD A;  5GZD A;  1VBD 1;  1PIV 3;  4AFC A;  2SBA A;  1HV1 A;  1UU5 A;  4AFB A;  3N7L A;  5EP9 A;  1EAH 2;  2HWD 1;  4AZZ A;  4Y4Y A;  4LHN A;  4OHZ A;  5EYX A;  4MVT A;  1R08 2;  1IPS A;  1DGW X;  3LFM A;  1ZBE 1;  1LOD A;  5CKM A;  5C8C B;  1Q43 A;  4Y1Y A;  3RZJ A;  2JG8 C;  2R06 3;  4Y1Z A;  2IXL A;  4XDO A;  3AZW A;  5DAX A;  3M3E A;  5KXE A;  1X36 A;  5FYC A;  3T0B A;  3D4K A;  3THD A;  2EXI A;  3JUU A;  3VBO C;  3RZM A;  5LRS A;  1LOF A;  4MHU A;  4R52 A;  3K46 A;  1RJ8 A;  1ULD A;  2CTV A;  3ACF A;  1OC1 A;  3WDT A;  1IS3 A;  5C8C A;  2WQ4 A;  1AX0 A;  3RYR A;  4C91 A;  3AMQ A;  3QD6 A;  2W1S A;  1GUI A;  5K0U B;  4XMA A;  2ZAA A;  2ZGT A;  4GJZ A;  4BIF A;  1NXM A;  3O5S A;  2F17 A;  3HT2 A;  3C8X A;  1FNZ A;  3POI A;  3WF1 A;  4E8D A;  1DQ2 A;  4D69 A;  3TYJ A;  1H4G A;  2GME A;  4P5Y A;  4LBQ A;  5FZC A;  4OZO A;  2EID A;  5K4L A;  4CE8 A;  1S0B A;  1UYZ A;  1UOJ A;  3HOB A;  4FFF A;  3ZVX A;  1UD1 A;  1ZM1 A;  3AFK A;  1V6I A;  3GHM A;  2VOK A;  4L97 A;  2MPF A;  1WW5 A;  2ADE A;  4IEQ A;  4RS5 C;  2AEN A;  5LBF A;  2C5D A;  1QJU 1;  3M3O A;  2VOW A;  1ULO A;  2Z42 A;  1LOE A;  2XKO A;  3H1M A;  5D8A A;  3NW4 A;  2XGX A;  3Q8A A;  1YFW A;  1K5M C;  1U0A A;  2AAC A;  1AR6 2;  3RJ2 X;  2IFR A;  1J58 A;  4RGK A;  2GMP A;  1V9U 3;  1AYN 1;  2QQV A;  3AFG A;  5CZK A;  1CAX B;  4D6Q A;  4FAH A;  1V6L A;  5ANQ A;  2IWG B;  4JGZ A;  3O0W A;  2ZHM A;  5A3U A;  4AFA A;  4L0P A;  4AI2 A;  5IVE A;  3T2T A;  1H2K A;  3WT3 A;  1SLI A;  4Q0P A;  3CQO A;  3BB6 A;  4CDW C;  1RUG 2;  2JB8 A;  3KQR A;  5JZG A;  4LO4 B;  4N90 A;  1JZ6 A;  4K8F A;  2W92 A;  4GWN A;  4CDX A;  4CP9 B;  5FXX A;  3N36 A;  1NAE A;  2IXC A;  2AGS A;  2UWA A;  2ORX A;  2V5Y A;  3JZV A;  1SBD A;  1XC6 A;  2JG8 B;  4HSJ A;  4LNV A;  2WZR 1;  5TSW A;  1W6P A;  3VGI A;  2QQJ A;  1G7Y A;  2PEL A;  3MBW A;  4H2A A;  4QU2 A;  4XFG A;  4Z1V A;  1JTZ X;  2CL2 A;  2OII A;  4AF9 A;  1WZX A;  2OQ6 A;  3WF2 A;  1ZVF A;  1Q8O A;  1YFY A;  2J1E A;  4XFA A;  3WLU A;  3WW3 A;  3ZR5 A;  4JDM A;  1V6J A;  2DUO A;  2W3J A;  3A0K A;  4ASK A;  1VE0 A;  1PK6 B;  4E4D X;  2V4V A;  2VY0 A;  2WS9 2;  4N7I A;  3R4D B;  5ABJ A;  2VTX A;  5IYY A;  4DRR A;  5DDJ 3;  4DIQ A;  2WZE A;  4QXH A;  4MXV A;  4UFM A;  5KHH A;  4HPK A;  1VIW B;  3PJY A;  3ON7 A;  4S2H A;  4CDQ A;  3GNE A;  4K20 A;  4N43 A;  3CHX A;  4NRQ A;  5F2S A;  4HL0 A;  1SHW B;  4LMF A;  5A7P A;  4BQY A;  2Q1M A;  5ACA 1;  3K4D A;  1D4M 1;  4BMB A;  3AP6 A;  1GP6 A;  4LKS A;  2D6K A;  4CDQ B;  1SLB A;  1DDL A;  4OCT A;  1DGL A;  4K6B A;  4SBV A;  1O4Z A;  3I3B A;  4MHR A;  2A6W A;  2HEV F;  4S2D A;  2DVA A;  1HB2 A;  2VCA A;  5GLV A;  3BPS A;  1AUY A;  5H9Q A;  1G6N A;  1K3I A;  1XSQ A;  2ZS6 B;  1GR3 A;  2ZEX A;  4GB3 2;  1Q56 A;  2DBN A;  4OHX A;  2VOT A;  1BBT 1;  5LBE A;  1QKQ A;  1IGO A;  4CCE A;  1COV 2;  3VKL A;  1MZ5 A;  4YWA A;  5C5U A;  2VCB A;  2Y64 A;  3U37 A;  3Q8C A;  2DCT A;  3THC A;  5LCW L;  1CZS A;  2E32 A;  1H8T B;  2VUL A;  3ECQ A;  4UI9 L;  2JWP A;  3RZL A;  3KV9 A;  4IV1 C;  1FMD 3;  4MAD A;  3MLL A;  3KB5 A;  3N7K A;  2HWD 3;  4J6G A;  1HB4 A;  3Q8B A;  4DUX A;  5JOW A;  1U5X A;  3ALQ A;  4KBB A;  3OY8 A;  1ZBE 3;  4NRP A;  5GJ6 A;  3QBQ A;  2XON A;  5CB7 A;  3NAP A;  2X5I C;  3ZYF A;  3J9S A;  1AHS A;  4C0H A;  3NJX A;  4XIK A;  1GWM A;  4WZC A;  4EWA A;  4MH0 E;  2TUN A;  1AYN 2;  1X8E A;  5ERL A;  1X82 A;  1NLQ A;  3TBD A;  2R07 2;  1W2O A;  4XFI A;  2E51 A;  1ONA A;  1EP0 A;  5EFU A;  4C0B A;  1H30 A;  4E4H A;  5KHI A;  4C1W A;  5GKA C;  3RZG A;  5A6Q A;  2VC9 A;  3KS7 A;  4LOR A;  1PHM A;  2DCY A;  4ZPI A;  1N3P A;  3UKN A;  1UZV A;  2RM2 3;  4JCK A;  4RHV 2;  1HLC A;  1D2S A;  4NVP A;  1JN2 P;  5BNP A;  4NWV A;  4HLT A;  1DP0 A;  1H2L A;  2LRO A;  1KJL A;  4JX0 A;  5AC9 1;  2YG0 A;  4CDQ C;  4N7U A;  3VD4 A;  3WDU A;  2PHD A;  4V2W A;  1ULP A;  5D1I A;  1LEM A;  1GU3 A;  3HN3 A;  3A0N A;  4O7X A;  1T6B X;  2XL9 A;  2GZW A;  3ZLI A;  4EN6 B;  4CDW B;  4DY5 A;  1O5L A;  1RVF 2;  5FMO L;  5J09 A;  1W6M A;  2A75 A;  1C1L A;  2JB4 A;  3X29 B;  1IKQ A;  1ZRE A;  3KV4 A;  4B29 A;  1LJ7 A;  3FLP A;  2V73 A;  4LTA A;  2Q1Z B;  1ZBA 1;  5GZG A;  4LBO A;  4CU9 A;  2JX9 A;  1AR8 3;  4XFF A;  3BIE A;  3PU3 A;  2XLF A;  2RS1 2;  3VBH C;  2XDV A;  3CJI A;  1W9F A;  2D6L X;  1K45 A;  1N47 A;  1OHF A;  2RVA A;  3M70 A;  2C9K A;  3OBT A;  1UMI A;  4XW3 A;  2JDA A;  2D6M A;  3ETP A;  4R8H A;  5CNA A;  3ZXG A;  3WEZ A;  3DKW A;  4MGT A;  3ZYI B;  2VAU A;  4FXG B;  4YVS B;  5J37 A;  5E1R A;  4N53 B;  1GBG A;  5EQU A;  2VBB A;  2KD7 A;  2DUR A;  5FUI A;  2YBK A;  3O0X A;  4HK9 A;  2PAK A;  3H1Y A;  1GWK A;  2RMU 2;  4ORF A;  4QHZ A;  2JE9 A;  1BBT 2;  3HN1 A;  3CF6 E;  1QQP 3;  3L2H A;  4P5H A;  4I30 A;  3VKN A;  2BWA A;  2YU1 A;  2WWJ A;  3ACG A;  2Q30 A;  2WYF A;  5JUV A;  1SDW A;  2VVF A;  1W9S A;  3FUO A;  3J7N A;  3BOW A;  4GWJ A;  1UMH A;  3HBK A;  1R09 3;  3AJY A;  4IV3 A;  2ZKN A;  4DXT A;  2HWC 1;  1MS3 A;  2WFF 3;  5FP3 A;  1YQ5 A;  2ORZ A;  2XUE A;  4GZ9 A;  3S5A A;  3ACL A;  2V5D A;  1BYH A;  3AYE A;  2ZEZ A;  4MYE A;  2DTY A;  5C8C C;  5BY5 A;  2DUQ A;  1OPM A;  4EV0 A;  2YGL A;  4IE5 A;  4E2G A;  4NII A;  3SHR A;  2QFE A;  3OD0 A;  1HQN A;  5FY8 A;  1WCQ A;  1DF0 A;  3DV8 A;  3E5U A;  3RZH A;  3WNP A;  2P17 A;  5T5O A;  4DQA A;  2PA7 A;  1EY2 A;  1H8T C;  3AVS A;  4QB1 A;  1Y7B A;  4WM7 B;  3VHO A;  1UKR A;  1PM7 A;  5FZE A;  1K42 A;  1REF A;  1L7Q A;  5LEJ A;  2R16 A;  2R07 1;  3ZSE A;  4BXF A;  1WMF A;  3SNM A;  4NO4 A;  4LKF A;  1DBN A;  4W4Z A;  2O8O A;  1BVP 1;  3QH6 A;  3CMG A;  4Q4W 2;  1VJ2 A;  2VEC A;  3ZKY A;  5A3P A;  4FTB A;  4Y20 A;  4MX3 A;  1XNK A;  3MV1 1;  5E89 A;  5A33 B;  2OT7 A;  5IVC A;  3PIJ A;  3MW4 A;  4BHP A;  2WN2 A;  3O1T A;  1RIR A;  2WNV C;  3ZDV A;  1CAW A;  5KWR A;  1FMD 2;  4Q1R A;  4PLN A;  1UYP A;  3AZZ A;  5F3G A;  3AYA A;  3S5Q A;  2CGO A;  1PGW 2;  1TEI A;  3BCW A;  1OFN A;  1UOG A;  4IV3 B;  1NT0 A;  1JOP A;  4FXK B;  1EV1 3;  4E8C A;  1HRV 2;  3NNM A;  1ASJ 1;  3TNQ A;  1U5I A;  3H8X A;  1K5M B;  5T5L A;  4GWI A;  1WLT A;  3T4H B;  3K2O A;  4MXW A;  3NL1 A;  1W0O A;  4AEJ A;  2VVD A;  4HET A;  3T4V A;  1GOG A;  1RVF 1;  3LIH A;  3WY6 A;  2JIC A;  4K7J A;  1QDC A;  4OI4 A;  1W8N A;  2VME A;  4ASL A;  4YW1 A;  3BTY A;  3H50 A;  1SDD B;  1URX A;  2E31 A;  3PUA A;  1JHN A;  1YQC A;  3KVA A;  4HKW A;  4L8Q A;  4JGZ C;  2ET7 A;  4ASM B;  3RQ0 A;  2NP0 A;  2W39 A;  3KZ4 C;  3J8F 3;  2ZML A;  2WDB A;  2AYH A;  2ZHN A;  2ES3 A;  5F3E A;  3C7E A;  3GYD A;  1C28 A;  4W8J A;  2DVG A;  3NV1 A;  5C7G A;  2DCK A;  4NRO A;  1NCR A;  2B46 X;  4Q0U A;  4GUL A;  4G9S B;  4RL7 A;  4R9C A;  3J4U H;  1VRH 3;  3OF1 A;  4IER A;  1US2 A;  1PGS A;  2XWB B;  3LGR A;  3ZFG A;  1UIJ A;  5BNO C;  5CFD B;  2J1A A;  1V00 A;  1OKQ A;  1VBA 3;  3FBM A;  1O3Q A;  4TZD A;  4Y22 B;  1MAC A;  1Y9M A;  4D0Q A;  2VCC A;  4YG0 A;  4DIN B;  5CG9 A;  3E6C C;  4XIL A;  4QQO A;  1GP5 A;  5IHR A;  4JV4 A;  5DUW A;  4ZZ8 A;  4GMP 3;  1NY7 2;  1YIF A;  4GJY A;  4LBN A;  1ZZC A;  4XUT A;  1BK1 A;  4Q29 A;  2BU9 A;  4AED C;  5JZG B;  1RUI 3;  2VQA A;  3WVJ A;  3WV6 A;  4Z82 A;  4YM2 A;  1Y9G A;  1N3O A;  3ES4 A;  5FZO A;  1QF3 A;  2B42 B;  2QZ3 A;  2R06 2;  3M3C A;  4LT5 A;  2YYO A;  2VUD A;  3LOI A;  1C8M 1;  1RUE 3;  1ZBA 3;  3WDX A;  3ZOI A;  2D98 A;  3U10 A;  3WIN E;  1ULF A;  1ZNP A;  4MGQ A;  5JLV A;  1O59 A;  1O91 A;  4GIQ A;  1MVE A;  1BK0 A;  2RM2 2;  4IE0 A;  2HWB 2;  1W9T A;  3HQU A;  4M0H A;  3ENR A;  1AL2 2;  4GA9 A;  1GQP A;  3WNX A;  5FKB A;  4CUC A;  2VUC A;  3UET A;  3O1V A;  3B94 A;  3GCW A;  4PQ9 A;  2UUR A;  1GMM A;  2UY9 A;  1IS5 A;  2KR2 A;  2VQT A;  2XVK A;  3CKH A;  3RSJ A;  1A8M A;  2VZV A;  1SMV A;  1WA4 A;  1RUJ 2;  2BGC A;  4XYX A;  4CEY A;  1CJD A;  3P3N A;  4XC9 A;  1J83 A;  4JQR A;  1WCD J;  3T2Q A;  2ZGU A;  4W65 A;  4P9J A;  4Q27 A;  1W6N A;  4NPM A;  3I59 A;  3ELN A;  3WF3 A;  2VMD A;  1OFS A;  5B4X A;  4TYS A;  3VN4 A;  5IVJ A;  5K0U A;  5LBC A;  1RMU 3;  4GWM A;  2P3J A;  4WVM B;  4ATE A;  5EYY A;  1RC6 A;  2WO3 A;  4COY A;  1HRV 1;  1FPN 3;  3PME A;  1CQ9 A;  1QJY 3;  4FFI A;  2W87 A;  5F7U A;  3BGA A;  3CLP A;  5FRA A;  4DXZ A;  5C3O A;  2HLE A;  3HQX A;  5A7S A;  1TNF A;  4FAG A;  3SC7 X;  2HWF 2;  3BTZ A;  3N9N A;  4U2A A;  1IG3 A;  5FZ1 A;  4JDO A;  4XJ8 A;  1AZD A;  1I5P A;  5FZL A;  3C2U A;  1NA1 C;  2VOX A;  3DN7 A;  4BLJ A;  2JDH A;  2ZPX A;  2D44 A;  1TMF 3;  4LEJ A;  4UW3 A;  5FLI A;  5L7O C;  1VRH 2;  5JXJ A;  1VR3 A;  2D7F A;  2I2S A;  4PT6 A;  3VBS C;  4LHK A;  4Y1X A;  3WCS A;  3I54 A;  1RB8 G;  2VTF A;  2YV8 A;  4LO6 B;  2YU2 A;  1KFX L;  2XJT A;  1J59 A;  3FHI B;  1E57 A;  3M3Q A;  4COZ A;  5L7O A;  2D3S A;  5L19 A;  1JUI A;  4AI3 A;  4NHL A;  2ZGP A;  4I0W B;  4DUW A;  2H0V A;  1RUI 2;  1WCS A;  4I0B A;  1J3Q A;  4A7Y A;  1NA1 B;  1NY7 1;  2ZZJ A;  3IMN A;  3P5B A;  1ND2 A;  3UNP A;  1H6Y A;  3LSE A;  5BYN A;  5LAT A;  2ZGR A;  1R64 A;  2BVV A;  2PFW A;  1JZ3 A;  2WN3 A;  3MEP A;  4K21 A;  1I3H A;  4OMD A;  2YXS A;  1MS8 A;  1SLL A;  1OLR A;  4BE3 A;  2R06 1;  3AK0 A;  3LB9 A;  1JI6 A;  1MZE A;  3QAC A;  4XVH A;  2F6B A;  2R0F A;  4IW3 A;  1QJY 1;  1H0B A;  4PF5 A;  1QH6 A;  5JSP A;  1VBA 1;  1AYM 3;  1FXZ A;  4K1Z A;  4FOQ A;  4M4P A;  5IAX A;  3H8R A;  4AQ6 A;  1W03 A;  4XZU G;  1DQ6 A;  4LK6 A;  3TB0 A;  3WUD A;  4AQT A;  2WNE A;  1AL2 1;  4YFW A;  5ISL A;  4GD4 A;  2NLR A;  4QT6 A;  5L9R A;  4ZKT B;  5ACA 2;  1QWR A;  4XUO A;  3PDQ A;  4EE2 A;  1NXD 1;  5J96 B;  1RXG A;  4QD2 A;  4TTG A;  4XAA A;  1W04 A;  3CU7 A;  1LTE A;  2PN5 A;  2XLA A;  1RUF 2;  4IEX A;  4BH9 A;  4CVU A;  1W8W A;  3MF9 A;  1GNH A;  4LUK A;  5J7M A;  2HH9 A;  1ODN A;  4B7K A;  3MFC A;  3WCR A;  2R6Q A;  2UWB A;  3FUQ A;  4FPL A;  4NHM A;  5FFO C;  3JU9 A;  1VPH A;  4BIO A;  4O9G A;  5F39 A;  1NE4 A;  1V6O A;  1W6Q B;  5FRE A;  3EJK A;  3RMX A;  2TEP A;  1CIW A;  5EXO A;  1CWP A;  1OH4 A;  5F3I A;  2GMM A;  2RS5 2;  3PNA A;  5DUX A;  2AEY A;  3ZYJ B;  2DDU A;  1KS4 A;  4PBO A;  4PLM A;  4AG4 A;  5FZH A;  5C71 A;  3J7H A;  3PUQ A;  3VBS A;  2HWE 3;  4LBK A;  4YZ4 A;  3WQ1 A;  1XB9 A;  3AB0 A;  2Y0O A;  2CNA A;  1FAT A;  2HWF 1;  3K77 A;  3KT7 A;  5A3L A;  2PHX A;  1S0C A;  4ONU A;  1QOS A;  3ZYG A;  3FL7 A;  3PTY A;  3SH3 A;  3BOD A;  2WO1 A;  3NJV A;  2RJ2 A;  2VZT A;  5DPN A;  3KV5 A;  5CIS A;  2V72 A;  2QCS B;  3MUY 1;  2MEV 1;  5EHD A;  1W06 A;  1DQ1 A;  4DRV A;  2OPW A;  5T5J A;  1GP4 A;  2UWC A;  1OT5 A;  2XJU A;  3WQB A;  4TSV A;  4C90 A;  3DEC A;  1VBB 3;  2A3Y A;  1S2K A;  4IEW A;  2PQS A;  1OQ1 A;  4JGY A;  1F4H A;  3POB A;  2OXB A;  5JVV A;  1WW6 A;  2OKX A;  4AVV A;  4XUN A;  4ES9 A;  4Z92 B;  4QX7 A;  2OUJ A;  3ZSL A;  4CEW C;  4AE2 A;  4L9B A;  3I3E A;  1VBE 2;  1I1E A;  1LHN A;  4MGI E;  2FDJ A;  4KG0 A;  5K8S A;  2ZHK A;  1XU2 A;  1JZ8 A;  2A5Z A;  4CPB D;  4EZH A;  4TXW A;  1XPW A;  4QPG B;  1AJO A;  1F5J A;  1B35 A;  2NMN A;  2WL1 A;  5GLW A;  5FPX A;  3C7F A;  1UAI A;  1DU3 D;  1FPN 1;  1S0E A;  3I4I A;  1UF2 C;  3VBU A;  1KIT A;  2B7Y A;  2D6O X;  5CAZ A;  1OXC A;  3AJZ A;  3VV1 A;  1U5Z A;  1Q8S A;  4QB6 A;  2RDQ A;  2GC3 A;  1VBD 3;  1VAK A;  2EIB A;  1MZ6 A;  1OMI A;  1XBF A;  3BU7 A;  4D8M A;  3N4M A;  3NJY A;  4KG8 A;  2IZW A;  5EJ1 B;  5BXX A;  3WZ1 A;  4GQ7 A;  3H9A A;  1LEN A;  4AFD A;  4QDQ A;  2CV6 A;  4JHT A;  2A1X A;  2A6Z A;  4AHY A;  4XXA A;  4WM8 B;  4ZU5 A;  4YM1 A;  4CDX C;  2WO2 A;  1S0F A;  2RR1 2;  2LW8 A;  2A3X A;  4JKM A;  3J26 N;  3LE0 A;  3PUI A;  1NKG A;  5FY9 A;  3ILR A;  5FYZ A;  1JU4 A;  1F2N A;  1AF9 A;  2AH2 A;  4JRL A;  1LOA A;  2D93 A;  2ETE A;  2JEC A;  1W2A X;  3UJO A;  2RS5 3;  5CFC C;  5A3W A;  4QM8 A;  4Q0V A;  2Q0A A;  1S0G A;  1UYY A;  2BNM A;  4NMI A;  5BNN A;  4TLG A;  5FKC A;  1J1L A;  2BRT A;  3I2I A;  4Q4V 2;  3PUR A;  3OB8 A;  5FTT C;  5BNN B;  4N8M A;  3NST A;  4Y1U A;  4BPZ A;  2F4P A;  3W59 A;  2XJQ A;  1QQP 2;  2JG9 A;  3VD5 A;  3DPR C;  3CL1 A;  1O4Y A;  1DCS A;  2GC2 A;  2JD4 A;  3VL9 A;  5AFB A;  5KC5 A;  4MV2 A;  4W6W A;  4CU7 A;  3MLK A;  1PZ7 A;  2ZCW A;  2P34 A;  4URT A;  4HPK B;  5F6K A;  1HQW A;  3ZYP A;  4R9A A;  3BVC A;  2LRP A;  5LK7 B;  1F9K A;  4ZS3 A;  5A1L A;  3ZPY A;  4Q4W 1;  1PX4 A;  3ZXL A;  2W46 A;  4X8P A;  3R4S A;  5IVB A;  2ZA9 A;  2VQ0 A;  3RDI A;  4GH4 C;  3IKW A;  1OKO A;  2PLV 3;  1KEX A;  3J8F 1;  4XDP A;  1Z78 A;  5LY2 A;  3AXD A;  2GN7 A;  1V6M A;  4FQZ A;  4XAB A;  3ZM8 A;  3LSD A;  4ES8 A;  3QH7 A;  2Y26 A;  4CDX B;  1OA3 A;  4AW7 A;  4NHK A;  5L9V A;  1RUD 1;  1BBT 3;  2HJI A;  3OEB A;  3WP4 A;  1NQD A;  3SEP A;  1W2T A;  3NKT A;  1HDK A;  5IVY A;  4QPG A;  2C6S A;  4Y3O A;  1BMV 2;  5LY1 A;  3GM8 A;  5IFT A;  1H2N A;  2HWE 1;  2J1S A;  1LHV A;  5FP4 A;  4XUQ A;  3PTR B;  1J84 A;  5FYH A;  4BQW A;  5J36 A;  1GZT A;  5A80 A;  2DU0 A;  4PJY A;  3S30 A;  4AQS A;  1LAJ A;  3SCG A;  3O1M A;  1H4H A;  4B4P A;  1AR7 1;  1N3Q A;  2PAE A;  4HXC A;  1AR8 1;  4Q4X 1;  3LF7 A;  1SQ4 A;  2X5I A;  2NPI A;  2VW1 A;  3VKO A;  1VMF A;  1F5F A;  1Z7S 3;  4HMZ A;  1XRU A;  3VZJ A;  1YNA A;  3RZK A;  1LUL A;  5DZF A;  4BWO A;  3UGH A;  1ENQ A;  1NZI A;  3AMM A;  4DEV A;  4Y22 A;  4IQP A;  4AEM A;  3UK9 A;  4Z8B A;  3R05 A;  1IQD C;  5CFD A;  3BI3 A;  2P3I A;  4RQP B;  1RL3 A;  3MFA A;  2PHW A;  2YB7 A;  5HBA A;  2ARC A;  2N7G A;  1UQX A;  3Q9O A;  4LUL A;  5LEK A;  1RXF A;  4A42 A;  3AP5 A;  2XWJ B;  3JBG 2;  1W39 A;  2X05 A;  2W52 A;  3FHQ A;  1JYT A;  3O1S A;  4XHX A;  1OH3 A;  4BCU A;  1OOP A;  4F3J A;  1KXG A;  2VNO A;  4FPJ A;  2BBV A;  3LPF A;  4IEY A;  1PO2 3;  5K9Y A;  1PX3 A;  1DYP A;  5C33 A;  3SKV A;  2BNN A;  2XKP A;  1GFF 2;  3JB8 A;  3MYX A;  4Q4Y 2;  4XF0 A;  3ZXD A;  3N35 A;  2DVD A;  2EAK A;  4XZP A;  3T2O A;  3IWZ A;  2I74 A;  4D6R A;  4AOC A;  3B9C A;  2Q4S A;  1DLC A;  1S2E A;  2W1W A;  2R7E B;  1ZZ6 A;  5CKQ A;  4WVW A;  4CCM A;  2XR4 A;  3WG4 A;  1DQ0 A;  3GF6 A;  4GH4 A;  5A7W A;  5F37 A;  3B3Q E;  4XQD A;  3JB4 C;  4K9S A;  2J22 A;  4L99 A;  5KXC A;  1CAU B;  3A22 A;  1OLM A;  3VBF A;  5EIY B;  5DG2 A;  5F1R A;  1HJG A;  3LFI A;  4LKE A;  4QQL A;  5C3R A;  3UGG A;  5FPZ A;  4ZS2 A;  2ZGO A;  4XAC A;  4E4Z A;  5I93 A;  3ASI A;  2JE8 A;  3MGU A;  4IEO A;  3ZN5 A;  4YLZ A;  4BB3 A;  2GN3 A;  3G6J B;  3OG2 A;  3ZXF A;  3RPQ A;  2YFZ A;  3CBN A;  1GOH A;  4RFR B;  2AUY A;  3OSD A;  4NN0 A;  5A6X A;  3DPR A;  5FPL A;  4FOY A;  3AKQ A;  3AL6 A;  1B35 C;  2ZHL A;  3U4S A;  4ATF A;  2A7A A;  1OBN A;  4RQP C;  1MVQ A;  4HN0 A;  5F5Q A;  4LA2 A;  3SIS A;  3CIH A;  1BMV 1;  4V2V A;  2OUH A;  3OUH A;  4CP0 A;  2WO7 A;  4XTM A;  2G1M A;  1G9A A;  2HWE 2;  3GJA A;  4NJ4 A;  4SLI A;  5LW9 A;  1FOD 1;  2PMW B;  2X09 A;  3FN9 A;  1SFP A;  4XBL A;  3FWE A;  1RUH 3;  2I07 B;  3EXU A;  4LBQ D;  1PM4 A;  4XFC A;  1PO2 1;  2GNT A;  3D0J A;  1CD3 G;  3MDP A;  4LR4 A;  2GAL A;  4Q4V 3;  5FZI A;  4HZF A;  4AL9 A;  1UU6 A;  4Q4X 2;  4D7T A;  1WW4 A;  2TNF A;  5JR7 B;  3WDV A;  2YC0 A;  3M7A A;  3NV2 A;  2X8K A;  3KMH A;  4ZHN A;  2VW2 A;  3LAG A;  2E7T A;  4EWE A;  1OUR A;  3A21 A;  4H7L A;  4EQV A;  1PIV 1;  3ILN A;  4CTE A;  2VZS A;  3ZXA C;  1PVC 3;  4BQ5 A;  5A7Q A;  2D3R A;  1COV 1;  4MSV A;  3B02 A;  4R9B A;  3RYP A;  2XQR A;  3PU8 A;  1HKD A;  2CGN A;  4IE7 A;  2R04 1;  4NR1 A;  1V9U 1;  3RI9 A;  1IPJ A;  5IW0 A;  2MNG A;  3IPV A;  3UV9 A;  1L7R A;  1RUH 1;  5JIU A;  4FFH A;  2RHP A;  5FQ0 B;  4XF3 A;  4QKB A;  1AX2 A;  1XE8 A;  1LOC A;  2WKK A;  4IEV A;  5CU1 A;  1EV1 1;  2ZEY A;  3ZIX A;  3RG0 A;  1XQN A;  1MS4 A;  5CFC B;  1CAV B;  2BDR A;  3JXS A;  2VNV A;  3LPG A;  4UFK A;  4PQQ A;  1O3R A;  1NG0 A;  1C8M 3;  1RUE 1;  1YQ2 A;  2LS6 A;  2WC2 A;  3ZXE A;  1KDK A;  2FDK A;  3QCW A;  1W0P A;  1ULC A;  1EYB A;  4E2S A;  4UF0 B;  2GDF A;  4HVQ A;  2E26 A;  4FCA A;  5B2G B;  5JXI A;  2B5H A;  3CEW A;  3WF4 A;  4B7E A;  4IUG A;  4XCA A;  2WZ8 A;  3PIG A;  2BFU L;  4MGS A;  4XJZ A;  1HV0 A;  1RUC 2;  3MV0 1;  3HPN A;  5FP7 A;  5JMC A;  3W5M A;  2DTW A;  2ZEW A;  1JZ7 A;  1QHD A;  4KU7 A;  4AAP A;  2PHF A;  3WP6 A;  4CCD A;  3AKP A;  4QXK A;  4ZU4 A;  5ACA 3;  1BEV 3;  2BNO A;  1ND3 C;  1LU1 A;  3BIW E;  1JYC A;  2YFU A;  3SIT A;  3ZFE A;  3V0A B;  2YUE A;  2P1B A;  2VQU A;  1F35 A;  3PMS A;  4QHB A;  3TNP B;  2YZ4 A;  4IE6 A;  4QPI A;  4IXL A;  1BQP A;  1ZRI A;  4OUS A;  5EJ3 A;  4RGG A;  5IK8 A;  1O8S A;  4OFG A;  2WSU A;  3U4X A;  1UKG A;  4JC1 A;  5A3M A;  4LHL A;  5DAP A;  3ETQ A;  2ZX3 A;  1WCK A;  1ENX A;  3OOX A;  4GMP 1;  1NCQ C;  4A3Z A;  1KJR A;  3OY8 B;  1YCI A;  1ZZ7 A;  3L2Y A;  4QX0 A;  3U07 A;  1VMJ A;  5FO8 B;  2WFP A;  1GOF A;  4RR3 C;  4QM9 A;  4B4R A;  2VZU A;  1B09 A;  3O7O A;  4PCR A;  5FYM A;  4QQP A;  5FYB A;  4XOG A;  4COW A;  3J7M A;  2ZX0 A;  1FOD 2;  4XIO A;  2ILM A;  4UAP A;  4R4X A;  2E9Q A;  2JIJ A;  2YC2 A;  4AYU A;  3PLQ A;  4URA A;  2EXK A;  1PO2 2;  4PIY A;  3FE5 A;  4D6S A;  1T6G C;  1GV9 A;  5G04 L;  3E97 A;  2XBO 2;  3J7L A;  4HK8 A;  3WUC A;  1GYK A;  5T52 A;  2GH2 A;  2O1Q A;  2PTM A;  1UY2 A;  4M4R A;  2D6P A;  2WSV A;  3I8T A;  4QPG C;  3GZT B;  4CUB A;  3VDA A;  2GP3 A;  3U14 A;  4QX3 A;  4S2F A;  2W2I A;  4QMA A;  5AVA A;  4YW2 A;  5HCB A;  4QKN A;  1VBE 1;  4A7K A;  4P9G A;  1HN1 A;  2HBT A;  5FXZ A;  1IHM A;  2GNB A;  2CAV A;  1CGP A;  4XBQ A;  4EN8 B;  2D40 A;  3HT1 A;  3ZFF A;  2UY8 A;  5AFE A;  3MPB A;  1V9U 2;  1H1A A;  3K4Z A;  3W5N A;  1UO9 A;  2G9F A;  4O65 A;  4TWT A;  2DVF A;  1ZZB A;  3C7O A;  4MXW B;  4YW4 A;  3TN9 1;  5IK5 A;  1ND3 B;  3HWJ A;  5JR2 A;  1JZ4 A;  2VCM A;  1MS5 A;  2CDP A;  2IC1 A;  2R32 A;  3AZY A;  1JOB A;  3E1F 1;  4Q4X 3;  2WBK A;  2CWS A;  5FZM A;  3KHC A;  3VBR B;  1G9C A;  4CEY C;  2ZAC A;  1BZW A;  4B3N A;  4A6O A;  1W8T A;  1RUE 2;  3NO8 A;  4YM3 A;  4QGM A;  3TOJ A;  4CDU A;  4DZG A;  1ZBE 2;  5FZ9 A;  2E53 A;  3MUZ 1;  2R07 3;  3WHU A;  2X53 S;  4LBJ A;  4NRM A;  4Y1V A;  4NIH A;  1VAL A;  5FBZ A;  4M0N A;  2VW0 A;  1RUC 1;  1UNB A;  4J1X A;  1UX6 A;  1Z7S 2;  4YVW A;  2PQQ A;  1Y9Q A;  1RED A;  4IEZ A;  4CP9 A;  5I91 A;  3AMH A;  1S1A A;  5I0D A;  3CJX A;  4P9L A;  5LZ6 A;  4Q2F A;  3T3Y A;  4QXC A;  1IQA A;  1RYY A;  4YW6 A;  4WBB A;  4IV1 B;  4XFH A;  3GHN A;  4KQ7 A;  4XEZ A;  4Y4R A;  1W0N A;  4C8D A;  4MG2 A;  3M3I A;  5FP8 A;  4LIV A;  1VBC 2;  5DUV A;  5IVF A;  2JIG A;  2XML A;  1DYO A;  2Z4F A;  3OBA A;  1J3R A;  4O9E A;  3GGL A;  3DYP A;  4Q4W 3;  1NA1 A;  2NM1 A;  2NQY A;  2RJL A;  4QDS A;  3URF A;  1PGL 1;  1BCX A;  5KHK A;  3IB3 A;  1WUV A;  4RSU A;  1P8J A;  2W95 A;  3HBZ A;  5BV6 A;  4XQW A;  1J3P A;  4ET7 A;  4HG6 B;  4CCN A;  1AR6 1;  2EIG A;  1SLA A;  4BXS V;  1UPS A;  1HN0 A;  1NCR C;  4YW3 A;  3ZFF B;  3E5X A;  4KGG A;  4N53 A;  1H9W A;  4FQ4 A;  1U5Y A;  4CDU B;  4N43 C;  4GH4 B;  1GWL A;  1YRZ A;  4FFG A;  5EZW A;  3VBR A;  5LA1 A;  1MQT C;  4CUG A;  1LHW A;  1JW6 A;  2XBO 1;  3NKG A;  4Y5S A;  3RWN A;  2VNG A;  5IT6 A;  2ZGK A;  4IDZ A;  2XHK A;  4M3C A;  3MIH A;  3VKF C;  4JKL A;  5DUU A;  4P9I A;  1M06 G;  2IXH A;  2JDU A;  2JEN A;  5A3O A;  4Q0S A;  3IM0 A;  4AGG A;  3J8F 2;  3RYK A;  2YBS A;  2XUM A;  4I2O A;  4ISR A;  2Z5W A;  4OUE A;  4XF1 A;  5BPX A;  1HX6 A;  3BAL A;  3I3M A;  1TZO A;  5CIR A;  5T5P A;  1UW8 A;  4CXY A;  5HCH A;  4FOV A;  4EN0 A;  3N3H A;  2VMG A;  1SFY A;  2QQM A;  1L3J A;  1MQT B;  2EVX A;  4MGY E;  2WNV A;  2NN8 A;  1WMD A;  1BEV 2;  2EIC A;  3RVH A;  5F5C A;  3SCF A;  3LDK A;  3AMP A;  3ZIW A;  4AED B;  1LGC A;  3HNY M;  2Q8O A;  3POE A;  4BQ3 A;  4XF9 A;  2ZGS A;  4RHV 3;  4QU1 A;  3THT A;  4YG3 A;  1H8V A;  2E6V A;  1X9P A;  3D5O A;  3ZYH A;  4N53 C;  5FJK A;  1R09 1;  1AR7 2;  1CJP A;  2BEO A;  5CG8 A;  4N9H A;  3ZFE B;  5FZK A;  3WR0 A;  1OLQ A;  3V0A A;  2QTW B;  4PDW B;  2JDP A;  5KC6 A;  5D8A C;  1G9D A;  1GAN A;  2VL4 A;  2B8M A;  1AYN 3;  2WT1 A;  4ARY A;  2EXH A;  1LRH A;  3ZFF C;  2DYC A;  3H42 B;  5APA A;  1ZRR A;  4IET A;  1YWK A;  4AED A;  1UPI A;  1EUT A;  2ZMK A;  5FZO B;  3ATG A;  3R4U A;  3MIG A;  1O8P A;  3OJB A;  3LD8 A;  1OUS A;  3S6P A;  2QQU A;  2BP6 A;  2HWF 3;  2NMO A;  4CCO A;  5GZC A;  4AGV A;  1VBC 1;  4Z2A A;  3GBF A;  4YNI A;  4JGY B;  3T1M A;  1UN1 A;  2ARX A;  1N1Y A;  4AR2 A;  1H1M A;  1GZW A;  2XJR A;  4UFL A;  5FPB A;  2C24 A;  4PDW C;  3OBZ A;  5L36 A;  3D3A A;  1O6U A;  3KT1 A;  3RRD A;  5FYI A;  4LHS A;  4UXA A;  3E5Q A;  1PMJ X;  4MOA A;  4Q4Y 1;  5IK4 A;  5J48 A;  3KLS A;  1NLS A;  3VKM A;  1RMU 2;  1MS1 A;  4HN1 A;  5FK8 A;  3IDA A;  5A7O A;  2ARA A;  1XNA A;  3S7I A;  1H9P A;  1JS9 A;  2O14 A;  4J1W A;  1JOD A;  1MS9 A;  2AR6 A;  3WP3 A;  3VD9 A;  4D3W A;  4Q5O A;  4TN7 A;  3V65 A;  4UBH A;  1GNY A;  2QE3 A;  2ZKL A;  3NVC A;  3HIF A;  3KHB A;  3POG A;  1UY3 A;  2DFB A;  1QOO A;  4L11 A;  1Y3T A;  2YRO A;  2ZZQ A;  1VRB A;  4GKX A;  5FXW A;  1Z0H A;  4RHV 1;  2X29 A;  5FUN A;  4AHZ A;  1VBB 2;  4UYB A;  4UW4 A;  2PHU A;  1QDO A;  5KHJ A;  3WG1 A;  1WME A;  3IPV B;  3V0B A;  2A6Y A;  3ITQ A;  5FUP A;  4QQH A;  3ZFE C;  4Q1P A;  3IDB B;  4UOJ A;  3UT0 A;  2BER A;  3VZN A;  4CUA A;  4YGD A;  2VXR A;  1W9Y A;  3KCC A;  2JXA A;  1DQ5 A;  3LCP A;  4XUR A;  3AX4 A;  1C3H A;  1VLN A;  2KA3 A;  2Y38 A;  1C5H A;  3ILF A;  1PNF A;  3PJQ A;  5GAL A;  2A6X A;  3U0Z A;  1WKY A;  4OI2 A;  2JEM A;  3NNJ A;  3W21 A;  1NUK A;  1R08 3;  2WUH A;  4LXL A;  1DFQ A;  4XJU A;  4XQ4 A;  4Y20 B;  4CP2 A;  1OPO A;  1ZBA 2;  3B7M A;  2W5F A;  2XHN A;  3HEI A;  3KGZ A;  3NJZ A;  3I3D A;  5H9R A;  1UX7 A;  2BWC A;  4PLO A;  1AYM 1;  1IG0 A;  1RUF 3;  2R1B A;  4YVW B;  2D5F A;  3AP7 A;  3FZ3 A;  2XBO 3;  4QX2 A;  1VBC 3;  5FXV A;  4XF4 A;  1POV 3;  3I59 B;  4XMI A;  5DDJ 2;  3ZO0 B;  4PBP A;  3ZMN A;  3TWI A;  1UXZ A;  5F6L B;  4HFS A;  4FP2 A;  5J1X A;  4UW5 A;  2A3W A;  3OGV A;  4JVA A;  2QKD A;  1W99 A;  1NX9 A;  2ENR A;  4QB2 A;  4YPJ A;  3WP5 A;  3WQ0 A;  3DPR B;  1U12 A;  4EN7 B;  2QNK A;  2DCZ A;  4OQ8 A;  1HJF A;  4Q8L A;  1TMF 1;  3M2M A;  4COV A;  5A6Z A;  5JSO A;  3WNN A;  2WWS A;  3I2G A;  4LJH A;  5LWB A;  1O3S A;  3SEE A;  2RMU 1;  3PUS A;  4UWD A;  2R1D A;  1ULG A;  5DAW A;  1YHF A;  2WJS A;  3VDD B;  5SV8 A;  3PL0 A;  4YZ1 A;  1ZRF A;  2HWC 2;  3FX3 A;  1H6X A;  2PLV 1;  4CP1 A;  4EZ4 A;  1VB2 A;  2Y6J A;  1KFU L;  2DVB A;  2LTN A;  1AL0 G;  4GB3 3;  1UCX A;  1UMZ A;  3D8C A;  4QXB A;  4YVS A;  3U1X A;  2Y60 A;  4ZU7 A;  2ZMN A;  4NIG A;  1JZ5 A;  1IKP A;  1RMU 1;  3JCI A;  1OOP B;  4B8E A;  4I3G A;  1HRI 3;  1RHI 2;  1SLC A;  2D97 A;  2QZ2 A;  3C3V A;  2PHR A;  4LPL A;  5FPA A;  3WSO A;  2MEV 2;  3UJQ A;  2EXJ A;  1R1A 2;  1VAM A;  4P14 A;  3VDD C;  5LAS A;  3ZYR A;  4CU6 A;  4NID A;  4RQP A;  4W50 A;  2GNM A;  2BOJ A;  2G4I A;  1UZ0 A;  2PHL A;  4LLO A;  3VHR A;  1JH5 A;  1QMJ A;  2NYY A;  1LOG A;  4M00 A;  1S55 A;  1OUX A;  2BV4 A;  1Q8P A;  1W8H A;  1WW7 A;  1WLC A;  3OBR A;  3VBO A;  1PZ8 A;  1FOD 3;  1EAH 3;  1XSR A;  1ZA7 A;  2X5I B;  3NMB A;  1AR7 3;  3I2F A;  5FY7 A;  1QXR A;  5A3N A;  2D5H A;  2W1U A;  3KWV A;  4OHY A;  2WS9 3;  2FCT A;  3KQ4 B;  2CY6 A;  2RS3 1;  3FFQ A;  1ST8 A;  1US3 A;  2C0Z A;  1YJK A;  4JHZ A;  4WM7 C;  4DEQ A;  1W28 A;  4G4F A;  3FJS A;  3UKT A;  2VZO A;  2HEW F;  3GZA A;  4LQR A;  4N43 B;  1XOY A;  4D7S A;  1AR9 3;  2IUW A;  2FHR A;  4CRQ A;  1RUG 3;  1UU4 A;  4DFS A;  1Y4W A;  1AYM 2;  2C4X A;  3AYD A;  3F95 A;  3OGS A;  4P00 B;  3SH5 A;  1LKN A;  1RIN A;  5A32 A;  5BNQ A;  1RUO A;  4PI2 A;  4JTN A;  1CAW B;  1D4M 2;  3B00 A;  5JZG C;  4OLL A;  1LES A;  1JOJ A;  4MO3 M;  3MI8 A;  3VBH A;  2ZGL A;  4EYU A;  1UIK A;  2FDI A;  3AKR A;  5C4W C;  3JD7 3;  1MEC 1;  2DUP A;  1C4R A;  1KD7 A;  3JQX A;  4UF0 A;  2PYT A;  3SLI A;  1XJA A;  1MQT A;  4OUL A;  3RZZ A;  2OZ6 A;  4KL1 A;  3RS6 A;  3U78 A;  3VBO B;  1LB2 A;  2XB6 C;  2VH9 A;  3MIB A;  3S0M A;  3B93 A;  1FV2 A;  1W2U A;  2DU1 A;  5FPV A;  1ZRD A;  1DIW A;  4ITC A;  1BLZ A;  4BME A;  3THP A;  1SZB A;  2FQP A;  4QWN A;  2DWR A;  4A44 A;  4A3X A;  4CXX A;  3ZN4 A;  3D0S A;  1ND2 B;  5I8S A;  1C8M 2;  1DZQ A;  1H1I A;  2GH8 A;  5I0R A;  3OYW A;  1FT9 A;  1IZ3 A;  1QNW A;  5J3U A;  3N9L A;  5LA9 A;  1LGB A;  5IUQ A;  1FX5 A;  3CDZ B;  2EAA A;  4X8N A;  3TEX A;  1CVN A;  2QQK A;  3TAY A;  5ABJ C;  3MLJ A;  2E7A A;  2QQN A;  4QKD A;  1BKZ A;  1LCL A;  3HNM A;  3I3Q A;  1F31 A;  3MIC A;  1HW5 A;  3A7Q A;  3LQC A;  4GXL A;  3SXW A;  1X8M A;  5FBJ A;  3H3L A; 
#chains in the Genus database with same CATH homology
 4QB1 A;  5JXI A;  1K42 A;  1L7Q A;  1UY1 A;  3OGR A;  5LA2 A;  4ZXE A;  3T0A A;  4W4Z A;  3WNL A;  1UWW A;  3CMG A;  3MV1 1;  2VZP A;  4RN5 A;  5DN2 A;  3A21 A;  2WN2 A;  2VZS A;  3K75 B;  1F4A A;  4E8C A;  1CZT A;  4BK5 A;  5HPO A;  1L7R A;  2RV9 A;  4GWI A;  1CZV A;  1GOG A;  2ZEY A;  1KGY A;  3DYM A;  3I2J A;  1W8N A;  2VME A;  2EIE A;  3HNB M;  3JXS A;  1SDD B;  3C7H A;  2E31 A;  3LPG A;  2DCJ A;  4PQQ A;  4FI9 A;  3CZJ A;  1YQ2 A;  2LS6 A;  2W1Q A;  2VZQ A;  2WDB A;  1W8O A;  2E26 A;  3C7E A;  4W8J A;  3LEK A;  2Y6G A;  3WF4 A;  4IUG A;  5C7G A;  2DCK A;  2WZ8 A;  4MGS A;  3T08 A;  3MV0 1;  3HPN A;  3W5M A;  2Y6H A;  1US2 A;  2ZEW A;  1JZ7 A;  2J1A A;  3AC0 A;  4D0Q A;  2VM9 A;  2VCC A;  3VD7 A;  1OD3 A;  2E33 A;  5IHR A;  2YFU A;  4ZZ8 A;  2VQU A;  3EB7 A;  4XUT A;  3WNM A;  4P02 B;  3VDC A;  3SKJ E;  1O8S A;  4BK4 A;  2B4K A;  3I97 A;  5HXM A;  1BHG A;  2VZR A;  3UES A;  4A3Z A;  4QX0 A;  1GOF A;  4MGQ A;  2VZU A;  3WF0 A;  2ID4 A;  1O59 A;  5B4N A;  3NQH A;  1W9T A;  2Y8K A;  2XOM A;  4CUC A;  1GQP A;  2QQI A;  2QQO A;  3UET A;  3P1I A;  4UAP A;  2YC2 A;  2WAO A;  5JXG A;  1GMM A;  2WYS A;  3BN6 A;  2VQT A;  2VMC A;  2ZXQ A;  3CKH A;  5G04 L;  2VZV A;  4KMQ A;  3K4A A;  3LEG A;  1D7P M;  3WNK A;  1UY2 A;  4M4R A;  1J83 A;  4CUB A;  3T2Q A;  3VDA A;  4QX3 A;  2HYX A;  3WF3 A;  2VMD A;  5B4X A;  2W94 A;  1HN1 A;  4ZZ5 A;  3ACH A;  4BDV B;  3K4Z A;  2WO3 A;  4DXR A;  3W5N A;  1XNT A;  2YC4 A;  3C7O A;  5F7U A;  2C26 A;  2W87 A;  3BGA A;  3FHA A;  5JR2 A;  1JZ4 A;  3T09 A;  2HLE A;  3VDB A;  3ABZ A;  2CDP A;  3E1F 1;  2WBK A;  3GDB A;  1PMH X;  4A6O A;  1I5P A;  1JHJ A;  3MUZ 1;  3NRU A;  2BBA A;  1OF4 A;  5JXJ A;  4PT6 A;  5EJZ B;  2J7M A;  4ARX A;  4AAX A;  2VTF A;  5IJR A;  5C70 A;  1LNS A;  4QX1 A;  1EUU A;  5I0D A;  4XUP A;  1UY4 A;  3IAP A;  1RYY A;  4DUW A;  1W0N A;  2BGP A;  2X10 A;  1MPX A;  2Y6K A;  3UNP A;  1H6Y A;  2CDO A;  3OBA A;  1DYO A;  2Z4F A;  1R64 A;  2W9X A;  3GGL A;  3DYP A;  5G05 L;  1JZ3 A;  4QDS A;  2WN3 A;  4OMD A;  3IB3 A;  2W91 A;  4CU8 A;  1P8J A;  2QBX A;  2W95 A;  1JI6 A;  4XVH A;  4ET7 A;  4HG6 B;  2QQL A;  1W9W A;  3ACI A;  4M4P A;  4BXS V;  2B9V A;  3T0D A;  4XZU G;  2BZD A;  2WAB A;  4KI5 M;  5LA1 A;  2VZ3 A;  4XUO A;  2J1V A;  3PUH A;  4TTG A;  5LA0 A;  4CVU A;  2VZ1 A;  4JKL A;  5IFP A;  4OYU A;  4OUE A;  1TG7 A;  2J1U A;  3T2P A;  1OH4 A;  4QPW A;  1T2X A;  3VD3 A;  2QQM A;  2DDU A;  4AG4 A;  4DUV A;  1JYW A;  2EIC A;  5C71 A;  3J7H A;  3K77 A;  3HNY M;  3FL7 A;  1TVG A;  2WO1 A;  3NJV A;  2VZT A;  2RJ2 A;  5DPN A;  2V72 A;  1SG3 A;  5CYY A;  3EYP A;  3IAQ A;  3MUY 1;  2BGO A;  3T0B A;  1OT5 A;  3THD A;  3WQB A;  3DEC A;  3K46 A;  2VR4 A;  2PQS A;  3ACF A;  2VL4 A;  1F4H A;  4ARY A;  2W1S A;  1GUI A;  2OKX A;  1UXX X;  4XUN A;  4A45 A;  3I3E A;  3C8X A;  3WF1 A;  1EUT A;  4E8D A;  1JZ8 A;  1O8P A;  4P5Y A;  4OZO A;  2EID A;  4Z2A A;  4TXW A;  1UYZ A;  1XPW A;  3HOB A;  3C7F A;  1ULO A;  3D3A A;  1JYV A;  4LHS A;  1PMJ X;  4MOA A;  2VJX A;  4QB6 A;  1CX1 A;  3IDA A;  1XNA A;  2EIB A;  4D8M A;  5CZK A;  3VD9 A;  5EJ1 B;  1GNY A;  1UYX A;  4QDQ A;  2L9L A;  1UY3 A;  4L0P A;  3CQO A;  3I2H A;  2WO2 A;  3NNG A;  1JZ6 A;  2LW8 A;  2W92 A;  4JKM A;  3LE0 A;  1NAE A;  1NKG A;  3PUI A;  2ORX A;  1XC6 A;  3III A;  1JU4 A;  2J1T A;  2QQJ A;  3MBW A;  3P6B A;  4UOJ A;  4CUA A;  2BER A;  3WF2 A;  2J1R A;  2J1E A;  1UYY A;  4JKK A;  2W3J A;  4XUR A;  2V4V A;  3I2I A;  5IYY A;  3OB8 A;  1WKY A;  2WAA A;  4A4A A;  1NUK A;  2WUH A;  2WZE A;  2W47 A;  2WQ8 A;  3HEI A;  2W5F A;  2XHN A;  3VD5 A;  3I3D A;  1UX7 A;  2VO5 A;  5A1A A;  1SHW B;  4BJ0 A;  5JMO A;  3DYO A;  4CU7 A;  3WNO A;  3K4D A;  1UY0 A;  4QX2 A;  4A41 A;  4LKS A;  1UXZ A;  2JKX A;  5J1X A;  3OGV A;  4QB2 A;  4RYD A;  1W99 A;  1NX9 A;  2Y6L A;  3I3B A;  4YPJ A;  1PX4 A;  2W46 A;  3A23 A;  3LQC A;  1JYX A;  2VCA A;  3WNN A;  3I2G A;  1K3I A;  2ZEX A;  3SEE A;  1KEX A;  2VOT A;  2VCB A;  2Y64 A;  3U37 A;  3ZM8 A;  3THC A;  5LCW L;  1CZS A;  2E32 A;  4UI9 L;  3ECQ A;  4KWU A;  4QAW A;  3OEB A;  4OMC A;  1H6X A;  4MAD A;  3SEP A;  2Y6J A;  5JXH A;  3GM8 A;  4DUX A;  5IFT A;  2J1S A;  1JZ5 A;  4ZY9 A;  2XON A;  4XUQ A;  1J84 A;  3NJX A;  1JU3 A;  3C7G A;  4LPL A;  3WSO A;  4PF1 A;  2VMF A;  4CU6 A;  2JD9 A;  4W50 A;  1UZ0 A;  2VC9 A;  1OF3 A;  4DEV A;  1IQD C;  1DP0 A;  3I2F A;  4JX0 A;  2YB7 A;  2YG0 A;  4QDR A;  3VD4 A;  2W1U A;  3MO4 A;  1ULP A;  4A42 A;  1GU3 A;  3HN3 A;  2X05 A;  3FHQ A;  5DMY A;  1US3 A;  4DEQ A;  4JHZ A;  3LPF A;  3GXU A;  1PX3 A;  1K12 A;  3SKV A;  2VZO A;  4LQR A;  2XQX A;  4CU9 A;  3T2O A;  3LEI A;  1DLC A;  3CZU A;  2C4X A;  3OGS A;  4P00 B;  2W1W A;  1K45 A;  2R7E B;  2RVA A;  2C9K A;  3I2K A;  1UMI A;  2JDA A;  4MO3 M;  3ETP A;  3OEA A;  4DXS A;  3WEZ A;  1JYN A;  2J22 A;  3A22 A;  3HJR A;  5EIY B;  2KD7 A;  5FUI A;  1CIY A;  2JE8 A;  3ACG A;  3OG2 A;  5JUV A;  2YFZ A;  5DQ0 A;  1GOH A;  1W9S A;  4A44 A;  4GWJ A;  1UMH A;  4DXT A;  2ORZ A;  4GZ9 A;  1JZ2 A;  4P08 A;  2V5D A;  3CIH A;  2ZEZ A;  3CDZ B;  2QQK A;  2QQN A;  1WCQ A;  3HNM A;  3WNP A;  2X09 A;  3FN9 A;  3A7Q A;  3F2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...